BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c79044_g1_i1 len=3373 path=[1:0-3372]

Length=3373
                                                                      Score     E

ref|XP_009592878.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1339   0.0      
ref|XP_009774397.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1334   0.0      
ref|XP_006343838.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1308   0.0      
ref|XP_004245506.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1305   0.0      
emb|CDP12174.1|  unnamed protein product                               1279   0.0      
ref|XP_011082296.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1270   0.0      
gb|EYU23323.1|  hypothetical protein MIMGU_mgv1a000926mg               1228   0.0      
ref|XP_010053156.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1197   0.0      
ref|XP_011026865.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1188   0.0      
ref|XP_008239146.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1184   0.0      
ref|XP_002299463.1|  hypothetical protein POPTR_0001s10780g            1184   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007210393.1|  hypothetical protein PRUPE_ppa000962mg            1184   0.0      
ref|XP_007040559.1|  FtsH extracellular protease family isoform 1      1182   0.0      
ref|XP_006476360.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1182   0.0      
gb|KDO76574.1|  hypothetical protein CISIN_1g002307mg                  1180   0.0      
ref|XP_006439318.1|  hypothetical protein CICLE_v10018718mg            1179   0.0      
ref|XP_006439320.1|  hypothetical protein CICLE_v10018718mg            1179   0.0      
ref|XP_002266075.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1177   0.0      Vitis vinifera
ref|XP_004300881.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1177   0.0      
ref|XP_010267613.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1171   0.0      
ref|XP_010109785.1|  ATP-dependent zinc metalloprotease FtsH           1170   0.0      
ref|XP_010541753.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1168   0.0      
gb|KCW77406.1|  hypothetical protein EUGRSUZ_D01758                    1163   0.0      
ref|XP_006284963.1|  hypothetical protein CARUB_v10006266mg            1163   0.0      
ref|XP_006413491.1|  hypothetical protein EUTSA_v10024337mg            1162   0.0      
ref|NP_567691.1|  FtsH extracellular protease                          1160   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDP25274.1|  hypothetical protein JCGZ_20430                        1158   0.0      
gb|KHN16731.1|  ATP-dependent zinc metalloprotease FTSH 2, chloro...   1154   0.0      
ref|XP_010448634.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1153   0.0      
ref|XP_010448636.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1152   0.0      
ref|XP_009358628.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1151   0.0      
ref|XP_010676266.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1150   0.0      
ref|XP_003532440.2|  PREDICTED: ATP-dependent zinc metalloproteas...   1150   0.0      
ref|XP_008341756.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1148   0.0      
gb|EPS61004.1|  hypothetical protein M569_13795                        1147   0.0      
ref|XP_010433839.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1147   0.0      
ref|XP_008799614.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1147   0.0      
ref|XP_002509985.1|  Cell division protein ftsH, putative              1146   0.0      Ricinus communis
ref|XP_002869753.1|  hypothetical protein ARALYDRAFT_492469            1146   0.0      
ref|XP_010918347.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1145   0.0      
gb|KGN53417.1|  hypothetical protein Csa_4G052670                      1140   0.0      
ref|XP_004162678.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1140   0.0      
ref|XP_007160181.1|  hypothetical protein PHAVU_002G299700g            1139   0.0      
emb|CDY03504.1|  BnaC01g15780D                                         1135   0.0      
ref|XP_009137556.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1133   0.0      
gb|KFK28948.1|  hypothetical protein AALP_AA7G069500                   1130   0.0      
ref|XP_007040560.1|  FtsH extracellular protease family isoform 2      1130   0.0      
ref|XP_009394180.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1129   0.0      
ref|XP_010439111.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1128   0.0      
emb|CDY47609.1|  BnaA01g13560D                                         1127   0.0      
ref|XP_009394179.1|  PREDICTED: uncharacterized protein LOC103979...   1114   0.0      
ref|XP_004503606.1|  PREDICTED: ATP-dependent zinc metalloproteas...   1100   0.0      
gb|KEH21246.1|  FTSH extracellular protease family protein             1097   0.0      
ref|XP_006852630.1|  hypothetical protein AMTR_s00021p00235220         1083   0.0      
gb|KCW77408.1|  hypothetical protein EUGRSUZ_D01758                    1021   0.0      
gb|KCW77407.1|  hypothetical protein EUGRSUZ_D01758                    1020   0.0      
gb|KDO76575.1|  hypothetical protein CISIN_1g002307mg                  1011   0.0      
ref|XP_006439319.1|  hypothetical protein CICLE_v10018718mg            1009   0.0      
gb|KDO76576.1|  hypothetical protein CISIN_1g002307mg                   991   0.0      
ref|XP_007040562.1|  FtsH extracellular protease family isoform 4       935   0.0      
gb|KEH21247.1|  FTSH extracellular protease family protein              932   0.0      
ref|XP_007040561.1|  FtsH extracellular protease family isoform 3       889   0.0      
gb|KDO76577.1|  hypothetical protein CISIN_1g002307mg                   815   0.0      
ref|XP_001754170.1|  predicted protein                                  815   0.0      
ref|XP_001769066.1|  predicted protein                                  784   0.0      
ref|XP_002972975.1|  hypothetical protein SELMODRAFT_98591              731   0.0      
ref|XP_002993396.1|  hypothetical protein SELMODRAFT_137006             727   0.0      
gb|KHG13773.1|  ATP-dependent zinc metalloprotease FtsH                 534   8e-170   
gb|EYU23321.1|  hypothetical protein MIMGU_mgv11b023061mg               416   8e-133   
ref|XP_002509020.1|  predicted protein                                  365   3e-111   Micromonas commoda
ref|XP_003061743.1|  predicted protein                                  362   2e-108   
ref|XP_001420493.1|  predicted protein                                  352   1e-105   Ostreococcus lucimarinus CCE9901
gb|KFM28746.1|  ATP-dependent zinc metalloprotease FtsH                 354   4e-102   
ref|XP_005645365.1|  AAA-domain-containing protein                      355   5e-102   
ref|XP_004149014.1|  PREDICTED: uncharacterized protein LOC101214425    344   8e-102   
ref|WP_013910143.1|  ATP-dependent metalloprotease                      338   7e-99    
ref|WP_012595157.1|  MULTISPECIES: cell division protein FtsH           337   4e-98    
ref|WP_011242912.1|  cell division protein FtsH                         336   6e-98    
ref|YP_008965670.1|  probable chloroplast ATP-dependent protease        334   2e-97    
ref|XP_003082018.1|  COG0465: ATP-dependent Zn proteases (ISS)          341   2e-97    
ref|WP_023066705.1|  ATP-dependent zinc metalloprotease FtsH 2          334   2e-97    
ref|WP_038061211.1|  cell division protein FtsH                         333   3e-97    
ref|WP_009555904.1|  membrane protease FtsH catalytic subunit           334   4e-97    
ref|WP_015222134.1|  membrane protease FtsH catalytic subunit           334   4e-97    
ref|WP_039725895.1|  cell division protein FtsH                         333   4e-97    
emb|CEF99656.1|  P-loop containing nucleoside triphosphate hydrolase    341   5e-97    
ref|WP_009787909.1|  cell division protein FtsH                         333   5e-97    
ref|WP_009627771.1|  membrane protease FtsH catalytic subunit           333   6e-97    
ref|WP_022606194.1|  ATP-dependent metalloprotease FtsH                 333   7e-97    
ref|WP_007353244.1|  MULTISPECIES: cell division protein FtsH           333   8e-97    
ref|WP_038057282.1|  cell division protein FtsH                         332   1e-96    
ref|WP_038041290.1|  cell division protein FtsH                         331   1e-96    
ref|WP_022855152.1|  ATP-dependent metalloprotease                      331   2e-96    
ref|WP_015198769.1|  membrane protease FtsH catalytic subunit           331   7e-96    
ref|WP_012629618.1|  cell division protein FtsH                         330   8e-96    
ref|WP_016876491.1|  cell division protein FtsH                         330   1e-95    
ref|WP_027845285.1|  cell division protein FtsH                         330   1e-95    
ref|WP_023070843.1|  membrane protease catalytic subunit                330   1e-95    
ref|WP_019498223.1|  cell division protein FtsH                         330   1e-95    
ref|WP_023075021.1|  cell division protein                              330   1e-95    
ref|WP_012953740.1|  cell division protein FtsH                         328   2e-95    
ref|WP_006515547.1|  ATP-dependent metalloprotease FtsH                 330   2e-95    
ref|WP_019504593.1|  cell division protein FtsH                         329   2e-95    
ref|WP_006635543.1|  cell division protein FtsH                         330   2e-95    
ref|WP_029632082.1|  cell division protein FtsH [                       329   2e-95    
ref|WP_006517061.1|  membrane protease FtsH catalytic subunit           329   2e-95    
ref|WP_017654114.1|  cell division protein FtsH                         329   2e-95    
ref|WP_006511814.1|  ATP-dependent metalloprotease FtsH                 329   2e-95    
ref|WP_015176808.1|  membrane protease FtsH catalytic subunit           329   2e-95    
ref|WP_017322954.1|  cell division protein FtsH                         329   2e-95    
gb|KFF41954.1|  ATP-dependent metalloprotease FtsH                      329   3e-95    
gb|AFC39995.1|  cell division protein                                   328   3e-95    
ref|WP_017286410.1|  cell division protein FtsH                         328   3e-95    
ref|WP_015213897.1|  membrane protease FtsH catalytic subunit           328   3e-95    
ref|YP_009051040.1|  putative plastid division protein                  328   4e-95    
ref|WP_008226785.1|  Cell division protein FtsH                         327   4e-95    
ref|YP_001293616.1|  cell division protein                              328   5e-95    Rhodomonas salina
gb|AIA21561.1|  putative plastid division protein                       328   5e-95    
ref|WP_016950305.1|  cell division protein FtsH                         328   5e-95    
ref|WP_011613887.1|  cell division protein FtsH                         328   6e-95    
ref|WP_022534834.1|  ATPase AAA                                         328   6e-95    
ref|WP_002789390.1|  cell division protein FtsH                         328   7e-95    
ref|WP_015148162.1|  membrane protease FtsH catalytic subunit           327   7e-95    
ref|WP_026732891.1|  cell division protein FtsH                         327   7e-95    
ref|WP_015189824.1|  membrane protease FtsH catalytic subunit           327   7e-95    
ref|YP_537009.1|  cell division protein                                 327   8e-95    Pyropia yezoensis
gb|AHB35104.1|  putative plastid division protein                       327   8e-95    
ref|YP_007947857.1|  cell division protein                              327   8e-95    
ref|WP_017287528.1|  hypothetical protein                               327   9e-95    
ref|WP_015168714.1|  ATP-dependent metalloprotease FtsH                 327   9e-95    
ref|WP_015119379.1|  membrane protease FtsH catalytic subunit           327   1e-94    
ref|WP_015203025.1|  membrane protease FtsH catalytic subunit           327   1e-94    
ref|WP_026788731.1|  MULTISPECIES: cell division protein FtsH           327   1e-94    
ref|WP_013193262.1|  cell division protein FtsH                         327   1e-94    
emb|CAO89717.1|  unnamed protein product                                326   1e-94    Microcystis aeruginosa PCC 7806
ref|WP_011125073.1|  MULTISPECIES: cell division protein FtsH           327   1e-94    
ref|WP_026797044.1|  cell division protein FtsH                         327   1e-94    
gb|AHJ28404.1|  Cell division protein FtsH                              326   1e-94    
ref|WP_039738453.1|  cell division protein FtsH                         327   1e-94    
ref|YP_063571.1|  cell division protein                                 327   1e-94    Gracilaria tenuistipitata var. liui
ref|WP_015219750.1|  membrane protease FtsH catalytic subunit           327   1e-94    
ref|NP_053937.1|  cell division protein                                 327   1e-94    Porphyra purpurea
ref|WP_017651155.1|  cell division protein FtsH                         327   2e-94    
ref|WP_019491912.1|  cell division protein FtsH                         327   2e-94    
dbj|GAL92236.1|  cell division protein FtsH                             327   2e-94    
ref|NP_050804.1|  cell division protein                                 327   2e-94    Guillardia theta
ref|WP_029633486.1|  cell division protein FtsH [                       326   2e-94    
ref|WP_009459923.1|  MULTISPECIES: cell division protein FtsH           326   2e-94    
ref|WP_035150451.1|  cell division protein FtsH                         326   2e-94    
ref|WP_006620106.1|  FtsH peptidase                                     326   2e-94    
ref|WP_017744879.1|  cell division protein FtsH                         326   2e-94    
gb|EKD08345.1|  ATP-dependent metalloprotease FtsH                      326   2e-94    
gb|AIA21355.1|  putative plastid division protein                       326   2e-94    
ref|WP_015203255.1|  membrane protease FtsH catalytic subunit           327   2e-94    
ref|WP_008317744.1|  ATP-dependent metalloprotease FtsH                 326   2e-94    
ref|WP_015078430.1|  ATP-dependent metallopeptidase                     325   2e-94    
ref|WP_006278637.1|  cell division protein FtsH                         326   3e-94    
ref|WP_010997786.1|  cell division protein FtsH                         326   3e-94    
ref|WP_013323344.1|  cell division protein FtsH                         326   3e-94    
ref|WP_038077545.1|  cell division protein FtsH                         326   3e-94    
ref|WP_002739047.1|  ATP-dependent zinc metalloprotease FtsH 2          326   3e-94    
ref|WP_015170903.1|  membrane protease FtsH catalytic subunit           326   3e-94    
ref|WP_029551302.1|  cell division protein FtsH                         325   3e-94    
ref|WP_030006124.1|  cell division protein FtsH                         325   3e-94    
ref|WP_036533052.1|  cell division protein FtsH                         325   3e-94    
ref|WP_017719679.1|  cell division protein FtsH                         325   3e-94    
ref|WP_017312271.1|  cell division protein FtsH                         325   3e-94    
ref|WP_015132046.1|  membrane protease FtsH catalytic subunit           325   4e-94    
ref|WP_011933123.1|  cell division protein FtsH                         326   4e-94    
ref|WP_024544588.1|  cell division protein FtsH                         325   4e-94    
ref|YP_009019579.1|  ftsH protease-like protein                         325   4e-94    
ref|WP_002778402.1|  cell division protein FtsH                         325   4e-94    
ref|WP_012305983.1|  cell division protein FtsH                         325   4e-94    
ref|WP_016516233.1|  ATP-dependent zinc metalloprotease FtsH 2          325   4e-94    
ref|WP_016858941.1|  cell division protein FtsH                         325   4e-94    
ref|WP_009545756.1|  MULTISPECIES: cell division protein FtsH           325   4e-94    
ref|WP_026719681.1|  cell division protein FtsH                         325   4e-94    
ref|WP_011242858.1|  cell division protein FtsH                         325   4e-94    
ref|WP_006199059.1|  cell division protein FtsH                         325   4e-94    
ref|WP_036399244.1|  cell division protein FtsH                         325   4e-94    
ref|WP_015194229.1|  ATP-dependent metalloprotease FtsH                 325   5e-94    
ref|WP_015229408.1|  ATP-dependent metalloprotease FtsH                 325   5e-94    
ref|YP_009027610.1|  putative plastid division protein                  325   5e-94    
ref|WP_011377820.1|  cell division protein FtsH                         325   5e-94    
ref|WP_015160893.1|  ATP-dependent metalloprotease FtsH                 325   5e-94    
ref|WP_019474838.1|  cell division protein FtsH                         321   6e-94    
ref|WP_006668579.1|  MULTISPECIES: cell division protein FtsH           325   6e-94    
ref|WP_026082835.1|  cell division protein FtsH                         325   6e-94    
ref|WP_011319922.1|  cell division protein FtsH                         325   6e-94    
gb|EAZ93206.1|  cell division protein; FtsH                             325   6e-94    Cyanothece sp. CCY0110
emb|CDN10469.1|  Cell division protein FtsH                             324   6e-94    
ref|WP_035986767.1|  cell division protein FtsH                         325   7e-94    
ref|WP_015137807.1|  ATP-dependent metalloprotease FtsH                 325   7e-94    
ref|WP_015130520.1|  membrane protease FtsH catalytic subunit           325   7e-94    
ref|WP_015173264.1|  membrane protease FtsH catalytic subunit           325   7e-94    
gb|AHE96232.1|  ATP-dependent metalloprotease                           325   8e-94    
ref|WP_009343692.1|  cell division protein FtsH                         325   8e-94    
ref|WP_029956900.1|  cell division protein FtsH                         321   8e-94    
ref|WP_015193120.1|  ATP-dependent metalloprotease FtsH                 325   8e-94    
ref|WP_016869882.1|  cell division protein FtsH                         324   9e-94    
ref|WP_022847537.1|  ATP-dependent metalloprotease                      324   9e-94    
ref|WP_039716067.1|  cell division protein FtsH                         324   1e-93    
ref|WP_022485169.1|  aTP-dependent metallopeptidase HflB                325   1e-93    
ref|WP_035798335.1|  cell division protein FtsH                         325   1e-93    
ref|WP_015163831.1|  membrane protease FtsH catalytic subunit           324   1e-93    
ref|WP_017292732.1|  cell division protein FtsH                         324   1e-93    
ref|YP_008144816.1|  ATP-dependent zinc metalloprotease FtsH            324   1e-93    
ref|WP_028089678.1|  cell division protein FtsH                         324   1e-93    
ref|WP_006041393.1|  cell division protein FtsH                         324   1e-93    
ref|WP_017711703.1|  hypothetical protein                               326   1e-93    
ref|WP_037216619.1|  cell division protein FtsH                         324   1e-93    
gb|KEF42784.1|  cell division protein FtsH                              325   1e-93    
ref|WP_006276440.1|  cell division protein FtsH                         324   1e-93    
ref|WP_028083738.1|  cell division protein FtsH                         324   1e-93    
ref|WP_012597876.1|  cell division protein FtsH                         325   1e-93    
ref|WP_018399208.1|  cell division protein FtsH                         324   1e-93    
ref|WP_016951384.1|  cell division protein FtsH                         324   1e-93    
ref|WP_035830157.1|  cell division protein FtsH                         324   1e-93    
ref|WP_002756164.1|  cell division protein FtsH                         324   1e-93    
ref|WP_015112002.1|  membrane protease FtsH catalytic subunit           324   1e-93    
ref|WP_039738012.1|  cell division protein FtsH                         323   2e-93    
ref|YP_007627352.1|  cell division protein                              323   2e-93    
gb|ELS49502.1|  ATP-dependent zinc metalloprotease FtsH 2               322   2e-93    
ref|WP_013638629.1|  ATP-dependent metalloprotease                      323   2e-93    
ref|WP_025951898.1|  cell division protein FtsH                         322   2e-93    
ref|WP_036485806.1|  cell division protein FtsH                         323   2e-93    
ref|WP_036917622.1|  MULTISPECIES: cell division protein FtsH           323   3e-93    
ref|WP_008227570.1|  Cell division protein FtsH                         323   3e-93    
ref|WP_036799574.1|  cell division protein FtsH                         323   3e-93    
ref|XP_007509442.1|  ATP-dependent metalloprotease FtsH                 333   3e-93    
ref|WP_015207685.1|  membrane protease FtsH catalytic subunit           323   3e-93    
ref|WP_008195899.1|  cell division protein FtsH                         323   3e-93    
ref|WP_012408087.1|  cell division protein FtsH                         323   3e-93    
ref|WP_015216796.1|  membrane protease FtsH catalytic subunit           323   3e-93    
ref|WP_008235692.1|  Cell division protein FtsH                         323   3e-93    
ref|YP_008519880.1|  cell division protein                              325   3e-93    
ref|WP_015153530.1|  membrane protease FtsH catalytic subunit           323   3e-93    
ref|WP_011376306.1|  cell division protein FtsH                         323   3e-93    
ref|WP_002782455.1|  cell division protein FtsH                         323   4e-93    
ref|WP_023174351.1|  ATP-dependent metalloprotease FtsH                 323   4e-93    
ref|WP_017662490.1|  cell division protein FtsH                         323   4e-93    
ref|WP_011619340.1|  cell division protein FtsH                         323   4e-93    
ref|WP_002803112.1|  cell division protein FtsH                         323   4e-93    
ref|WP_006852631.1|  cell division protein FtsH                         323   4e-93    
ref|WP_012628968.1|  cell division protein FtsH                         323   4e-93    
gb|AIE73046.1|  Cell division protein FtsH                              322   4e-93    
ref|YP_002048840.1|  FtsH ATP-dependent protease-like protein           323   4e-93    Paulinella chromatophora
ref|WP_032516957.1|  cell division protein FtsH                         323   5e-93    
ref|WP_032524286.1|  cell division protein FtsH                         323   5e-93    
ref|WP_009787350.1|  cell division protein FtsH                         322   5e-93    
ref|WP_010873456.1|  cell division protein FtsH                         322   5e-93    
ref|WP_027401898.1|  cell division protein FtsH                         322   6e-93    
ref|WP_015108278.1|  ATP-dependent metalloprotease FtsH                 323   6e-93    
ref|WP_011293827.1|  cell division protein FtsH                         322   6e-93    
ref|WP_011057669.1|  cell division protein FtsH                         323   6e-93    
ref|WP_015178297.1|  ATP-dependent metalloprotease FtsH                 322   6e-93    
ref|WP_011993349.1|  cell division protein FtsH                         322   6e-93    
ref|WP_010317244.1|  cell division protein FtsH                         323   6e-93    
ref|WP_025964215.1|  cell division protein FtsH                         322   6e-93    
ref|WP_006911435.1|  cell division protein FtsH                         322   7e-93    
ref|WP_036907505.1|  cell division protein FtsH                         322   7e-93    
ref|WP_025926344.1|  cell division protein FtsH                         322   7e-93    
ref|WP_013538114.1|  ATP-dependent metalloprotease                      322   7e-93    
ref|WP_006530586.1|  ATP-dependent metalloprotease FtsH                 322   7e-93    
ref|YP_007317003.1|  ATP-dependent metalloprotease                      324   7e-93    
ref|WP_010308856.1|  cell division protein FtsH                         323   8e-93    
ref|WP_015145547.1|  ATP-dependent metalloprotease FtsH                 322   8e-93    
ref|WP_019476356.1|  cell division protein FtsH                         322   8e-93    
ref|WP_024970580.1|  cell division protein FtsH                         322   8e-93    
ref|WP_004158378.1|  cell division protein FtsH                         322   8e-93    
ref|WP_002787163.1|  cell division protein FtsH                         322   8e-93    
ref|YP_008519506.1|  cell division protein                              324   8e-93    
ref|WP_016515060.1|  ATP-dependent zinc metalloprotease FtsH 2          322   8e-93    
ref|YP_008520004.1|  cell division protein                              324   8e-93    
ref|WP_009343155.1|  cell division protein FtsH                         322   8e-93    
gb|AHX25269.1|  ATP-dependent Zn protease (chloroplast)                 324   9e-93    
ref|WP_025930185.1|  cell division protein FtsH                         322   9e-93    
ref|WP_002734973.1|  cell division protein FtsH                         322   9e-93    
gb|AGI98611.1|  cell division protein                                   323   9e-93    
ref|WP_002767533.1|  cell division protein FtsH                         322   9e-93    
ref|WP_025931751.1|  cell division protein FtsH                         322   1e-92    
ref|WP_002795930.1|  cell division protein FtsH                         322   1e-92    
ref|WP_025920789.1|  MULTISPECIES: cell division protein FtsH           322   1e-92    
ref|WP_006633417.1|  cell division protein FtsH                         322   1e-92    
ref|WP_025941718.1|  cell division protein FtsH                         322   1e-92    
ref|WP_025938221.1|  cell division protein FtsH                         322   1e-92    
ref|WP_025972025.1|  cell division protein FtsH                         322   1e-92    
ref|WP_025947311.1|  cell division protein FtsH                         322   1e-92    
ref|WP_025943367.1|  cell division protein FtsH                         322   1e-92    
ref|YP_008519757.1|  cell division protein                              323   1e-92    
ref|WP_025953730.1|  cell division protein FtsH                         322   1e-92    
ref|WP_036481899.1|  cell division protein FtsH                         321   1e-92    
ref|WP_011818250.1|  cell division protein FtsH                         322   1e-92    
ref|WP_017299397.1|  cell division protein FtsH                         321   1e-92    
ref|WP_032518740.1|  cell division protein FtsH                         322   1e-92    
ref|WP_002759067.1|  cell division protein FtsH                         321   1e-92    
ref|WP_032515248.1|  cell division protein FtsH                         322   1e-92    
ref|WP_007097881.1|  cell division protein FtsH                         322   1e-92    
ref|YP_008519631.1|  cell division protein                              323   1e-92    
ref|WP_025957687.1|  cell division protein FtsH                         321   1e-92    
gb|AIQ94851.1|  FtsH ATP-dependent protease precursor                   321   1e-92    
ref|WP_012408423.1|  cell division protein FtsH                         322   1e-92    
ref|WP_032526018.1|  cell division protein FtsH                         321   1e-92    
ref|WP_023067437.1|  ATP-dependent zinc metalloprotease FtsH 2          320   2e-92    
ref|WP_015112004.1|  membrane protease FtsH catalytic subunit           322   2e-92    
ref|WP_015078525.1|  ATP-dependent metalloprotease                      321   2e-92    
ref|WP_025894366.1|  MULTISPECIES: cell division protein FtsH           321   2e-92    
dbj|GAL91523.1|  cell division protein FtsH                             321   2e-92    
ref|WP_025974580.1|  cell division protein FtsH                         321   2e-92    
ref|WP_015224644.1|  membrane protease FtsH catalytic subunit           321   2e-92    
ref|WP_018312265.1|  ATPase AAA                                         321   2e-92    
ref|WP_038652493.1|  cell division protein FtsH                         321   2e-92    
ref|WP_011428929.1|  cell division protein FtsH                         320   2e-92    
ref|WP_011823653.1|  cell division protein FtsH                         321   2e-92    
ref|WP_011295949.1|  ATPase AAA                                         321   2e-92    
ref|WP_007102428.1|  cell division protein FtsH                         321   3e-92    
ref|WP_006527578.1|  ATP-dependent metalloprotease FtsH                 320   3e-92    
ref|WP_032513478.1|  cell division protein FtsH                         320   3e-92    
ref|YP_007878193.1|  cell division protein                              320   3e-92    
ref|WP_015185885.1|  ATP-dependent metalloprotease FtsH                 320   3e-92    
ref|WP_025925219.1|  MULTISPECIES: cell division protein FtsH           320   3e-92    
ref|WP_036920706.1|  cell division protein FtsH                         320   3e-92    
ref|WP_004104198.1|  cell division protein FtsH                         320   3e-92    
ref|WP_019480478.1|  cell division protein FtsH                         320   3e-92    
ref|WP_009625877.1|  membrane protease FtsH catalytic subunit           320   4e-92    
ref|WP_015124159.1|  membrane protease FtsH catalytic subunit           320   4e-92    
dbj|BAM50924.1|  cell division protein FtsH                             320   4e-92    
ref|WP_011935819.1|  cell division protein FtsH                         320   4e-92    
ref|WP_025969164.1|  cell division protein FtsH                         320   4e-92    
ref|WP_006171535.1|  cell division protein FtsH                         320   5e-92    
ref|WP_015136120.1|  membrane protease FtsH catalytic subunit           320   5e-92    
ref|WP_015157505.1|  ATP-dependent metalloprotease FtsH                 319   5e-92    
ref|WP_034785026.1|  hypothetical protein                               319   5e-92    
ref|WP_025980921.1|  cell division protein FtsH                         320   5e-92    
ref|WP_016868197.1|  cell division protein FtsH                         320   6e-92    
ref|WP_002801171.1|  cell division protein FtsH                         320   6e-92    
ref|WP_025958884.1|  cell division protein FtsH                         320   6e-92    
ref|WP_015140612.1|  ATP-dependent metalloprotease FtsH                 319   7e-92    
ref|WP_011056581.1|  cell division protein FtsH                         319   7e-92    
ref|WP_032522293.1|  cell division protein FtsH                         319   7e-92    
ref|WP_025957177.1|  MULTISPECIES: cell division protein FtsH           319   8e-92    
ref|WP_025942312.1|  cell division protein FtsH                         319   8e-92    
ref|WP_017320796.1|  cell division protein FtsH                         320   8e-92    
ref|WP_021946527.1|  aTP-dependent zinc metalloprotease FtsH 4          319   9e-92    
ref|WP_006456705.1|  cell division protein FtsH                         319   9e-92    
ref|WP_022441915.1|  aTP-dependent zinc metalloprotease FtsH 4          319   9e-92    
ref|WP_025970153.1|  cell division protein FtsH                         319   9e-92    
ref|WP_025944607.1|  MULTISPECIES: cell division protein FtsH           319   9e-92    
ref|WP_025890654.1|  cell division protein FtsH                         319   9e-92    
ref|WP_008647607.1|  MULTISPECIES: FtsH-2 peptidase                     320   1e-91    
ref|WP_025940255.1|  cell division protein FtsH                         319   1e-91    
ref|WP_025980390.1|  cell division protein FtsH                         319   1e-91    
ref|WP_025900453.1|  MULTISPECIES: cell division protein FtsH           319   1e-91    
ref|WP_002768356.1|  cell division protein FtsH                         319   1e-91    
ref|WP_002806795.1|  cell division protein FtsH                         319   1e-91    
ref|WP_012056441.1|  cell division protein FtsH                         318   1e-91    
ref|WP_015405249.1|  ATP-dependent metalloprotease FtsH                 318   1e-91    
ref|WP_025960416.1|  cell division protein FtsH                         319   1e-91    
ref|WP_039009201.1|  cell division protein FtsH                         319   1e-91    
ref|WP_013943080.1|  cell division protein FtsH                         327   1e-91    
ref|WP_025964749.1|  cell division protein FtsH                         319   1e-91    
ref|WP_008278253.1|  cell division protein FtsH                         318   1e-91    
ref|WP_010871834.1|  cell division protein FtsH                         320   1e-91    
ref|WP_025954563.1|  cell division protein FtsH                         319   1e-91    
ref|WP_025893147.1|  cell division protein FtsH                         319   1e-91    
ref|WP_013320534.1|  cell division protein FtsH                         318   1e-91    
ref|WP_015955308.1|  cell division protein FtsH                         318   1e-91    
ref|WP_025961053.1|  cell division protein FtsH                         318   1e-91    
ref|WP_025932453.1|  cell division protein FtsH                         318   1e-91    
ref|WP_039644431.1|  cell division protein FtsH                         318   1e-91    
dbj|BAP17852.1|  cell division protein                                  318   1e-91    
ref|WP_025937462.1|  cell division protein FtsH                         318   1e-91    
ref|WP_012195398.1|  cell division protein FtsH                         318   1e-91    
gb|AIE74451.1|  Cell division protein FtsH                              319   1e-91    
gb|EDP75070.1|  tryptophan synthase subunit beta                        318   2e-91    
ref|WP_032496651.1|  cell division protein FtsH                         318   2e-91    
ref|WP_038554713.1|  cell division protein FtsH                         318   2e-91    
ref|WP_027400938.1|  cell division protein FtsH                         318   2e-91    
ref|WP_013933196.1|  cell division protein FtsH                         318   2e-91    
pdb|2CE7|A  Chain A, Edta Treated                                       313   2e-91    
ref|WP_013191839.1|  cell division protein FtsH                         318   2e-91    
ref|WP_008311260.1|  ATP-dependent metalloprotease FtsH                 318   2e-91    
ref|WP_011431525.1|  cell division protein FtsH                         318   2e-91    
ref|WP_011142572.1|  cell division protein FtsH                         318   2e-91    
ref|WP_024124871.1|  ATP-dependent metalloprotease FtsH1                318   2e-91    
ref|WP_024970425.1|  cell division protein FtsH                         318   2e-91    
ref|WP_025955577.1|  cell division protein FtsH                         318   2e-91    
ref|WP_011862782.1|  cell division protein FtsH                         318   3e-91    
ref|WP_039726006.1|  cell division protein FtsH                         318   3e-91    
gb|AHF63606.1|  ATP-dependent metalloprotease FtsH                      318   3e-91    
ref|WP_012003567.1|  MULTISPECIES: cell division protein FtsH           317   3e-91    
ref|WP_032882680.1|  cell division protein FtsH                         314   3e-91    
ref|WP_025781809.1|  cell division protein FtsH                         317   3e-91    
ref|WP_022481504.1|  aTP-dependent zinc metalloprotease FtsH 4          317   4e-91    
ref|WP_021863831.1|  aTP-dependent zinc metalloprotease FtsH 4          317   4e-91    
ref|WP_020249018.1|  hypothetical protein                               318   4e-91    
ref|WP_011364407.1|  cell division protein FtsH                         317   4e-91    
ref|WP_017234470.1|  ATPase AAA                                         318   4e-91    
ref|WP_002782936.1|  ATP-dependent zinc metalloprotease FtsH 1          317   5e-91    
ref|WP_011143134.1|  cell division protein FtsH                         317   5e-91    
ref|WP_022853551.1|  ATP-dependent metalloprotease                      316   5e-91    
ref|WP_009544095.1|  MULTISPECIES: cell division protein FtsH           317   5e-91    
ref|WP_038060357.1|  cell division protein FtsH                         316   6e-91    
pdb|3KDS|E  Chain E, Apo-ftsh Crystal Structure                         311   6e-91    
ref|WP_012954085.1|  cell division protein FtsH                         317   7e-91    
ref|WP_035159486.1|  cell division protein FtsH                         317   7e-91    
ref|WP_015222183.1|  membrane protease FtsH catalytic subunit           316   7e-91    
ref|WP_011130055.1|  cell division protein FtsH                         317   7e-91    
ref|WP_028083820.1|  cell division protein FtsH                         317   8e-91    
ref|WP_011736119.1|  ATP-dependent metalloprotease                      316   8e-91    
ref|WP_002795052.1|  cell division protein FtsH                         316   9e-91    
ref|WP_037220735.1|  cell division protein FtsH                         316   1e-90    
ref|WP_015181955.1|  membrane protease FtsH catalytic subunit           317   1e-90    
ref|WP_011820153.1|  cell division protein FtsH                         316   1e-90    
ref|WP_025933379.1|  cell division protein FtsH                         306   1e-90    
ref|WP_004081278.1|  MULTISPECIES: cell division protein FtsH           315   1e-90    
ref|WP_012310494.1|  cell division protein FtsH                         315   1e-90    
ref|WP_034300657.1|  cell division protein FtsH                         316   1e-90    
ref|WP_006098770.1|  cell division protein FtsH                         316   1e-90    
ref|WP_009059951.1|  cell division protein FtsH                         317   1e-90    
ref|WP_012991883.1|  ATP-dependent metalloprotease                      315   1e-90    
ref|WP_012264845.1|  cell division protein FtsH                         316   1e-90    
ref|WP_035784306.1|  ATP-dependent metallopeptidase HflB                319   1e-90    
ref|WP_039721896.1|  cell division protein FtsH                         317   1e-90    
ref|WP_013906710.1|  ATP-dependent metalloprotease                      315   1e-90    
ref|WP_028088619.1|  cell division protein FtsH                         316   1e-90    
ref|WP_011432278.1|  cell division protein FtsH                         316   1e-90    
ref|WP_038071700.1|  cell division protein FtsH                         315   2e-90    
gb|AII45199.1|  cell division protein FtsH                              316   2e-90    
ref|WP_017303292.1|  cell division protein FtsH                         315   2e-90    
ref|WP_017714927.1|  hypothetical protein                               316   2e-90    
ref|WP_013007746.1|  ATP-dependent metalloprotease                      315   2e-90    
ref|WP_011128164.1|  cell division protein FtsH                         316   2e-90    
ref|WP_010475360.1|  cell division protein FtsH                         315   2e-90    
ref|WP_012874129.1|  cell division protein FtsH                         316   2e-90    
ref|WP_037999739.1|  cell division protein FtsH                         314   2e-90    
ref|WP_036903091.1|  cell division protein FtsH                         315   2e-90    
ref|WP_014686053.1|  cell division protein FtsH                         315   2e-90    
ref|WP_015219606.1|  membrane protease FtsH catalytic subunit           315   2e-90    
ref|WP_036915227.1|  MULTISPECIES: cell division protein FtsH           315   2e-90    
ref|WP_004159541.1|  cell division protein FtsH                         315   2e-90    
ref|WP_019902313.1|  hypothetical protein                               314   2e-90    
ref|WP_015188757.1|  membrane protease FtsH catalytic subunit           315   3e-90    
ref|WP_011826180.1|  cell division protein FtsH                         315   3e-90    
ref|WP_015051709.1|  cell division protein FtsH                         314   3e-90    
ref|WP_015143779.1|  ATP-dependent metalloprotease FtsH                 315   3e-90    
ref|WP_032110120.1|  cell division protein FtsH                         314   3e-90    
ref|WP_017877252.1|  hypothetical protein                               315   4e-90    
gb|AAK76625.2|  putative FtsH protease                                  310   4e-90    
ref|WP_006195742.1|  cell division protein FtsH                         314   4e-90    
ref|WP_022457522.1|  aTP-dependent zinc metalloprotease FtsH 2          314   4e-90    
ref|WP_022777963.1|  ATP-dependent metallopeptidase HflB                318   4e-90    
ref|WP_011132377.1|  cell division protein FtsH                         315   4e-90    
ref|WP_038033732.1|  MULTISPECIES: cell division protein FtsH           313   5e-90    
ref|WP_009789713.1|  cell division protein FtsH                         315   5e-90    
ref|WP_010942454.1|  ATP-dependent metalloprotease                      313   5e-90    
gb|EPJ31169.1|  ATP-dependent metallopeptidase HflB family protein      312   5e-90    
ref|WP_014551655.1|  ATP-dependent metalloprotease                      313   5e-90    
ref|XP_002507586.1|  aaa-metalloprotease chloroplast precursor          314   5e-90    
ref|WP_011359858.1|  cell division protein FtsH                         315   5e-90    
ref|WP_036667619.1|  cell division protein FtsH                         310   5e-90    
ref|WP_011431677.1|  cell division protein FtsH                         314   5e-90    
ref|WP_008203455.1|  cell division protein FtsH                         314   5e-90    
ref|XP_001774532.1|  predicted protein                                  314   6e-90    
ref|WP_036615618.1|  cell division protein FtsH                         314   6e-90    
ref|WP_012644970.1|  cell division protein FtsH                         313   7e-90    
ref|WP_035139819.1|  cell division protein FtsH                         313   7e-90    
ref|WP_033336702.1|  cell division protein FtsH                         313   7e-90    
dbj|BAH20304.1|  AT2G30950                                              312   7e-90    
ref|XP_001697103.1|  membrane AAA-metalloprotease                       315   7e-90    
ref|WP_007938241.1|  cell division protein FtsH                         310   7e-90    
ref|WP_011612712.1|  cell division protein FtsH                         315   7e-90    
ref|WP_038054563.1|  cell division protein FtsH                         313   8e-90    
ref|WP_015147290.1|  membrane protease FtsH catalytic subunit           315   8e-90    
ref|WP_002798552.1|  cell division protein FtsH                         313   8e-90    
ref|WP_038026758.1|  cell division protein FtsH                         315   8e-90    
ref|WP_014451006.1|  cell division protein FtsH                         313   8e-90    
ref|WP_011319224.1|  cell division protein FtsH                         313   8e-90    
ref|WP_038024259.1|  cell division protein FtsH                         315   9e-90    
ref|WP_013506914.1|  ATP-dependent metalloprotease                      314   9e-90    
ref|WP_025209651.1|  cell division protein FtsH                         312   9e-90    
ref|WP_034415436.1|  cell division protein FtsH                         311   9e-90    
ref|WP_018226816.1|  cell division protein FtsH                         315   9e-90    
ref|WP_004511954.1|  ATP-dependent metalloprotease                      313   9e-90    
ref|WP_036233223.1|  cell division protein FtsH                         313   1e-89    
ref|WP_010468934.1|  cell division protein FtsH                         313   1e-89    
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit           313   1e-89    
ref|WP_012464248.1|  cell division protein FtsH                         313   1e-89    
gb|EKQ70111.1|  ATP-dependent metalloprotease FtsH                      314   1e-89    
ref|WP_009632300.1|  ATP-dependent metalloprotease FtsH                 313   1e-89    
ref|WP_022023618.1|  aTP-dependent zinc metalloprotease FtsH            313   1e-89    
ref|WP_010998906.1|  cell division protein FtsH                         314   1e-89    
ref|WP_009632186.1|  ATP-dependent metalloprotease FtsH                 313   1e-89    
ref|WP_039722110.1|  cell division protein FtsH                         312   1e-89    
ref|WP_013703235.1|  cell division protein FtsH                         313   1e-89    
ref|WP_031502528.1|  cell division protein FtsH                         313   1e-89    
ref|WP_026087455.1|  cell division protein FtsH                         313   1e-89    
ref|WP_033191260.1|  cell division protein FtsH                         312   1e-89    
ref|WP_006508907.1|  ATP-dependent metalloprotease FtsH                 313   2e-89    
ref|WP_033366248.1|  cell division protein FtsH                         312   2e-89    



>ref|XP_009592878.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, chloroplastic 
[Nicotiana tomentosiformis]
Length=952

 Score =  1339 bits (3466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 745/947 (79%), Positives = 831/947 (88%), Gaps = 4/947 (0%)
 Frame = -2

Query  3228  SAGSPNTCNSSPIFIQRRPNillrssfilrfsLQKRHQNLKFPRNIARRSPPCYCPRTIF  3049
             S  + N C S+  F    PNI L+SSFI++F  QK  +N  F RN  RRS   +CP  I 
Sbjct  9     SFSTANNCISAS-FTHPNPNIQLQSSFIIKFPHQKSFKNSTFHRNFRRRSHFYHCPCAIL  67

Query  3048  GQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGAL  2869
             G  K+  ++   G N++DFVTRVLKENPSQVE +YK+G+KL TLKEKEDL KK  + G +
Sbjct  68    G--KWKSKNEGEGSNNEDFVTRVLKENPSQVEPKYKIGNKLYTLKEKEDLGKKGLNGGIM  125

Query  2868  EILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefekn  2689
             EIL+RLN K   +   ++G     E VYLK+ILR++KGKLYVPEQIF +NLSEEEEFE N
Sbjct  126   EILKRLNFKGLVKNGSDEGSLVNSENVYLKDILRKYKGKLYVPEQIFGANLSEEEEFENN  185

Query  2688  veELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWT  2509
             VE+LPKM+ EDFQKY+K DK+KLLTFKED  A+ GFGFRDFVVELK++PG KSLQRTKW 
Sbjct  186   VEDLPKMKLEDFQKYMKFDKIKLLTFKEDTGASLGFGFRDFVVELKDIPGEKSLQRTKWA  245

Query  2508  MRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmt  2329
             M+LD NQAQ LL EYTGPRYEVEKQMM+WVGKLPE P+P ASKIS+R++VELGMLTA+M 
Sbjct  246   MKLDQNQAQGLLEEYTGPRYEVEKQMMSWVGKLPEYPNPAASKISSRVVVELGMLTAVMI  305

Query  2328  aaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA  2149
             AAA I G++LASAVFAVTSF FAV VYV+WPVAKPF+K F GL+F +LERVWDK+ DAF 
Sbjct  306   AAAVIVGTFLASAVFAVTSFVFAVAVYVMWPVAKPFLKLFFGLIFGILERVWDKVVDAFT  365

Query  2148  -FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEF  1972
               G+F+K Y+VYTFGG+SASIE+LKPI+LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEF
Sbjct  366   DGGIFSKLYEVYTFGGVSASIEMLKPIMLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEF  425

Query  1971  SQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPP  1792
             SQSKPQARVDG TGVTF+DVAGIE+AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPP
Sbjct  426   SQSKPQARVDGSTGVTFSDVAGIEEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPP  485

Query  1791  GCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEID  1612
             GCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVN+PSVIFIDEID
Sbjct  486   GCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNRPSVIFIDEID  545

Query  1611  ALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPA  1432
             ALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNR DLLDPA
Sbjct  546   ALATRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDPA  605

Query  1431  LLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllq  1252
             LLRPGRFDRKIRIRPPNAKGRL ILKVHARKVKLS+TVDL SYAQNLPGWSGAKLAQLLQ
Sbjct  606   LLRPGRFDRKIRIRPPNAKGRLDILKVHARKVKLSDTVDLASYAQNLPGWSGAKLAQLLQ  665

Query  1251  eaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLR  1072
             EAALVAVR+GHNSIL SDMDDAVDRLTVGPKRVG++LGHQGQCRRA TEVGTALTSHLLR
Sbjct  666   EAALVAVRRGHNSILHSDMDDAVDRLTVGPKRVGVELGHQGQCRRAVTEVGTALTSHLLR  725

Query  1071  HYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVI  892
             HYENA VE CDRISINPRGQTLSQVVF+RLDDESYMFER PQLLHRLQV LGGRAAEEVI
Sbjct  726   HYENANVERCDRISINPRGQTLSQVVFNRLDDESYMFERLPQLLHRLQVFLGGRAAEEVI  785

Query  891   YGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLY  712
             YGRDTS+ASV+YLADA+WLARK+IT+WN+ENPM IHGEP PWRK  +FVGPRLDFEGSLY
Sbjct  786   YGRDTSRASVNYLADASWLARKIITIWNMENPMAIHGEPPPWRKKVRFVGPRLDFEGSLY  845

Query  711   DDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGE  532
             DDYDLIEPP NFDLDDDV+K+TE LIRD Y KT++LLR H AALLKTVKVLL  KEI+G+
Sbjct  846   DDYDLIEPPTNFDLDDDVAKKTEELIRDMYGKTVSLLRHHDAALLKTVKVLLNHKEINGD  905

Query  531   EIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLSS  391
             EID ILS+YP +TP SLLLEE DPGSLP  +++QE+ N +EYSLL+S
Sbjct  906   EIDLILSHYPQNTPTSLLLEERDPGSLPFLNEKQEQHNNVEYSLLNS  952



>ref|XP_009774397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, chloroplastic 
[Nicotiana sylvestris]
Length=948

 Score =  1334 bits (3452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/948 (79%), Positives = 831/948 (88%), Gaps = 3/948 (0%)
 Frame = -2

Query  3228  SAGSPNTCNSSPIFIQRRPNillrssfilrfsLQKRHQNLKFPRNIARRSPPCYCPRTIF  3049
             S  + N C S+  F    PNI L+SSFI++F  QK  +N  F RN  +RS   +CP  I 
Sbjct  2     SFSTANNCISAS-FTHPNPNIQLQSSFIIKFPHQKSFKNSTFHRNFKKRSHFYHCPCAIL  60

Query  3048  GQAKY-SEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGA  2872
             G+ K  S+ S   G N++DFVTRVLKENPSQVE +YK+G+KL TLKEKEDL KK  + G 
Sbjct  61    GKWKSNSKPSEEKGSNNEDFVTRVLKENPSQVEPKYKIGNKLYTLKEKEDLGKKGLNGGI  120

Query  2871  LEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefek  2692
             LE L+RLN K   +   ++G+    E VYLK+ILRE+KGKLYVPEQIF +NLSEEEEFEK
Sbjct  121   LETLKRLNFKGLVKNGSDEGNLVNSENVYLKDILREYKGKLYVPEQIFGANLSEEEEFEK  180

Query  2691  nveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKW  2512
             NVE+LPKM+ EDFQKY+K DK+KLLTFKED  A+ GFG RDFVVELK++PG KSLQRTKW
Sbjct  181   NVEDLPKMKLEDFQKYMKFDKIKLLTFKEDIGASLGFGVRDFVVELKDIPGEKSLQRTKW  240

Query  2511  TMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalm  2332
              M+LD NQAQ LL EYTGPRYEVEKQMM+WVGKLPE P+P ASKIS+R+MVELGMLTA+M
Sbjct  241   AMKLDQNQAQRLLEEYTGPRYEVEKQMMSWVGKLPEYPNPAASKISSRVMVELGMLTAVM  300

Query  2331  taaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAF  2152
              AAA I G++LASAVFAVTSF FAV VYV+WPVAKPF+K F GL+F +LERVWDK+ DAF
Sbjct  301   IAAAVIVGTFLASAVFAVTSFVFAVAVYVMWPVAKPFLKLFFGLIFGILERVWDKVVDAF  360

Query  2151  A-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIE  1975
                G+F+K Y+VYTFGG+SASIE+LKPI+LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIE
Sbjct  361   TDGGIFSKLYEVYTFGGVSASIEMLKPIMLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIE  420

Query  1974  FSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGP  1795
             FSQSKPQARVDG TGVTF+DVAGIE+AVEELQELV YLKNPELFDKMGIKPPHGVLLEGP
Sbjct  421   FSQSKPQARVDGSTGVTFSDVAGIEEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGP  480

Query  1794  PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEI  1615
             PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVN+PSVIFIDEI
Sbjct  481   PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNRPSVIFIDEI  540

Query  1614  DALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDP  1435
             DALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNR DLLDP
Sbjct  541   DALATRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDP  600

Query  1434  ALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqll  1255
             ALLRPGRFDRKIRIRPPNAKGRL ILKVHARKVKLS+TVDL +YAQNLPGWSGAKLAQLL
Sbjct  601   ALLRPGRFDRKIRIRPPNAKGRLDILKVHARKVKLSDTVDLATYAQNLPGWSGAKLAQLL  660

Query  1254  qeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLL  1075
             QEAALVAVR+GHNSIL SDMDDAVDRLTVGPKRVG++LGHQGQCRRA TEVG ALTSHLL
Sbjct  661   QEAALVAVRRGHNSILHSDMDDAVDRLTVGPKRVGVELGHQGQCRRAVTEVGAALTSHLL  720

Query  1074  RHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEV  895
             RHYENA VE CDRISINPRGQTLSQVVF+RLDDESYMFER PQLLHRLQV LGGRAAEEV
Sbjct  721   RHYENANVERCDRISINPRGQTLSQVVFNRLDDESYMFERLPQLLHRLQVFLGGRAAEEV  780

Query  894   IYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSL  715
             IYGRDTS+ASV+YLADA+WLARK+IT+WN+ENPM IHGEP PWRK  +FVGPRLDFEGSL
Sbjct  781   IYGRDTSRASVNYLADASWLARKIITIWNMENPMAIHGEPPPWRKKVRFVGPRLDFEGSL  840

Query  714   YDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISG  535
             YDDYDLIEPP NFDLDDD++K+TE LI D Y KT+ALLRQH AALLKTVKVLL  KEISG
Sbjct  841   YDDYDLIEPPTNFDLDDDIAKKTEELICDMYGKTVALLRQHDAALLKTVKVLLNHKEISG  900

Query  534   EEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLSS  391
             +EID ILS+YP +TP SLLLEE DPGSLP  +++QE+ N +EYSLL+S
Sbjct  901   DEIDLILSHYPQNTPTSLLLEERDPGSLPFLNEKQEQHNNVEYSLLNS  948



>ref|XP_006343838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
[Solanum tuberosum]
Length=956

 Score =  1308 bits (3384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 735/948 (78%), Positives = 829/948 (87%), Gaps = 3/948 (0%)
 Frame = -2

Query  3228  SAGSPNTCNSSPIFIQRRPNillrssfilrfsLQKRHQNLKFPRNIARRSPPCYCPRTIF  3049
             S  + N C S+   +  +PNI L+SSFI++F  QK + N  F RN  +RS   + P  I 
Sbjct  9     SFSTGNNCISARSILHPKPNIQLQSSFIIKFPFQKSYTNSIFHRNFRKRSHFYHSPYAIL  68

Query  3048  GQAKYSEQSNSSGG-NDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSF-DTG  2875
             G+ + + +S+  GG N++DFVTRVLKENPSQVE +Y +G+KL TLKEKEDL KK   + G
Sbjct  69    GKWRSNSKSSEDGGSNNEDFVTRVLKENPSQVEPKYLIGNKLYTLKEKEDLGKKGLLNGG  128

Query  2874  ALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefe  2695
              LEIL+RLN+K   +   ++G   K  +V+LK+ILRE+KGKLYVPEQIF ++LSEEEEFE
Sbjct  129   VLEILKRLNIKGMVKNGSDEGSLMKSGDVFLKDILREYKGKLYVPEQIFGASLSEEEEFE  188

Query  2694  knveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTK  2515
             KNVE+LPKM   DFQKY+K DK+KLLTFKED+ A+ G   RDF+VELKEMPG KSLQRTK
Sbjct  189   KNVEDLPKMSLVDFQKYMKFDKIKLLTFKEDSGASLGLRSRDFIVELKEMPGEKSLQRTK  248

Query  2514  WTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltal  2335
             W M+LD +QAQ+LL EYTGPRYEVEKQMM+WVGKLPE P+P ASKIS+R+MVELGMLTA+
Sbjct  249   WAMKLDQSQAQALLEEYTGPRYEVEKQMMSWVGKLPEYPNPAASKISSRVMVELGMLTAV  308

Query  2334  mtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDA  2155
             MTAAA I G++LASAVFAVTSF F VTVYV+WPVAKPF+K F GL+F +LERVWDK+ DA
Sbjct  309   MTAAAVIVGAFLASAVFAVTSFVFVVTVYVMWPVAKPFLKLFFGLIFGILERVWDKVADA  368

Query  2154  FA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGI  1978
             FA  G+F+K Y++YTFGG+SASIE+LKPI+LVF+TMVLLVRFTLSRRPKNFRKWDIWQGI
Sbjct  369   FADGGIFSKLYELYTFGGVSASIEMLKPIMLVFVTMVLLVRFTLSRRPKNFRKWDIWQGI  428

Query  1977  EFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEG  1798
             EFSQSKPQARVDG TGVTFNDVAGIE+AVEELQELV YLKNPELFDKMGIKPPHGVLLEG
Sbjct  429   EFSQSKPQARVDGSTGVTFNDVAGIEEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEG  488

Query  1797  PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDE  1618
             PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDE
Sbjct  489   PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDE  548

Query  1617  IDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLD  1438
             IDALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNR DLLD
Sbjct  549   IDALATRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLD  608

Query  1437  PALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaql  1258
             PALLRPGRFDRKIRIRPPNAKGRL ILKVHARKVKLSETVDL+SYAQNLPGWSGAKLAQL
Sbjct  609   PALLRPGRFDRKIRIRPPNAKGRLEILKVHARKVKLSETVDLSSYAQNLPGWSGAKLAQL  668

Query  1257  lqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHL  1078
             LQEAALVAVR+GHNSIL SDMDDAVDRLTVGP+RVGI+LGHQGQCRRA TEVGTALTSHL
Sbjct  669   LQEAALVAVRRGHNSILHSDMDDAVDRLTVGPRRVGIELGHQGQCRRAITEVGTALTSHL  728

Query  1077  LRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEE  898
             LR YENA+VE CDRISINPRGQTLSQVVFHRLDDESYMFER P+LLHRLQV LGGRAAEE
Sbjct  729   LRQYENAEVERCDRISINPRGQTLSQVVFHRLDDESYMFERLPRLLHRLQVFLGGRAAEE  788

Query  897   VIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGS  718
             VIYGRDTS+ASV+YLADA+WLARK+IT+WN++N M IHGEP PW K  KFVGPRLDF GS
Sbjct  789   VIYGRDTSRASVNYLADASWLARKIITIWNMKNSMAIHGEPPPWVKRVKFVGPRLDFGGS  848

Query  717   LYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEIS  538
             LYDDYDLIEPP+NF+LDDDV+K+TE LI D Y KT++LLRQH  ALLKTVKVLL + EIS
Sbjct  849   LYDDYDLIEPPINFNLDDDVAKKTEELICDMYGKTVSLLRQHDTALLKTVKVLLNRTEIS  908

Query  537   GEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLS  394
             G+EID ILS+YPP+TP SLLLEE DP SLP   +++ + N IEYSL S
Sbjct  909   GDEIDLILSHYPPNTPTSLLLEETDPASLPFVDEKEGQHNNIEYSLSS  956



>ref|XP_004245506.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Solanum lycopersicum]
Length=956

 Score =  1305 bits (3378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 734/948 (77%), Positives = 826/948 (87%), Gaps = 3/948 (0%)
 Frame = -2

Query  3228  SAGSPNTCNSSPIFIQRRPNillrssfilrfsLQKRHQNLKFPRNIARRSPPCYCPRTIF  3049
             S  + N   S+   +  +PNI L+SSF+++   QK + N  F RN  +RS   + P  I 
Sbjct  9     SFSTGNNFISARSILHPKPNIQLQSSFVIKSPFQKSYTNPIFHRNFRKRSHFYHSPYAIL  68

Query  3048  GQAKYSEQSNSSGG-NDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSF-DTG  2875
             G+ + + +S+  G  N++DFVTRVLKENPSQVE +Y +G+KL TLKEKEDL KK   + G
Sbjct  69    GKWRSNSKSSEEGASNNEDFVTRVLKENPSQVEPKYLIGNKLYTLKEKEDLGKKGLLNGG  128

Query  2874  ALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefe  2695
              LEIL+RLN+K   +   ++G   K  +V+LK+ILRE+KGKLYVPEQIF +NLSEEEEFE
Sbjct  129   VLEILKRLNIKGMVKNGSDEGSLMKSGDVFLKDILREYKGKLYVPEQIFGANLSEEEEFE  188

Query  2694  knveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTK  2515
             KNVE+LPKM  +DFQKY+K DK+KLLTFKED  A+ G G RDF+VELKEMPG KSLQRTK
Sbjct  189   KNVEDLPKMSLKDFQKYMKFDKIKLLTFKEDTGASLGLGSRDFIVELKEMPGEKSLQRTK  248

Query  2514  WTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltal  2335
             W M+LD NQAQ+LL EYTGPRYEVEKQMM+WVGKLPE P+P ASKIS+R+MVELGMLTA 
Sbjct  249   WAMKLDQNQAQALLEEYTGPRYEVEKQMMSWVGKLPEYPNPAASKISSRVMVELGMLTAA  308

Query  2334  mtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDA  2155
             MTAAA I G++LASAVFAVTSF F VTVYV+WPVAKPF+K F GL+F +LERVWDK+ DA
Sbjct  309   MTAAAVIVGAFLASAVFAVTSFVFVVTVYVMWPVAKPFLKLFFGLIFGILERVWDKVGDA  368

Query  2154  FA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGI  1978
             F   G+F+K Y++YTFGG+SASIE+LKPI+LVF+TMVLLVRFTLSRRPKNFRKWDIWQGI
Sbjct  369   FTDGGIFSKLYELYTFGGVSASIEMLKPIMLVFVTMVLLVRFTLSRRPKNFRKWDIWQGI  428

Query  1977  EFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEG  1798
             EFSQSKPQARVDG TGVTFNDVAGIE+AVEELQELV YLKNPELFDK+GIKPPHGVLLEG
Sbjct  429   EFSQSKPQARVDGSTGVTFNDVAGIEEAVEELQELVRYLKNPELFDKLGIKPPHGVLLEG  488

Query  1797  PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDE  1618
             PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDE
Sbjct  489   PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDE  548

Query  1617  IDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLD  1438
             IDALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNR DLLD
Sbjct  549   IDALATRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLD  608

Query  1437  PALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaql  1258
             PALLRPGRFDRKIRIRPPNAKGRL ILKVHARKVKLS+TVDL+SYAQNLPGWSGAKLAQL
Sbjct  609   PALLRPGRFDRKIRIRPPNAKGRLEILKVHARKVKLSDTVDLSSYAQNLPGWSGAKLAQL  668

Query  1257  lqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHL  1078
             LQEAALVAVR+GHNSIL SDMDDAVDRLTVGP+RVGI+LGHQGQCRRA TEVGTALTSHL
Sbjct  669   LQEAALVAVRRGHNSILHSDMDDAVDRLTVGPRRVGIELGHQGQCRRAITEVGTALTSHL  728

Query  1077  LRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEE  898
             LR YENA+VE CDRISINPRGQTLSQVVFHRLDDESYMFER P+LLHRLQV LGGRAAEE
Sbjct  729   LRQYENAEVERCDRISINPRGQTLSQVVFHRLDDESYMFERLPRLLHRLQVFLGGRAAEE  788

Query  897   VIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGS  718
             VIYGRDTS+ASV+YLADA+WLARK+IT+WN++NPM IHGEP PW K  KFVGPRLDF GS
Sbjct  789   VIYGRDTSRASVNYLADASWLARKIITIWNMKNPMAIHGEPPPWVKRVKFVGPRLDFGGS  848

Query  717   LYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEIS  538
             LYDDYDLIEPP+NF+LDDDV+K+TE LI D Y KT+ LLRQH  ALLKTVKVLL + EIS
Sbjct  849   LYDDYDLIEPPINFNLDDDVAKKTEELICDMYGKTVTLLRQHDTALLKTVKVLLNRTEIS  908

Query  537   GEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLS  394
             G+EID ILS+YPP+TP SLLLEE DP SLP   ++QE+ N IEYSL S
Sbjct  909   GDEIDLILSHYPPNTPTSLLLEERDPASLPFVDEKQEQHNNIEYSLSS  956



>emb|CDP12174.1| unnamed protein product [Coffea canephora]
Length=958

 Score =  1279 bits (3310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 723/958 (75%), Positives = 830/958 (87%), Gaps = 8/958 (1%)
 Frame = -2

Query  3240  MFCSSAG-SPNTCNSSPIFIQRRPNillrssfilrf-sLQKRHQNLKFPRNIARRSPPCY  3067
             M+ S+ G  P   N SP   Q +P+I+ R   +     LQKR + L  P   A+R    +
Sbjct  1     MYFSAVGLGPFQNNPSPTLFQPQPSIIRRDFSLHVKFQLQKRQKYLNCPVTSAKRVHFYH  60

Query  3066  CPRTIFGQAKYSEQS--NSSGGND--DDFVTRVLKENPSQVETRYKVGdklltlkekedl  2899
              P T+FG+ K + ++  N  G ND  DDFVTR+LKENPSQVE RY +G+KL TLKEKE+L
Sbjct  61    SPYTLFGKIKANSKASENLDGSNDEKDDFVTRILKENPSQVEPRYLIGNKLYTLKEKENL  120

Query  2898  qkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEE-VYLKEILREHKGKLYVPEQIFRS  2722
               K+ D G + +L+ LNLK+   K++ +G   K EE VYLK+ILRE+KGKL+VPEQIF +
Sbjct  121   SNKNLDYGVVGLLKTLNLKSLLSKTRYEGQLTKSEEEVYLKDILREYKGKLFVPEQIFGA  180

Query  2721  NLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMP  2542
             N S+EEEFEKNVE LPKM  EDF+KY+K+DK+KLLTFKE+ A+ YG GFRDFVVELKE+P
Sbjct  181   NFSDEEEFEKNVEVLPKMSIEDFRKYMKSDKIKLLTFKENPASPYGVGFRDFVVELKEIP  240

Query  2541  GHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLM  2362
             G +SLQRTKW MRLD +QAQ +L +YTGPR E+EKQMM++VGKLPE PHP+ASKIS+R+M
Sbjct  241   GERSLQRTKWAMRLDESQAQVMLEQYTGPRNEIEKQMMSFVGKLPEYPHPIASKISSRVM  300

Query  2361  VELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLE  2182
             VELG+LTA+MTAAA + G +LASAVFAVTSF FAV VYVVWPV KPF+KFF G++F VLE
Sbjct  301   VELGVLTAVMTAAAIVVGGFLASAVFAVTSFIFAVAVYVVWPVVKPFLKFFFGIIFGVLE  360

Query  2181  RVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNF  2005
             RVW+K  D F   G F+K Y+VYTFGG+SASIE+LKPILLVF TMV+L+RFTLSRRPKNF
Sbjct  361   RVWEKFLDFFTDGGFFSKLYEVYTFGGVSASIEMLKPILLVFGTMVILLRFTLSRRPKNF  420

Query  2004  RKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIK  1825
             RKWDIWQGIEFSQSKPQARVDG TGV F+DVAGI++AV+ELQELV YLKNPELFDKMGIK
Sbjct  421   RKWDIWQGIEFSQSKPQARVDGSTGVLFSDVAGIDEAVDELQELVRYLKNPELFDKMGIK  480

Query  1824  PPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVN  1645
             PPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVN
Sbjct  481   PPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVN  540

Query  1644  KPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLG  1465
             KPSVIFIDEIDALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLG
Sbjct  541   KPSVIFIDEIDALATRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLG  600

Query  1464  ATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPG  1285
             ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILKVHAR+VK+SETVDL SYA+NLPG
Sbjct  601   ATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKVHARRVKISETVDLASYAKNLPG  660

Query  1284  WSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTE  1105
             W+GAKLAQLLQEAALVAVRKGH+SI++SD+DDAVDRLTVGP+RVG +LGHQGQC RATTE
Sbjct  661   WTGAKLAQLLQEAALVAVRKGHSSIIQSDLDDAVDRLTVGPRRVGFELGHQGQCCRATTE  720

Query  1104  VGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQV  925
             VGTALTSHLLR  ENA+VE CDR+SI PRGQTLSQVVFHRLDDESYMFERRPQL+HRLQV
Sbjct  721   VGTALTSHLLRRLENAQVERCDRVSIIPRGQTLSQVVFHRLDDESYMFERRPQLVHRLQV  780

Query  924   LLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFV  745
             LLGGRAAEE+I+GRDTS+ASV+YLADATWLARK+IT+WNLE PM IHGEP PWRKS KFV
Sbjct  781   LLGGRAAEELIFGRDTSRASVNYLADATWLARKIITIWNLETPMVIHGEPPPWRKSSKFV  840

Query  744   GPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvk  565
             GPRLDFEGSLYDDY LIE P+NF+LDD++++RTE L+R+ YA TLALL++H AAL KTVK
Sbjct  841   GPRLDFEGSLYDDYGLIERPVNFNLDDEIARRTEELMREMYAMTLALLKRHQAALFKTVK  900

Query  564   vllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLSS  391
             VLL QKEISGEEIDFIL +YPPHTP +L+LEEGDPGSLP F Q+Q++  E+EYSLLSS
Sbjct  901   VLLNQKEISGEEIDFILDSYPPHTPINLILEEGDPGSLPFFSQKQKQDTELEYSLLSS  958



>ref|XP_011082296.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Sesamum indicum]
Length=942

 Score =  1270 bits (3287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/917 (77%), Positives = 796/917 (87%), Gaps = 8/917 (1%)
 Frame = -2

Query  3117  QNLKFPRNIARRSPPCYCPRTIFGQAKYSEQ-SNSSGGNDDDFVTRVLKENPSQVETRYK  2941
             +N  FP    +R      PR +  +A  + + S SSGG D+DFV+RVL+ENPSQVE +Y 
Sbjct  26    KNYNFPVEPTKRLQFNSYPRVLLVKASSNAKPSVSSGGGDEDFVSRVLRENPSQVEPKYL  85

Query  2940  VGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQG----KPE-EVYLKE  2776
             +GDKL TLKEKE L KK F     EIL+RLNLKA   KS E+        KPE EVYLK+
Sbjct  86    IGDKLYTLKEKEGLSKKGFRERVSEILKRLNLKALVSKSDEETGNASNFVKPEGEVYLKD  145

Query  2775  ILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNA  2596
             +LRE++GKLYVPEQ+F +NLSEEEEF+KNV+ELP+M +EDFQKY+  DK+KLLTFKE++ 
Sbjct  146   LLREYRGKLYVPEQVFGANLSEEEEFDKNVKELPRMSYEDFQKYMTCDKIKLLTFKEESG  205

Query  2595  ANYG-FGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWV  2419
              +Y  +GFRDFVV+LKE+PG K L +TKW MRLD+ Q + LL  YTGPR E+EKQMM+WV
Sbjct  206   ISYSNYGFRDFVVDLKEIPGDKRLHQTKWAMRLDVEQVKDLLEAYTGPRNEIEKQMMSWV  265

Query  2418  GKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVW  2239
             GKLPE PHPVASKIS+R++ ELG+LTA M AAA   G +LASAVFAVTSF FAV  YV+W
Sbjct  266   GKLPEYPHPVASKISSRMIAELGVLTASMAAAAVFVGGFLASAVFAVTSFVFAVAAYVIW  325

Query  2238  PVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLV  2062
             PV KPF+K   GL+F VLER+W+ + D     G+ +K Y+VY FGG+SASIE+LKPILLV
Sbjct  326   PVVKPFLKIILGLIFSVLERIWENLADFLGDEGLRSKLYEVYAFGGVSASIEMLKPILLV  385

Query  2061  FLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEEL  1882
             FLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDG TGV F+DVAGIE+AVEEL
Sbjct  386   FLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGSTGVMFSDVAGIEEAVEEL  445

Query  1881  QELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEV  1702
             QELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEV
Sbjct  446   QELVKYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEV  505

Query  1701  LVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLN  1522
             LVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQG+F +S+DD YNAATQERETTLN
Sbjct  506   LVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGMFRESTDDHYNAATQERETTLN  565

Query  1521  QLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHAR  1342
             QLL ELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRL ILKVHAR
Sbjct  566   QLLIELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKVHAR  625

Query  1341  KVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGP  1162
             KVKLS+TVDL+SYA NLPGW+GAKLAQLLQEAALVAVRKGH +IL+SDMDDAVDRLTVGP
Sbjct  626   KVKLSDTVDLSSYANNLPGWTGAKLAQLLQEAALVAVRKGHAAILQSDMDDAVDRLTVGP  685

Query  1161  KRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRL  982
             KRVGIDLGHQGQ RRATTEVGTALTSHLLR  ENAKVE CDR+SI+PRGQTLSQVVFHRL
Sbjct  686   KRVGIDLGHQGQSRRATTEVGTALTSHLLRRIENAKVERCDRVSIHPRGQTLSQVVFHRL  745

Query  981   DDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLE  802
             DDESYMFERRPQLLHRLQVLLGGRAAEEVI+GRDTSKASVSYLADA+WLARK+ITVWN+E
Sbjct  746   DDESYMFERRPQLLHRLQVLLGGRAAEEVIFGRDTSKASVSYLADASWLARKIITVWNME  805

Query  801   NPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTY  622
             +PM +HGEP PWRK  KFVGPR+DFEGSLYDDYDLI+PP+NF LDDDV++RTE L+RD Y
Sbjct  806   DPMVVHGEPPPWRKRIKFVGPRIDFEGSLYDDYDLIDPPINFKLDDDVARRTEDLMRDMY  865

Query  621   AKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLF  442
              KT+ALLRQH+AALLKTVKVLL +KEI+G EIDFIL NYPP TP SL+LEE +PGSLP F
Sbjct  866   GKTVALLRQHNAALLKTVKVLLDRKEINGYEIDFILDNYPPETPTSLVLEERNPGSLPFF  925

Query  441   HQEQEEANEIEYSLLSS  391
               EQ ++ E+EY+LL+S
Sbjct  926   EDEQSQSKELEYTLLTS  942



>gb|EYU23323.1| hypothetical protein MIMGU_mgv1a000926mg [Erythranthe guttata]
Length=941

 Score =  1228 bits (3176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 681/923 (74%), Positives = 789/923 (85%), Gaps = 10/923 (1%)
 Frame = -2

Query  3129  QKRHQNLKFPRNIARRSPPCYCPRTIF--GQAKYSEQSNSSGGNDDDFVTRVLKENPSQV  2956
             Q+  +N  F     ++S P   PR +     A   + S +SG  D+DFVT+VL+ENPSQ+
Sbjct  19    QRTQKNWHFSLKPTKKSQPRSRPRVLLLPRAASNPKPSVNSGAGDEDFVTKVLRENPSQI  78

Query  2955  ETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAF-----SRKSQEDGDQGKPE-  2794
             E +Y VG+KL TLKEKE+L KK  +     IL+RLNLK        ++S +DG+  K E 
Sbjct  79    EPKYLVGNKLYTLKEKENLGKKGLNERVAGILKRLNLKEVVSKGGGKESGDDGNFAKSEG  138

Query  2793  EVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLT  2614
             EVYL ++LRE+KGKLYVPEQ+F +NLSEEEEF KN  ELP+M ++DF+KY+K+D VKL+T
Sbjct  139   EVYLNDLLREYKGKLYVPEQVFGANLSEEEEFRKNANELPRMNYDDFRKYVKSDTVKLVT  198

Query  2613  FKEDNAANYG-FGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEK  2437
             FKED   +YG +G+RDF+V+LK++PG KSL RTKW MRLD  Q Q L   Y GPR E+EK
Sbjct  199   FKEDGGVSYGNYGYRDFLVDLKDIPGDKSLHRTKWAMRLDEEQVQDLWEVYKGPRNEIEK  258

Query  2436  QMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafav  2257
             QMM++VGK+PE PHP+ASKIS+R+MVELG+LTA M AAA + G +LASAVFA TSF FAV
Sbjct  259   QMMSFVGKVPEYPHPIASKISSRMMVELGVLTAAMAAAAVVVGGFLASAVFAATSFVFAV  318

Query  2256  tvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVL  2080
             T YVVWPVAKPF+K F GL F +LE+VWD + +     G+ +K Y++YT+GG+SASIE+L
Sbjct  319   TAYVVWPVAKPFLKLFLGLTFGILEKVWDNLGELLGDGGIPSKLYELYTYGGVSASIEML  378

Query  2079  KPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIE  1900
             KPI+LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDG TGV FNDVAGIE
Sbjct  379   KPIMLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGSTGVMFNDVAGIE  438

Query  1899  QAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAG  1720
              AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAG
Sbjct  439   GAVEELQELVKYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAG  498

Query  1719  SEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQE  1540
             SEFVEVLVGVG+AR+RDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQE
Sbjct  499   SEFVEVLVGVGSARVRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDLLYNAATQE  558

Query  1539  RETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGI  1360
             RETTLNQLL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIRI+PPNAKGRL I
Sbjct  559   RETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRIQPPNAKGRLDI  618

Query  1359  LKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVD  1180
             LKVHARKVKLS+TVDL+SYA NLPGW+GAKLAQLLQEAALVAVRKGH++IL SD+DDAVD
Sbjct  619   LKVHARKVKLSDTVDLSSYANNLPGWTGAKLAQLLQEAALVAVRKGHSAILHSDLDDAVD  678

Query  1179  RLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQ  1000
             RLTVGPKRVG+DLGHQGQ RRAT EVGTALTSHLLR  ENA VE CDR+SI+PRGQTLSQ
Sbjct  679   RLTVGPKRVGVDLGHQGQLRRATVEVGTALTSHLLRRIENANVELCDRVSIHPRGQTLSQ  738

Query  999   VVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMI  820
             VVFHR DDESY+FERRPQLLHRLQVLLGGRAAEEVI+GRDTS+ASV YLADA+WLARK+I
Sbjct  739   VVFHRFDDESYVFERRPQLLHRLQVLLGGRAAEEVIFGRDTSRASVDYLADASWLARKII  798

Query  819   TVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEA  640
             ++WN+ENPM +HGEP PWRK PKFVGP++DFEGSLYDDYDLIEPP+NF LDDD++KRTE 
Sbjct  799   SIWNMENPMVVHGEPPPWRKRPKFVGPKIDFEGSLYDDYDLIEPPVNFKLDDDIAKRTEK  858

Query  639   LIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDP  460
             L+ + Y KT++LLRQH+AALLKTVKVL+ QKEI+G+EIDFI+ NYPP TP SL+LEE +P
Sbjct  859   LMHEMYEKTVSLLRQHNAALLKTVKVLIDQKEINGDEIDFIIDNYPPQTPTSLVLEERNP  918

Query  459   GSLPLFHQEQEEANEIEYSLLSS  391
             G+LP F Q + ++NE+EY+L  S
Sbjct  919   GTLPFFEQNEVQSNELEYTLSGS  941



>ref|XP_010053156.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Eucalyptus 
grandis]
 gb|KCW77405.1| hypothetical protein EUGRSUZ_D01758 [Eucalyptus grandis]
Length=949

 Score =  1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/891 (74%), Positives = 760/891 (85%), Gaps = 11/891 (1%)
 Frame = -2

Query  3024  SNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRR-LN  2848
             S S+    DDFV RVL+ENPSQVE RY +GDK  TLKE+E+L K + D GA EILRR L+
Sbjct  63    SGSTPPKGDDFVARVLQENPSQVEPRYLIGDKFYTLKERENLSKNT-DVGAFEILRRTLD  121

Query  2847  LKAFSRKSQEDGDQ-----GKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknve  2683
              +  S++  ++G        K E VYLK++LRE+KGKLYVPEQ+F  +LSEEEEF++N+E
Sbjct  122   KRGKSKRGSDEGQDKAKAAAKEESVYLKDLLREYKGKLYVPEQVFGEDLSEEEEFDRNLE  181

Query  2682  ELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMR  2503
              LPKM  EDF+K +++DKVKLLT KE  + +   GFRDF++ELKE+PG +SL RT+W M+
Sbjct  182   ALPKMSLEDFRKAMESDKVKLLTSKEVPSISTANGFRDFIIELKEIPGDRSLHRTRWAMK  241

Query  2502  LDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaa  2323
             L+  +AQ+LL EY GP YE+E+Q M+WVGKLPE PHPVAS IS+R+MVE GM+TA+M AA
Sbjct  242   LNQGEAQALLEEYNGPTYEIERQTMSWVGKLPEYPHPVASSISSRMMVEFGMITAIMAAA  301

Query  2322  aaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-F  2146
             A + G +LASAVFAVTSF F  TVY+VWP+A+PF K F GL+  + ERVWD + D F+  
Sbjct  302   AVVVGGFLASAVFAVTSFIFVTTVYIVWPIARPFFKLFLGLILSIFERVWDNVVDLFSDG  361

Query  2145  GVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQ  1966
             G+F+KFY+ YTFGG+SAS+E+LKPI  V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+
Sbjct  362   GIFSKFYEFYTFGGVSASLEMLKPISFVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSR  421

Query  1965  SKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGC  1786
             SK +ARVDG TGV F DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGC
Sbjct  422   SKAEARVDGSTGVKFGDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGC  481

Query  1785  GKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDAL  1606
             GKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDAL
Sbjct  482   GKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDAL  541

Query  1605  ATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALL  1426
             AT+RQGIF +S+D  YNA TQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALL
Sbjct  542   ATRRQGIFKESTDHLYNAGTQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALL  601

Query  1425  RPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqea  1246
             RPGRFDRKI+IRPPNAKGR  ILK+HA KVK+SETVDL+SYAQNLPGWSGA+LAQL+QEA
Sbjct  602   RPGRFDRKIKIRPPNAKGRRDILKIHASKVKMSETVDLSSYAQNLPGWSGARLAQLVQEA  661

Query  1245  alvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHY  1066
             ALVAVRKGH SILRSDMDDA DRLTVGP+RVGI+LGHQGQCRRATTEVG A+TSHLL+ Y
Sbjct  662   ALVAVRKGHGSILRSDMDDAADRLTVGPRRVGIELGHQGQCRRATTEVGVAMTSHLLKRY  721

Query  1065  ENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG  886
             ENA VE CDRISI PRG+TLSQV+FHRLDDE YMFERRPQLLHRLQVLLGGRAAEEVIYG
Sbjct  722   ENADVEYCDRISIIPRGETLSQVIFHRLDDEKYMFERRPQLLHRLQVLLGGRAAEEVIYG  781

Query  885   RDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDD  706
             RDTS+ASV YLADA+WLARK++T WNLENPM IHGEP PWRK  KFVGPRLDFEGSLYDD
Sbjct  782   RDTSRASVGYLADASWLARKILTTWNLENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDD  841

Query  705   YDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEI  526
             Y LIEPP+NF+LDD V++RTE LI D Y +T+ALLR+HHAALLK VKVLL Q+EISGEEI
Sbjct  842   YGLIEPPINFNLDDQVAQRTEELIHDMYERTVALLREHHAALLKAVKVLLNQEEISGEEI  901

Query  525   DFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLSS*KRKHI  373
             DFIL+ YPP TP SLLL E +PGSLP F QE  ++   EY+L+S  + K +
Sbjct  902   DFILNKYPPQTPLSLLLAEENPGSLPFFKQETSDS---EYALVSQSEEKSL  949



>ref|XP_011026865.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Populus euphratica]
Length=932

 Score =  1188 bits (3073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/910 (74%), Positives = 783/910 (86%), Gaps = 18/910 (2%)
 Frame = -2

Query  3084  RSPPCYCPRTIF--------GQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdk  2929
             +SPP +  +T+F         +   +  + S   N +DFVTRVLK+NPSQ+E RY +GDK
Sbjct  23    KSPPKFRSKTLFLNRSLRVLCEVNSASTAQSGDTNKEDFVTRVLKQNPSQIEPRYLIGDK  82

Query  2928  lltlkekedlqkKSFDTGALEILRRL-NLKAFSRKSQEDGDQGKPEE--VYLKEILREHK  2758
               TLKEK+DL KK  + G +EI+ RL NLK    K +++G++ + EE  VYLK+ILRE+K
Sbjct  83    FYTLKEKQDLSKKK-NVGLIEIVDRLLNLKG---KVKKEGNESENEEKAVYLKDILREYK  138

Query  2757  GKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFG  2578
             GKLYVPEQ+F   LSEEEEF++N+EELPKM FEDF+K +++DKVKLLT KE     Y   
Sbjct  139   GKLYVPEQVFSVKLSEEEEFDRNLEELPKMGFEDFKKAMESDKVKLLTSKEAAMGTYAND  198

Query  2577  FRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQP  2398
             +RDF+V+LKE+PG KSL RTKWTMRL+ N+AQ+LL EYTGP YE+E+ M + VGKLPE P
Sbjct  199   YRDFIVDLKEIPGEKSLHRTKWTMRLNENEAQTLLEEYTGPFYEIERHMASSVGKLPEYP  258

Query  2397  HPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFM  2218
             HPVAS IS+R+MVELGM+TA+M AAA + G +LASAVFAVTSF F  TVYV WP+AKPF+
Sbjct  259   HPVASSISSRMMVELGMVTAVMAAAAVVVGGFLASAVFAVTSFIFVATVYVAWPIAKPFV  318

Query  2217  KFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLL  2041
             K F G++F +LE VWD + D F+  G+F+KFY+ YTFGG+SASIE+LKPI+LV LTMVLL
Sbjct  319   KLFLGIIFSILEGVWDYVVDIFSDGGLFSKFYEFYTFGGVSASIEMLKPIMLVLLTMVLL  378

Query  2040  VRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYL  1861
             VRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F DVAGI++AVEELQELV YL
Sbjct  379   VRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFGDVAGIDEAVEELQELVRYL  438

Query  1860  KNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAA  1681
             KNPELFDKMGIKPPHGVLLEG PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+A
Sbjct  439   KNPELFDKMGIKPPHGVLLEGAPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSA  498

Query  1680  RIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELD  1501
             RIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETTLNQLL ELD
Sbjct  499   RIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETTLNQLLIELD  558

Query  1500  GFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSET  1321
             GFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++
Sbjct  559   GFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLEILKIHASKVKMSDS  618

Query  1320  VDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDL  1141
             VDL++Y +NLPGW+GAKLAQL+QEAALVAVR+GH +IL+SDMDDAVDRLTVGPKRVGI+L
Sbjct  619   VDLSTYGKNLPGWTGAKLAQLVQEAALVAVRQGHAAILQSDMDDAVDRLTVGPKRVGIEL  678

Query  1140  GHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMF  961
             GHQGQCRRATTE+G  +TSHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDESYMF
Sbjct  679   GHQGQCRRATTELGVVMTSHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMF  738

Query  960   ERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHG  781
             ER PQLLHRLQV LGGRAAEEVIYGRDTS+ASVSYLADA+WLARK+IT+WNLENPM IHG
Sbjct  739   ERLPQLLHRLQVFLGGRAAEEVIYGRDTSRASVSYLADASWLARKIITIWNLENPMVIHG  798

Query  780   EPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlall  601
             EP PWRK+ +F+GPRLDFEGSLYDDYDLIEPP+NF+LDD V++RTE LI D Y +T++LL
Sbjct  799   EPPPWRKNVRFMGPRLDFEGSLYDDYDLIEPPINFNLDDQVAQRTEKLICDMYGRTVSLL  858

Query  600   rqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEA  421
             ++HHAALLK VKVLL QKEISGEEID+IL+NYPP T  SLLLEE +PG LP F QE E  
Sbjct  859   KRHHAALLKAVKVLLNQKEISGEEIDYILNNYPPQTRLSLLLEEENPGILPFFKQELE--  916

Query  420   NEIEYSLLSS  391
             NE++Y+LL++
Sbjct  917   NELDYALLTT  926



>ref|XP_008239146.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Prunus mume]
Length=948

 Score =  1184 bits (3063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/929 (73%), Positives = 776/929 (84%), Gaps = 21/929 (2%)
 Frame = -2

Query  3126  KRHQNLKFPRNIAR-------RSPPCYCPRTI-FGQAKYSEQSNSSGGND----DDFVTR  2983
             K H + K P +  R       +  P +  RT+ F    YS  S+ SG       DDFVTR
Sbjct  16    KPHTHFKSPNHSKRFNLIRKIQPQPPFPHRTLTFLCQSYSGPSSRSGDTSKAPQDDFVTR  75

Query  2982  VLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEI-LRRLNLKAFSRKSQ----E  2818
             VLKENPSQ+E RY VGDK  T KEKE L K S + G +E+  +RL       K +    +
Sbjct  76    VLKENPSQIEPRYLVGDKFYTSKEKESLGKNS-NVGFIELWAKRLKFSKVEPKKERTEGQ  134

Query  2817  DGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLK  2638
             +  Q + E VYLK+ILRE+KGKLYVPEQIF + L EEEEFE+++EELP M FEDFQK LK
Sbjct  135   NDSQVRDESVYLKDILREYKGKLYVPEQIFGTELPEEEEFERSLEELPTMSFEDFQKALK  194

Query  2637  TDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTG  2458
             +DKVKLLTFKE    +YGF   DF+V+LKE+PG KSL RTKW MRLD  +AQ+LL EYTG
Sbjct  195   SDKVKLLTFKEATGTSYGF--TDFIVDLKEIPGQKSLHRTKWAMRLDEGEAQALLEEYTG  252

Query  2457  PRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfav  2278
             PRY +E    + VGKLP  PHPVAS IS+R+MVELGM+TA+M AAA + G +LASAVFAV
Sbjct  253   PRYVIEGHTTSLVGKLPRYPHPVASSISSRMMVELGMVTAVMAAAAVVVGGFLASAVFAV  312

Query  2277  tsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGI  2101
             TSF F  TVYVVWP+ KPF++ F GL+F +LERVWD + D F+  G+F+KF   YTFGG+
Sbjct  313   TSFVFVSTVYVVWPIVKPFIRLFLGLIFGILERVWDNLVDFFSDGGIFSKFSDFYTFGGV  372

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             S+SIE+LKPI +V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F
Sbjct  373   SSSIEMLKPITIVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKF  432

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             +DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV
Sbjct  433   SDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  492

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +SSD  
Sbjct  493   PFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESSDHL  552

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             YNAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKI+IRPP 
Sbjct  553   YNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIKIRPPA  612

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             AKGRL ILK+HA KVK+SE+VDL+SYAQNLPGW+GAKLAQL+QEAALVAVRKGH SI +S
Sbjct  613   AKGRLDILKIHASKVKMSESVDLSSYAQNLPGWTGAKLAQLVQEAALVAVRKGHESIRQS  672

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             D+DDAVDRLTVGPKRVGI+LGHQGQCRR+TTEVG A+TSHLLR YENA+VECCDRISI P
Sbjct  673   DLDDAVDRLTVGPKRVGIELGHQGQCRRSTTEVGVAITSHLLRQYENAEVECCDRISIIP  732

Query  1020  RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADAT  841
             RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS+ASV YLADA+
Sbjct  733   RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSRASVDYLADAS  792

Query  840   WLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDD  661
             WLARK++T+WNLENPM IHGEP PWRK  +FVGPRLDFEGSLY DYDLIEPP+NF+LDD+
Sbjct  793   WLARKILTIWNLENPMVIHGEPPPWRKKVQFVGPRLDFEGSLYHDYDLIEPPVNFNLDDE  852

Query  660   VSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASL  481
             V+KRTE LI + Y KTL+LL++HHAALLKTVKVLL++KEISGEEIDFIL+ YPP TP  L
Sbjct  853   VAKRTEELIHNMYDKTLSLLKRHHAALLKTVKVLLERKEISGEEIDFILNKYPPQTPLKL  912

Query  480   LLEEGDPGSLPLFHQEQEEANEIEYSLLS  394
             L EE +PGSL    QEQE+  E+EY+LL+
Sbjct  913   LFEEENPGSLKFIKQEQEQERELEYALLT  941



>ref|XP_002299463.1| hypothetical protein POPTR_0001s10780g [Populus trichocarpa]
 gb|EEE84268.1| hypothetical protein POPTR_0001s10780g [Populus trichocarpa]
Length=932

 Score =  1184 bits (3063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/910 (74%), Positives = 780/910 (86%), Gaps = 18/910 (2%)
 Frame = -2

Query  3084  RSPPCYCPRTIF--------GQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdk  2929
             +SPP +  +T+F         +   +  + S   N +DFVTRVLK+NPSQ+E RY +GDK
Sbjct  23    KSPPKFRSKTLFLNRSLTVLCEVNSASTAQSGDTNKEDFVTRVLKQNPSQIEPRYLIGDK  82

Query  2928  lltlkekedlqkKSFDTGALEILRR-LNLKAFSRKSQEDGDQGKPEE--VYLKEILREHK  2758
               T KEK+DL KK  + G +EI+ R LNLK    K +++G++ + EE  VYLK+ILRE+K
Sbjct  83    FYTSKEKQDLSKKK-NVGFIEIVDRFLNLKG---KVKKEGNESENEEKAVYLKDILREYK  138

Query  2757  GKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFG  2578
             GKLYVPEQ+F   LSEEEEF++N+EELPKM FEDF+K ++++KVKLLT KE     Y   
Sbjct  139   GKLYVPEQVFSVKLSEEEEFDRNLEELPKMGFEDFKKAMESEKVKLLTSKEAAMGTYAND  198

Query  2577  FRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQP  2398
             +R F+V+LKE+PG KSL RTKWTMRL+ N+AQ+LL EYTGP YE+E+ M + VGKLPE P
Sbjct  199   YRGFIVDLKEIPGEKSLHRTKWTMRLNENEAQTLLEEYTGPFYEIERHMASSVGKLPEYP  258

Query  2397  HPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFM  2218
             HPVAS IS+R+MVELGM+TA+M AAA + G +LASAVFAVTSF F  TVYV WP+AKPF+
Sbjct  259   HPVASSISSRMMVELGMVTAVMAAAAVVVGGFLASAVFAVTSFIFVATVYVAWPIAKPFV  318

Query  2217  KFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLL  2041
             K F GL F +LE VWD + D F+  G+F+KFY+ YTFGG+SASIE+LKPI+LV LTMVLL
Sbjct  319   KLFLGLTFSILEGVWDYVVDIFSDGGLFSKFYEFYTFGGVSASIEMLKPIMLVLLTMVLL  378

Query  2040  VRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYL  1861
             VRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQELV YL
Sbjct  379   VRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQELVRYL  438

Query  1860  KNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAA  1681
             KNPELFDKMGIKPPHGVLLEG PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+A
Sbjct  439   KNPELFDKMGIKPPHGVLLEGAPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSA  498

Query  1680  RIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELD  1501
             RIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETTLNQLL ELD
Sbjct  499   RIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETTLNQLLIELD  558

Query  1500  GFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSET  1321
             GFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++
Sbjct  559   GFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLEILKIHASKVKMSDS  618

Query  1320  VDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDL  1141
             VDL++Y +NLPGW+GAKLAQL+QEAALVAVR+GH +IL+SDMDDAVDRLTVGPKRVGI+L
Sbjct  619   VDLSTYGKNLPGWTGAKLAQLVQEAALVAVRQGHAAILQSDMDDAVDRLTVGPKRVGIEL  678

Query  1140  GHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMF  961
             GHQGQCRRATTE+G  +TSHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDESYMF
Sbjct  679   GHQGQCRRATTELGVVMTSHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDESYMF  738

Query  960   ERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHG  781
             ER PQLLHRLQV LGGRAAEEVIYGRDTS+ASVSYLADA+WLARK+IT+WNLENPM IHG
Sbjct  739   ERLPQLLHRLQVFLGGRAAEEVIYGRDTSRASVSYLADASWLARKIITIWNLENPMVIHG  798

Query  780   EPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlall  601
             EP PWRK  +F+GPRLDFEGSLYDDYDLIEPP+NF+LDD V++RTE LI D Y +T++LL
Sbjct  799   EPPPWRKKVRFMGPRLDFEGSLYDDYDLIEPPINFNLDDQVAQRTEKLICDMYGRTVSLL  858

Query  600   rqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEA  421
             ++HHAALLK VKVLL QKEISGEEID+IL+NYPP T  SLLLEE +PG LP F QE E  
Sbjct  859   KRHHAALLKAVKVLLNQKEISGEEIDYILNNYPPQTRLSLLLEEENPGILPFFKQELE--  916

Query  420   NEIEYSLLSS  391
             NE++Y+LL++
Sbjct  917   NELDYALLTT  926



>ref|XP_007210393.1| hypothetical protein PRUPE_ppa000962mg [Prunus persica]
 gb|EMJ11592.1| hypothetical protein PRUPE_ppa000962mg [Prunus persica]
Length=948

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 682/929 (73%), Positives = 777/929 (84%), Gaps = 21/929 (2%)
 Frame = -2

Query  3126  KRHQNLKFPRNIAR-------RSPPCYCPRTI-FGQAKYSEQSNSSGGND----DDFVTR  2983
             K H + K P +  R       +  P +  RT+ F    YS  S+ SG       DDFVTR
Sbjct  16    KPHTHFKSPNHSKRFNLIRKIQPQPPFPHRTLTFLCQSYSGPSSRSGDTSKAPQDDFVTR  75

Query  2982  VLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEI-LRRLNL-KAFSRKSQEDG-  2812
             VLKENPSQ+E RY VGDK  T KEKE L K S + G +E+  +RL   KA  +K + +G 
Sbjct  76    VLKENPSQIEPRYLVGDKFYTSKEKESLGKNS-NVGFIELWAKRLKFSKAEPKKERTEGQ  134

Query  2811  --DQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLK  2638
                + + E VYLK+ILRE+KGKLYVPEQIF + L EEEEFE+++ ELP M FEDFQK LK
Sbjct  135   NYSEVRDESVYLKDILREYKGKLYVPEQIFGTELPEEEEFERSLGELPTMSFEDFQKALK  194

Query  2637  TDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTG  2458
             +DKVKLLT KE    +YGF   DF+V+LKE+PG KSL RTKW MRLD  +AQ+LL EYTG
Sbjct  195   SDKVKLLTLKEVTGTSYGF--TDFIVDLKEIPGQKSLHRTKWAMRLDEGEAQALLEEYTG  252

Query  2457  PRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfav  2278
             PRY +E    + VGKLP  PHPVAS IS+R+MVELGM+TA+M AAA + G +LASAVFAV
Sbjct  253   PRYVIEGHATSLVGKLPRYPHPVASSISSRMMVELGMVTAVMAAAAVVVGGFLASAVFAV  312

Query  2277  tsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGI  2101
             TSF F  TVYV WP+AKPF++ F GL+F +LERVWD + D F+  G+F+KF   YTFGG+
Sbjct  313   TSFVFVSTVYVAWPIAKPFIRLFLGLIFGILERVWDNLVDFFSDGGIFSKFSDFYTFGGV  372

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             S+SIE+LKPI +V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F
Sbjct  373   SSSIEMLKPITIVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKF  432

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             +DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV
Sbjct  433   SDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  492

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +SSD  
Sbjct  493   PFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESSDHL  552

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             YNAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKI+IRPP 
Sbjct  553   YNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIKIRPPA  612

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             AKGRL ILK+HA KVK+SE+VDL+SYAQNLPGW+GAKLAQL+QEAALVAVRKGH SI +S
Sbjct  613   AKGRLDILKIHASKVKMSESVDLSSYAQNLPGWTGAKLAQLVQEAALVAVRKGHESIRQS  672

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             D+DDAVDRLTVGPKRVGI+LGHQGQCRR+TTEVG A+TSHLLR YENA+VECCDRISI P
Sbjct  673   DLDDAVDRLTVGPKRVGIELGHQGQCRRSTTEVGVAITSHLLRQYENAEVECCDRISIIP  732

Query  1020  RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADAT  841
             RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS+ASV YLADA+
Sbjct  733   RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSRASVDYLADAS  792

Query  840   WLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDD  661
             WLARK++T+WNLENPM IHGEP PWRK  +FVGPRLDFEGSLY DYDLIEPP+NF+LDD+
Sbjct  793   WLARKILTIWNLENPMVIHGEPPPWRKKVQFVGPRLDFEGSLYHDYDLIEPPVNFNLDDE  852

Query  660   VSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASL  481
             V+KRTE LI + Y KTL+LL++HHAALLKTVKVLL++KEISGEEIDFIL+ YPP TP  L
Sbjct  853   VAKRTEELIHNMYDKTLSLLKRHHAALLKTVKVLLERKEISGEEIDFILNKYPPQTPLKL  912

Query  480   LLEEGDPGSLPLFHQEQEEANEIEYSLLS  394
             L EE +PGSL    QEQE+  E+EY+LL+
Sbjct  913   LFEEENPGSLKFIKQEQEQERELEYALLT  941



>ref|XP_007040559.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY25060.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=948

 Score =  1182 bits (3058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 673/918 (73%), Positives = 783/918 (85%), Gaps = 10/918 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             +R + L   R    R+   +   T+  + + S+   +S    DDFVTRVLK+NPSQVE R
Sbjct  27    RRIKPLNLTRKFQSRTSFLHRSFTVLCELQSSQPGETSKPKGDDFVTRVLKQNPSQVEPR  86

Query  2946  YKVGdklltlkekedlqkKSFDTGALEILRR-LNLKAFSRKSQEDGDQ-----GKPEEVY  2785
             Y VG+K+ TLKEKEDL K+  +   +EIL++ LN KA  +    + ++      + + VY
Sbjct  87    YLVGNKIYTLKEKEDLSKR-INLSLIEILKKKLNSKAKLKNESNESERETERSSENDNVY  145

Query  2784  LKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKE  2605
             L +ILRE++GKLYVPEQIF   LSEEEEFEKN+EELPKM  EDF+K +K+DKVKLLT KE
Sbjct  146   LSDILREYRGKLYVPEQIFGEELSEEEEFEKNLEELPKMSLEDFRKAMKSDKVKLLTSKE  205

Query  2604  DNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT  2425
              +  +Y  G RDFVV+LK++PG KSLQRTKW MRLD  +AQ+LL+EY G RYE+E+ M +
Sbjct  206   VSGVSYVGGHRDFVVDLKDIPGDKSLQRTKWAMRLDETEAQTLLSEYAGKRYEIERHMTS  265

Query  2424  WVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyv  2245
             WVGK+PE PHPVAS IS+R+MVELGM+TA+M AAA I G +LA+AVFAVTSF F  TVYV
Sbjct  266   WVGKVPEYPHPVASSISSRMMVELGMVTAVMAAAAVIVGGFLAAAVFAVTSFVFVTTVYV  325

Query  2244  VWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPIL  2068
             VWP+ KPF+K F G++F +LERVWD + D F+  G+F+K Y+ YTFGG+SAS+E+LKPI 
Sbjct  326   VWPIVKPFVKLFLGIIFSILERVWDNLVDVFSDGGIFSKLYEFYTFGGVSASLEMLKPIT  385

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             +V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVE
Sbjct  386   VVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVE  445

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV
Sbjct  446   ELQELVRYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  505

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             EVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETT
Sbjct  506   EVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETT  565

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+H
Sbjct  566   LNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLQILKIH  625

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             A KVK+SE+VDL+SYA NLPGW+GAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTV
Sbjct  626   ASKVKMSESVDLSSYANNLPGWTGAKLAQLVQEAALVAVRKRHDSILQSDMDDAVDRLTV  685

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             GPKRVGI+LGHQGQCRRATTE+G A+TSHLLR YENA+VECCDRISI PRGQTLSQVVFH
Sbjct  686   GPKRVGIELGHQGQCRRATTELGVAMTSHLLRRYENAEVECCDRISIVPRGQTLSQVVFH  745

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWN  808
             RLDDESYMFERRPQLLHRLQV LGGRAAEEVIYGRDTS+AS++YLADA+WLARK++T+WN
Sbjct  746   RLDDESYMFERRPQLLHRLQVFLGGRAAEEVIYGRDTSRASLNYLADASWLARKILTIWN  805

Query  807   LENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRD  628
             LENPM IHGEP PWRK  KFVGPRLDFEGSLYDDYDLIEPP+NF+LDD++++R+E L+RD
Sbjct  806   LENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDDYDLIEPPVNFNLDDEIAQRSEELLRD  865

Query  627   TYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLP  448
              YA+T++LLR+HHAALLK VKVLL QKEISGEEIDFIL+ YPP TP SLLL E +PGSLP
Sbjct  866   MYARTVSLLRRHHAALLKAVKVLLNQKEISGEEIDFILNKYPPQTPLSLLLGEENPGSLP  925

Query  447   LFHQEQEEANEIEYSLLS  394
                QEQE   ++E  LL+
Sbjct  926   FIKQEQE--RDLERVLLT  941



>ref|XP_006476360.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=938

 Score =  1182 bits (3057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/913 (72%), Positives = 775/913 (85%), Gaps = 9/913 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             K  + LKF R    R+   +  R+     + S+  ++S   ++DFVTRVLKENPSQVE +
Sbjct  26    KSAKPLKFTRKCQSRT--NFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPK  83

Query  2946  YKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEIL  2770
             Y +G++  +LKE+++L +K+ D G  + L  +LN K  S+K  E  +Q     VYLK+IL
Sbjct  84    YLIGERFYSLKERQNLSEKN-DVGIFQSLAEKLNSKENSKK--ESDNQNVSGSVYLKDIL  140

Query  2769  REHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAAN  2590
             RE+KGKLYVPEQ+F   LSEEEEF KNV+ELPKM  E+F+KY+++DKVKLLT K  N   
Sbjct  141   REYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVA  200

Query  2589  YGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKL  2410
             +  G+RDF+V+LK++PG+K LQRTKW MRLD N+AQ+LL+EYTGP+YE+EK M +WVGKL
Sbjct  201   FANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKL  260

Query  2409  PEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVA  2230
             PE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVYVVWP+A
Sbjct  261   PEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIA  320

Query  2229  KPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPILLVFLT  2053
             +PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI LV LT
Sbjct  321   RPFVYIFRGLILGIIENILDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILT  380

Query  2052  MVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQEL  1873
             MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQEL
Sbjct  381   MVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQEL  440

Query  1872  VTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  1693
             V YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG
Sbjct  441   VRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  500

Query  1692  VGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLL  1513
             VG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERETTLNQLL
Sbjct  501   VGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLL  560

Query  1512  TELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVK  1333
              ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+HA KVK
Sbjct  561   IELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVK  620

Query  1332  LSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRV  1153
             +S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLTVGPKR 
Sbjct  621   MSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR  680

Query  1152  GIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE  973
             GI+LGHQGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDE
Sbjct  681   GIELGHQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDE  740

Query  972   SYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             SYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLARK++T+WNLENPM
Sbjct  741   SYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLARKILTIWNLENPM  800

Query  792   TIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKT  613
              IHGEP PWRK  KFVGPRLDFEGSLYDDY L EPP+NF+LDDD+++RTE L+RD Y +T
Sbjct  801   VIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLTEPPVNFNLDDDIARRTEELLRDMYGRT  860

Query  612   lallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQE  433
             + LLR+HHAALLKTVKVLL QKEI  EEI++IL+NYPP TP S LLEE +PG+LP   QE
Sbjct  861   VTLLRRHHAALLKTVKVLLNQKEIGREEIEYILNNYPPQTPISRLLEEENPGTLPFIKQE  920

Query  432   QEEANEIEYSLLS  394
             Q   +++E++L++
Sbjct  921   Q--CSQVEHALVN  931



>gb|KDO76574.1| hypothetical protein CISIN_1g002307mg [Citrus sinensis]
Length=938

 Score =  1180 bits (3053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/913 (72%), Positives = 774/913 (85%), Gaps = 9/913 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             K  + LKF R    R+   +  R+     + S+  ++S   ++DFVTRVLKENPSQVE +
Sbjct  26    KSAKPLKFTRKCQSRT--NFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPK  83

Query  2946  YKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEIL  2770
             Y +G++  +LKE+++L +K+ D G  + L  +LN K  S+K  E  +Q     VYLK+IL
Sbjct  84    YLIGERFYSLKERQNLSEKN-DVGIFQSLAEKLNSKENSKK--ESDNQNVSGSVYLKDIL  140

Query  2769  REHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAAN  2590
             RE+KGKLYVPEQ+F   LSEEEEF KNV+ELPKM  E+F+KY+++DKVKLLT K  N   
Sbjct  141   REYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVA  200

Query  2589  YGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKL  2410
             +  G+RDF+V+LK++PG+K LQRTKW MRLD N+AQ+LL+EYTGP+YE+EK M +WVGKL
Sbjct  201   FANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKL  260

Query  2409  PEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVA  2230
             PE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVYVVWP+A
Sbjct  261   PEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIA  320

Query  2229  KPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPILLVFLT  2053
             +PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI LV LT
Sbjct  321   RPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILT  380

Query  2052  MVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQEL  1873
             MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQEL
Sbjct  381   MVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQEL  440

Query  1872  VTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  1693
             V YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG
Sbjct  441   VRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  500

Query  1692  VGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLL  1513
             VG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERETTLNQLL
Sbjct  501   VGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLL  560

Query  1512  TELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVK  1333
              ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+HA KVK
Sbjct  561   IELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVK  620

Query  1332  LSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRV  1153
             +S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLTVGPKR 
Sbjct  621   MSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR  680

Query  1152  GIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE  973
             GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDE
Sbjct  681   GIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDE  740

Query  972   SYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             SYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLARK++T+WNLENPM
Sbjct  741   SYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLARKILTIWNLENPM  800

Query  792   TIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKT  613
              IHGEP PWRK  KFVGPRLDFEGSLYDDY L EPP+NF+LDDD++ RTE L+RD Y +T
Sbjct  801   VIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLTEPPVNFNLDDDIAWRTEELLRDMYGRT  860

Query  612   lallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQE  433
             + LLR+HHAALLKTVKVLL QKEI  EEIDFIL+NYPP TP S LLEE +PG+LP   QE
Sbjct  861   VTLLRRHHAALLKTVKVLLNQKEIGREEIDFILNNYPPQTPISRLLEEENPGTLPFIKQE  920

Query  432   QEEANEIEYSLLS  394
             Q   +++E++L++
Sbjct  921   Q--CSQVEHALVN  931



>ref|XP_006439318.1| hypothetical protein CICLE_v10018718mg [Citrus clementina]
 gb|ESR52558.1| hypothetical protein CICLE_v10018718mg [Citrus clementina]
Length=970

 Score =  1179 bits (3051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 667/957 (70%), Positives = 791/957 (83%), Gaps = 15/957 (2%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             K  + LKF R    R+   +  R+     + S+  ++S   ++DFVTRVLKENPSQVE +
Sbjct  26    KSAKPLKFTRKCQSRT--NFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPK  83

Query  2946  YKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEIL  2770
             Y +G++  +LKE+++L +K+ D G  + L  +LN K  S+K  E  +Q     VYLK+IL
Sbjct  84    YLIGERFYSLKERQNLSEKN-DVGIFQSLAEKLNSKENSKK--ESDNQNVSGSVYLKDIL  140

Query  2769  REHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAAN  2590
             RE+KGKLYVPEQ+F   LSEEEEF+KNV+ELPKM  E+F+KY+++DKVKLLT +  N   
Sbjct  141   REYKGKLYVPEQVFGHELSEEEEFDKNVKELPKMSIEEFKKYMESDKVKLLTSRGINGMA  200

Query  2589  YGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKL  2410
             +  G+RDF+V+LK++PG+K LQRTKW MRLD N+AQ+LL+EYTGP+YE+EK M +WVGKL
Sbjct  201   FANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKL  260

Query  2409  PEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVA  2230
             PE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVYVVWP+A
Sbjct  261   PEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIA  320

Query  2229  KPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPILLVFLT  2053
             +PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI LV LT
Sbjct  321   RPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILT  380

Query  2052  MVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQEL  1873
             MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQEL
Sbjct  381   MVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQEL  440

Query  1872  VTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  1693
             V YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG
Sbjct  441   VRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  500

Query  1692  VGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLL  1513
             VG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERETTLNQLL
Sbjct  501   VGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLL  560

Query  1512  TELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVK  1333
              ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+HA KVK
Sbjct  561   IELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVK  620

Query  1332  LSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRV  1153
             +S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLTVGPKR 
Sbjct  621   MSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR  680

Query  1152  GIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE  973
             GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDE
Sbjct  681   GIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDE  740

Query  972   SYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             SYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLARK++T+WNLENPM
Sbjct  741   SYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLARKILTIWNLENPM  800

Query  792   TIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKT  613
              IHGEP PWRK  KFVGPRLDFEGSLYDDY L EPP+NF+LDDD++ RTE L+RD Y +T
Sbjct  801   VIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLTEPPVNFNLDDDIAWRTEELLRDMYGRT  860

Query  612   lallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQE  433
             + LLR+HHAALLKTVKVLL QKEI  EEIDFIL+NYPP TP S LLEE +PG+LP   QE
Sbjct  861   VTLLRRHHAALLKTVKVLLNQKEIGREEIDFILNNYPPQTPISRLLEEENPGTLPFIKQE  920

Query  432   QEEANEIEYSLLSS*KRKHIFLQNETERENICQNESVFFTLQIANRGEASEDRWMLL  262
             Q   +++E++L++     H   Q   ++ +  Q +   F   +  R E + + W+L 
Sbjct  921   Q--CSQVEHALVN-----HSKEQKRQQQTHADQTKPKPFVHAVPLRHEETAE-WLLF  969



>ref|XP_006439320.1| hypothetical protein CICLE_v10018718mg [Citrus clementina]
 gb|ESR52560.1| hypothetical protein CICLE_v10018718mg [Citrus clementina]
Length=938

 Score =  1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/913 (72%), Positives = 775/913 (85%), Gaps = 9/913 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             K  + LKF R    R+   +  R+     + S+  ++S   ++DFVTRVLKENPSQVE +
Sbjct  26    KSAKPLKFTRKCQSRT--NFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPK  83

Query  2946  YKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEIL  2770
             Y +G++  +LKE+++L +K+ D G  + L  +LN K  S+K  E  +Q     VYLK+IL
Sbjct  84    YLIGERFYSLKERQNLSEKN-DVGIFQSLAEKLNSKENSKK--ESDNQNVSGSVYLKDIL  140

Query  2769  REHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAAN  2590
             RE+KGKLYVPEQ+F   LSEEEEF+KNV+ELPKM  E+F+KY+++DKVKLLT +  N   
Sbjct  141   REYKGKLYVPEQVFGHELSEEEEFDKNVKELPKMSIEEFKKYMESDKVKLLTSRGINGMA  200

Query  2589  YGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKL  2410
             +  G+RDF+V+LK++PG+K LQRTKW MRLD N+AQ+LL+EYTGP+YE+EK M +WVGKL
Sbjct  201   FANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKL  260

Query  2409  PEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVA  2230
             PE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVYVVWP+A
Sbjct  261   PEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIA  320

Query  2229  KPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPILLVFLT  2053
             +PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI LV LT
Sbjct  321   RPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILT  380

Query  2052  MVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQEL  1873
             MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQEL
Sbjct  381   MVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQEL  440

Query  1872  VTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  1693
             V YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG
Sbjct  441   VRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  500

Query  1692  VGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLL  1513
             VG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERETTLNQLL
Sbjct  501   VGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLL  560

Query  1512  TELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVK  1333
              ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+HA KVK
Sbjct  561   IELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVK  620

Query  1332  LSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRV  1153
             +S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLTVGPKR 
Sbjct  621   MSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR  680

Query  1152  GIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE  973
             GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDE
Sbjct  681   GIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDE  740

Query  972   SYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             SYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLARK++T+WNLENPM
Sbjct  741   SYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLARKILTIWNLENPM  800

Query  792   TIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKT  613
              IHGEP PWRK  KFVGPRLDFEGSLYDDY L EPP+NF+LDDD++ RTE L+RD Y +T
Sbjct  801   VIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLTEPPVNFNLDDDIAWRTEELLRDMYGRT  860

Query  612   lallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQE  433
             + LLR+HHAALLKTVKVLL QKEI  EEIDFIL+NYPP TP S LLEE +PG+LP   QE
Sbjct  861   VTLLRRHHAALLKTVKVLLNQKEIGREEIDFILNNYPPQTPISRLLEEENPGTLPFIKQE  920

Query  432   QEEANEIEYSLLS  394
             Q   +++E++L++
Sbjct  921   Q--CSQVEHALVN  931



>ref|XP_002266075.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Vitis vinifera]
 emb|CBI39970.3| unnamed protein product [Vitis vinifera]
Length=907

 Score =  1177 bits (3044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/871 (75%), Positives = 753/871 (86%), Gaps = 18/871 (2%)
 Frame = -2

Query  3024  SNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLN-  2848
             S S  G+ +DF+TRVLK+NPSQVE ++ +G  L T K+K++   KS          R N 
Sbjct  33    SASQNGDKEDFITRVLKQNPSQVEPKFLIGQTLYTQKQKDEAFNKSRQN-------RWNW  85

Query  2847  LKAFSRKSQEDG----DQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveE  2680
             L+   RK +++G    ++   E V+LK+ILREHKGKLYVPEQIF + LSEEEEF +++E 
Sbjct  86    LRLMPRKGEKNGVLENEEVGSEAVFLKDILREHKGKLYVPEQIFGTRLSEEEEFARDLES  145

Query  2679  LPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRL  2500
             LP M  E+F+K ++ DKVK++  K+++   YGFG  +F+VELKE+PG KSLQRTKW M+L
Sbjct  146   LPVMSLEEFRKAVENDKVKVVISKDES---YGFG--NFIVELKEIPGDKSLQRTKWAMKL  200

Query  2499  DLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaa  2320
             D +QA   +  YTGPRYE+E+   +WVGKLPE PHPVAS IS+R+MVELGM+TA+M AAA
Sbjct  201   DEDQAYEAMAGYTGPRYEIERTTKSWVGKLPEFPHPVASSISSRMMVELGMVTAVMAAAA  260

Query  2319  aiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FG  2143
              + G +LASAVFAVTSF FA  VYVVWP+ KPF++ F+G++  +LERVWD + D F+  G
Sbjct  261   VVVGGFLASAVFAVTSFIFATAVYVVWPLVKPFLRLFTGIISGILERVWDNVIDVFSDGG  320

Query  2142  VFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQS  1963
             VF+K  ++YTFGGISAS+E+LKPI+LVFLTM LLVRFTLSRRPKNFRKWDIWQGIEFSQS
Sbjct  321   VFSKLNEIYTFGGISASLEMLKPIMLVFLTMALLVRFTLSRRPKNFRKWDIWQGIEFSQS  380

Query  1962  KPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCG  1783
             K QARVDG TGV F+DVAGIE+AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCG
Sbjct  381   KAQARVDGSTGVKFSDVAGIEEAVEELQELVKYLKNPELFDKMGIKPPHGVLLEGPPGCG  440

Query  1782  KTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALA  1603
             KTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALA
Sbjct  441   KTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALA  500

Query  1602  TKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLR  1423
             T+RQGIF++S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNRMDLLDPALLR
Sbjct  501   TRRQGIFSESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRMDLLDPALLR  560

Query  1422  PGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaa  1243
             PGRFDRKIRIRPPNAKGRL ILKVHARKVKL+E+VDL++YAQNLPGW+GA+LAQLLQEAA
Sbjct  561   PGRFDRKIRIRPPNAKGRLDILKVHARKVKLAESVDLSTYAQNLPGWTGARLAQLLQEAA  620

Query  1242  lvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYE  1063
             LVAVRKGH +IL+SD+D+AVDRLTVGPKRVGI+LGHQGQCRRATTEVGTA+TSHLLR YE
Sbjct  621   LVAVRKGHEAILQSDVDEAVDRLTVGPKRVGIELGHQGQCRRATTEVGTAITSHLLRRYE  680

Query  1062  NAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR  883
             +AKVE CDRIS+ PRGQTLSQVVF RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR
Sbjct  681   SAKVERCDRISVIPRGQTLSQVVFDRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR  740

Query  882   DTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDY  703
             DTS+ASV YLADA+WLARK++T+WNLENPM IHGEP PWRK  KFVGPRLDFEGSLYDDY
Sbjct  741   DTSRASVDYLADASWLARKILTIWNLENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDDY  800

Query  702   DLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEID  523
              LIEPP+NF+LDD V++RTE LI D Y KTL LLR+HHAALLKTVKVL++QKEISGEEID
Sbjct  801   GLIEPPVNFNLDDQVAQRTEELISDMYGKTLTLLRRHHAALLKTVKVLVEQKEISGEEID  860

Query  522   FILSNYPPHTPASLLLEEGDPGSLPLFHQEQ  430
             FIL++YPP TP S LLEE +PGSLP   QE 
Sbjct  861   FILNSYPPQTPVSCLLEEENPGSLPFGRQEH  891



>ref|XP_004300881.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Fragaria 
vesca subsp. vesca]
Length=933

 Score =  1177 bits (3044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/915 (73%), Positives = 770/915 (84%), Gaps = 21/915 (2%)
 Frame = -2

Query  3129  QKRHQNLKFPRNIAR-RSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVE  2953
               RH NL     I R R  P +  R++      S+  ++S  + DDF+TRVLKENPSQVE
Sbjct  26    HSRHLNL-----ITRLRKQPPFPRRSL--TVLCSKSGDASKASGDDFMTRVLKENPSQVE  78

Query  2952  TRYKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEE--VYL  2782
              R+ +G+K  TLKEKE L KK  + G  E L +RL  K    K++ED  + + EE  V+L
Sbjct  79    PRFLIGEKFYTLKEKESLGKKP-NVGFAEFLAKRLTFK----KAEEDVKKQRNEEEGVFL  133

Query  2781  KEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKED  2602
              +ILRE+KGKLYVPEQIF + L EE+EFEK+ EELPKM FEDFQK +K DKV+LL++KE 
Sbjct  134   NDILREYKGKLYVPEQIFGAELPEEDEFEKSSEELPKMSFEDFQKAMKNDKVELLSYKEV  193

Query  2601  NAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTW  2422
                 YGF   DFVV+LKE+PG K L RTKW MRLD  +AQ+LL EYTGPRY +E+   + 
Sbjct  194   KGGAYGFS--DFVVDLKEIPGEKRLHRTKWAMRLDEGEAQALLEEYTGPRYVIERHTTSS  251

Query  2421  VGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvV  2242
             VG LP+ PHPVAS IS+R+MVELG++TALM AAA + G +LASAVFAVTSF F  TVYVV
Sbjct  252   VGSLPQYPHPVASSISSRMMVELGVVTALMAAAAVVVGGFLASAVFAVTSFVFVATVYVV  311

Query  2241  WPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILL  2065
             WP+ KPF++ F G++F +LERVW+K+ D F+  G+F+K Y+ YTFGG+SAS+E+LKPI +
Sbjct  312   WPIVKPFIRLFLGILFGILERVWEKVVDFFSDGGIFSKLYEFYTFGGVSASLEMLKPISI  371

Query  2064  VFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEE  1885
             V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F DVAGI++AVEE
Sbjct  372   VLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFGDVAGIDEAVEE  431

Query  1884  LQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVE  1705
             LQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVE
Sbjct  432   LQELVKYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVE  491

Query  1704  VLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTL  1525
             VLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S D  YNAATQERETTL
Sbjct  492   VLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESGDQLYNAATQERETTL  551

Query  1524  NQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHA  1345
             NQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKI+IRPP  KGRL ILK+HA
Sbjct  552   NQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIKIRPPGPKGRLEILKIHA  611

Query  1344  RKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVG  1165
              KVK+SE+VDL+SYA NLPGW+GAKLAQL+QEAALVAVRKGH+SILRSD+DDAVDRLTVG
Sbjct  612   SKVKMSESVDLSSYALNLPGWTGAKLAQLVQEAALVAVRKGHDSILRSDLDDAVDRLTVG  671

Query  1164  PKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHR  985
             P+RVGIDLG+QGQCRRATTEVG ALTSHLLR YE+AKVE CDRISI PRGQTLSQVVF R
Sbjct  672   PRRVGIDLGYQGQCRRATTEVGVALTSHLLRQYESAKVESCDRISIIPRGQTLSQVVFDR  731

Query  984   LDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNL  805
             LDDE+YMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS ASV YLADA+WLARK++TVWNL
Sbjct  732   LDDEAYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSMASVDYLADASWLARKILTVWNL  791

Query  804   ENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDT  625
             ENPM IHGEP PWR+ PKFVGPRLDFEGSLYDDY LIEPP+NF+LDD V++RTE L++  
Sbjct  792   ENPMVIHGEPPPWRRKPKFVGPRLDFEGSLYDDYGLIEPPVNFNLDDQVAQRTEELVQSM  851

Query  624   YAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             YAKTL+LL++HHAALLKTVKVLL++KEISGEEIDFIL  YPP TP  LLLEE +PGSL  
Sbjct  852   YAKTLSLLKRHHAALLKTVKVLLERKEISGEEIDFILKKYPPQTPVKLLLEEENPGSLQF  911

Query  444   FHQEQEEANEIEYSL  400
                +QEE +E+EY+L
Sbjct  912   M--KQEEKHELEYAL  924



>ref|XP_010267613.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Nelumbo nucifera]
Length=951

 Score =  1171 bits (3029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 665/924 (72%), Positives = 773/924 (84%), Gaps = 17/924 (2%)
 Frame = -2

Query  3123  RHQNLKFPRNIAR-RSPPCYCPRT--IFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVE  2953
             R + L   RNI R R    +  R+  +F ++     S +   + DDFVTRVLKENPSQVE
Sbjct  34    RPKRLGSGRNIGRTRLYTRFNSRSYAVFRKSDSDSVSQTDSSSRDDFVTRVLKENPSQVE  93

Query  2952  TRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKA-FSRKSQEDGDQGKPEE----V  2788
              R+ VG+   TLKEK++L K     G   + +RL  K+ F ++  E G  GK EE    V
Sbjct  94    PRFLVGNNFYTLKEKQNLSKGV--DGIFGVAKRLYQKSRFGKQGDEVG--GKKEESSEPV  149

Query  2787  YLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFK  2608
             YLK+ILRE+KGKLYVPE +F++ LSEEEEF++N+EELPKM FEDF K +  +KV+LLT K
Sbjct  150   YLKDILREYKGKLYVPEAVFKATLSEEEEFDRNLEELPKMSFEDFMKAMANNKVELLTSK  209

Query  2607  EDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMM  2428
                +++YG+  RDFVV LKE+PG KSLQRTKW ++L  NQA+ +L EY GP+YE+E    
Sbjct  210   ALVSSDYGY--RDFVVNLKEIPGDKSLQRTKWALKLSENQARIVLEEYRGPQYEIETHST  267

Query  2427  TWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvy  2248
             ++VGKLPE PHPVAS IS+R+MVELGM+T LM AAA + G +LASAVFAVTSF F V VY
Sbjct  268   SYVGKLPEYPHPVASSISSRIMVELGMVTTLMAAAAVVVGGFLASAVFAVTSFLFVVAVY  327

Query  2247  vVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPI  2071
             ++WP+ KPF+K   GLVF + ER+ D + D FA  G+ +K  + YTFGG+S+S+E+LKPI
Sbjct  328   IIWPLTKPFLKLVLGLVFGIAERILDNVVDVFADGGIVSKLKEFYTFGGVSSSLEMLKPI  387

Query  2070  LLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAV  1891
             ++VFLTMVLLVRFTLSRRPKNFRKWDIWQGIEF QSKPQARVDG TGV+F+DVAGIE+AV
Sbjct  388   MIVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFGQSKPQARVDGSTGVSFSDVAGIEEAV  447

Query  1890  EELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  1711
             EELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF
Sbjct  448   EELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  507

Query  1710  VEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERET  1531
             VEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF++S++  YNAATQERET
Sbjct  508   VEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFSESTNYLYNAATQERET  567

Query  1530  TLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKV  1351
             TLNQLL ELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPP AKGRL ILKV
Sbjct  568   TLNQLLIELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPGAKGRLDILKV  627

Query  1350  HARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLT  1171
             HARKVK+S +VDL +YAQNLPGW+GAKLAQLLQEAALVAVRKGH +IL+SD+D AVDRLT
Sbjct  628   HARKVKMSPSVDLGTYAQNLPGWTGAKLAQLLQEAALVAVRKGHEAILQSDVDGAVDRLT  687

Query  1170  VGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             VGPKRVGI+LGHQGQCRRATTEVG A+TSHLLR +E+AKVE C+RISINPRGQT SQ+VF
Sbjct  688   VGPKRVGIELGHQGQCRRATTEVGMAMTSHLLRRFEDAKVEFCERISINPRGQTYSQIVF  747

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVW  811
             HRL DESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS+ASVSYL DA+WLARK++T+W
Sbjct  748   HRLGDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSRASVSYLGDASWLARKILTIW  807

Query  810   NLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIR  631
             NLENPM IHGEP PWRK   FVGPRLDFEGSLYDDY L+EPP+NF+LDD V++RTE L+ 
Sbjct  808   NLENPMAIHGEPPPWRKKVSFVGPRLDFEGSLYDDYGLVEPPINFNLDDQVAQRTEELVC  867

Query  630   DTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSL  451
               Y KT++LLRQHHAALLKTVKVL+ QKEISGE+I+FIL+ YP  TP S+LLEE  PG+L
Sbjct  868   TXYKKTVSLLRQHHAALLKTVKVLVDQKEISGEQIEFILNKYPAETPVSILLEEDQPGNL  927

Query  450   PLFHQEQEEANEIEYSLLSS*KRK  379
             P+F  EQ   +++E SLL+S K K
Sbjct  928   PMFDVEQ--GHDLELSLLTSSKEK  949



>ref|XP_010109785.1| ATP-dependent zinc metalloprotease FtsH [Morus notabilis]
 gb|EXC24703.1| ATP-dependent zinc metalloprotease FtsH [Morus notabilis]
Length=950

 Score =  1170 bits (3026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/926 (72%), Positives = 775/926 (84%), Gaps = 17/926 (2%)
 Frame = -2

Query  3126  KRHQNLKFPR------NIAR--RSPPCYCPRTIFGQAKYSEQSNSSGG-----NDDDFVT  2986
             +RH     PR      N  R  R PP +  R+     +   ++ S  G     +D+DFVT
Sbjct  20    RRHGFHSIPRLHSNGFNFTRIGRPPPLFLRRSPAVSCQSKSEATSQAGEAIKPSDEDFVT  79

Query  2985  RVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQ  2806
             RVLKENPSQ+E RY +GDK  TLKEKE+L K S + G   +++RLN +   +K ++D  +
Sbjct  80    RVLKENPSQIEPRYLIGDKFYTLKEKENLSKDSDNGGFDYLVKRLNSRLNEKKVRDDSQK  139

Query  2805  GKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKV  2626
                 +V+LK+ILRE++GKLYVPEQ+F + LSEE EFE++++ LPKM F DFQK +K+DKV
Sbjct  140   KNEGDVFLKDILREYRGKLYVPEQVFGTELSEEAEFERDLQALPKMSFVDFQKAMKSDKV  199

Query  2625  KLLTFKE-DNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRY  2449
             K+LT+KE  +  + G G+RDF+VELKE+PG KSLQR +W MRLD NQA  LL EY GPRY
Sbjct  200   KMLTWKEVTSVMSNGDGYRDFIVELKEIPGDKSLQRRRWAMRLDENQALDLLEEYNGPRY  259

Query  2448  EVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsf  2269
             ++EKQ  +W+GKLPE P PVAS +S+R+MVELGM+TALM AA  + G Y+ASAVFAVTSF
Sbjct  260   QIEKQTTSWIGKLPEYPSPVASSLSSRIMVELGMVTALMAAAGVVIGGYMASAVFAVTSF  319

Query  2268  afavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISAS  2092
              +  TVYVVWPV +PF+K   G++F + ERV D + + F   G+ + F + YTFGG+SAS
Sbjct  320   VYVTTVYVVWPVVRPFVKLLFGIIFGIFERVSDYVVEFFGDGGIISSFSRFYTFGGVSAS  379

Query  2091  IEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDV  1912
             IEVLKPI LV LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DV
Sbjct  380   IEVLKPITLVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDV  439

Query  1911  AGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY  1732
             AGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY
Sbjct  440   AGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY  499

Query  1731  QMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNA  1552
             QMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNA
Sbjct  500   QMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNA  559

Query  1551  ATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKG  1372
             ATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPP AKG
Sbjct  560   ATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPAAKG  619

Query  1371  RLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMD  1192
             RL ILK+HA KVK+S +VDL+SYAQNLPGW+GAKLAQL+QEAALVAVRKGH SIL+SDMD
Sbjct  620   RLEILKIHASKVKMSGSVDLSSYAQNLPGWTGAKLAQLVQEAALVAVRKGHQSILQSDMD  679

Query  1191  DAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQ  1012
             DAVDRLTVGPKRVGI+L HQGQCRRATTEVG A+TSHLLR YENAKVE CDRISI PRGQ
Sbjct  680   DAVDRLTVGPKRVGIELSHQGQCRRATTEVGVAMTSHLLRRYENAKVEFCDRISIVPRGQ  739

Query  1011  TLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLA  832
             TLSQ+VFHRLDDESYMFERRPQLLHRLQ+LLGGRAAEEVIYGRDTS+ASV YLADA+WLA
Sbjct  740   TLSQLVFHRLDDESYMFERRPQLLHRLQILLGGRAAEEVIYGRDTSRASVDYLADASWLA  799

Query  831   RKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSK  652
             RK++T+WNLENPM IHGEP PWRK  KFVGPRLDFEGSLYDDY LIEPPLNF+LDD++++
Sbjct  800   RKILTIWNLENPMRIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLIEPPLNFNLDDEIAQ  859

Query  651   RTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLE  472
             RTE LIRD Y +TL+LL++HHAALLKT+KVLL QKEISGEEIDFIL  YP  T  SLLLE
Sbjct  860   RTEELIRDMYERTLSLLQRHHAALLKTIKVLLDQKEISGEEIDFILDKYPSQTSISLLLE  919

Query  471   EGDPGSLPLFHQEQEEANEIEYSLLS  394
             E DPGSL LF + Q++ +EIEY+L++
Sbjct  920   EDDPGSL-LFVR-QDDCHEIEYALIN  943



>ref|XP_010541753.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic 
[Tarenaya hassleriana]
Length=952

 Score =  1168 bits (3021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/889 (74%), Positives = 755/889 (85%), Gaps = 12/889 (1%)
 Frame = -2

Query  3093  IARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlk  2914
             + RRS    C     G ++  + +N +G   DDFVTRVLKENPSQVE RY++GDKL TLK
Sbjct  45    LLRRSFTVLCELKS-GLSRSGDANNVAG---DDFVTRVLKENPSQVEPRYRIGDKLYTLK  100

Query  2913  ekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEE-----VYLKEILREHKGKL  2749
             E+EDL K + + G  E +RR  L + +   +E G+  K  E     VYLK+ILRE++GKL
Sbjct  101   EREDLSKGA-NAGVFEFVRR-KLDSKTAMEKETGESEKSSETGNGSVYLKDILREYRGKL  158

Query  2748  YVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRD  2569
             YVPEQ+F   LSEEEEFEKN+ +LPKM  EDF K +K+DKVKLLT KE +  +Y  G+RD
Sbjct  159   YVPEQVFGPELSEEEEFEKNLRDLPKMSSEDFSKAVKSDKVKLLTSKEASGLSYVSGYRD  218

Query  2568  FVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPV  2389
             FVVELKE+PG KSLQRTKW MRLD  +AQ+LL EY GP  E+EK M +WVGK+PE PHP+
Sbjct  219   FVVELKEIPGEKSLQRTKWAMRLDSREAQALLEEYAGPLNEIEKHMTSWVGKVPEFPHPI  278

Query  2388  ASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFF  2209
             AS IS+R+MVELGM+TA++ AAA + G +LASAVFAVTSF FA TVYVVWP+AKPF+K F
Sbjct  279   ASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFVFATTVYVVWPIAKPFIKLF  338

Query  2208  SGLVFDVLERVWDKIYDAF-AFGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRF  2032
               +   VLER WD + DAF + G+F+K Y  YTFGG+S+SIE+LKPIL+V LTMVLLVRF
Sbjct  339   FSIFLGVLERFWDYLADAFGSGGIFSKLYDFYTFGGLSSSIEMLKPILIVVLTMVLLVRF  398

Query  2031  TLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNP  1852
             TLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV FNDVAGI++AVEELQELV YLKNP
Sbjct  399   TLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVQFNDVAGIDEAVEELQELVRYLKNP  458

Query  1851  ELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIR  1672
             ELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIR
Sbjct  459   ELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIR  518

Query  1671  DLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFD  1492
             DLFKRAKVN+PSVIFIDEIDALAT+RQGIF +++D  YNAATQERETTLNQLL ELDGFD
Sbjct  519   DLFKRAKVNRPSVIFIDEIDALATRRQGIFKETTDHLYNAATQERETTLNQLLIELDGFD  578

Query  1491  TGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDL  1312
             TGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++VDL
Sbjct  579   TGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKIHASKVKMSDSVDL  638

Query  1311  TSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQ  1132
             +SYA NLPGW+GAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP+R+GI+L H 
Sbjct  639   SSYANNLPGWTGAKLAQLVQEAALVAVRKRHSSILQSDMDDAVDRLTVGPRRIGIELSHL  698

Query  1131  GQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERR  952
             GQCRRATTEVG A+TSHLLR YENAKVE CDRISI PRGQTLSQVVFHRLDDE+YMFERR
Sbjct  699   GQCRRATTEVGVAITSHLLRRYENAKVERCDRISIIPRGQTLSQVVFHRLDDEAYMFERR  758

Query  951   PQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPL  772
             PQLLHRLQV LGGRAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGE  
Sbjct  759   PQLLHRLQVFLGGRAAEEVIYGPDTSKASVDYLSDASWLARKILTIWNLENPMVIHGELP  818

Query  771   PWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqh  592
             PWRK  KFVGPRLDFEGSLYDDYDL+EPP+NFD+DD+++KR E L RD Y KT++LLRQH
Sbjct  819   PWRKRVKFVGPRLDFEGSLYDDYDLVEPPVNFDMDDEITKRCEELTRDMYKKTVSLLRQH  878

Query  591   haallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             H ALLKTVKVL+ QKEISGEE+D IL++YPP TP + LL+E +P SLP 
Sbjct  879   HTALLKTVKVLVNQKEISGEEMDMILNHYPPQTPLTTLLQEQNPASLPF  927



>gb|KCW77406.1| hypothetical protein EUGRSUZ_D01758 [Eucalyptus grandis]
Length=934

 Score =  1163 bits (3008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/891 (73%), Positives = 746/891 (84%), Gaps = 26/891 (3%)
 Frame = -2

Query  3024  SNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRR-LN  2848
             S S+    DDFV RVL+ENPSQVE RY +GDK  TLKE+E+L K + D GA EILRR L+
Sbjct  63    SGSTPPKGDDFVARVLQENPSQVEPRYLIGDKFYTLKERENLSKNT-DVGAFEILRRTLD  121

Query  2847  LKAFSRKSQEDGDQ-----GKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknve  2683
              +  S++  ++G        K E VYLK++LRE+KGKLYVPEQ+F  +LSEEEEF++N+E
Sbjct  122   KRGKSKRGSDEGQDKAKAAAKEESVYLKDLLREYKGKLYVPEQVFGEDLSEEEEFDRNLE  181

Query  2682  ELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMR  2503
              LPKM  EDF+K +++DKVKLLT KE  + +   GFRDF++ELKE+PG +SL RT+W M+
Sbjct  182   ALPKMSLEDFRKAMESDKVKLLTSKEVPSISTANGFRDFIIELKEIPGDRSLHRTRWAMK  241

Query  2502  LDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaa  2323
             L+  +AQ+LL EY GP YE+E+Q M+WVGKLPE PHPVAS IS+R+MVE GM+TA+M AA
Sbjct  242   LNQGEAQALLEEYNGPTYEIERQTMSWVGKLPEYPHPVASSISSRMMVEFGMITAIMAAA  301

Query  2322  aaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-F  2146
             A + G +LASAVFAVTSF F  TVY+VWP+A+PF K F GL+  + ERVWD + D F+  
Sbjct  302   AVVVGGFLASAVFAVTSFIFVTTVYIVWPIARPFFKLFLGLILSIFERVWDNVVDLFSDG  361

Query  2145  GVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQ  1966
             G+F+KFY+ YTFGG+SAS+E+LKPI  V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+
Sbjct  362   GIFSKFYEFYTFGGVSASLEMLKPISFVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSR  421

Query  1965  SKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGC  1786
             SK +ARVDG TGV F DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGC
Sbjct  422   SKAEARVDGSTGVKFGDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGC  481

Query  1785  GKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDAL  1606
             GKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDAL
Sbjct  482   GKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDAL  541

Query  1605  ATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALL  1426
             AT+RQGIF +S+D  YNA TQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALL
Sbjct  542   ATRRQGIFKESTDHLYNAGTQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALL  601

Query  1425  RPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqea  1246
             RPGRFDRKI+IRPPNAKGR  ILK+HA KVK+SETVDL+SYAQNLPGWSGA+LAQL+QEA
Sbjct  602   RPGRFDRKIKIRPPNAKGRRDILKIHASKVKMSETVDLSSYAQNLPGWSGARLAQLVQEA  661

Query  1245  alvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHY  1066
             ALVAVRKGH SILRSDMDDA DRLTVGP+RVGI+LGHQGQCRRATTEVG A+TSHLL+ Y
Sbjct  662   ALVAVRKGHGSILRSDMDDAADRLTVGPRRVGIELGHQGQCRRATTEVGVAMTSHLLKRY  721

Query  1065  ENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG  886
             ENA VE CDRISI PRG+TLSQV+FHRLDDE YMFERRPQLLHRLQVLLGGRAAEEVIYG
Sbjct  722   ENADVEYCDRISIIPRGETLSQVIFHRLDDEKYMFERRPQLLHRLQVLLGGRAAEEVIYG  781

Query  885   RDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDD  706
             RDTS+ASV                WNLENPM IHGEP PWRK  KFVGPRLDFEGSLYDD
Sbjct  782   RDTSRASVG---------------WNLENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDD  826

Query  705   YDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEI  526
             Y LIEPP+NF+LDD V++RTE LI D Y +T+ALLR+HHAALLK VKVLL Q+EISGEEI
Sbjct  827   YGLIEPPINFNLDDQVAQRTEELIHDMYERTVALLREHHAALLKAVKVLLNQEEISGEEI  886

Query  525   DFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLSS*KRKHI  373
             DFIL+ YPP TP SLLL E +PGSLP F QE  ++   EY+L+S  + K +
Sbjct  887   DFILNKYPPQTPLSLLLAEENPGSLPFFKQETSDS---EYALVSQSEEKSL  934



>ref|XP_006284963.1| hypothetical protein CARUB_v10006266mg [Capsella rubella]
 gb|EOA17861.1| hypothetical protein CARUB_v10006266mg [Capsella rubella]
Length=944

 Score =  1163 bits (3008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/895 (72%), Positives = 751/895 (84%), Gaps = 5/895 (1%)
 Frame = -2

Query  3123  RHQNLK-FPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             +H N   F      R+P      T+  + K S +S SSG   DDFVTRVLKENPSQVE R
Sbjct  28    KHANASTFAARTRWRAPILRRSFTVLCELKKSGES-SSGATADDFVTRVLKENPSQVEPR  86

Query  2946  YKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILR  2767
             Y+VGD L  LKE+EDL K +  TGA E ++R    + ++   E  D G  E VYL +ILR
Sbjct  87    YRVGDTLYNLKEREDLSKGANATGAFEFIKR-KFDSKTKTETEKSDIGN-ESVYLSDILR  144

Query  2766  EHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANY  2587
             E+KGKLYVPEQ+F   LSEEEEFEK V +LPKM  E+F+K +K DKVKLLT KE +   Y
Sbjct  145   EYKGKLYVPEQVFGPELSEEEEFEKTVSDLPKMSLENFRKAMKNDKVKLLTSKEVSGGPY  204

Query  2586  GFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLP  2407
               G+RDF+V+LKE+PG KSLQRTKW+M+L+L +AQ+LL EYTGP+Y++E+ M +WVGK+ 
Sbjct  205   MSGYRDFIVDLKEIPGVKSLQRTKWSMKLELEEAQALLKEYTGPQYQIERHMTSWVGKVA  264

Query  2406  EQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAK  2227
             + P+PVAS IS+R+MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVWP+AK
Sbjct  265   DFPNPVASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVWPIAK  324

Query  2226  PFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTM  2050
             PF+K F G+   VLE+ WD + D  A  G+F++    YTFGG+S+S+E+LKPILLV +TM
Sbjct  325   PFLKLFVGIFLGVLEKTWDYLVDVLADGGIFSRISDFYTFGGVSSSLEMLKPILLVVMTM  384

Query  2049  VLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELV  1870
             VLLVRFTLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV
Sbjct  385   VLLVRFTLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDELQELV  444

Query  1869  TYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGV  1690
              YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGV
Sbjct  445   KYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGV  504

Query  1689  GAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLT  1510
             G+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL 
Sbjct  505   GSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLNQLLI  564

Query  1509  ELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKL  1330
             ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA KVK+
Sbjct  565   ELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHASKVKM  624

Query  1329  SETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVG  1150
             S++VDL+SYA NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP R+G
Sbjct  625   SDSVDLSSYASNLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPTRIG  684

Query  1149  IDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDES  970
             ++LGHQGQCRRATTEVG A+TSHLL  YENAK+E CDR+SI PRGQTLSQVVFHRLDDES
Sbjct  685   LELGHQGQCRRATTEVGVAITSHLLLRYENAKIERCDRVSIIPRGQTLSQVVFHRLDDES  744

Query  969   YMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMT  790
             YMF R PQLLHRLQVLL GRAAE+VIYG DTSKASV YL+DA+WLARK++T+WNLENPM 
Sbjct  745   YMFGRLPQLLHRLQVLLAGRAAEQVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMV  804

Query  789   IHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTl  610
             IHGEP PWRK  +FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V++R+E LI   Y KT+
Sbjct  805   IHGEPPPWRKRAQFVGPRLDFEGSLYDDYDLVEPPINFNMDDEVAQRSEELISQMYDKTV  864

Query  609   allrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
              LL Q+  ALLKTVKVLL +KEISGE IDFIL  YPP TP +LLL+E +PGSLP 
Sbjct  865   TLLTQNQTALLKTVKVLLNEKEISGEAIDFILDQYPPQTPLNLLLQEQNPGSLPF  919



>ref|XP_006413491.1| hypothetical protein EUTSA_v10024337mg [Eutrema salsugineum]
 gb|ESQ54944.1| hypothetical protein EUTSA_v10024337mg [Eutrema salsugineum]
Length=943

 Score =  1162 bits (3006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/884 (73%), Positives = 754/884 (85%), Gaps = 7/884 (1%)
 Frame = -2

Query  3093  IARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlk  2914
             I RRS    C     G ++  E++N +G   +DFVTRVLKENPSQVE RY+VGDKL  LK
Sbjct  41    ILRRSFTVLCELKP-GSSRSGEENNPAG---EDFVTRVLKENPSQVEPRYRVGDKLYNLK  96

Query  2913  ekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQ  2734
             E+EDL + + +TG  E ++R  L + ++   E  + G  E VYL +ILRE+KGKLYVPEQ
Sbjct  97    EREDLTRAANETGPFEFIKR-KLGSKTKMETEKSEIGN-ESVYLSDILREYKGKLYVPEQ  154

Query  2733  IFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVEL  2554
             +F   LSEEE+FEKNV+ELPKM  EDF+K +K DKVKLLT  E +   Y  G+RDF+V+L
Sbjct  155   VFGPELSEEEDFEKNVKELPKMSLEDFRKAMKNDKVKLLTSNEASGVPYTTGYRDFIVDL  214

Query  2553  KEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKIS  2374
             KE+PG KSLQRTKW+M+L++ +AQ+LL +YTGP+YE+E+ M +WVGK+ + P+PVAS IS
Sbjct  215   KEIPGVKSLQRTKWSMKLEVGEAQALLKDYTGPQYEIERHMTSWVGKVADFPNPVASSIS  274

Query  2373  TRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVF  2194
             +R+MVELGM+TA++ AAAA+ G +LASAVFAVTSFAF  TVYVVWP+ KPF+K F G+V 
Sbjct  275   SRVMVELGMVTAVIAAAAAVVGGFLASAVFAVTSFAFVTTVYVVWPIVKPFLKLFVGIVV  334

Query  2193  DVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRR  2017
               +ER WD + D  A  G+F++    YTFGG+S+S+E+LKPILLV +TMVLLVRFTLSRR
Sbjct  335   GTIERSWDYLVDVLADGGIFSRLSDFYTFGGLSSSLEMLKPILLVVMTMVLLVRFTLSRR  394

Query  2016  PKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDK  1837
             PKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV YLKNP+LFDK
Sbjct  395   PKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFGDVAGIDEAVDELQELVKYLKNPDLFDK  454

Query  1836  MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKR  1657
             MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKR
Sbjct  455   MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKR  514

Query  1656  AKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGV  1477
             AKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGV
Sbjct  515   AKVNKPSVIFIDEIDALATRRQGIFKENSDQSYNAATQERETTLNQLLIELDGFDTGKGV  574

Query  1476  IFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQ  1297
             IFLGATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++VDL+SYA 
Sbjct  575   IFLGATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKIHASKVKMSDSVDLSSYAS  634

Query  1296  NLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR  1117
             NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP R+G++LGHQGQCRR
Sbjct  635   NLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPTRIGLELGHQGQCRR  694

Query  1116  ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLH  937
             ATTEVG A+TSHLL  YENAK+E CDRISI PRGQTLSQVVFHRLDDESYMF RRPQLLH
Sbjct  695   ATTEVGVAITSHLLMRYENAKIERCDRISIIPRGQTLSQVVFHRLDDESYMFGRRPQLLH  754

Query  936   RLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKS  757
             RLQVLLGGRAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGEP PWRK 
Sbjct  755   RLQVLLGGRAAEEVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMVIHGEPPPWRKR  814

Query  756   PKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaall  577
              +FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V++R+E L+   Y KT++LL Q+  ALL
Sbjct  815   AQFVGPRLDFEGSLYDDYDLVEPPVNFNMDDEVAQRSEELVSQMYNKTVSLLTQNQTALL  874

Query  576   ktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             KTVKVLL QKEISGE ID+IL +YPP TP + LL+E +PGSLP 
Sbjct  875   KTVKVLLNQKEISGEAIDYILDHYPPQTPLNSLLQEQNPGSLPF  918



>ref|NP_567691.1| FtsH extracellular protease [Arabidopsis thaliana]
 gb|AAB63626.1| cell division protein isolog [Arabidopsis thaliana]
 emb|CAB43894.1| cell division protein-like [Arabidopsis thaliana]
 emb|CAB81312.1| cell division protein-like [Arabidopsis thaliana]
 gb|AEE84830.1| FtsH extracellular protease [Arabidopsis thaliana]
Length=946

 Score =  1160 bits (3000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/885 (73%), Positives = 752/885 (85%), Gaps = 10/885 (1%)
 Frame = -2

Query  3093  IARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlk  2914
             I RRS    C     G +   E +NS     DDFVTRVLKENPSQVE RY+VGDKL  LK
Sbjct  45    ILRRSFTVLCELKT-GSSSSGETNNSPAA--DDFVTRVLKENPSQVEPRYRVGDKLYNLK  101

Query  2913  ekedlqk-KSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPE  2737
             E+EDL K  +  TGA E ++R     F  K + + D+ + E VYL +ILRE+KGKLYVPE
Sbjct  102   EREDLSKGTNAATGAFEFIKR----KFDSKKKTETDKSE-ESVYLSDILREYKGKLYVPE  156

Query  2736  QIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVE  2557
             Q+F   LSEEEEFEKNV++LPKM  EDF+K ++ DKVKLLT KE +  +Y  G+R F+V+
Sbjct  157   QVFGPELSEEEEFEKNVKDLPKMSLEDFRKAMENDKVKLLTSKEVSGVSYTSGYRGFIVD  216

Query  2556  LKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKI  2377
             LKE+PG KSLQRTKW+M+L++ +AQ+LL EYTGP+YE+E+ M +WVGK+ + P+PVAS I
Sbjct  217   LKEIPGVKSLQRTKWSMKLEVGEAQALLKEYTGPQYEIERHMTSWVGKVADFPNPVASSI  276

Query  2376  STRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLV  2197
             S+R+MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVWP+AKPF+K F G+ 
Sbjct  277   SSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVWPIAKPFLKLFVGVF  336

Query  2196  FDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSR  2020
               VLE+ WD I D  A  G+F++    YTFGG+++S+E+LKPILLV +TMVLLVRFTLSR
Sbjct  337   LGVLEKSWDYIVDVLADGGIFSRISDFYTFGGVASSLEMLKPILLVVMTMVLLVRFTLSR  396

Query  2019  RPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFD  1840
             RPKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV YLKNP+LFD
Sbjct  397   RPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDELQELVKYLKNPDLFD  456

Query  1839  KMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFK  1660
             KMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFK
Sbjct  457   KMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFK  516

Query  1659  RAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKG  1480
             RAKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKG
Sbjct  517   RAKVNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLNQLLIELDGFDTGKG  576

Query  1479  VIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYA  1300
             VIFLGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA KVK+S++VDL+SYA
Sbjct  577   VIFLGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHASKVKMSDSVDLSSYA  636

Query  1299  QNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCR  1120
              NLPGWSGAKLAQL+QEAALVAVRK HNSIL+SDMDDAVDRLTVGP R+G++LGHQGQCR
Sbjct  637   SNLPGWSGAKLAQLVQEAALVAVRKTHNSILQSDMDDAVDRLTVGPTRIGLELGHQGQCR  696

Query  1119  RATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLL  940
             RATTEVG A+TSHLL  YENAK+E CDR+SI PRGQTLSQVVFHRLDDESYMF R PQLL
Sbjct  697   RATTEVGVAITSHLLLRYENAKIERCDRVSIIPRGQTLSQVVFHRLDDESYMFGRLPQLL  756

Query  939   HRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRK  760
             HRLQVLLGGRAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGEP PWRK
Sbjct  757   HRLQVLLGGRAAEEVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMVIHGEPPPWRK  816

Query  759   SPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaal  580
              P+FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V+ R+E LI   Y KT++LLRQ+  AL
Sbjct  817   RPQFVGPRLDFEGSLYDDYDLVEPPVNFNMDDEVAHRSEELISQMYNKTVSLLRQNQTAL  876

Query  579   lktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             LKTVKVLL QKEISGE IDFIL +YPP TP + LL+E +PGSLP 
Sbjct  877   LKTVKVLLNQKEISGEAIDFILDHYPPQTPLNSLLQEQNPGSLPF  921



>gb|KDP25274.1| hypothetical protein JCGZ_20430 [Jatropha curcas]
Length=932

 Score =  1158 bits (2996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/911 (72%), Positives = 770/911 (85%), Gaps = 6/911 (1%)
 Frame = -2

Query  3120  HQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYK  2941
              ++LK  R I  ++   +   T+  +         S    DDFVTR+LKENPSQ+E  Y 
Sbjct  19    QKSLKCTRKIRSKTLFLHQSFTVLCELNSGSAPRPSDTKKDDFVTRILKENPSQIEPTYL  78

Query  2940  VGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEILRE  2764
             VGDK  +LKE+++L K S +    E L +RLN+KA S+K + +  Q + E VYLK+ILRE
Sbjct  79    VGDKFYSLKERQNLSK-SQNMDFFEFLAKRLNIKAKSKKERNES-QKEDETVYLKDILRE  136

Query  2763  HKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYG  2584
             +KGKLYVPEQ+F ++LSEEEEF++N+EELPKM F +F+K +K+DKVKLLT KE   +  G
Sbjct  137   YKGKLYVPEQVFGADLSEEEEFDRNLEELPKMSFAEFRKSMKSDKVKLLTSKEVAGSTLG  196

Query  2583  FGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPE  2404
              G RDF+V+LKE+PG KSL RTKW MRL+ N+AQ LL EY GPRYE+EK M + VG LP+
Sbjct  197   NGHRDFIVDLKEIPGEKSLHRTKWAMRLNENEAQLLLEEYKGPRYEIEKHMKSLVGILPD  256

Query  2403  QPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKP  2224
              PHP+AS IS+R++VELGML+A++ AAA + G +LASAVFAVTSF F +TVYV WP+AKP
Sbjct  257   YPHPIASSISSRMVVELGMLSAVIAAAAIVVGGFLASAVFAVTSFIFVMTVYVAWPIAKP  316

Query  2223  FMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMV  2047
             F K F G++  + E + D + D F+  GVF+K Y+ YTFGG+SASIE+LKPI+LV LTMV
Sbjct  317   FFKLFLGIISGIFEGIADCLVDIFSDGGVFSKLYKFYTFGGVSASIEMLKPIMLVLLTMV  376

Query  2046  LLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVT  1867
             LLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F DVAGI++AVEELQELV 
Sbjct  377   LLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFKDVAGIDEAVEELQELVR  436

Query  1866  YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG  1687
             YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG
Sbjct  437   YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG  496

Query  1686  AARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTE  1507
             +ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETTLNQLL E
Sbjct  497   SARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETTLNQLLIE  556

Query  1506  LDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLS  1327
             LDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S
Sbjct  557   LDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLEILKIHASKVKMS  616

Query  1326  ETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGI  1147
             E+VDL++YA+NLPGW+GAKLAQL+QEAALVAVR+GH SI++SDMDDAVDRLTVGPKRVGI
Sbjct  617   ESVDLSTYAKNLPGWTGAKLAQLVQEAALVAVRQGHGSIIQSDMDDAVDRLTVGPKRVGI  676

Query  1146  DLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESY  967
             +L +QGQCRRA TEVG A+ SHLLR YENA+VECCDRISI PRGQTLSQVVFHRLDDESY
Sbjct  677   ELDYQGQCRRAITEVGIAMVSHLLRRYENAEVECCDRISIIPRGQTLSQVVFHRLDDESY  736

Query  966   MFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTI  787
             MFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV YLADA+WLARK+IT+WNLENPM I
Sbjct  737   MFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVGYLADASWLARKIITIWNLENPMVI  796

Query  786   HGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTla  607
             HGEP PWRK  +FVGPRLDFEGSLYDDY LIEPP+NF+LDD V++RTE LI+D Y KT++
Sbjct  797   HGEPPPWRKKERFVGPRLDFEGSLYDDYGLIEPPVNFNLDDQVAQRTEELIQDMYEKTVS  856

Query  606   llrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQE  427
             LLRQHHAALLK  KVLL +KE+SGEEID+IL +YPP T  SLLL+E +PGSLP   +E E
Sbjct  857   LLRQHHAALLKAAKVLLNKKEVSGEEIDYILDSYPPQTHISLLLQEENPGSLPFSRKELE  916

Query  426   EANEIEYSLLS  394
               +E++Y+LLS
Sbjct  917   --DELDYALLS  925



>gb|KHN16731.1| ATP-dependent zinc metalloprotease FTSH 2, chloroplastic [Glycine 
soja]
Length=926

 Score =  1154 bits (2986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/901 (72%), Positives = 755/901 (84%), Gaps = 23/901 (3%)
 Frame = -2

Query  3093  IARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlk  2914
             + RRSP   C        K S  +N  G   DDFV+RVLKENPSQV+ +Y +GDKL TLK
Sbjct  37    LLRRSPTVLC--------KSSSATNEPGS--DDFVSRVLKENPSQVQPKYLIGDKLYTLK  86

Query  2913  ekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGD-QGKPEEVYLKEILREHKGKLYVPE  2737
             EKE+L+K S + G L++L+RL       KS+   +  G+ + VYLK++L+E++GKLYVPE
Sbjct  87    EKENLRKLS-NAGILDVLKRLKSTKPQSKSENVSEASGERDSVYLKDLLKEYRGKLYVPE  145

Query  2736  QIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVE  2557
             Q+F + LSEEEEF +NV ELPKM  E+F+K L  DK+KL+T K       G  +RDFVVE
Sbjct  146   QLFGTELSEEEEFNRNVNELPKMSIEEFRKALSKDKIKLITSK-----GGGGLYRDFVVE  200

Query  2556  LKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEK-QMMTWVGKLPEQPHPVASK  2380
             LKE+PG KSL  TKW +RL   +AQ+++ +YTGPRYE+E+   M+WVGK PE PHPVA+ 
Sbjct  201   LKEIPGDKSLHTTKWVLRLGNGEAQAIMADYTGPRYEIERSHTMSWVGKTPEYPHPVATS  260

Query  2379  ISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGL  2200
             IS+R++VEL ++T  +  AA IAG +LASA FA TS    + VYVVWP+AKPF+K F GL
Sbjct  261   ISSRVVVELAVVTGCVAVAAVIAGGFLASAFFAATSLVAVMAVYVVWPIAKPFLKLFLGL  320

Query  2199  VFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLS  2023
                +LE++WD I D F+  G+ +K  ++YTFGG SAS+E LKPI++V LTMVLLVRFTLS
Sbjct  321   TLAILEKIWDNIVDFFSDGGILSKISEIYTFGGFSASLEALKPIMIVVLTMVLLVRFTLS  380

Query  2022  RRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELF  1843
             RRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F DVAGI++AVEELQELV YLKNPELF
Sbjct  381   RRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFCDVAGIDEAVEELQELVRYLKNPELF  440

Query  1842  DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLF  1663
             DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLF
Sbjct  441   DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLF  500

Query  1662  KRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGK  1483
             KRAKVNKPSV+FIDEIDALAT+RQGIF +++D  YNAATQERETTLNQLL ELDGFDTGK
Sbjct  501   KRAKVNKPSVVFIDEIDALATRRQGIFKENTDHLYNAATQERETTLNQLLIELDGFDTGK  560

Query  1482  GVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSY  1303
             GVIFL ATNR DLLDPALLRPGRFDRKIRIRPP+AKGR  ILK+H+ KVK+SE+VDL+SY
Sbjct  561   GVIFLAATNRKDLLDPALLRPGRFDRKIRIRPPSAKGRHDILKIHSSKVKMSESVDLSSY  620

Query  1302  AQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQC  1123
             AQNLPGWSGA+LAQL+QEAALVAVRK HNSIL+SDMDDAVDRLTVGPKRVGI+LG+QGQC
Sbjct  621   AQNLPGWSGARLAQLVQEAALVAVRKQHNSILQSDMDDAVDRLTVGPKRVGIELGYQGQC  680

Query  1122  RRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQL  943
             RRATTE+G ALTSHLLR YE+AKVECCDRISI PRGQTLSQ+VFHRLDDESYMFERRPQL
Sbjct  681   RRATTELGLALTSHLLRRYEHAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQL  740

Query  942   LHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWR  763
             LHRLQVLLGGRAAEEVIYGRDTSKASV YLADA+WLARK++T+WNLENPM IHGEP PWR
Sbjct  741   LHRLQVLLGGRAAEEVIYGRDTSKASVDYLADASWLARKILTIWNLENPMVIHGEPPPWR  800

Query  762   KSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaa  583
             KS KFVGPRLDFEGSLYDDY+LIEPPLNF +DD V++RTE LIRD Y KT++LLR+HHAA
Sbjct  801   KSVKFVGPRLDFEGSLYDDYNLIEPPLNFKMDDQVAQRTEELIRDMYRKTVSLLRRHHAA  860

Query  582   llktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYS  403
             LLKT+KVLL QKEISGEEI+FIL+ YPP TP   LLEE   G+LP     +E+ +++EY+
Sbjct  861   LLKTIKVLLDQKEISGEEIEFILNKYPPQTPI-YLLEEEYAGNLPF---TREQVHDLEYA  916

Query  402   L  400
             L
Sbjct  917   L  917



>ref|XP_010448634.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010448635.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=950

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/909 (71%), Positives = 754/909 (83%), Gaps = 8/909 (1%)
 Frame = -2

Query  3123  RHQNLK-FPRNIARRSPPCYCPRTIFGQAKYSEQSNSS-GGNDDDFVTRVLKENPSQVET  2950
             +H N   F      R P      T+  + K S ++N       DDFVTRVLKENPSQVE 
Sbjct  29    KHANASNFSAKTRWRGPILRRSFTVLCELKKSGETNKPPEAAVDDFVTRVLKENPSQVEP  88

Query  2949  RYKVGdklltlkekedlqk--KSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKE  2776
             RY+VGDKL  LKE+EDL K   +  +GA E +RR  L + ++    +  +   E VYL +
Sbjct  89    RYRVGDKLYNLKEREDLSKGGANASSGAFEFIRR-KLDSKTKVETTEKSESGNESVYLSD  147

Query  2775  ILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNA  2596
             ILRE++GKLYVPEQ+F   LSEE+EFE+ V++LPKM  EDF+  +K DKVKLLT KE + 
Sbjct  148   ILREYRGKLYVPEQVFGPELSEEDEFERTVKDLPKMSLEDFRNVMKNDKVKLLTSKEVSG  207

Query  2595  ANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVG  2416
             + Y  G+RDFVV+LKE+PG KSLQRTKW+M+L+L +AQ+LL EYTGP+YE+E+ M +WVG
Sbjct  208   SPYTSGYRDFVVDLKEIPGVKSLQRTKWSMKLELGEAQALLKEYTGPQYEIERHMTSWVG  267

Query  2415  KLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWP  2236
             K+ + P+PVAS IS+R+MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVWP
Sbjct  268   KVADYPNPVASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVWP  327

Query  2235  VAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVF  2059
             +AKPF+K F G+   VLE+VWD   D  A  G+F++    YTFGG+S+S+E+LKPILLV 
Sbjct  328   IAKPFLKLFVGIFLGVLEKVWDYFVDVLADGGIFSRITDFYTFGGVSSSLEMLKPILLVV  387

Query  2058  LTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQ  1879
             +TMVLLVRFTLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQ
Sbjct  388   MTMVLLVRFTLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDELQ  447

Query  1878  ELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL  1699
             ELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL
Sbjct  448   ELVKYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL  507

Query  1698  VGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQ  1519
             VGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQ
Sbjct  508   VGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLNQ  567

Query  1518  LLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARK  1339
             LL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA K
Sbjct  568   LLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHASK  627

Query  1338  VKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPK  1159
             VK+S++VDL+SYA NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP 
Sbjct  628   VKMSDSVDLSSYASNLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPT  687

Query  1158  RVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLD  979
             R+G++LGHQGQCRRATTEVG A+TSHLL  YENAK+E CDRISI PRGQTLSQVVFHRLD
Sbjct  688   RIGLELGHQGQCRRATTEVGVAITSHLLLRYENAKIERCDRISIIPRGQTLSQVVFHRLD  747

Query  978   DESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLEN  799
             DESYMF R PQLLHRLQVLL GRAAE+VIYG DTSKASV YL+DA+WLARK++T+WNLEN
Sbjct  748   DESYMFGRLPQLLHRLQVLLAGRAAEQVIYGSDTSKASVVYLSDASWLARKILTIWNLEN  807

Query  798   PMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYA  619
             PM IHGEP PWRK  +FVGPRLDFEGSLY+D DL+EPP+NF++DD+V++R+E LI   Y 
Sbjct  808   PMVIHGEPPPWRKRAQFVGPRLDFEGSLYEDDDLVEPPINFNMDDEVAQRSEELISQMYD  867

Query  618   KTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLF-  442
             KT+ALL Q+  ALLKTVKVLL QKEISGE IDFIL  YPP TP +LLL+E +PGSLP   
Sbjct  868   KTVALLTQNQTALLKTVKVLLNQKEISGEAIDFILDQYPPETPLNLLLQEQNPGSLPFVP  927

Query  441   -HQEQEEAN  418
              H  QE  +
Sbjct  928   EHLRQESGD  936



>ref|XP_010448636.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=950

 Score =  1152 bits (2981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/909 (71%), Positives = 754/909 (83%), Gaps = 8/909 (1%)
 Frame = -2

Query  3123  RHQNLK-FPRNIARRSPPCYCPRTIFGQAKYSEQSNSS-GGNDDDFVTRVLKENPSQVET  2950
             +H N   F      R P      T+  + K S ++N       DDFVTRVLKENPSQVE 
Sbjct  29    KHANASNFSAKTRWRGPILRRSFTVLCELKKSGETNKPPEAAVDDFVTRVLKENPSQVEP  88

Query  2949  RYKVGdklltlkekedlqk--KSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKE  2776
             RY+VGDKL  LKE+EDL K   +  +GA E +RR  L + ++    +  +   E VYL +
Sbjct  89    RYRVGDKLYNLKEREDLSKGGANASSGAFEFIRR-KLDSKTKVETTEKSESGNESVYLSD  147

Query  2775  ILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNA  2596
             ILRE++GKLYVPEQ+F   LSEE+EFE+ V++LPKM  EDF+  +K DKVKLLT KE + 
Sbjct  148   ILREYRGKLYVPEQVFGPELSEEDEFERTVKDLPKMSLEDFRNVMKNDKVKLLTSKEVSG  207

Query  2595  ANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVG  2416
             + Y  G+RDFVV+LKE+PG KSLQRTKW+M+L+L +AQ+LL EYTGP+YE+E+ M +WVG
Sbjct  208   SPYTSGYRDFVVDLKEIPGVKSLQRTKWSMKLELGEAQALLKEYTGPQYEIERHMTSWVG  267

Query  2415  KLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWP  2236
             K+ + P+PVAS IS+R+MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVWP
Sbjct  268   KVADYPNPVASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVWP  327

Query  2235  VAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVF  2059
             +AKPF+K F G+   VLE+VWD   D  A  G+F++    YTFGG+S+S+E+LKPILLV 
Sbjct  328   IAKPFLKLFVGIFLGVLEKVWDYFVDVLADGGIFSRITDFYTFGGVSSSLEMLKPILLVV  387

Query  2058  LTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQ  1879
             +TMVLLVRFTLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQ
Sbjct  388   MTMVLLVRFTLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDELQ  447

Query  1878  ELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL  1699
             ELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL
Sbjct  448   ELVKYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL  507

Query  1698  VGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQ  1519
             VGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQ
Sbjct  508   VGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLNQ  567

Query  1518  LLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARK  1339
             LL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA K
Sbjct  568   LLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHASK  627

Query  1338  VKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPK  1159
             VK+S++VDL+SYA NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP 
Sbjct  628   VKMSDSVDLSSYASNLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPT  687

Query  1158  RVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLD  979
             R+G++LGHQGQCRRATTEVG A+TSHLL  YENAK+E CDR+SI PRGQTLSQVVFHRLD
Sbjct  688   RIGLELGHQGQCRRATTEVGVAITSHLLLRYENAKIERCDRVSIIPRGQTLSQVVFHRLD  747

Query  978   DESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLEN  799
             DESYMF R PQLLHRLQVLL GRAAE+VIYG DTSKASV YL+DA+WLARK++T+WNLEN
Sbjct  748   DESYMFGRLPQLLHRLQVLLAGRAAEQVIYGSDTSKASVVYLSDASWLARKILTIWNLEN  807

Query  798   PMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYA  619
             PM IHGEP PWRK  +FVGPRLDFEGSLY+D DL+EPP+NF++DD+V++R+E LI   Y 
Sbjct  808   PMVIHGEPPPWRKRAQFVGPRLDFEGSLYEDDDLVEPPINFNMDDEVAQRSEELISQMYD  867

Query  618   KTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLF-  442
             KT+ALL Q+  ALLKTVKVLL QKEISGE IDFIL  YPP TP +LLL+E +PGSLP   
Sbjct  868   KTVALLTQNQTALLKTVKVLLNQKEISGEAIDFILDQYPPETPLNLLLQEQNPGSLPFVP  927

Query  441   -HQEQEEAN  418
              H  QE  +
Sbjct  928   EHLRQESGD  936



>ref|XP_009358628.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial 
[Pyrus x bretschneideri]
Length=948

 Score =  1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/890 (74%), Positives = 753/890 (85%), Gaps = 13/890 (1%)
 Frame = -2

Query  3033  SEQSNSSGGND----DDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALE  2866
             S  S+ SG N     DDFV RVLKENPSQ+E RY VGDK  TLKEKE L K S + G +E
Sbjct  55    SGPSSRSGDNSKTPQDDFVARVLKENPSQIEPRYLVGDKFYTLKEKERLGKNS-NVGFVE  113

Query  2865  IL-RRLNLKAFSRKSQEDGDQG--KPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefe  2695
             +L +RLN      +  E    G  K + VYLK+ILRE+KGKLYVPEQIF + L EEE+FE
Sbjct  114   LLAKRLNFSKLKNERIEGQSDGGVKDDAVYLKDILREYKGKLYVPEQIFGTELPEEEQFE  173

Query  2694  knveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTK  2515
             K++EELP+M +EDF K +K++KVKLLT KE   A   +G  D++V+LKE+PG KSL RTK
Sbjct  174   KSLEELPRMSYEDFLKAVKSEKVKLLTSKE--VAGTSYGVSDYIVDLKEIPGQKSLHRTK  231

Query  2514  WTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltal  2335
             W MRLD  +AQ+LL +Y GPRY +E    +WVGK+P+ PHPVAS IS+R+MVELGM+TA+
Sbjct  232   WAMRLDEGEAQALLEDYMGPRYVIEGHTTSWVGKVPQYPHPVASSISSRMMVELGMVTAV  291

Query  2334  mtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDA  2155
             M AAA   G +LASAVFAVTSF FA TVYVVWP+ KPF + F GLV  +LERVWD + D 
Sbjct  292   MAAAAVFIGGFLASAVFAVTSFVFASTVYVVWPIVKPFTRLFLGLVLGILERVWDNLVDF  351

Query  2154  FA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGI  1978
             F+  G+F+KF + YTFGG+SASIE+LKPI +V +TMV+LVRFTLSRRPKNFRKWD+WQGI
Sbjct  352   FSDGGIFSKFSEFYTFGGLSASIEMLKPITIVLMTMVILVRFTLSRRPKNFRKWDLWQGI  411

Query  1977  EFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEG  1798
             +FS+SK +ARVDG TGV F+DVAGI++AVEEL ELV YLKNPELFDKMGIKPPHGVLLEG
Sbjct  412   DFSRSKAEARVDGSTGVKFSDVAGIDEAVEELLELVRYLKNPELFDKMGIKPPHGVLLEG  471

Query  1797  PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDE  1618
             PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDE
Sbjct  472   PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDE  531

Query  1617  IDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLD  1438
             IDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLD
Sbjct  532   IDALATRRQGIFKETSDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLD  591

Query  1437  PALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaql  1258
             PALLRPGRFDRKI+IRPP AKGRL ILK+HA KVK+S +VDL+SYAQNLPGW+GAKLAQL
Sbjct  592   PALLRPGRFDRKIKIRPPAAKGRLDILKIHASKVKMSPSVDLSSYAQNLPGWTGAKLAQL  651

Query  1257  lqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHL  1078
             +QEAALVAVRKGH+SI ++D+DDAVDRLTVGPKR+GI+LGH GQCRRATTEVG A+TSHL
Sbjct  652   VQEAALVAVRKGHDSIFQTDLDDAVDRLTVGPKRIGIELGHLGQCRRATTEVGVAMTSHL  711

Query  1077  LRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEE  898
             LR YENA+VE CDRISI PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEE
Sbjct  712   LRQYENAEVERCDRISIIPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEE  771

Query  897   VIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGS  718
             VIYGRDTS+ASV YLADA+WLARK++T+WNLENPM IHGEP PWRK  +FVGPRLDFEGS
Sbjct  772   VIYGRDTSRASVDYLADASWLARKILTIWNLENPMVIHGEPPPWRKKLEFVGPRLDFEGS  831

Query  717   LYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEIS  538
             LY DYDLIEPP+NF+LDDDV+KR E LI   Y KTL+LL++HH ALLKTVKVLL++KEIS
Sbjct  832   LYHDYDLIEPPVNFNLDDDVAKRAEELIHKMYDKTLSLLKKHHTALLKTVKVLLERKEIS  891

Query  537   GEEIDFILSNYPPHTPASLLLEEGDPGSLPLF--HQEQEEANEIEYSLLS  394
             GEEIDFIL+ YPP TP  LLL E +PGSL      QEQE+  + EY+LLS
Sbjct  892   GEEIDFILNKYPPQTPLKLLLGEENPGSLKFVTQEQEQEQERKSEYALLS  941



>ref|XP_010676266.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Beta vulgaris 
subsp. vulgaris]
Length=948

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/905 (72%), Positives = 757/905 (84%), Gaps = 16/905 (2%)
 Frame = -2

Query  3096  NIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltl  2917
             N  RR P  YC  T           N+   + +DFVTRVLKENPSQVE R+++GDK+ T 
Sbjct  49    NFTRRKPTLYCKST----------ENAPNSDTEDFVTRVLKENPSQVEPRFQIGDKVYTS  98

Query  2916  kekedlqkKSFDTGALEILRRLNLK---AFSRKSQEDGDQGKPEEVYLKEILREHKGKLY  2746
              E+E+L+K  +  GALE+L+RL LK     +  S+E+G +     VYL +ILRE++GKLY
Sbjct  99    TERENLKKNKYRFGALEVLKRLKLKDKVRINEASEENGGRNLEGNVYLNDILREYRGKLY  158

Query  2745  VPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDF  2566
             VPEQ+F  NLSEEE F++N+E LPKM +E+F K++  DKVKLL+FKE +    G   RDF
Sbjct  159   VPEQMFGVNLSEEEVFDRNIEALPKMSYEEFVKFMVKDKVKLLSFKEQSGIVSGDEMRDF  218

Query  2565  VVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVA  2386
             +VELK+ PG KSL + +W M+L  +QA+ LL EYTGP+YE+E + MT +   PE P+PVA
Sbjct  219   IVELKDTPGEKSLHQIQWAMQLGADQAKELLAEYTGPQYEIETRAMTSIVNSPEYPNPVA  278

Query  2385  SKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFS  2206
             S IS+R+MVE GM+T +M AAA I GS+LASAVFAVTSF F  TVY+VWPV KPF+KFF 
Sbjct  279   SSISSRIMVEFGMVTVVMAAAAVIVGSFLASAVFAVTSFVFVATVYIVWPVVKPFLKFFF  338

Query  2205  GLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFT  2029
             G++  + E V DK  D F   GV +K  + Y FGG+SAS+++L+PI+LV L MVLLVRFT
Sbjct  339   GIISGIAESVGDKWADIFIDGGVVSKLQEFYIFGGVSASLQILRPIMLVLLIMVLLVRFT  398

Query  2028  LSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPE  1849
             LSRRPKNF+KWDIWQGI+FSQSKPQARVDG TGVTF DVAGIE+AVEELQELV YLKNP+
Sbjct  399   LSRRPKNFKKWDIWQGIDFSQSKPQARVDGSTGVTFADVAGIEEAVEELQELVNYLKNPD  458

Query  1848  LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRD  1669
             LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRD
Sbjct  459   LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRD  518

Query  1668  LFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDT  1489
             LFKRAKVNKPSVIFIDEIDALAT+RQGIF++SSD+ YNA+TQERETTLNQLL ELDGFDT
Sbjct  519   LFKRAKVNKPSVIFIDEIDALATRRQGIFSNSSDNLYNASTQERETTLNQLLIELDGFDT  578

Query  1488  GKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLT  1309
             GKGVIFLGATNRMDLLDPALLRPGRFDRKIR++PP+AKGRL +LKVHARKVKLS +VDL+
Sbjct  579   GKGVIFLGATNRMDLLDPALLRPGRFDRKIRVQPPSAKGRLEVLKVHARKVKLSPSVDLS  638

Query  1308  SYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQG  1129
             +YA +LPGWSGA+LAQLLQE+ALVA RKGH  I +SD+DDAV RLT+GPKRVGI+LGHQG
Sbjct  639   TYANDLPGWSGARLAQLLQESALVAARKGHEEIEQSDIDDAVGRLTIGPKRVGIELGHQG  698

Query  1128  QCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRP  949
             QCRRATTEVGTA+TSHLLR  ENAKVE CDR+SINPRG+TLSQVVFHRLDDE Y+FERRP
Sbjct  699   QCRRATTEVGTAMTSHLLRRLENAKVEPCDRVSINPRGETLSQVVFHRLDDELYIFERRP  758

Query  948   QLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLP  769
             QLL+RLQ+LLGGRAAEEVIYGRDTS+ASV+YLADATWLARK+IT+WNLE PMTIHGEP P
Sbjct  759   QLLYRLQILLGGRAAEEVIYGRDTSRASVNYLADATWLARKIITIWNLEKPMTIHGEPPP  818

Query  768   WRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhh  589
             WRK+ KFVGPRLDFEGSLYDDYDLIEPP+NF+LDD V KRTE L+++ Y KTL LLR+HH
Sbjct  819   WRKTAKFVGPRLDFEGSLYDDYDLIEPPINFNLDDQVVKRTEELVQEMYKKTLTLLRRHH  878

Query  588   aallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIE  409
             AALLKTVKVLL QKEISG EIDFIL  YP  TP +LLLEE +PGSLP F +EQ    E+E
Sbjct  879   AALLKTVKVLLNQKEISGAEIDFILDKYPAETPVNLLLEEENPGSLPFFREEQ--GYELE  936

Query  408   YSLLS  394
             Y L +
Sbjct  937   YELTT  941



>ref|XP_003532440.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic-like 
[Glycine max]
Length=926

 Score =  1150 bits (2975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/901 (72%), Positives = 754/901 (84%), Gaps = 23/901 (3%)
 Frame = -2

Query  3093  IARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlk  2914
             + RRSP   C        K S  +N  G   DDFV+RVLKENPSQV+ +Y +GDKL TLK
Sbjct  37    LLRRSPTVLC--------KSSSATNEPGS--DDFVSRVLKENPSQVQPKYLIGDKLYTLK  86

Query  2913  ekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGD-QGKPEEVYLKEILREHKGKLYVPE  2737
             EKE+L+K S + G L++L+RL       KS+   +  G+ + VYLK++L+E++GKLYVPE
Sbjct  87    EKENLRKLS-NAGILDVLKRLKSTKPQSKSENVSEASGERDSVYLKDLLKEYRGKLYVPE  145

Query  2736  QIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVE  2557
             Q+F + LSEEEEF +NV ELPKM   +F+K L  DK+KL+T K       G  +RDFVVE
Sbjct  146   QLFGTELSEEEEFNRNVNELPKMSIGEFRKALSKDKIKLITSK-----GGGGLYRDFVVE  200

Query  2556  LKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEK-QMMTWVGKLPEQPHPVASK  2380
             LK++PG KSL  TKW +RL   +AQ+++ +YTGPRYE+E+   M+WVGK PE PHPVA+ 
Sbjct  201   LKKIPGDKSLHTTKWVLRLGNGEAQAIMADYTGPRYEIERSHTMSWVGKTPEYPHPVATS  260

Query  2379  ISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGL  2200
             IS+R++VEL ++T  +  AA IAG +LASA FA TS    + VYVVWP+AKPF+K F GL
Sbjct  261   ISSRVVVELAVVTGCVAVAAVIAGGFLASAFFAATSLVAVMAVYVVWPIAKPFLKLFLGL  320

Query  2199  VFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLS  2023
                +LE++WD I D F+  G+ +K  ++YTFGG SAS+E LKPI++V LTMVLLVRFTLS
Sbjct  321   TLAILEKIWDNIVDFFSDGGILSKISEIYTFGGFSASLEALKPIMIVVLTMVLLVRFTLS  380

Query  2022  RRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELF  1843
             RRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F DVAGI++AVEELQELV YLKNPELF
Sbjct  381   RRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFCDVAGIDEAVEELQELVRYLKNPELF  440

Query  1842  DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLF  1663
             DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLF
Sbjct  441   DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLF  500

Query  1662  KRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGK  1483
             KRAKVNKPSV+FIDEIDALAT+RQGIF +++D  YNAATQERETTLNQLL ELDGFDTGK
Sbjct  501   KRAKVNKPSVVFIDEIDALATRRQGIFKENTDHLYNAATQERETTLNQLLIELDGFDTGK  560

Query  1482  GVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSY  1303
             GVIFL ATNR DLLDPALLRPGRFDRKIRIRPP+AKGR  ILK+H+ KVK+SE+VDL+SY
Sbjct  561   GVIFLAATNRKDLLDPALLRPGRFDRKIRIRPPSAKGRHDILKIHSSKVKMSESVDLSSY  620

Query  1302  AQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQC  1123
             AQNLPGWSGA+LAQL+QEAALVAVRK HNSIL+SDMDDAVDRLTVGPKRVGI+LG+QGQC
Sbjct  621   AQNLPGWSGARLAQLVQEAALVAVRKQHNSILQSDMDDAVDRLTVGPKRVGIELGYQGQC  680

Query  1122  RRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQL  943
             RRATTE+G ALTSHLLR YE+AKVECCDRISI PRGQTLSQ+VFHRLDDESYMFERRPQL
Sbjct  681   RRATTELGLALTSHLLRRYEHAKVECCDRISIVPRGQTLSQLVFHRLDDESYMFERRPQL  740

Query  942   LHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWR  763
             LHRLQVLLGGRAAEEVIYGRDTSKASV YLADA+WLARK++T+WNLENPM IHGEP PWR
Sbjct  741   LHRLQVLLGGRAAEEVIYGRDTSKASVDYLADASWLARKILTIWNLENPMVIHGEPPPWR  800

Query  762   KSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaa  583
             KS KFVGPRLDFEGSLYDDY+LIEPPLNF +DD V++RTE LIRD Y KT++LLR+HHAA
Sbjct  801   KSVKFVGPRLDFEGSLYDDYNLIEPPLNFKMDDQVAQRTEELIRDMYRKTVSLLRRHHAA  860

Query  582   llktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYS  403
             LLKT+KVLL QKEISGEEI+FIL+ YPP TP   LLEE   G+LP     +E+ +++EY+
Sbjct  861   LLKTIKVLLDQKEISGEEIEFILNKYPPQTPI-YLLEEEYAGNLPF---TREQVHDLEYA  916

Query  402   L  400
             L
Sbjct  917   L  917



>ref|XP_008341756.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 4, mitochondrial 
[Malus domestica]
Length=948

 Score =  1148 bits (2970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/861 (75%), Positives = 742/861 (86%), Gaps = 7/861 (1%)
 Frame = -2

Query  3021  NSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEIL-RRLNL  2845
             ++S    DD+VTRVLKENPSQ+E RY VGDK  TLKEKE L K S + G  E+  +RLN 
Sbjct  63    DNSKAPQDDYVTRVLKENPSQIEPRYLVGDKFYTLKEKESLGKNS-NVGFAELFAKRLNF  121

Query  2844  -KAFSRKSQEDGDQG-KPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPK  2671
              KA + +++   D G K + V+LK+ILRE+KGKLYVPEQIF + L EEE+FEK++EELP+
Sbjct  122   SKAKNERTEGLSDGGVKDDAVHLKDILREYKGKLYVPEQIFGTELPEEEQFEKSLEELPR  181

Query  2670  MEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLN  2491
             M +E+F K +K+DKVKLL  KE   A   +G  D++V+LKE+PG KSL RTKW MRLD  
Sbjct  182   MSYEEFLKVVKSDKVKLLISKE--VAGTSYGVCDYIVDLKEIPGEKSLHRTKWAMRLDEG  239

Query  2490  QAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaia  2311
             +AQ+LL +YTGPRY +E    +WVGK+P+ PHPVAS IS+R+MVELGM+TA+M AAA   
Sbjct  240   EAQALLEDYTGPRYMIEGHTTSWVGKVPQYPHPVASSISSRMMVELGMVTAVMAAAAVFI  299

Query  2310  gsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFA  2134
             G +LASAVFAVTSF FA TVYVV P+ KPF++ F GLV  +LERVWD + D F+  G+F+
Sbjct  300   GGFLASAVFAVTSFVFASTVYVVLPIVKPFLRLFLGLVLGILERVWDNLVDFFSDGGIFS  359

Query  2133  KFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQ  1954
             KF + YTFGG+SASIE+LKPI +V +TMV+LVRFTLSRRPKNFRKWD+WQGI+FS+SK +
Sbjct  360   KFSEFYTFGGLSASIEMLKPITIVLMTMVILVRFTLSRRPKNFRKWDLWQGIDFSRSKAE  419

Query  1953  ARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTL  1774
             ARVDG TGV F DVAGI++AVEEL ELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTL
Sbjct  420   ARVDGSTGVKFGDVAGIDEAVEELLELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTL  479

Query  1773  VAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKR  1594
             VAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+R
Sbjct  480   VAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRR  539

Query  1593  QGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGR  1414
             QGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGR
Sbjct  540   QGIFKETSDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGR  599

Query  1413  FDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalva  1234
             FDRKI+IRPP AKGRL ILK+HA KVK+S +VDL+SYAQNLPGW+GAKLAQL+QEAALVA
Sbjct  600   FDRKIKIRPPAAKGRLDILKIHASKVKMSPSVDLSSYAQNLPGWTGAKLAQLVQEAALVA  659

Query  1233  VRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAK  1054
             VRKGH+SI +SD+DDAVDRLTVGPKRVGI+LGHQGQCRRATTEVG A+ SHLLR YENA+
Sbjct  660   VRKGHDSIFQSDLDDAVDRLTVGPKRVGIELGHQGQCRRATTEVGVAMASHLLRQYENAE  719

Query  1053  VECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS  874
             VE CDRISI PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS
Sbjct  720   VERCDRISIIPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS  779

Query  873   KASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLI  694
             +ASV YLADA+WLARK++T+WNLENPM IHGEP PWRK  +FVGPRLDFEGSLY DYDLI
Sbjct  780   RASVDYLADASWLARKILTIWNLENPMVIHGEPPPWRKKLEFVGPRLDFEGSLYHDYDLI  839

Query  693   EPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFIL  514
             EPP+NF+LDDDV+KR E LI   Y KTL+LL++HH ALLKTVKVLL++KEISGEEIDFIL
Sbjct  840   EPPVNFNLDDDVAKRAEELIHKMYDKTLSLLKKHHTALLKTVKVLLERKEISGEEIDFIL  899

Query  513   SNYPPHTPASLLLEEGDPGSL  451
             + YPP TP  LLLEE +PGSL
Sbjct  900   NKYPPQTPLKLLLEEENPGSL  920



>gb|EPS61004.1| hypothetical protein M569_13795, partial [Genlisea aurea]
Length=858

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/856 (75%), Positives = 724/856 (85%), Gaps = 11/856 (1%)
 Frame = -2

Query  3012  GGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFS  2833
             G   +DFVTRVL+ENPSQVE +Y +G+KL T  E+E L +K      L +L+RLN +   
Sbjct  7     GTGTEDFVTRVLRENPSQVEPKYLIGNKLYTSTERESLYRKGITAQLLRLLKRLNSETIV  66

Query  2832  RKSQEDGDQGKPE-EVYLKEILREHKGKLYVPEQIFRSNLSeeee---feknveELPKME  2665
                 ++ +    E  VYLK++LREHKGKLYVPEQIF   LSEEEE     +  EELPKME
Sbjct  67    HAPDKESNLVNAEGNVYLKDLLREHKGKLYVPEQIFGVRLSEEEEFDRNAQEEEELPKME  126

Query  2664  FEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQA  2485
             +EDFQK+LK+DKVKL++FKEDN      G+RDFVV+LKE PG KSL RTKW MRL   QA
Sbjct  127   YEDFQKHLKSDKVKLVSFKEDN------GYRDFVVDLKETPGAKSLHRTKWAMRLYEEQA  180

Query  2484  QSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiags  2305
             + LL  Y GPR  +EKQ+++ +GKLP+ PHPVASKIS+R+MVE G++TALM  AAA+ G 
Sbjct  181   EDLLESYKGPRNVIEKQLVSSIGKLPQYPHPVASKISSRVMVEFGVITALMATAAAVVGG  240

Query  2304  ylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFGVF-AKF  2128
             +LAS VFAVT FA+    YV+WP+AKP +K   G+V+ VLE VWD + D F  G F +K 
Sbjct  241   FLASTVFAVTGFAYINAAYVIWPLAKPLLKLSVGIVYGVLENVWDHLADIFTEGGFISKL  300

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             Y+VYTFGG++ASIEVLKPIL V +TMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR
Sbjct  301   YEVYTFGGVAASIEVLKPILFVLVTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  360

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             VDG TGV F+DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA
Sbjct  361   VDGSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  420

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQG
Sbjct  421   KAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQG  480

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
             I+ +S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFD
Sbjct  481   IYRESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFD  540

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             RKIRIRPPNAKGR  ILKVHARKVKLS+ VDL +YA NLPGWSGAKLAQLLQEAALVAVR
Sbjct  541   RKIRIRPPNAKGRFDILKVHARKVKLSDAVDLGTYANNLPGWSGAKLAQLLQEAALVAVR  600

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             K H++IL+SDMDDAVDRLTVGPKR+GIDL  QGQCRRAT EVGTALTSHLLR  ENAKVE
Sbjct  601   KRHSAILQSDMDDAVDRLTVGPKRIGIDLSRQGQCRRATAEVGTALTSHLLRRLENAKVE  660

Query  1047  CCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKA  868
              CDR+SI+PRGQTLSQVVF+RLDD++Y+FERRPQLLHRLQVLLGGRAAEEVI+GRDTSKA
Sbjct  661   PCDRVSIHPRGQTLSQVVFNRLDDDNYIFERRPQLLHRLQVLLGGRAAEEVIFGRDTSKA  720

Query  867   SVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEP  688
             SV YLADA+WLARK+IT+WNLE  M +HGE   W K  KFVGPRLDFEGSLYDDYDL EP
Sbjct  721   SVGYLADASWLARKIITIWNLEESMAVHGEHPAWIKRMKFVGPRLDFEGSLYDDYDLTEP  780

Query  687   PLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSN  508
             P+NF+LDDDV++RTE L+RD Y KT+ LL+Q+ AALLKTVKVLL +KEISG+EID IL +
Sbjct  781   PINFNLDDDVARRTEDLMRDMYRKTVDLLKQYEAALLKTVKVLLDRKEISGDEIDSILRH  840

Query  507   YPPHTPASLLLEEGDP  460
             YP HTPASL+ EE +P
Sbjct  841   YPAHTPASLVAEERNP  856



>ref|XP_010433839.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Camelina 
sativa]
Length=949

 Score =  1147 bits (2967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/898 (72%), Positives = 750/898 (84%), Gaps = 7/898 (1%)
 Frame = -2

Query  3123  RHQNL-KFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGND-DDFVTRVLKENPSQVET  2950
             +H N   F      R P      T+  + K S ++N     D DDFVTRVLKENPSQVE 
Sbjct  29    KHANASNFSAKTRWRGPILRRSFTVLCELKKSGETNKPQAADVDDFVTRVLKENPSQVEP  88

Query  2949  RYKVGdklltlkekedlqk--KSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKE  2776
             RY+VGDKL  LKE+EDL K   +  +GA E +RR  L +   K + +  +   E VYL +
Sbjct  89    RYRVGDKLYNLKEREDLSKGGANASSGAFEFIRR-KLDS-ETKVETEKSESVNESVYLSD  146

Query  2775  ILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNA  2596
             ILRE++GKLYVPEQ+F   LSEE+EFE+ V++LPKM  EDF+K +K DKVKLLT K+ + 
Sbjct  147   ILREYRGKLYVPEQVFGPELSEEDEFERTVKDLPKMSLEDFRKAMKNDKVKLLTSKDVSG  206

Query  2595  ANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVG  2416
               Y  G+RDF+V+LKE+PG KSLQRTKW+M+L+L +AQ+LL EYTGP+YE+E+   +WVG
Sbjct  207   RPYTSGYRDFIVDLKEIPGVKSLQRTKWSMKLELGEAQALLKEYTGPQYEIERHRTSWVG  266

Query  2415  KLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWP  2236
             K+ + P+PVAS IS+R+MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVWP
Sbjct  267   KVADFPNPVASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVWP  326

Query  2235  VAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVF  2059
             +AKPF+K F G+   VLE+VWD + D  A  G+F++    YTFGG+S+S+E+LKPILLV 
Sbjct  327   IAKPFLKLFVGIFLGVLEKVWDYLVDVLADGGIFSRISDFYTFGGVSSSLEMLKPILLVV  386

Query  2058  LTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQ  1879
             +TMVLLVRFTLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQ
Sbjct  387   MTMVLLVRFTLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDELQ  446

Query  1878  ELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL  1699
             ELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL
Sbjct  447   ELVKYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVL  506

Query  1698  VGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQ  1519
             VGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQ
Sbjct  507   VGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLNQ  566

Query  1518  LLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARK  1339
             LL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA K
Sbjct  567   LLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHASK  626

Query  1338  VKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPK  1159
             VK+S++VDL+SYA NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP 
Sbjct  627   VKMSDSVDLSSYASNLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPT  686

Query  1158  RVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLD  979
             R+G++LGHQGQCRRATTE G A+TSHLL  YENAK+E CDRISI PRGQTLSQVVFHRLD
Sbjct  687   RIGLELGHQGQCRRATTEAGVAITSHLLLRYENAKIERCDRISIIPRGQTLSQVVFHRLD  746

Query  978   DESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLEN  799
             DESYMF R PQLLHRLQVLL GRAAE+VIYG DTSKASV YL+DA+WLARK++T+WNLEN
Sbjct  747   DESYMFGRLPQLLHRLQVLLAGRAAEQVIYGSDTSKASVDYLSDASWLARKILTIWNLEN  806

Query  798   PMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYA  619
             PM IHGEP PWRK  +FVGPRLDFEGSLY+D DL+EPP+NF++DD+V++R+E LI   Y 
Sbjct  807   PMVIHGEPPPWRKRAQFVGPRLDFEGSLYEDDDLVEPPINFNMDDEVAQRSEELISQMYD  866

Query  618   KTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             KT+ALL Q+  ALLKTVKVLL QKEISGE IDFIL  YPP TP +LLL+E +PGSLP 
Sbjct  867   KTVALLTQNQTALLKTVKVLLNQKEISGEAIDFILDQYPPETPLNLLLQEQNPGSLPF  924



>ref|XP_008799614.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Phoenix dactylifera]
Length=957

 Score =  1147 bits (2966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/892 (71%), Positives = 748/892 (84%), Gaps = 9/892 (1%)
 Frame = -2

Query  3090  ARRSPPCYCP---RTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdkllt  2920
             +R +PP   P   R+     K     N  G   DDF+TRVLKENPSQVE ++ VGD+ LT
Sbjct  47    SRSNPPRKTPPFRRSFVVLQKLDADRNGGGSGGDDFITRVLKENPSQVEPKFLVGDRFLT  106

Query  2919  lkekedlqkKSFDTGALEILRRL----NLKAFSRKSQEDGDQGKPEEVYLKEILREHKGK  2752
             L+EK+   K   +    ++L+RL     +K    +   D        VYLK+ILRE +GK
Sbjct  107   LREKQRSGKAP-EFRVHQLLKRLLGESGVKKEGDEGGGDRGGEASSPVYLKDILREFRGK  165

Query  2751  LYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFR  2572
             LYVPE++F+ NLSEEEEFE+N++ELP M FEDFQK+L   K+KLLT + +  +    G+R
Sbjct  166   LYVPEEVFKGNLSEEEEFERNLKELPAMRFEDFQKHLVAGKIKLLTSRSEVGSPPDIGYR  225

Query  2571  DFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHP  2392
             DFVV+LKE+PG KS+Q+TKWT+RL  +QA++++ EY GP+YE+EK   ++VGKL   PHP
Sbjct  226   DFVVDLKEIPGDKSIQKTKWTIRLSASQARAVMEEYMGPQYEIEKHTTSYVGKLLAYPHP  285

Query  2391  VASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKF  2212
             VAS IS+R+MVELGM+TAL+ AA A+  S++ASAVFAVTSF +A T+YVVWP+A+PF+K 
Sbjct  286   VASSISSRVMVELGMVTALIAAAGAVITSFMASAVFAVTSFLYAATLYVVWPLARPFVKL  345

Query  2211  FSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVR  2035
               G+VF++ ER+W+ I D F+  G+F+K Y+ YTFGG+SAS+E+LKPI+LVF+TMVLL+R
Sbjct  346   ALGIVFNIAERIWEYIIDIFSEGGIFSKIYEFYTFGGVSASLEMLKPIMLVFVTMVLLLR  405

Query  2034  FTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKN  1855
             FTLSRRPKNFRKWDIWQGIEF QSKPQARVDG TGV F+DVAGI++AVEELQELV YLKN
Sbjct  406   FTLSRRPKNFRKWDIWQGIEFGQSKPQARVDGSTGVKFSDVAGIDEAVEELQELVRYLKN  465

Query  1854  PELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARI  1675
             PELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARI
Sbjct  466   PELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARI  525

Query  1674  RDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGF  1495
             RDLFKRAKVNKPSV+FIDEIDALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGF
Sbjct  526   RDLFKRAKVNKPSVVFIDEIDALATRRQGIFSESTDYLYNAATQERETTLNQLLIELDGF  585

Query  1494  DTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVD  1315
             DTGKGVIFLGATNRMDLLDPALLRPGRFDRK+RIRPP AKGRL ILKVHARKVK+S TVD
Sbjct  586   DTGKGVIFLGATNRMDLLDPALLRPGRFDRKVRIRPPGAKGRLDILKVHARKVKMSPTVD  645

Query  1314  LTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGH  1135
             L++YAQNLPGW+GA+LAQL+QE+ALVAVR  H+SIL+SDMDDAVDRLTVGPKR+GI+LGH
Sbjct  646   LSTYAQNLPGWTGAQLAQLVQESALVAVRNRHDSILQSDMDDAVDRLTVGPKRLGIELGH  705

Query  1134  QGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFER  955
             QGQCRRA TEVG A+TSHLLR YENAKVE C+RISI PRGQTLSQ+VF  LD+ESYMFER
Sbjct  706   QGQCRRAVTEVGVAITSHLLRRYENAKVEFCERISIIPRGQTLSQIVFLHLDEESYMFER  765

Query  954   RPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEP  775
             RPQLLHRLQVLLGGRAAEEVIYGRDTSKAS+ YL DAT LARK++ +WNLENPMTIHGEP
Sbjct  766   RPQLLHRLQVLLGGRAAEEVIYGRDTSKASLKYLEDATCLARKILCIWNLENPMTIHGEP  825

Query  774   LPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrq  595
              PW K P FVGPRLDFEGSLYDDY LIEPP+NFDLDD V++RTE L+   Y KT+++LR+
Sbjct  826   FPWIKKPSFVGPRLDFEGSLYDDYGLIEPPINFDLDDRVAQRTEELMHGMYGKTISMLRR  885

Query  594   hhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFH  439
             H AALLKT KVLL  KEISG++I+FIL++YP  T   L+LEE +PGSLPLF 
Sbjct  886   HAAALLKTTKVLLDNKEISGDQIEFILNSYPADTAVKLVLEEKNPGSLPLFE  937



>ref|XP_002509985.1| Cell division protein ftsH, putative [Ricinus communis]
 gb|EEF51372.1| Cell division protein ftsH, putative [Ricinus communis]
Length=925

 Score =  1146 bits (2964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/883 (74%), Positives = 752/883 (85%), Gaps = 10/883 (1%)
 Frame = -2

Query  3033  SEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEIL-R  2857
             S +S  S    D FVTRVLKENPSQ+E RY++G+K  TLKEK++L K   + G +E L +
Sbjct  48    SSESQPSDTKKDGFVTRVLKENPSQLEPRYRIGEKFYTLKEKDNLSKNQ-NKGMIEFLAK  106

Query  2856  RLNLKA-FSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveE  2680
             RLN    + +   E  ++GK  +VYLK+ILRE+KGKLYVPEQIF + LSEEEEF +N+EE
Sbjct  107   RLNFTGKWKKVDNESQNEGK--DVYLKDILREYKGKLYVPEQIFVAALSEEEEFNRNLEE  164

Query  2679  LPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRL  2500
             LP+M FEDF K +K DKVKL+T KE   ++Y   +RDF+V+LKE+PG K+L RTKW MRL
Sbjct  165   LPQMSFEDFNKAMKKDKVKLVTSKEVRGSSYLDNYRDFIVDLKEIPGEKTLHRTKWAMRL  224

Query  2499  DLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaa  2320
                +AQ+LL EY GP+YE+E+ M + VGKLPE PHPVAS IS+R++VELGM+TA+M  AA
Sbjct  225   YQTEAQTLLEEYKGPQYEIERHMKSSVGKLPEYPHPVASSISSRMIVELGMVTAVMATAA  284

Query  2319  aiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFGV  2140
                G +LASAVF VTSF F  TVYV+WP+A+PF+K F G++  +LE ++D   D    GV
Sbjct  285   VAVGGFLASAVFVVTSFIFVTTVYVIWPIARPFVKLFLGIISGILEGIFDVFSDG---GV  341

Query  2139  FAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSK  1960
             F+K  + YTFGG+SASIE+LKPI LV LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK
Sbjct  342   FSKLSEFYTFGGVSASIEMLKPITLVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSK  401

Query  1959  PQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGK  1780
              +ARVDG TGV F+DVAGI+ AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGK
Sbjct  402   AEARVDGSTGVKFSDVAGIDDAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGK  461

Query  1779  TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALAT  1600
             TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT
Sbjct  462   TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALAT  521

Query  1599  KRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRP  1420
             +RQGIF +S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRP
Sbjct  522   RRQGIFKESTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRP  581

Query  1419  GRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaal  1240
             GRFDRKIRIR PNAKGRL ILK+HA KVK+SE+VDL++ A+NLPGW+GAKLAQL+QEAAL
Sbjct  582   GRFDRKIRIRAPNAKGRLEILKIHASKVKMSESVDLSTCAKNLPGWTGAKLAQLVQEAAL  641

Query  1239  vaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYEN  1060
             VAVR+GH SI++SD+DDAVDRLTVGPKRVGIDLGHQGQCRRATTEVG A+TSHLLR YE+
Sbjct  642   VAVRQGHASIIQSDIDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGVAMTSHLLRLYED  701

Query  1059  AKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD  880
             AKVECCDRISI PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLG RAAEEVIYGR+
Sbjct  702   AKVECCDRISIVPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGARAAEEVIYGRN  761

Query  879   TSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYD  700
             TS+AS+ YLADA+WLARK+IT+WNLENPM IHGEP PWRK  +FVGPRLDFEGSLYDDY 
Sbjct  762   TSRASIPYLADASWLARKIITIWNLENPMVIHGEPPPWRKKVRFVGPRLDFEGSLYDDYG  821

Query  699   LIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDF  520
             LIEPP+NF+LDD V++RTE LI D Y KT++LLR+HHAALLK VKVL+ QKEISG EID+
Sbjct  822   LIEPPINFNLDDQVAQRTEKLINDMYEKTVSLLRRHHAALLKAVKVLINQKEISGNEIDY  881

Query  519   ILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLSS  391
             IL+NYPP T  SLLLEE +PGSLP    EQ   +E++Y LL+S
Sbjct  882   ILNNYPPQTCISLLLEEENPGSLPFTKNEQ--GHEVDYELLTS  922



>ref|XP_002869753.1| hypothetical protein ARALYDRAFT_492469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46012.1| hypothetical protein ARALYDRAFT_492469 [Arabidopsis lyrata subsp. 
lyrata]
Length=933

 Score =  1146 bits (2964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/893 (72%), Positives = 751/893 (84%), Gaps = 9/893 (1%)
 Frame = -2

Query  3084  RSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkeke  2905
             R+P      T+  + K      ++    DDFVTRVLKENPSQ+E RY+VGDKL  LKE+E
Sbjct  32    RAPILRRSFTVLCELKSRSNETNNPPPADDFVTRVLKENPSQLEPRYRVGDKLYNLKERE  91

Query  2904  dlqk-KSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIF  2728
             DL K  +  TGA E ++R     F  K++ + ++ + E VYL +ILRE+KGKLYVPEQ+F
Sbjct  92    DLSKGANAATGAFEFIKR----KFDSKTKTETEKSQ-ESVYLSDILREYKGKLYVPEQVF  146

Query  2727  RSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKE  2548
                LSEEEEFEK V++LP +  EDF+K ++ DKVKLLT KE +   Y  G+RDF+V+LKE
Sbjct  147   APELSEEEEFEKTVKDLPNLSLEDFRKAMENDKVKLLTSKEVSGVPYTSGYRDFIVDLKE  206

Query  2547  MPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTR  2368
             +PG KSLQRTKW+M+L++ +AQ+LL EYTGP+YE+E+ M +WVGK+ + P+PVAS IS+R
Sbjct  207   IPGVKSLQRTKWSMKLEVGEAQALLKEYTGPQYEIERHMTSWVGKVTDFPNPVASSISSR  266

Query  2367  LMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDV  2188
             +MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVWP+AKPF+K F G+ F V
Sbjct  267   VMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVWPIAKPFLKLFVGIFFGV  326

Query  2187  LERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPK  2011
             LE+ WD + D     G+F++    YTFGG+S+S+E+LKPILLV +TMVLLVRFTLSRRPK
Sbjct  327   LEKSWDYLVDFLGDGGIFSRISDFYTFGGVSSSLEMLKPILLVVMTMVLLVRFTLSRRPK  386

Query  2010  NFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMG  1831
             NFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV YLKNP+LFDKMG
Sbjct  387   NFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDELQELVKYLKNPDLFDKMG  446

Query  1830  IKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAK  1651
             IKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAK
Sbjct  447   IKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAK  506

Query  1650  VNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIF  1471
             VNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGVIF
Sbjct  507   VNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLNQLLIELDGFDTGKGVIF  566

Query  1470  LGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNL  1291
             LGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA KVK+S++VDL+SYA NL
Sbjct  567   LGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHASKVKMSDSVDLSSYASNL  626

Query  1290  PGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRAT  1111
             PGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP R+G++LGHQGQCRRAT
Sbjct  627   PGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPTRIGLELGHQGQCRRAT  686

Query  1110  TEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRL  931
             TEVG A+TSHLL  YENAK+E CDR+SI PRGQTLSQVVFHRLDDESYMF R PQLLHRL
Sbjct  687   TEVGVAITSHLLLRYENAKIERCDRVSIIPRGQTLSQVVFHRLDDESYMFGRLPQLLHRL  746

Query  930   QVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPK  751
             QV LGGRAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGEP PWRK  +
Sbjct  747   QVFLGGRAAEEVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMVIHGEPPPWRKRAQ  806

Query  750   FVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallkt  571
             FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V++R+E LI   Y KT++LL Q+  ALLKT
Sbjct  807   FVGPRLDFEGSLYDDYDLVEPPINFNMDDEVAQRSEELISQMYNKTVSLLTQNQTALLKT  866

Query  570   vkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLF--HQEQEEAN  418
             VKVLL QKEISGE IDFIL  YPP TP + LL+E +PGSLP    H ++E  +
Sbjct  867   VKVLLNQKEISGEAIDFILDQYPPQTPLNSLLQEQNPGSLPFVPEHLQRESGD  919



>ref|XP_010918347.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH [Elaeis guineensis]
Length=958

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/891 (71%), Positives = 747/891 (84%), Gaps = 7/891 (1%)
 Frame = -2

Query  3096  NIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltl  2917
             N  R++PP      +F Q   ++++   GG   DF+TRVLKENPSQVE ++ VGD+ LTL
Sbjct  50    NPLRKTPPFRRSFVVF-QKVDADRNGGGGGGGGDFITRVLKENPSQVEPKFLVGDRFLTL  108

Query  2916  kekedlqkKSFDTGALEILRRL----NLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKL  2749
             +EK+   +   +    ++L+RL     +K    +            VYLK+ILRE +GKL
Sbjct  109   REKQRSGEAP-EFRVFQLLKRLLGESGVKKEGDEGGGGRGGEASSPVYLKDILREFRGKL  167

Query  2748  YVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRD  2569
             YVPE++F+ NLSEEEEFE+N++ELP M FEDFQK+L   K+KLLT + D  +    G+RD
Sbjct  168   YVPEEVFKGNLSEEEEFERNLKELPAMTFEDFQKHLMAGKIKLLTSRSDVGSPPDIGYRD  227

Query  2568  FVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPV  2389
             FVV+LKEMPG KS+Q+TKW +RL  +QA++++ EYTGP+YE+EK  M++VGKLPE PHPV
Sbjct  228   FVVDLKEMPGDKSIQKTKWAIRLSASQARAVMEEYTGPQYEIEKHTMSYVGKLPEYPHPV  287

Query  2388  ASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFF  2209
             AS IS+R+MVELGM+TAL+ AA A+   ++A+AVF VTSF +A T YVVWP+A+PF+K  
Sbjct  288   ASSISSRVMVELGMITALIAAAGAVITGFVAAAVFVVTSFLYAATFYVVWPLARPFLKLA  347

Query  2208  SGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRF  2032
              G+V ++ E +W+ I D F+  G+F+K Y+ YTFGGISASIE+LKPI+ V +TMVLLVRF
Sbjct  348   LGIVSNIAEGIWEYIIDMFSEGGIFSKIYEFYTFGGISASIEMLKPIMFVLVTMVLLVRF  407

Query  2031  TLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNP  1852
             TLSRRPKNFRKWDIWQGIEF QSKPQARVDG TGV F+DVAGI++AVEELQELV YLKNP
Sbjct  408   TLSRRPKNFRKWDIWQGIEFGQSKPQARVDGSTGVKFSDVAGIDEAVEELQELVRYLKNP  467

Query  1851  ELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIR  1672
             ELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIR
Sbjct  468   ELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIR  527

Query  1671  DLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFD  1492
             DLFKRAKVNKPSV+F+DEIDALAT+RQGIF++S+D  YNAATQERETTLNQLL ELDGFD
Sbjct  528   DLFKRAKVNKPSVVFVDEIDALATRRQGIFSESTDYLYNAATQERETTLNQLLIELDGFD  587

Query  1491  TGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDL  1312
             TGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPP  KGRL ILKVHARKVK+S TVDL
Sbjct  588   TGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPGTKGRLDILKVHARKVKMSPTVDL  647

Query  1311  TSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQ  1132
             ++YAQNLPGW+GA+LAQL+QE+ALVAVR  H+SIL+SDMDDAVDRLT+GPKR+GIDLGHQ
Sbjct  648   STYAQNLPGWTGAQLAQLVQESALVAVRNRHDSILQSDMDDAVDRLTIGPKRLGIDLGHQ  707

Query  1131  GQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERR  952
             GQCRRA TEVG A+TSHLLR YENAKVE C+RISI PRGQTLSQ+VF  LD+ESYMFERR
Sbjct  708   GQCRRAVTEVGVAITSHLLRRYENAKVEFCERISIIPRGQTLSQIVFRHLDEESYMFERR  767

Query  951   PQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPL  772
             PQLLHRLQVLLGGRAAEEV+YG+DTSKAS+ YL DAT LARK++ +WNLENPMTIHGEP 
Sbjct  768   PQLLHRLQVLLGGRAAEEVVYGQDTSKASLKYLEDATCLARKILCIWNLENPMTIHGEPF  827

Query  771   PWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqh  592
             PW K P FVGPRLDFEGSLYDDY+LIEPP+NFDLDD V++RTE L+RD Y KT+++LR+H
Sbjct  828   PWIKKPSFVGPRLDFEGSLYDDYNLIEPPINFDLDDRVAQRTEELMRDMYRKTISMLRRH  887

Query  591   haallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFH  439
              AALLKT KVLL  KEI+G++I+FIL++Y   TP  L+LEE +PGSLP F 
Sbjct  888   AAALLKTTKVLLDNKEINGDQIEFILNSYAAETPVKLVLEEKNPGSLPFFE  938



>gb|KGN53417.1| hypothetical protein Csa_4G052670 [Cucumis sativus]
Length=962

 Score =  1140 bits (2949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/859 (72%), Positives = 732/859 (85%), Gaps = 12/859 (1%)
 Frame = -2

Query  2997  DFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALE-ILRRLNLKAFSRKSQ  2821
             DFVTRVLKENPSQ+E RY +GDKL TLKEKE L +   + G  + +++ LN +   +KS+
Sbjct  78    DFVTRVLKENPSQLEPRYLIGDKLYTLKEKEYLSR-KLEVGVFDFVVKWLNSR---KKSK  133

Query  2820  EDGDQG------KPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFE  2659
             E+G +G      K E+VYLK+ILRE+KGKLYVPEQ+FRS LSE EEF++++E LPKM FE
Sbjct  134   EEGIEGRNEGGNKSEDVYLKDILREYKGKLYVPEQVFRSELSEGEEFDRSLEALPKMSFE  193

Query  2658  DFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQS  2479
             DF K L+ DKVKLLT KE  A  YG  FRDF+V+LKE+PG KSLQRT+W +RLD  + Q+
Sbjct  194   DFVKALENDKVKLLTSKESRATFYGSMFRDFIVDLKEIPGEKSLQRTRWALRLDETEIQT  253

Query  2478  LLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsyl  2299
             +L +YTGP+Y++E    +WVGKLP  PHPVAS+IS+R+MVELG+ T ++ AAA + G +L
Sbjct  254   VLEQYTGPQYQIESHTSSWVGKLPNYPHPVASQISSRMMVELGVATIMIAAAAFLIGGFL  313

Query  2298  asavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFGV-FAKFYQ  2122
             ASAVF+ T F F   V VVWP+ +PF+K   GL+F + ERVWD + D F +G  F+K  +
Sbjct  314   ASAVFSFTGFVFFTVVNVVWPIIRPFLKLSLGLIFGICERVWDNVGDFFEYGGGFSKLQE  373

Query  2121  VYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVD  1942
             V+ + GIS S+E++ PI  + L MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVD
Sbjct  374   VFIYCGISDSLELIVPISTIVLIMVLLLRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVD  433

Query  1941  GMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA  1762
             G TGV F+DVAGI++AVEELQELV YLKNPELFD +GIKPPHGVLLEGPPGCGKTLVAKA
Sbjct  434   GSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDTIGIKPPHGVLLEGPPGCGKTLVAKA  493

Query  1761  IAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIF  1582
             IAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF
Sbjct  494   IAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIF  553

Query  1581  NDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRK  1402
              +S+D+ YNA+TQERETTLNQLLTELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRK
Sbjct  554   KESTDNLYNASTQERETTLNQLLTELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRK  613

Query  1401  IRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKG  1222
             I+I PP AKGRL ILK+HA KVK+S +VDL+ Y++NLPGWSGAKLAQL+QEAALVAVRKG
Sbjct  614   IKICPPGAKGRLDILKIHASKVKMSHSVDLSIYSRNLPGWSGAKLAQLVQEAALVAVRKG  673

Query  1221  HNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECC  1042
             H SI +SDMDDAVDRLTVGP+R+G+ LGHQGQCRRATTE+G A+TSHLLR +E+AKVECC
Sbjct  674   HESIFQSDMDDAVDRLTVGPRRIGVKLGHQGQCRRATTEMGVAITSHLLRRFESAKVECC  733

Query  1041  DRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASV  862
             DRISI PRG TLSQVVF RLDDESYMFERRPQLLHRLQV LG RAAEEVIYGRDTSKASV
Sbjct  734   DRISIIPRGWTLSQVVFRRLDDESYMFERRPQLLHRLQVFLGARAAEEVIYGRDTSKASV  793

Query  861   SYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPL  682
             SYLADA+WLARK+IT+WNLENPM IHGEP PWR+   F+GPRLDFEGSLY+DY+L EPPL
Sbjct  794   SYLADASWLARKIITIWNLENPMVIHGEPPPWRREANFIGPRLDFEGSLYNDYNLTEPPL  853

Query  681   NFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYP  502
             NF+LDD+V++RTEALIRD Y +TLA+L++HHAALLK VKVL+ Q+EISGEEIDFIL NYP
Sbjct  854   NFNLDDEVARRTEALIRDMYDRTLAMLQRHHAALLKAVKVLITQEEISGEEIDFILDNYP  913

Query  501   PHTPASLLLEEGDPGSLPL  445
               TP S++L+E +PGSLP 
Sbjct  914   QQTPISVVLQEENPGSLPF  932



>ref|XP_004162678.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH 2-like [Cucumis 
sativus]
Length=962

 Score =  1140 bits (2949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/859 (72%), Positives = 732/859 (85%), Gaps = 12/859 (1%)
 Frame = -2

Query  2997  DFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALE-ILRRLNLKAFSRKSQ  2821
             DFVTRVLKENPSQ+E RY +GDKL TLKEKE L +   + G  + +++ LN +   +KS+
Sbjct  78    DFVTRVLKENPSQLEPRYLIGDKLYTLKEKEYLSR-KLEVGVFDFVVKWLNSR---KKSK  133

Query  2820  EDGDQG------KPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFE  2659
             E+G +G      K E+VYLK+ILRE+KGKLYVPEQ+FRS LSE EEF++++E LPKM FE
Sbjct  134   EEGIEGRNEGGNKSEDVYLKDILREYKGKLYVPEQVFRSELSEGEEFDRSLEALPKMSFE  193

Query  2658  DFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQS  2479
             DF K L+ DKVKLLT KE  A  YG  FRDF+V+LKE+PG KSLQRT+W +RLD  + Q+
Sbjct  194   DFVKALENDKVKLLTSKESRATFYGSMFRDFIVDLKEIPGEKSLQRTRWALRLDETEIQT  253

Query  2478  LLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsyl  2299
             +L +YTGP+Y++E    +WVGKLP  PHPVAS+IS+R+MVELG+ T +M AAA + G +L
Sbjct  254   VLEQYTGPQYQIESHTSSWVGKLPNYPHPVASQISSRMMVELGVATIMMAAAAFLIGGFL  313

Query  2298  asavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFGV-FAKFYQ  2122
             ASAVF+ T F F   V VVWP+ +PF+K   GL+F + ERVWD + D F +G  F+K  +
Sbjct  314   ASAVFSFTGFVFFTVVNVVWPIIRPFLKLSLGLIFGICERVWDNVGDFFEYGGGFSKLQE  373

Query  2121  VYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVD  1942
             V+ + GIS S+E++ PI  + L MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVD
Sbjct  374   VFIYCGISDSLELIVPISTIVLIMVLLLRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVD  433

Query  1941  GMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA  1762
             G TGV F+DVAGI++AVEELQELV YLKNPELFD +GIKPPHGVLLEGPPGCGKTLVAKA
Sbjct  434   GSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDTIGIKPPHGVLLEGPPGCGKTLVAKA  493

Query  1761  IAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIF  1582
             IAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF
Sbjct  494   IAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIF  553

Query  1581  NDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRK  1402
              +S+D+ YNA+TQERETTLNQLLTELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRK
Sbjct  554   KESTDNLYNASTQERETTLNQLLTELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRK  613

Query  1401  IRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKG  1222
             I+I PP AKGRL ILK+HA KVK+S +VDL+ Y++NLPGWSGAKLAQL+QEAALVAVRKG
Sbjct  614   IKICPPGAKGRLDILKIHASKVKMSHSVDLSIYSRNLPGWSGAKLAQLVQEAALVAVRKG  673

Query  1221  HNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECC  1042
             H SI +SDMDDAVDRLTVGP+R+G+ LGHQGQCRRATTE+G A+TSHLLR +E+AKVECC
Sbjct  674   HESIFQSDMDDAVDRLTVGPRRIGVKLGHQGQCRRATTEMGVAITSHLLRRFESAKVECC  733

Query  1041  DRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASV  862
             DRISI PRG TLSQVVF RLDDESYMFERRPQLLHRLQV LG RAAEEVIYGRDTSKASV
Sbjct  734   DRISIIPRGWTLSQVVFRRLDDESYMFERRPQLLHRLQVFLGARAAEEVIYGRDTSKASV  793

Query  861   SYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPL  682
             SYLADA+WLARK+IT+WNLENPM IHGEP PWR+   F+GPRLDFEGSLY+DY+L EPPL
Sbjct  794   SYLADASWLARKIITIWNLENPMVIHGEPPPWRREANFIGPRLDFEGSLYNDYNLTEPPL  853

Query  681   NFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYP  502
             NF+LDD+V++RTEALIRD Y +TLA+L++HHAALLK VKVL+ Q+EISGEEIDFIL NYP
Sbjct  854   NFNLDDEVARRTEALIRDMYDRTLAMLQRHHAALLKAVKVLITQEEISGEEIDFILDNYP  913

Query  501   PHTPASLLLEEGDPGSLPL  445
               TP S++L+E +PGSLP 
Sbjct  914   QQTPISVVLQEENPGSLPF  932



>ref|XP_007160181.1| hypothetical protein PHAVU_002G299700g [Phaseolus vulgaris]
 gb|ESW32175.1| hypothetical protein PHAVU_002G299700g [Phaseolus vulgaris]
Length=919

 Score =  1139 bits (2945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/906 (71%), Positives = 744/906 (82%), Gaps = 27/906 (3%)
 Frame = -2

Query  3108  KFPRNIARRSPP-CYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGd  2932
             + P  + RR PP   C          +  S S     DDFV+RVLKENPSQ++ +Y +GD
Sbjct  29    RVPTLLLRRRPPTVLC----------NSSSASGEPGSDDFVSRVLKENPSQMQPKYLIGD  78

Query  2931  klltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGK  2752
             KL TLKEKE L K S   G  ++L+RLN      KS+ D   G+   VYLK++L+E++GK
Sbjct  79    KLYTLKEKESLGKVS-RLGIFDVLKRLNPTKPQSKSESDV-SGEGNSVYLKDLLKEYRGK  136

Query  2751  LYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFR  2572
             LYVPEQIF S LSEEEEF + V ELP+M  E+F K L  DKV+L+T K       G    
Sbjct  137   LYVPEQIFGSELSEEEEFNRAVNELPRMSVEEFSKSLSKDKVRLITSK-------GGANT  189

Query  2571  DFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQ-MMTWVGKLPEQPH  2395
             DFVVELKE+PG KSL  TKW +RL   +A+ +L +Y GPRYE+E++  M+WVGK PE PH
Sbjct  190   DFVVELKEIPGDKSLHTTKWVLRLGKGEAREVLADYNGPRYEIERRHAMSWVGKTPEYPH  249

Query  2394  PVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMK  2215
             PVAS IS+R+MVEL +++  M  AA + G ++A+A+FA TSF F VT YVVWP++KPF+K
Sbjct  250   PVASSISSRVMVELAVVSVFMGLAATLVGGFIAAALFAATSFVFVVTAYVVWPISKPFLK  309

Query  2214  FFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLV  2038
              F GL   +LE++WD I D F+  G+F+K +++YTFGGISAS+E LKPI++V LTMVLLV
Sbjct  310   LFLGLALAILEKIWDNIVDFFSDGGIFSKIFELYTFGGISASLEALKPIMIVVLTMVLLV  369

Query  2037  RFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLK  1858
             RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F DVAGI++AVEELQELV YLK
Sbjct  370   RFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFCDVAGIDEAVEELQELVRYLK  429

Query  1857  NPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAAR  1678
             NPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+AR
Sbjct  430   NPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSAR  489

Query  1677  IRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDG  1498
             IRDLFKRAKVNKPSV+FIDEIDALATKRQGIF +S+D  YNAATQERETTLNQLL ELDG
Sbjct  490   IRDLFKRAKVNKPSVVFIDEIDALATKRQGIFKESTDHLYNAATQERETTLNQLLIELDG  549

Query  1497  FDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETV  1318
             FDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPP +KGR  ILK+HA KVK+SE+V
Sbjct  550   FDTGKGVIFLAATNRKDLLDPALLRPGRFDRKIRIRPPGSKGRHDILKIHAGKVKMSESV  609

Query  1317  DLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLG  1138
             DL+SYAQNLPGWSGA+LAQL+QEAALVAVRK HNSIL+SDMDDAVDRLT+GPK +GIDLG
Sbjct  610   DLSSYAQNLPGWSGARLAQLVQEAALVAVRKRHNSILQSDMDDAVDRLTIGPKLIGIDLG  669

Query  1137  HQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFE  958
             +QGQCRRATTEVG ALTSHLLR YE+A VECCDRISI PRGQTLSQ+VFHRLDDESYMFE
Sbjct  670   YQGQCRRATTEVGVALTSHLLRRYEHAIVECCDRISIVPRGQTLSQLVFHRLDDESYMFE  729

Query  957   RRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGE  778
             RRPQLLHRLQVLLGGRAAEEVIYGRDTSKAS  YLADA+WLARK++T+WNLENPM IHGE
Sbjct  730   RRPQLLHRLQVLLGGRAAEEVIYGRDTSKASTDYLADASWLARKILTIWNLENPMVIHGE  789

Query  777   PLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallr  598
             P PWRKS KFVGPRLDFEGSLYDDY+LI+PPLNF +DD V++R+E LIRD Y KT++LLR
Sbjct  790   PPPWRKSVKFVGPRLDFEGSLYDDYNLIQPPLNFKMDDQVAQRSEELIRDMYLKTVSLLR  849

Query  597   qhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEAN  418
             +HHAALLKTVKVLL Q+EI GEEI+FIL  YPP TP   LLEE    +LPL     +E +
Sbjct  850   RHHAALLKTVKVLLDQEEIRGEEIEFILDKYPPQTPL-YLLEEEYAANLPL----TKEVH  904

Query  417   EIEYSL  400
             ++EY+L
Sbjct  905   DLEYAL  910



>emb|CDY03504.1| BnaC01g15780D [Brassica napus]
Length=936

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/884 (72%), Positives = 741/884 (84%), Gaps = 10/884 (1%)
 Frame = -2

Query  3084  RSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKV-Gdklltlkek  2908
             R+P      TI  + K     ++ GG  DDFVTRVLKENPSQVE RY+V G      + +
Sbjct  34    RAPILRRSFTILCELKPGPSPSNPGG--DDFVTRVLKENPSQVEPRYRVNGKLYNPKERE  91

Query  2907  edlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIF  2728
             +  +      GA E ++R   K  + K +E G+    E VYL +ILRE+KGKLYVPEQ+F
Sbjct  92    DLSKGGEARRGAFEFIKR---KTENEKEKERGEVVN-ESVYLSDILREYKGKLYVPEQVF  147

Query  2727  RSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKED-NAANYGFGFRDFVVELK  2551
                LSEEEEFEKNV+ELPKM  EDF+K ++ DKVKLLT KE+ +  +Y  G+RDF+V+LK
Sbjct  148   GQELSEEEEFEKNVKELPKMSLEDFRKAMENDKVKLLTSKEEASGVSYSGGYRDFIVDLK  207

Query  2550  EMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT-WVGKLPEQPHPVASKIS  2374
             E+PG KSLQRTKW+MRL + +AQ+LL EY+GP+YEVE  MMT WVGK+ + P+PVAS IS
Sbjct  208   EIPGVKSLQRTKWSMRLGVGEAQALLKEYSGPQYEVESNMMTSWVGKVTDFPNPVASSIS  267

Query  2373  TRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVF  2194
             +R+MVELGM++A++ AAAA+ G +LASAVFAVTSFAF  TVYVVWP+ KPF+K F G+  
Sbjct  268   SRVMVELGMVSAVIAAAAAVVGGFLASAVFAVTSFAFVTTVYVVWPIVKPFLKLFIGVFV  327

Query  2193  DVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRR  2017
               +ER W+ I D  A  G+F++    YTFGG+S+S+E+LKPILLV +TMVLLVRFTLSRR
Sbjct  328   GAIERSWEYIADVLADGGIFSRISDFYTFGGMSSSVEMLKPILLVVMTMVLLVRFTLSRR  387

Query  2016  PKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDK  1837
             PKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV YLKNP+LFDK
Sbjct  388   PKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFGDVAGIDEAVDELQELVKYLKNPDLFDK  447

Query  1836  MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKR  1657
             MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKR
Sbjct  448   MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKR  507

Query  1656  AKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGV  1477
             AKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGV
Sbjct  508   AKVNKPSVIFIDEIDALATRRQGIFKENSDQSYNAATQERETTLNQLLIELDGFDTGKGV  567

Query  1476  IFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQ  1297
             IFLGATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++VDL+SYA 
Sbjct  568   IFLGATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKIHASKVKMSDSVDLSSYAS  627

Query  1296  NLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR  1117
             NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP R+G++LGH+GQCRR
Sbjct  628   NLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPTRIGLELGHEGQCRR  687

Query  1116  ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLH  937
             ATTEVG A+TSHLL  YE+AK+E CDRISI PRGQTLSQVVFHRLDDESYMF RRPQLLH
Sbjct  688   ATTEVGVAITSHLLLRYEDAKIERCDRISIIPRGQTLSQVVFHRLDDESYMFGRRPQLLH  747

Query  936   RLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKS  757
             RLQVLLG RAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGEP PWRK 
Sbjct  748   RLQVLLGARAAEEVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMVIHGEPPPWRKR  807

Query  756   PKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaall  577
              +FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V++R+E LI   Y KT+ALL+Q+  ALL
Sbjct  808   AQFVGPRLDFEGSLYDDYDLVEPPINFNMDDEVAERSEELISQMYNKTVALLKQNQTALL  867

Query  576   ktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             KTVKVLL QKEISGE IDFIL +YPP T    LL+E +PGSLP 
Sbjct  868   KTVKVLLNQKEISGEAIDFILDHYPPETRLDSLLQEQNPGSLPF  911



>ref|XP_009137556.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic 
[Brassica rapa]
Length=932

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/884 (72%), Positives = 737/884 (83%), Gaps = 14/884 (2%)
 Frame = -2

Query  3084  RSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKV-Gdklltlkek  2908
             R+P      TI  + K     ++  G  DDFVTRVLKENPSQVE RY+V G      + +
Sbjct  34    RAPILRRSFTILCELKPGPSPSNPAG--DDFVTRVLKENPSQVEPRYRVNGKLYNPKERE  91

Query  2907  edlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIF  2728
                +      GA E ++R        K++++  +   E VYL +ILRE+KGKLYVPEQ+F
Sbjct  92    GLSKGGEARRGAFEFIKR--------KTEKEKSEDVNESVYLSDILREYKGKLYVPEQVF  143

Query  2727  RSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKED-NAANYGFGFRDFVVELK  2551
                LSEEEEFEK+V+ELPKM  EDF+K ++ DKVKLLT KE+ +  +Y  G+RDF+V+LK
Sbjct  144   GQELSEEEEFEKSVKELPKMSLEDFRKAMENDKVKLLTSKEEASGVSYSGGYRDFIVDLK  203

Query  2550  EMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT-WVGKLPEQPHPVASKIS  2374
             E+PG KSLQRTKW+MRL + +AQ+LL EY+GP+YEVE  MMT WVGK+ + P+PVAS IS
Sbjct  204   EIPGVKSLQRTKWSMRLGVGEAQALLKEYSGPQYEVESNMMTSWVGKVTDFPNPVASSIS  263

Query  2373  TRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVF  2194
             +R+MVELGM+TA++ A+AA+ G +LASAVFAVTSFAF  TVYVVWP+ KPF+K F G+  
Sbjct  264   SRVMVELGMVTAVIAASAAVVGGFLASAVFAVTSFAFVTTVYVVWPIVKPFLKLFIGVFV  323

Query  2193  DVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRR  2017
               +ER W+ I D  A  G+F++    YTFGG+S+S+E+LKPILLV +TMVLLVRFTLSRR
Sbjct  324   GGIERSWEYIADVLADGGIFSRISDFYTFGGMSSSVEMLKPILLVVMTMVLLVRFTLSRR  383

Query  2016  PKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDK  1837
             PKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV YLKNP+LFDK
Sbjct  384   PKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFGDVAGIDEAVDELQELVKYLKNPDLFDK  443

Query  1836  MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKR  1657
             MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKR
Sbjct  444   MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKR  503

Query  1656  AKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGV  1477
             AKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGV
Sbjct  504   AKVNKPSVIFIDEIDALATRRQGIFKENSDQSYNAATQERETTLNQLLIELDGFDTGKGV  563

Query  1476  IFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQ  1297
             IFLGATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++VDL+SYA 
Sbjct  564   IFLGATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKIHASKVKMSDSVDLSSYAS  623

Query  1296  NLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR  1117
             NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP R+G++LGH+GQCRR
Sbjct  624   NLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPTRIGLELGHEGQCRR  683

Query  1116  ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLH  937
             A TEVG A+TSHLL  YENAK+E CDRISI PRGQTLSQVVFHRLDDESYMF RRPQLLH
Sbjct  684   AATEVGVAITSHLLLRYENAKIERCDRISIIPRGQTLSQVVFHRLDDESYMFGRRPQLLH  743

Query  936   RLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKS  757
             RLQVLLG RAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGEP PWRK 
Sbjct  744   RLQVLLGARAAEEVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMVIHGEPPPWRKR  803

Query  756   PKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaall  577
              +FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V++R+E LI   Y KT+ALL+Q+  ALL
Sbjct  804   AQFVGPRLDFEGSLYDDYDLVEPPINFNMDDEVAERSEELISQMYNKTVALLKQNQTALL  863

Query  576   ktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             KTVKVLL QKEISGE IDFIL NYPP T    LL+E +PGSLP 
Sbjct  864   KTVKVLLNQKEISGEAIDFILDNYPPETRLDSLLQEQNPGSLPF  907



>gb|KFK28948.1| hypothetical protein AALP_AA7G069500 [Arabis alpina]
Length=931

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/851 (74%), Positives = 726/851 (85%), Gaps = 8/851 (1%)
 Frame = -2

Query  2994  FVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQED  2815
             FVTRVLKENPSQVE RYKVGDKL  LKE+E L K S  TG  E ++R   K  S+   E 
Sbjct  63    FVTRVLKENPSQVEPRYKVGDKLYNLKEREGLSKSSNVTGPFEFIKR---KLGSKMETEK  119

Query  2814  GDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKT  2635
               + + E VYL +ILRE+KGKLYVPEQ+F + LSEEEEFEKNV+ELPKM  +DF+K +K 
Sbjct  120   SSELENESVYLSDILREYKGKLYVPEQVFGAELSEEEEFEKNVKELPKMSLDDFRKAMKN  179

Query  2634  DKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGP  2455
             DKVKLLT K+D    +G  +R+F+V LKE+PG KSLQRTKW+M+L++ +AQ+LL EYTGP
Sbjct  180   DKVKLLTSKDD----FGSEYREFIVHLKEIPGVKSLQRTKWSMKLEVGEAQALLKEYTGP  235

Query  2454  RYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavt  2275
             +YE+E+ M +WVGK+ + P+PVAS IS+R+MVELGM+TA++ AAA + G +LASAVFAVT
Sbjct  236   QYEIERHMTSWVGKVADFPNPVASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVT  295

Query  2274  sfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGIS  2098
             SF F  TVYVVWP+ KPF+K F G+     ER W+ + D     G+F +    YTFGG+S
Sbjct  296   SFVFVTTVYVVWPIVKPFLKLFIGIFVGGFERSWEYLVDFLGDGGIFTRLSDFYTFGGLS  355

Query  2097  ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFN  1918
             +S+E+LKPILLV +TMVLLVRFTLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV F 
Sbjct  356   SSVEMLKPILLVVMTMVLLVRFTLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFG  415

Query  1917  DVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVP  1738
             DVAGI++AV+ELQELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVP
Sbjct  416   DVAGIDEAVDELQELVKYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVP  475

Query  1737  FYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQY  1558
             FYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +++D  Y
Sbjct  476   FYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKENTDQLY  535

Query  1557  NAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNA  1378
             NAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNA
Sbjct  536   NAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNA  595

Query  1377  KGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSD  1198
             KGRL ILK+HA KVK+S+TVDL+SYA NLPGWSGAKLAQL QEAALVAVRK H+SIL+SD
Sbjct  596   KGRLDILKIHASKVKMSDTVDLSSYASNLPGWSGAKLAQLCQEAALVAVRKTHSSILQSD  655

Query  1197  MDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPR  1018
             MDDAVDRLTVGP R+G++LGHQGQCRRATTEVG A+TSHLL  Y+NAK+E CDRISI PR
Sbjct  656   MDDAVDRLTVGPTRIGLELGHQGQCRRATTEVGVAITSHLLLRYDNAKIERCDRISIIPR  715

Query  1017  GQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATW  838
             GQTLSQVVFHRLDDESYMF R PQLLHRLQVLLGGRAAEEVIYG DTSKASV YL+DA+W
Sbjct  716   GQTLSQVVFHRLDDESYMFGRLPQLLHRLQVLLGGRAAEEVIYGSDTSKASVEYLSDASW  775

Query  837   LARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDV  658
             LARK++T+WNLENPM IHGEP PWRK  +FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V
Sbjct  776   LARKILTIWNLENPMVIHGEPPPWRKRVQFVGPRLDFEGSLYDDYDLVEPPINFNMDDEV  835

Query  657   SKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLL  478
             ++R+E LI   Y KT +LL Q+  ALLKTVKVLL QKEISGE ID+IL +YPP TP + L
Sbjct  836   AQRSEELISQMYNKTFSLLTQNQTALLKTVKVLLNQKEISGEAIDYILDHYPPQTPLNSL  895

Query  477   LEEGDPGSLPL  445
             L+E +PGSLP 
Sbjct  896   LQEQNPGSLPF  906



>ref|XP_007040560.1| FtsH extracellular protease family isoform 2 [Theobroma cacao]
 gb|EOY25061.1| FtsH extracellular protease family isoform 2 [Theobroma cacao]
Length=896

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/845 (74%), Positives = 725/845 (86%), Gaps = 8/845 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             +R + L   R    R+   +   T+  + + S+   +S    DDFVTRVLK+NPSQVE R
Sbjct  27    RRIKPLNLTRKFQSRTSFLHRSFTVLCELQSSQPGETSKPKGDDFVTRVLKQNPSQVEPR  86

Query  2946  YKVGdklltlkekedlqkKSFDTGALEILRR-LNLKAFSRKSQEDGDQ-----GKPEEVY  2785
             Y VG+K+ TLKEKEDL K+  +   +EIL++ LN KA  +    + ++      + + VY
Sbjct  87    YLVGNKIYTLKEKEDLSKR-INLSLIEILKKKLNSKAKLKNESNESERETERSSENDNVY  145

Query  2784  LKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKE  2605
             L +ILRE++GKLYVPEQIF   LSEEEEFEKN+EELPKM  EDF+K +K+DKVKLLT KE
Sbjct  146   LSDILREYRGKLYVPEQIFGEELSEEEEFEKNLEELPKMSLEDFRKAMKSDKVKLLTSKE  205

Query  2604  DNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT  2425
              +  +Y  G RDFVV+LK++PG KSLQRTKW MRLD  +AQ+LL+EY G RYE+E+ M +
Sbjct  206   VSGVSYVGGHRDFVVDLKDIPGDKSLQRTKWAMRLDETEAQTLLSEYAGKRYEIERHMTS  265

Query  2424  WVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyv  2245
             WVGK+PE PHPVAS IS+R+MVELGM+TA+M AAA I G +LA+AVFAVTSF F  TVYV
Sbjct  266   WVGKVPEYPHPVASSISSRMMVELGMVTAVMAAAAVIVGGFLAAAVFAVTSFVFVTTVYV  325

Query  2244  VWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPIL  2068
             VWP+ KPF+K F G++F +LERVWD + D F+  G+F+K Y+ YTFGG+SAS+E+LKPI 
Sbjct  326   VWPIVKPFVKLFLGIIFSILERVWDNLVDVFSDGGIFSKLYEFYTFGGVSASLEMLKPIT  385

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             +V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVE
Sbjct  386   VVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVE  445

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV
Sbjct  446   ELQELVRYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  505

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             EVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETT
Sbjct  506   EVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETT  565

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+H
Sbjct  566   LNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLQILKIH  625

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             A KVK+SE+VDL+SYA NLPGW+GAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTV
Sbjct  626   ASKVKMSESVDLSSYANNLPGWTGAKLAQLVQEAALVAVRKRHDSILQSDMDDAVDRLTV  685

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             GPKRVGI+LGHQGQCRRATTE+G A+TSHLLR YENA+VECCDRISI PRGQTLSQVVFH
Sbjct  686   GPKRVGIELGHQGQCRRATTELGVAMTSHLLRRYENAEVECCDRISIVPRGQTLSQVVFH  745

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWN  808
             RLDDESYMFERRPQLLHRLQV LGGRAAEEVIYGRDTS+AS++YLADA+WLARK++T+WN
Sbjct  746   RLDDESYMFERRPQLLHRLQVFLGGRAAEEVIYGRDTSRASLNYLADASWLARKILTIWN  805

Query  807   LENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRD  628
             LENPM IHGEP PWRK  KFVGPRLDFEGSLYDDYDLIEPP+NF+LDD++++R+E L+RD
Sbjct  806   LENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDDYDLIEPPVNFNLDDEIAQRSEELLRD  865

Query  627   TYAKT  613
              YA+T
Sbjct  866   MYART  870



>ref|XP_009394180.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH isoform X2 
[Musa acuminata subsp. malaccensis]
Length=961

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/874 (70%), Positives = 733/874 (84%), Gaps = 6/874 (1%)
 Frame = -2

Query  3018  SSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKA  2839
             +    DDDF+TRVLKENPSQVE ++ VGD+ +TL+EK+   K   + G +++L+RL  ++
Sbjct  77    NGSARDDDFITRVLKENPSQVEPKFLVGDRFVTLREKQRSGK-DLNFGVIQLLKRLFGRS  135

Query  2838  FSRKSQEDGDQGK----PEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPK  2671
              +RK   +G   K     E VYLK++LRE KGKLYVPE++FR NLSEEEEFEKNV+ELP 
Sbjct  136   GTRKEGVEGGGRKEGEAAEPVYLKDLLREFKGKLYVPEEVFRENLSEEEEFEKNVQELPL  195

Query  2670  MEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLN  2491
             M FEDFQK+LK DK+KLLT K     +    +RDF+V+LKE+PG +++Q+TKW +RL  +
Sbjct  196   MSFEDFQKHLKADKIKLLTSKSTFDYSSEIYYRDFLVDLKEIPGDRNIQKTKWVIRLSAS  255

Query  2490  QAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaia  2311
             QA++ L EY GP+YE+EK  M++VGK  E PHPVAS IS+R+MVEL M TAL+ AAAA+ 
Sbjct  256   QARAALEEYNGPQYEIEKHTMSYVGKSLEYPHPVASSISSRVMVELAMATALIAAAAAVI  315

Query  2310  gsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFA  2134
               ++ASA FA+TSF +A T+Y VWP+++PF+K   G+V  + ER+W+ + D F+  G F+
Sbjct  316   VGFVASAAFAMTSFLYAATIYFVWPLSRPFVKLVLGIVSSIAERMWENVVDIFSEGGFFS  375

Query  2133  KFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQ  1954
             K Y+ YTFGG+SAS+ +LKPI+LV +TMVLLVRFTLSRRPKNFRKWDIWQGIEF  SK Q
Sbjct  376   KIYEFYTFGGVSASLVMLKPIMLVLITMVLLVRFTLSRRPKNFRKWDIWQGIEFGHSKSQ  435

Query  1953  ARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTL  1774
             ARVDG TGV F+DVAGI+ AVEELQELV YLKNPELFDK+GIKPPHGVLLEGPPGCGKTL
Sbjct  436   ARVDGSTGVKFSDVAGIDDAVEELQELVRYLKNPELFDKIGIKPPHGVLLEGPPGCGKTL  495

Query  1773  VAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKR  1594
             VAKAIAGEA VPFYQMAGSEFVEVLVGVG+ARIRDLF RAKVNKP+V+F+DEIDALAT+R
Sbjct  496   VAKAIAGEAHVPFYQMAGSEFVEVLVGVGSARIRDLFMRAKVNKPAVVFVDEIDALATRR  555

Query  1593  QGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGR  1414
             QGIFN+S++  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNRMDLLDPALLRPGR
Sbjct  556   QGIFNESTNYFYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRMDLLDPALLRPGR  615

Query  1413  FDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalva  1234
             FDRKIRIRPP AKGRL ILKVHARKVK+S TVDL++YAQNLPGW+GAKLAQL+QE+ALVA
Sbjct  616   FDRKIRIRPPGAKGRLDILKVHARKVKMSPTVDLSTYAQNLPGWTGAKLAQLVQESALVA  675

Query  1233  VRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAK  1054
             VR+GH SIL+SDMDDAVDRLTVGPKR+GI+LGHQGQCRRA TEVG ALTSHLLR YENA+
Sbjct  676   VRRGHESILQSDMDDAVDRLTVGPKRLGIELGHQGQCRRAVTEVGVALTSHLLRRYENAR  735

Query  1053  VECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS  874
             VE C+RISI PRGQ LSQ+VF  LD+ESYMFERRPQLLHRLQV LGGRAAEEVIYGRDTS
Sbjct  736   VEFCERISIIPRGQALSQIVFLHLDEESYMFERRPQLLHRLQVFLGGRAAEEVIYGRDTS  795

Query  873   KASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLI  694
             KAS+ YL DAT LARKM+T+WNLENPMTIHGE  PW+K PKF+GP+LDFE  LYD Y L+
Sbjct  796   KASLKYLQDATCLARKMLTIWNLENPMTIHGESFPWKKKPKFIGPKLDFEKELYDHYGLV  855

Query  693   EPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFIL  514
             EP +NFDLDD V++RTE L+RD Y KT++LL+ H AAL K+VKVLL  KEISG++I+FIL
Sbjct  856   EPSINFDLDDAVARRTEELLRDMYEKTVSLLKTHVAALAKSVKVLLDNKEISGDQIEFIL  915

Query  513   SNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEI  412
             ++YP  TP  L+LEE DPGSLP F  + + +  +
Sbjct  916   NSYPAETPVKLILEEKDPGSLPFFQVDADRSTAL  949



>ref|XP_010439111.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Camelina 
sativa]
Length=945

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/899 (72%), Positives = 754/899 (84%), Gaps = 9/899 (1%)
 Frame = -2

Query  3123  RHQNL-KFPRNIARRSPPCYCPRTIFGQAKYSEQSNS-SGGNDDDFVTRVLKENPSQVET  2950
             +H N   F      R P      T+  + K S ++N       DDFVTRVLKENPSQVE 
Sbjct  25    KHANASNFSAKTRWRGPILRRSFTVLCELKKSGETNKPQAAVVDDFVTRVLKENPSQVEP  84

Query  2949  RYKVGdklltlkekedlqk--KSFDTGALEILRR-LNLKAFSRKSQEDGDQGKPEEVYLK  2779
             RY+VGDKL  LKE+EDL K   +  +GA E +RR L+ K    +++E G +   E VYL 
Sbjct  85    RYRVGDKLYNLKEREDLSKGGANASSGAFEFIRRKLDSKM---ETEERGSESGNESVYLS  141

Query  2778  EILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDN  2599
             +ILRE++GKLYVPEQ+F   LSEE+EFE+ V++LPKM  EDF+K +K DKVKLLT KE +
Sbjct  142   DILREYRGKLYVPEQVFGPELSEEDEFERTVKDLPKMSLEDFRKVMKNDKVKLLTSKEVS  201

Query  2598  AANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWV  2419
              + Y  G+RDFVV+LKE+PG KSLQRTKW+M+L+  +AQSLL EYTGP+YE+E+ + +WV
Sbjct  202   VSPYTSGYRDFVVDLKEIPGVKSLQRTKWSMKLEAGEAQSLLKEYTGPQYEIERHITSWV  261

Query  2418  GKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVW  2239
             GK+ + P+PVAS IS+R+MVELGM+TA++ AAA + G +LASAVFAVTSFAF  TVYVVW
Sbjct  262   GKVADFPNPVASSISSRVMVELGMVTAVIAAAAVVVGGFLASAVFAVTSFAFVTTVYVVW  321

Query  2238  PVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLV  2062
             P+AKPF+K F G+   VLE+VWD + D  A  G+F++    YTFGG+S+S+E+LKPILLV
Sbjct  322   PIAKPFLKLFVGIFLVVLEKVWDYLVDVLADGGIFSRISDFYTFGGVSSSLEMLKPILLV  381

Query  2061  FLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEEL  1882
              +TMVLLVRFTLSRRPKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+EL
Sbjct  382   VVTMVLLVRFTLSRRPKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFADVAGIDEAVDEL  441

Query  1881  QELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEV  1702
             QELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEV
Sbjct  442   QELVKYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEV  501

Query  1701  LVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLN  1522
             LVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLN
Sbjct  502   LVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKENSDQLYNAATQERETTLN  561

Query  1521  QLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHAR  1342
             QLL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIR+RPPNAKGRL ILK+HA 
Sbjct  562   QLLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRVRPPNAKGRLDILKIHAS  621

Query  1341  KVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGP  1162
             KVK+S++VDL+SYA NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP
Sbjct  622   KVKMSDSVDLSSYASNLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGP  681

Query  1161  KRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRL  982
              R+G++LGHQGQCRRATTEVG A+TSHLL  +ENAK+E CDR+SI PRGQTLSQVVFHRL
Sbjct  682   TRIGLELGHQGQCRRATTEVGVAITSHLLLRHENAKIERCDRVSIIPRGQTLSQVVFHRL  741

Query  981   DDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLE  802
             DDESYMF R PQLLHRLQVLL GRAAE+VIYG DTSKASV YL+DA+WLARK++T+WNLE
Sbjct  742   DDESYMFGRFPQLLHRLQVLLAGRAAEQVIYGSDTSKASVDYLSDASWLARKILTIWNLE  801

Query  801   NPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTY  622
             NPM IHGEP PWRK  +FVGPRLDFEGSLY+D DL+EPP+NF++DD+V++R+E LI   Y
Sbjct  802   NPMVIHGEPPPWRKRAQFVGPRLDFEGSLYEDDDLVEPPINFNMDDEVAQRSEELICQMY  861

Query  621   AKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
              KT+ALL Q+  ALLKT+KVLL QKEISGE IDFIL  YPP TP +LLL+E +PGSLP 
Sbjct  862   DKTVALLTQNQTALLKTIKVLLNQKEISGEAIDFILDQYPPETPLNLLLQEQNPGSLPF  920



>emb|CDY47609.1| BnaA01g13560D [Brassica napus]
Length=932

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/884 (71%), Positives = 736/884 (83%), Gaps = 14/884 (2%)
 Frame = -2

Query  3084  RSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKV-Gdklltlkek  2908
             R+P      TI  + K     ++  G  DDFVTRVLKEN SQVE RY+V G      + +
Sbjct  34    RAPILRRSFTILCELKPGPSPSNPAG--DDFVTRVLKENTSQVEPRYRVNGKLYNPKERE  91

Query  2907  edlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIF  2728
                +      GA E ++R        K++++  +   E VYL +ILRE+KGKLYVPEQ+F
Sbjct  92    GLSKGGEARRGAFEFIKR--------KTEKEKSEDVNESVYLSDILREYKGKLYVPEQVF  143

Query  2727  RSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKED-NAANYGFGFRDFVVELK  2551
                LSEEEEFEK+V+ELPKM  EDF+K ++ DKVKLLT KE+ +  +Y  G+RDF+V+LK
Sbjct  144   GQELSEEEEFEKSVKELPKMSLEDFRKAMENDKVKLLTSKEEASGVSYSGGYRDFIVDLK  203

Query  2550  EMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT-WVGKLPEQPHPVASKIS  2374
             E+PG KSLQRTKW+MRL + +AQ+LL EY+GP+YEVE   MT WVGK+ + P+PVAS IS
Sbjct  204   EIPGVKSLQRTKWSMRLGVGEAQALLKEYSGPQYEVESNTMTSWVGKVTDFPNPVASSIS  263

Query  2373  TRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVF  2194
             +R+MVELGM+TA++ A+AA+ G +LASAVFAVTSFAF  TVYVVWP+ KPF+K F G+  
Sbjct  264   SRVMVELGMVTAVIAASAAVVGGFLASAVFAVTSFAFVTTVYVVWPIVKPFLKLFIGVFV  323

Query  2193  DVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRR  2017
               +ER W+ I D  A  G+F++    YTFGG+S+S+E+LKPILLV +TMVLLVRFTLSRR
Sbjct  324   GGIERSWEYIADVLADGGIFSRISDFYTFGGMSSSVEMLKPILLVVMTMVLLVRFTLSRR  383

Query  2016  PKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDK  1837
             PKNFRKWD+WQGI FSQSK +ARVDG TGV F DVAGI++AV+ELQELV YLKNP+LFDK
Sbjct  384   PKNFRKWDLWQGIAFSQSKAEARVDGSTGVKFGDVAGIDEAVDELQELVKYLKNPDLFDK  443

Query  1836  MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKR  1657
             MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKR
Sbjct  444   MGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKR  503

Query  1656  AKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGV  1477
             AKVNKPSVIFIDEIDALAT+RQGIF ++SD  YNAATQERETTLNQLL ELDGFDTGKGV
Sbjct  504   AKVNKPSVIFIDEIDALATRRQGIFKENSDQSYNAATQERETTLNQLLIELDGFDTGKGV  563

Query  1476  IFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQ  1297
             IFLGATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+HA KVK+S++VDL+SYA 
Sbjct  564   IFLGATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLDILKIHASKVKMSDSVDLSSYAS  623

Query  1296  NLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR  1117
             NLPGWSGAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTVGP R+G++LGH+GQCRR
Sbjct  624   NLPGWSGAKLAQLVQEAALVAVRKTHSSILQSDMDDAVDRLTVGPTRIGLELGHEGQCRR  683

Query  1116  ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLH  937
             ATTEVG A+TSHLL  YENAK+E CDRISI PRGQTLSQVVFHRLDDESYMF RRPQLLH
Sbjct  684   ATTEVGVAITSHLLLRYENAKIERCDRISIIPRGQTLSQVVFHRLDDESYMFGRRPQLLH  743

Query  936   RLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKS  757
             RLQVLLG RAAEEVIYG DTSKASV YL+DA+WLARK++T+WNLENPM IHGEP PWRK 
Sbjct  744   RLQVLLGARAAEEVIYGSDTSKASVDYLSDASWLARKILTIWNLENPMVIHGEPPPWRKR  803

Query  756   PKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaall  577
              +FVGPRLDFEGSLYDDYDL+EPP+NF++DD+V++R+E LI   Y KT+ALL+Q+  ALL
Sbjct  804   AQFVGPRLDFEGSLYDDYDLVEPPINFNMDDEVAERSEELISQMYNKTVALLKQNQTALL  863

Query  576   ktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPL  445
             KTVKVLL QKEISGE IDFIL +YPP T    LL+E +PGSLP 
Sbjct  864   KTVKVLLNQKEISGEAIDFILDHYPPETRLDSLLQEQNPGSLPF  907



>ref|XP_009394179.1| PREDICTED: uncharacterized protein LOC103979718 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=988

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/901 (68%), Positives = 733/901 (81%), Gaps = 33/901 (4%)
 Frame = -2

Query  3018  SSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKA  2839
             +    DDDF+TRVLKENPSQVE ++ VGD+ +TL+EK+   K   + G +++L+RL  ++
Sbjct  77    NGSARDDDFITRVLKENPSQVEPKFLVGDRFVTLREKQRSGK-DLNFGVIQLLKRLFGRS  135

Query  2838  FSRKSQEDGDQGK----PEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPK  2671
              +RK   +G   K     E VYLK++LRE KGKLYVPE++FR NLSEEEEFEKNV+ELP 
Sbjct  136   GTRKEGVEGGGRKEGEAAEPVYLKDLLREFKGKLYVPEEVFRENLSEEEEFEKNVQELPL  195

Query  2670  MEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLN  2491
             M FEDFQK+LK DK+KLLT K     +    +RDF+V+LKE+PG +++Q+TKW +RL  +
Sbjct  196   MSFEDFQKHLKADKIKLLTSKSTFDYSSEIYYRDFLVDLKEIPGDRNIQKTKWVIRLSAS  255

Query  2490  QAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaia  2311
             QA++ L EY GP+YE+EK  M++VGK  E PHPVAS IS+R+MVEL M TAL+ AAAA+ 
Sbjct  256   QARAALEEYNGPQYEIEKHTMSYVGKSLEYPHPVASSISSRVMVELAMATALIAAAAAVI  315

Query  2310  gsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFA  2134
               ++ASA FA+TSF +A T+Y VWP+++PF+K   G+V  + ER+W+ + D F+  G F+
Sbjct  316   VGFVASAAFAMTSFLYAATIYFVWPLSRPFVKLVLGIVSSIAERMWENVVDIFSEGGFFS  375

Query  2133  KFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQ  1954
             K Y+ YTFGG+SAS+ +LKPI+LV +TMVLLVRFTLSRRPKNFRKWDIWQGIEF  SK Q
Sbjct  376   KIYEFYTFGGVSASLVMLKPIMLVLITMVLLVRFTLSRRPKNFRKWDIWQGIEFGHSKSQ  435

Query  1953  ARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTL  1774
             ARVDG TGV F+DVAGI+ AVEELQELV YLKNPELFDK+GIKPPHGVLLEGPPGCGKTL
Sbjct  436   ARVDGSTGVKFSDVAGIDDAVEELQELVRYLKNPELFDKIGIKPPHGVLLEGPPGCGKTL  495

Query  1773  VAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKR  1594
             VAKAIAGEA VPFYQMAGSEFVEVLVGVG+ARIRDLF RAKVNKP+V+F+DEIDALAT+R
Sbjct  496   VAKAIAGEAHVPFYQMAGSEFVEVLVGVGSARIRDLFMRAKVNKPAVVFVDEIDALATRR  555

Query  1593  QGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGR  1414
             QGIFN+S++  YNAATQERETTLNQLL ELDGFDTGKGVIFLGATNRMDLLDPALLRPGR
Sbjct  556   QGIFNESTNYFYNAATQERETTLNQLLIELDGFDTGKGVIFLGATNRMDLLDPALLRPGR  615

Query  1413  FDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalva  1234
             FDRKIRIRPP AKGRL ILKVHARKVK+S TVDL++YAQNLPGW+GAKLAQL+QE+ALVA
Sbjct  616   FDRKIRIRPPGAKGRLDILKVHARKVKMSPTVDLSTYAQNLPGWTGAKLAQLVQESALVA  675

Query  1233  VRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAK  1054
             VR+GH SIL+SDMDDAVDRLTVGPKR+GI+LGHQGQCRRA TEVG ALTSHLLR YENA+
Sbjct  676   VRRGHESILQSDMDDAVDRLTVGPKRLGIELGHQGQCRRAVTEVGVALTSHLLRRYENAR  735

Query  1053  VECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQ------------------  928
             VE C+RISI PRGQ LSQ+VF  LD+ESYMFERRPQLLHRLQ                  
Sbjct  736   VEFCERISIIPRGQALSQIVFLHLDEESYMFERRPQLLHRLQVCLWKYYCSIDLPNFLGL  795

Query  927   ---------VLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEP  775
                      V LGGRAAEEVIYGRDTSKAS+ YL DAT LARKM+T+WNLENPMTIHGE 
Sbjct  796   FCLYVSFIKVFLGGRAAEEVIYGRDTSKASLKYLQDATCLARKMLTIWNLENPMTIHGES  855

Query  774   LPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrq  595
              PW+K PKF+GP+LDFE  LYD Y L+EP +NFDLDD V++RTE L+RD Y KT++LL+ 
Sbjct  856   FPWKKKPKFIGPKLDFEKELYDHYGLVEPSINFDLDDAVARRTEELLRDMYEKTVSLLKT  915

Query  594   hhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANE  415
             H AAL K+VKVLL  KEISG++I+FIL++YP  TP  L+LEE DPGSLP F  + + +  
Sbjct  916   HVAALAKSVKVLLDNKEISGDQIEFILNSYPAETPVKLILEEKDPGSLPFFQVDADRSTA  975

Query  414   I  412
             +
Sbjct  976   L  976



>ref|XP_004503606.1| PREDICTED: ATP-dependent zinc metalloprotease FtsH-like [Cicer 
arietinum]
Length=919

 Score =  1100 bits (2845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/917 (66%), Positives = 739/917 (81%), Gaps = 30/917 (3%)
 Frame = -2

Query  3129  QKRHQNLKFPRN----IARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPS  2962
              +RH+ L+  RN    + RR     C           E S+SS     DFV RVL+ENPS
Sbjct  17    HQRHKTLRSNRNRTHHLLRRPFTVLC-----------ESSSSS----HDFVKRVLEENPS  61

Query  2961  QVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYL  2782
             QV  +Y +G+KL T ++KE+L KKS D     + ++L+LK   RK + +    + + V L
Sbjct  62    QVPPKYLIGEKLYTSQQKENLAKKSNDGIFYVLKKKLSLKNSQRKKESEVLGEREDSVVL  121

Query  2781  KEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKED  2602
              ++L+E+KGKLYVPEQIF + LSEEEEF +N++ LPKM  EDF K L  DK+K +T KED
Sbjct  122   NDLLKEYKGKLYVPEQIFGTPLSEEEEFNENLKTLPKMSVEDFAKALSKDKIKSVTSKED  181

Query  2601  NAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVE--KQMM  2428
                 YG G+R ++VELKE+PG K LQ TKW +R+D ++AQ++L EY GPRYE+   + M+
Sbjct  182   ----YGIGYRSYIVELKEIPGDKRLQATKWVLRVDNSEAQAILEEYYGPRYEIASARTMV  237

Query  2427  TWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvy  2248
             +WVGK+ E PHPVAS IS+R++ ELG +T ++  AA + G +L++A F  TSF F   VY
Sbjct  238   SWVGKIAEYPHPVASSISSRVVAELGAVTVVLGLAAVLVGGFLSAAAFVATSFIFVTAVY  297

Query  2247  vVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFGVF-AKFYQVYTFGGISASIEVLKPI  2071
             V WP++KP + FF G+   +LERVWD + D F  G F +K Y+++T GG+++S+++L+ +
Sbjct  298   VAWPISKPILNFFLGVAVSMLERVWDNVLDFFIDGAFLSKIYELFTAGGVASSVQILRIV  357

Query  2070  LLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAV  1891
             + V + M+LLVRFTLSR+PKNFRKWD+WQG+ FS SK +ARVDG TG+ F+DVAGI+ AV
Sbjct  358   MPVVVGMILLVRFTLSRKPKNFRKWDLWQGMNFSLSKAEARVDGSTGIKFSDVAGIDGAV  417

Query  1890  EELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  1711
             EELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF
Sbjct  418   EELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  477

Query  1710  VEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERET  1531
             VE LVGVG+ARIRDLFKRAKVNKPSV+FIDEIDALAT+RQG F +S+D+ YNAATQERET
Sbjct  478   VEFLVGVGSARIRDLFKRAKVNKPSVVFIDEIDALATRRQGTFKESTDNLYNAATQERET  537

Query  1530  TLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKV  1351
             TLNQLL ELDGFDTGKG+IFL ATNR DLLDPALLRPGR DRKI+I PP+AKGRL IL +
Sbjct  538   TLNQLLIELDGFDTGKGIIFLAATNRRDLLDPALLRPGRLDRKIKILPPSAKGRLDILNI  597

Query  1350  HARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLT  1171
             HA KVK+S++VDL+SYAQNLPGWSGA+LAQL+QEAALVAVRK HNSI++S MD+AVDRLT
Sbjct  598   HASKVKMSDSVDLSSYAQNLPGWSGARLAQLIQEAALVAVRKRHNSIVQSHMDEAVDRLT  657

Query  1170  VGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             VGPK +G++LG+QGQCRRATTEVG ALTSHLLR YENAKVE C+RISI PRGQTL Q+VF
Sbjct  658   VGPKCIGVELGYQGQCRRATTEVGVALTSHLLRRYENAKVEYCERISIVPRGQTLCQLVF  717

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVW  811
             HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKAS+ YLA A+WLARK++T+W
Sbjct  718   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASIEYLAHASWLARKILTIW  777

Query  810   NLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIR  631
             NLE+PM IHGEP PWRK+ KFVGPRLDFEGSLYDDYDLI+PPLNF+LD  VS+RTE LI 
Sbjct  778   NLEDPMVIHGEPSPWRKAVKFVGPRLDFEGSLYDDYDLIDPPLNFNLDSQVSQRTEELIH  837

Query  630   DTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSL  451
             D Y KT++LLR+HHAALLKT+KVLL QKE+SGEEIDFIL+ YPP TP   LLEE  PG+L
Sbjct  838   DMYGKTVSLLREHHAALLKTIKVLLNQKEMSGEEIDFILNKYPPQTPLH-LLEEEIPGNL  896

Query  450   PLFHQEQEEANEIEYSL  400
             P     +E+  +++Y++
Sbjct  897   PFM---KEQVPDLDYAI  910



>gb|KEH21246.1| FTSH extracellular protease family protein [Medicago truncatula]
Length=918

 Score =  1097 bits (2838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/890 (68%), Positives = 736/890 (83%), Gaps = 19/890 (2%)
 Frame = -2

Query  3063  PRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSF  2884
             P T+F ++       SS  + DDFV RVL+ENPSQV  +Y +G+KL T ++K++L +KS 
Sbjct  37    PFTVFCKS-------SSNSDADDFVKRVLEENPSQVPPKYLIGNKLYTSQQKDNLGQKS-  88

Query  2883  DTGALEILRRLNLKAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeee  2704
             + G  ++L +  LK  S++   +  + + + VYL ++L+E+KGKLYVPEQIF + LSEEE
Sbjct  89    NEGLFDLLLK-RLKNNSQRKSGELYEERDDSVYLNDLLKEYKGKLYVPEQIFGTPLSEEE  147

Query  2703  efeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQ  2524
             EF +N++ LPKM  EDF K L  DK+KL+T KED    YG+G+RD++V+LKE+PG K LQ
Sbjct  148   EFNENLKTLPKMSVEDFTKALSKDKIKLVTSKED----YGYGYRDYIVDLKEIPGDKRLQ  203

Query  2523  RTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT-WVGKLPEQPHPVASKISTRLMVELGm  2347
              TKW +R+D ++A+++L EY+GPRYE+E + +T WVGK+   PHP A+ IS+R++ ELG 
Sbjct  204   ATKWVLRVDSSEARAILEEYSGPRYEIESRRITSWVGKMSVSPHPAAASISSRVVAELGA  263

Query  2346  ltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDK  2167
             +T ++  AA + G +L++AVF VTSF F  TVYV WP+AKP +KF  G+   +LER WD+
Sbjct  264   VTVVVGLAALLVGGFLSAAVFVVTSFIFVTTVYVGWPIAKPILKFSLGVAVSMLERFWDR  323

Query  2166  IYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDI  1990
             + D F   G+ AK Y + T GG++++++VLK  L + + MVLLVRFTLSR+PKNFRKWD+
Sbjct  324   LLDFFMDGGLLAKTYNLLTVGGLASTLDVLKVTLPIVVGMVLLVRFTLSRKPKNFRKWDL  383

Query  1989  WQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGV  1810
             WQG+ FS SK +ARVDG TG+ F+DVAGI+ AV+ELQELV YLKNPELFDKMGIKPPHGV
Sbjct  384   WQGMNFSLSKAEARVDGSTGIKFSDVAGIDDAVDELQELVKYLKNPELFDKMGIKPPHGV  443

Query  1809  LLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVI  1630
             LLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVE LVGVG+ARIRDLFKRAKVNKPSV+
Sbjct  444   LLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEFLVGVGSARIRDLFKRAKVNKPSVV  503

Query  1629  FIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRM  1450
             FIDEIDALAT+RQG F +S+D+ YNAATQERETTLNQLL ELDGFDTGKG+IFL ATNR 
Sbjct  504   FIDEIDALATRRQGTFKESTDNLYNAATQERETTLNQLLIELDGFDTGKGIIFLAATNRR  563

Query  1449  DLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAK  1270
             DLLDPALLRPGR DRKI+I PPNAKGRL ILK+H  KVK+S++VDL+SYAQNLPGWSGA+
Sbjct  564   DLLDPALLRPGRLDRKIKILPPNAKGRLDILKIHGSKVKMSDSVDLSSYAQNLPGWSGAR  623

Query  1269  laqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTAL  1090
             LAQL+QEAALVAVRK H+SIL+SDMD+AVDRLTVGPKR+G++LG+QGQCRRATTEVG A+
Sbjct  624   LAQLVQEAALVAVRKRHDSILQSDMDEAVDRLTVGPKRIGVELGYQGQCRRATTEVGVAI  683

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
             TSHLLR YENAKVE CDRISI PRGQTLSQ+VF RLDDESYMFERRPQLLHRLQVLLGGR
Sbjct  684   TSHLLRRYENAKVEYCDRISIVPRGQTLSQLVFQRLDDESYMFERRPQLLHRLQVLLGGR  743

Query  909   AAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLD  730
             AAEE+IYGRDTSKASV YLA+A+WLARK++T+WNLE+PM IHGEP PWRKS KFVGPRLD
Sbjct  744   AAEEIIYGRDTSKASVEYLANASWLARKILTIWNLEDPMVIHGEPPPWRKSVKFVGPRLD  803

Query  729   FEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkq  550
             FEGSLYD YDLI+PPLNF+LD  V++RTE LIRD Y KT++LLR HHAALLKT+KVLL Q
Sbjct  804   FEGSLYDHYDLIDPPLNFNLDAQVAQRTEELIRDMYRKTVSLLRGHHAALLKTIKVLLNQ  863

Query  549   KEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSL  400
             KE+SGEEIDFIL+ YPP TP   LLEE  P  LP     +E+ N +EY+L
Sbjct  864   KEMSGEEIDFILNKYPPQTPLH-LLEEERPSDLPFM---KEQVNNVEYTL  909



>ref|XP_006852630.1| hypothetical protein AMTR_s00021p00235220 [Amborella trichopoda]
 gb|ERN14097.1| hypothetical protein AMTR_s00021p00235220 [Amborella trichopoda]
Length=969

 Score =  1083 bits (2802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/907 (68%), Positives = 726/907 (80%), Gaps = 25/907 (3%)
 Frame = -2

Query  3129  QKRH--QNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQV  2956
             Q+ H  Q L+F R +A           + G++     +N    + DDF+T+VL ENPSQV
Sbjct  64    QRLHFSQRLQFSRTVA-----------VNGKSVSESYNNGRKSSGDDFITKVLSENPSQV  112

Query  2955  ETRYKVGdklltlkekedlqkKSFDTG-ALEILRRLNLKAF----------SRKSQEDGD  2809
             E +  VG  L TL+E E L+ ++     A E+  +L  K             RK+  D  
Sbjct  113   ERKILVGKNLYTLREWEQLKSRNRTLQLAKELFEKLGSKLKLDSHEHIVNEERKAGLDER  172

Query  2808  QGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDK  2629
             +   + V L++ILRE KG+LYVPE+  +  LSEEEEF++++  LP M  EDF K ++ D 
Sbjct  173   ESTAKPVNLQDILREFKGELYVPEEALKQRLSEEEEFDRSLATLPIMRLEDFLKAMRGDT  232

Query  2628  VKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRY  2449
             +KLLT K   +    +G  DF+VELKE+PG K+LQRTKW M L   +AQ++L +YTGPRY
Sbjct  233   IKLLTSKGSASLASNYGHYDFIVELKEIPGDKNLQRTKWVMHLSDEEAQAVLEDYTGPRY  292

Query  2448  EVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsf  2269
             E+EK  M +VGKLP+ PHPVAS IS+R+MVELGM+T+ +  AA + G + ASAVFAVTSF
Sbjct  293   EIEKSTMAYVGKLPQYPHPVASSISSRMMVELGMVTSFIATAAFVIGGFFASAVFAVTSF  352

Query  2268  afavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISAS  2092
              F V  YVV P+  P +K    L+  V+E +WDKI D F   GVF+K Y++YTFGG+SAS
Sbjct  353   VFVVVSYVVRPLVLPIIKLSLSLISSVVEVIWDKIIDIFGDGGVFSKIYEIYTFGGVSAS  412

Query  2091  IEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDV  1912
             +EVLK IL+V LTMVLLVRFT+SRRPKNFRKWDIWQGIEF QSKPQARVDG TGVTFNDV
Sbjct  413   LEVLKTILMVLLTMVLLVRFTISRRPKNFRKWDIWQGIEFGQSKPQARVDGSTGVTFNDV  472

Query  1911  AGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY  1732
             AGIE+AVEELQELV YLKNPELFDK+GI+PPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY
Sbjct  473   AGIEEAVEELQELVRYLKNPELFDKLGIRPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFY  532

Query  1731  QMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNA  1552
             QMAGSEFVEVLVGVG+ARIRDLF RAKVNKP+VIFIDEIDALAT+RQGIF +S++  YNA
Sbjct  533   QMAGSEFVEVLVGVGSARIRDLFMRAKVNKPAVIFIDEIDALATRRQGIFRESTNYLYNA  592

Query  1551  ATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKG  1372
             ATQERETTLNQLL ELDGFDTGKGVIFLGATNR DLLDPALLRPGRFDRKIRIRPP AKG
Sbjct  593   ATQERETTLNQLLIELDGFDTGKGVIFLGATNRRDLLDPALLRPGRFDRKIRIRPPAAKG  652

Query  1371  RLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMD  1192
             RL ILKVHARKVK+S +VDL+SYAQNLPGW+GAKLAQL+QEAAL+AVR GH +I +SDMD
Sbjct  653   RLDILKVHARKVKMSPSVDLSSYAQNLPGWTGAKLAQLMQEAALMAVRNGHKAIFQSDMD  712

Query  1191  DAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQ  1012
             DAVDRLTVGPKRVGI+L HQGQCRRATTEVGTALTSHLLR  ENAKVE C+RISI PRGQ
Sbjct  713   DAVDRLTVGPKRVGIELDHQGQCRRATTEVGTALTSHLLRRLENAKVEFCERISIIPRGQ  772

Query  1011  TLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLA  832
             T SQ+VFHRLDDE+YMFERRPQLLHRLQVLLGGRAAEEVIYGRDTS AS+SYL DA+WLA
Sbjct  773   TYSQIVFHRLDDEAYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSTASLSYLQDASWLA  832

Query  831   RKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSK  652
             RK+I+ WNLE  MTIHGEP+PW+KSP F+GPRLDFEGSLYDDY L EPPL + L+D V+ 
Sbjct  833   RKIISAWNLEKSMTIHGEPVPWKKSPSFIGPRLDFEGSLYDDYGLFEPPLGYKLEDKVAT  892

Query  651   RTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLE  472
             R+E L+RD Y KT++L+++HHAAL+KTV+VLL +KEISG  I+FIL+NYP  TP  L+L+
Sbjct  893   RSEDLLRDMYQKTVSLIKKHHAALVKTVQVLLSEKEISGNHIEFILNNYPADTPVDLVLK  952

Query  471   EGDPGSL  451
             E +PG L
Sbjct  953   EENPGRL  959



>gb|KCW77408.1| hypothetical protein EUGRSUZ_D01758 [Eucalyptus grandis]
Length=838

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/748 (74%), Positives = 640/748 (86%), Gaps = 11/748 (1%)
 Frame = -2

Query  3027  QSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRR-L  2851
              S S+    DDFV RVL+ENPSQVE RY +GDK  TLKE+E+L K + D GA EILRR L
Sbjct  62    SSGSTPPKGDDFVARVLQENPSQVEPRYLIGDKFYTLKERENLSKNT-DVGAFEILRRTL  120

Query  2850  NLKAFSRKSQEDGDQ-----GKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknv  2686
             + +  S++  ++G        K E VYLK++LRE+KGKLYVPEQ+F  +LSEEEEF++N+
Sbjct  121   DKRGKSKRGSDEGQDKAKAAAKEESVYLKDLLREYKGKLYVPEQVFGEDLSEEEEFDRNL  180

Query  2685  eELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTM  2506
             E LPKM  EDF+K +++DKVKLLT KE  + +   GFRDF++ELKE+PG +SL RT+W M
Sbjct  181   EALPKMSLEDFRKAMESDKVKLLTSKEVPSISTANGFRDFIIELKEIPGDRSLHRTRWAM  240

Query  2505  RLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmta  2326
             +L+  +AQ+LL EY GP YE+E+Q M+WVGKLPE PHPVAS IS+R+MVE GM+TA+M A
Sbjct  241   KLNQGEAQALLEEYNGPTYEIERQTMSWVGKLPEYPHPVASSISSRMMVEFGMITAIMAA  300

Query  2325  aaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-  2149
             AA + G +LASAVFAVTSF F  TVY+VWP+A+PF K F GL+  + ERVWD + D F+ 
Sbjct  301   AAVVVGGFLASAVFAVTSFIFVTTVYIVWPIARPFFKLFLGLILSIFERVWDNVVDLFSD  360

Query  2148  FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFS  1969
              G+F+KFY+ YTFGG+SAS+E+LKPI  V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS
Sbjct  361   GGIFSKFYEFYTFGGVSASLEMLKPISFVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFS  420

Query  1968  QSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPG  1789
             +SK +ARVDG TGV F DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPG
Sbjct  421   RSKAEARVDGSTGVKFGDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPG  480

Query  1788  CGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDA  1609
             CGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDA
Sbjct  481   CGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDA  540

Query  1608  LATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPAL  1429
             LAT+RQGIF +S+D  YNA TQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPAL
Sbjct  541   LATRRQGIFKESTDHLYNAGTQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPAL  600

Query  1428  LRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqe  1249
             LRPGRFDRKI+IRPPNAKGR  ILK+HA KVK+SETVDL+SYAQNLPGWSGA+LAQL+QE
Sbjct  601   LRPGRFDRKIKIRPPNAKGRRDILKIHASKVKMSETVDLSSYAQNLPGWSGARLAQLVQE  660

Query  1248  aalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRH  1069
             AALVAVRKGH SILRSDMDDA DRLTVGP+RVGI+LGHQGQCRRATTEVG A+TSHLL+ 
Sbjct  661   AALVAVRKGHGSILRSDMDDAADRLTVGPRRVGIELGHQGQCRRATTEVGVAMTSHLLKR  720

Query  1068  YENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIY  889
             YENA VE CDRISI PRG+TLSQV+FHRLDDE YMFERRPQLLHRLQVLLGGRAAEEVIY
Sbjct  721   YENADVEYCDRISIIPRGETLSQVIFHRLDDEKYMFERRPQLLHRLQVLLGGRAAEEVIY  780

Query  888   GRDTSKASVSYLADATWLARKMITVWNL  805
             GRDTS+ASV YLADA+WLAR    +W +
Sbjct  781   GRDTSRASVGYLADASWLAR---GIWRI  805



>gb|KCW77407.1| hypothetical protein EUGRSUZ_D01758 [Eucalyptus grandis]
Length=809

 Score =  1020 bits (2638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/743 (75%), Positives = 638/743 (86%), Gaps = 8/743 (1%)
 Frame = -2

Query  3027  QSNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRR-L  2851
              S S+    DDFV RVL+ENPSQVE RY +GDK  TLKE+E+L K + D GA EILRR L
Sbjct  62    SSGSTPPKGDDFVARVLQENPSQVEPRYLIGDKFYTLKERENLSKNT-DVGAFEILRRTL  120

Query  2850  NLKAFSRKSQEDGDQ-----GKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknv  2686
             + +  S++  ++G        K E VYLK++LRE+KGKLYVPEQ+F  +LSEEEEF++N+
Sbjct  121   DKRGKSKRGSDEGQDKAKAAAKEESVYLKDLLREYKGKLYVPEQVFGEDLSEEEEFDRNL  180

Query  2685  eELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTM  2506
             E LPKM  EDF+K +++DKVKLLT KE  + +   GFRDF++ELKE+PG +SL RT+W M
Sbjct  181   EALPKMSLEDFRKAMESDKVKLLTSKEVPSISTANGFRDFIIELKEIPGDRSLHRTRWAM  240

Query  2505  RLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmta  2326
             +L+  +AQ+LL EY GP YE+E+Q M+WVGKLPE PHPVAS IS+R+MVE GM+TA+M A
Sbjct  241   KLNQGEAQALLEEYNGPTYEIERQTMSWVGKLPEYPHPVASSISSRMMVEFGMITAIMAA  300

Query  2325  aaaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-  2149
             AA + G +LASAVFAVTSF F  TVY+VWP+A+PF K F GL+  + ERVWD + D F+ 
Sbjct  301   AAVVVGGFLASAVFAVTSFIFVTTVYIVWPIARPFFKLFLGLILSIFERVWDNVVDLFSD  360

Query  2148  FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFS  1969
              G+F+KFY+ YTFGG+SAS+E+LKPI  V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS
Sbjct  361   GGIFSKFYEFYTFGGVSASLEMLKPISFVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFS  420

Query  1968  QSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPG  1789
             +SK +ARVDG TGV F DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPG
Sbjct  421   RSKAEARVDGSTGVKFGDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPG  480

Query  1788  CGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDA  1609
             CGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDA
Sbjct  481   CGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDA  540

Query  1608  LATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPAL  1429
             LAT+RQGIF +S+D  YNA TQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPAL
Sbjct  541   LATRRQGIFKESTDHLYNAGTQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPAL  600

Query  1428  LRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqe  1249
             LRPGRFDRKI+IRPPNAKGR  ILK+HA KVK+SETVDL+SYAQNLPGWSGA+LAQL+QE
Sbjct  601   LRPGRFDRKIKIRPPNAKGRRDILKIHASKVKMSETVDLSSYAQNLPGWSGARLAQLVQE  660

Query  1248  aalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRH  1069
             AALVAVRKGH SILRSDMDDA DRLTVGP+RVGI+LGHQGQCRRATTEVG A+TSHLL+ 
Sbjct  661   AALVAVRKGHGSILRSDMDDAADRLTVGPRRVGIELGHQGQCRRATTEVGVAMTSHLLKR  720

Query  1068  YENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIY  889
             YENA VE CDRISI PRG+TLSQV+FHRLDDE YMFERRPQLLHRLQVLLGGRAAEEVIY
Sbjct  721   YENADVEYCDRISIIPRGETLSQVIFHRLDDEKYMFERRPQLLHRLQVLLGGRAAEEVIY  780

Query  888   GRDTSKASVSYLADATWLARKMI  820
             GRDTS+ASV YLADA+WLAR  +
Sbjct  781   GRDTSRASVGYLADASWLARSTM  803



>gb|KDO76575.1| hypothetical protein CISIN_1g002307mg [Citrus sinensis]
Length=807

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/787 (72%), Positives = 663/787 (84%), Gaps = 11/787 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             K  + LKF R    R+   +  R+     + S+  ++S   ++DFVTRVLKENPSQVE +
Sbjct  26    KSAKPLKFTRKCQSRT--NFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPK  83

Query  2946  YKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEIL  2770
             Y +G++  +LKE+++L +K+ D G  + L  +LN K  S+K  E  +Q     VYLK+IL
Sbjct  84    YLIGERFYSLKERQNLSEKN-DVGIFQSLAEKLNSKENSKK--ESDNQNVSGSVYLKDIL  140

Query  2769  REHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAAN  2590
             RE+KGKLYVPEQ+F   LSEEEEF KNV+ELPKM  E+F+KY+++DKVKLLT K  N   
Sbjct  141   REYKGKLYVPEQVFGHELSEEEEFHKNVKELPKMSIEEFKKYMESDKVKLLTSKGINGVA  200

Query  2589  YGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKL  2410
             +  G+RDF+V+LK++PG+K LQRTKW MRLD N+AQ+LL+EYTGP+YE+EK M +WVGKL
Sbjct  201   FANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKL  260

Query  2409  PEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVA  2230
             PE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVYVVWP+A
Sbjct  261   PEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIA  320

Query  2229  KPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPILLVFLT  2053
             +PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI LV LT
Sbjct  321   RPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILT  380

Query  2052  MVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQEL  1873
             MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQEL
Sbjct  381   MVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQEL  440

Query  1872  VTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  1693
             V YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG
Sbjct  441   VRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  500

Query  1692  VGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLL  1513
             VG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERETTLNQLL
Sbjct  501   VGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLL  560

Query  1512  TELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVK  1333
              ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+HA KVK
Sbjct  561   IELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVK  620

Query  1332  LSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRV  1153
             +S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLTVGPKR 
Sbjct  621   MSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR  680

Query  1152  GIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE  973
             GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDE
Sbjct  681   GIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDE  740

Query  972   SYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITV-WN-LEN  799
             SYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLA  +  + W+ +EN
Sbjct  741   SYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMEN  800

Query  798   PMTIHGE  778
              +  HGE
Sbjct  801   HL--HGE  805



>ref|XP_006439319.1| hypothetical protein CICLE_v10018718mg [Citrus clementina]
 gb|ESR52559.1| hypothetical protein CICLE_v10018718mg [Citrus clementina]
Length=807

 Score =  1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/787 (72%), Positives = 664/787 (84%), Gaps = 11/787 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             K  + LKF R    R+   +  R+     + S+  ++S   ++DFVTRVLKENPSQVE +
Sbjct  26    KSAKPLKFTRKCQSRT--NFLHRSFTVLCELSQPGDTSKPTEEDFVTRVLKENPSQVEPK  83

Query  2946  YKVGdklltlkekedlqkKSFDTGALEIL-RRLNLKAFSRKSQEDGDQGKPEEVYLKEIL  2770
             Y +G++  +LKE+++L +K+ D G  + L  +LN K  S+K  E  +Q     VYLK+IL
Sbjct  84    YLIGERFYSLKERQNLSEKN-DVGIFQSLAEKLNSKENSKK--ESDNQNVSGSVYLKDIL  140

Query  2769  REHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKEDNAAN  2590
             RE+KGKLYVPEQ+F   LSEEEEF+KNV+ELPKM  E+F+KY+++DKVKLLT +  N   
Sbjct  141   REYKGKLYVPEQVFGHELSEEEEFDKNVKELPKMSIEEFKKYMESDKVKLLTSRGINGMA  200

Query  2589  YGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMTWVGKL  2410
             +  G+RDF+V+LK++PG+K LQRTKW MRLD N+AQ+LL+EYTGP+YE+EK M +WVGKL
Sbjct  201   FANGYRDFIVDLKDIPGNKKLQRTKWAMRLDDNEAQALLDEYTGPQYEIEKHMTSWVGKL  260

Query  2409  PEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVA  2230
             PE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVYVVWP+A
Sbjct  261   PEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVYVVWPIA  320

Query  2229  KPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPILLVFLT  2053
             +PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI LV LT
Sbjct  321   RPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPITLVILT  380

Query  2052  MVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQEL  1873
             MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVEELQEL
Sbjct  381   MVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVEELQEL  440

Query  1872  VTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  1693
             V YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG
Sbjct  441   VRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVG  500

Query  1692  VGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLL  1513
             VG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERETTLNQLL
Sbjct  501   VGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERETTLNQLL  560

Query  1512  TELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVK  1333
              ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+HA KVK
Sbjct  561   IELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKIHASKVK  620

Query  1332  LSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRV  1153
             +S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLTVGPKR 
Sbjct  621   MSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLTVGPKRR  680

Query  1152  GIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE  973
             GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VFHRLDDE
Sbjct  681   GIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVFHRLDDE  740

Query  972   SYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITV-WN-LEN  799
             SYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLA  +  + W+ +EN
Sbjct  741   SYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLAHGIWRIQWSYMEN  800

Query  798   PMTIHGE  778
              +  HGE
Sbjct  801   HL--HGE  805



>gb|KDO76576.1| hypothetical protein CISIN_1g002307mg [Citrus sinensis]
Length=688

 Score =   991 bits (2561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/679 (79%), Positives = 607/679 (89%), Gaps = 3/679 (0%)
 Frame = -2

Query  2427  TWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvy  2248
             +WVGKLPE PHPVAS IS+RLMVELGM+TA+M AAAAI G +LASAVFAVTSF F  TVY
Sbjct  5     SWVGKLPEYPHPVASSISSRLMVELGMVTAIMAAAAAIVGGFLASAVFAVTSFIFVTTVY  64

Query  2247  vVWPVAKPFMKFFSGLVFDVLERVWDKIYD-AFAFGVFAKFYQVYTFGGISASIEVLKPI  2071
             VVWP+A+PF+  F GL+  ++E + D I D +   G+ +KFY+ YTFGG+SAS+E+LKPI
Sbjct  65    VVWPIARPFVNIFRGLILGIIENISDYIVDLSGEGGILSKFYEFYTFGGLSASLEMLKPI  124

Query  2070  LLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAV  1891
              LV LTMVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AV
Sbjct  125   TLVILTMVLLIRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAV  184

Query  1890  EELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  1711
             EELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF
Sbjct  185   EELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  244

Query  1710  VEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERET  1531
             VEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF D++D  YNAATQERET
Sbjct  245   VEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKDTTDHLYNAATQERET  304

Query  1530  TLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKV  1351
             TLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIR PNAKGR  ILK+
Sbjct  305   TLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRAPNAKGRTEILKI  364

Query  1350  HARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLT  1171
             HA KVK+S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKGH SIL SDMDDAVDRLT
Sbjct  365   HASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKGHESILSSDMDDAVDRLT  424

Query  1170  VGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             VGPKR GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECCDRISI PRGQTLSQ+VF
Sbjct  425   VGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECCDRISIVPRGQTLSQLVF  484

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVW  811
             HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV+YLADA+WLARK++T+W
Sbjct  485   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASVNYLADASWLARKILTIW  544

Query  810   NLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIR  631
             NLENPM IHGEP PWRK  KFVGPRLDFEGSLYDDY L EPP+NF+LDDD++ RTE L+R
Sbjct  545   NLENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLTEPPVNFNLDDDIAWRTEELLR  604

Query  630   DTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSL  451
             D Y +T+ LLR+HHAALLKTVKVLL QKEI  EEIDFIL+NYPP TP S LLEE +PG+L
Sbjct  605   DMYGRTVTLLRRHHAALLKTVKVLLNQKEIGREEIDFILNNYPPQTPISRLLEEENPGTL  664

Query  450   PLFHQEQEEANEIEYSLLS  394
             P   QEQ   +++E++L++
Sbjct  665   PFIKQEQ--CSQVEHALVN  681



>ref|XP_007040562.1| FtsH extracellular protease family isoform 4, partial [Theobroma 
cacao]
 gb|EOY25063.1| FtsH extracellular protease family isoform 4, partial [Theobroma 
cacao]
Length=722

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/740 (70%), Positives = 602/740 (81%), Gaps = 36/740 (5%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             +R + L   R    R+   +   T+  + + S+   +S    DDFVTRVLK+NPSQVE R
Sbjct  12    RRIKPLNLTRKFQSRTSFLHRSFTVLCELQSSQPGETSKPKGDDFVTRVLKQNPSQVEPR  71

Query  2946  YKVGdklltlkekedlqkKSFDTGALEILRR-LNLKAFSRKSQEDGDQ-----GKPEEVY  2785
             Y VG+K+ TLKEKEDL K+  +   +EIL++ LN KA  +    + ++      + + VY
Sbjct  72    YLVGNKIYTLKEKEDLSKR-INLSLIEILKKKLNSKAKLKNESNESERETERSSENDNVY  130

Query  2784  LKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKE  2605
             L +ILRE++GKLYVPEQIF   LSEEEEFEKN+EELPKM  EDF+K +K+DKVKLLT KE
Sbjct  131   LSDILREYRGKLYVPEQIFGEELSEEEEFEKNLEELPKMSLEDFRKAMKSDKVKLLTSKE  190

Query  2604  DNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT  2425
              +  +Y  G RDFVV+LK++PG KSLQRTKW MRLD  +AQ+LL+EY G RYE+E+ M +
Sbjct  191   VSGVSYVGGHRDFVVDLKDIPGDKSLQRTKWAMRLDETEAQTLLSEYAGKRYEIERHMTS  250

Query  2424  WVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyv  2245
             WVGK+PE PHPVAS IS+R+MV                             F F  TVYV
Sbjct  251   WVGKVPEYPHPVASSISSRMMVS----------------------------FVFVTTVYV  282

Query  2244  VWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPIL  2068
             VWP+ KPF+K F G++F +LERVWD + D F+  G+F+K Y+ YTFGG+SAS+E+LKPI 
Sbjct  283   VWPIVKPFVKLFLGIIFSILERVWDNLVDVFSDGGIFSKLYEFYTFGGVSASLEMLKPIT  342

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             +V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVE
Sbjct  343   VVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVE  402

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV
Sbjct  403   ELQELVRYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  462

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             EVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETT
Sbjct  463   EVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETT  522

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+H
Sbjct  523   LNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLQILKIH  582

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             A KVK+SE+VDL+SYA NLPGW+GAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTV
Sbjct  583   ASKVKMSESVDLSSYANNLPGWTGAKLAQLVQEAALVAVRKRHDSILQSDMDDAVDRLTV  642

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             GPKRVGI+LGHQGQCRRATTE+G A+TSHLLR YENA+VECCDRISI PRGQTLSQVVFH
Sbjct  643   GPKRVGIELGHQGQCRRATTELGVAMTSHLLRRYENAEVECCDRISIVPRGQTLSQVVFH  702

Query  987   RLDDESYMFERRPQLLHRLQ  928
             RLDDESYMFERRPQLLHRLQ
Sbjct  703   RLDDESYMFERRPQLLHRLQ  722



>gb|KEH21247.1| FTSH extracellular protease family protein [Medicago truncatula]
Length=677

 Score =   932 bits (2409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/668 (75%), Positives = 578/668 (87%), Gaps = 5/668 (1%)
 Frame = -2

Query  2400  PHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyvVWPVAKPF  2221
             PHP A+ IS+R++ ELG +T ++  AA + G +L++AVF VTSF F  TVYV WP+AKP 
Sbjct  5     PHPAAASISSRVVAELGAVTVVVGLAALLVGGFLSAAVFVVTSFIFVTTVYVGWPIAKPI  64

Query  2220  MKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPILLVFLTMVL  2044
             +KF  G+   +LER WD++ D F   G+ AK Y + T GG++++++VLK  L + + MVL
Sbjct  65    LKFSLGVAVSMLERFWDRLLDFFMDGGLLAKTYNLLTVGGLASTLDVLKVTLPIVVGMVL  124

Query  2043  LVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTY  1864
             LVRFTLSR+PKNFRKWD+WQG+ FS SK +ARVDG TG+ F+DVAGI+ AV+ELQELV Y
Sbjct  125   LVRFTLSRKPKNFRKWDLWQGMNFSLSKAEARVDGSTGIKFSDVAGIDDAVDELQELVKY  184

Query  1863  LKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGA  1684
             LKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVE LVGVG+
Sbjct  185   LKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEFLVGVGS  244

Query  1683  ARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTEL  1504
             ARIRDLFKRAKVNKPSV+FIDEIDALAT+RQG F +S+D+ YNAATQERETTLNQLL EL
Sbjct  245   ARIRDLFKRAKVNKPSVVFIDEIDALATRRQGTFKESTDNLYNAATQERETTLNQLLIEL  304

Query  1503  DGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSE  1324
             DGFDTGKG+IFL ATNR DLLDPALLRPGR DRKI+I PPNAKGRL ILK+H  KVK+S+
Sbjct  305   DGFDTGKGIIFLAATNRRDLLDPALLRPGRLDRKIKILPPNAKGRLDILKIHGSKVKMSD  364

Query  1323  TVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGID  1144
             +VDL+SYAQNLPGWSGA+LAQL+QEAALVAVRK H+SIL+SDMD+AVDRLTVGPKR+G++
Sbjct  365   SVDLSSYAQNLPGWSGARLAQLVQEAALVAVRKRHDSILQSDMDEAVDRLTVGPKRIGVE  424

Query  1143  LGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYM  964
             LG+QGQCRRATTEVG A+TSHLLR YENAKVE CDRISI PRGQTLSQ+VF RLDDESYM
Sbjct  425   LGYQGQCRRATTEVGVAITSHLLRRYENAKVEYCDRISIVPRGQTLSQLVFQRLDDESYM  484

Query  963   FERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIH  784
             FERRPQLLHRLQVLLGGRAAEE+IYGRDTSKASV YLA+A+WLARK++T+WNLE+PM IH
Sbjct  485   FERRPQLLHRLQVLLGGRAAEEIIYGRDTSKASVEYLANASWLARKILTIWNLEDPMVIH  544

Query  783   GEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlal  604
             GEP PWRKS KFVGPRLDFEGSLYD YDLI+PPLNF+LD  V++RTE LIRD Y KT++L
Sbjct  545   GEPPPWRKSVKFVGPRLDFEGSLYDHYDLIDPPLNFNLDAQVAQRTEELIRDMYRKTVSL  604

Query  603   lrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEE  424
             LR HHAALLKT+KVLL QKE+SGEEIDFIL+ YPP TP   LLEE  P  LP     +E+
Sbjct  605   LRGHHAALLKTIKVLLNQKEMSGEEIDFILNKYPPQTPLH-LLEEERPSDLPFM---KEQ  660

Query  423   ANEIEYSL  400
              N +EY+L
Sbjct  661   VNNVEYTL  668



>ref|XP_007040561.1| FtsH extracellular protease family isoform 3, partial [Theobroma 
cacao]
 gb|EOY25062.1| FtsH extracellular protease family isoform 3, partial [Theobroma 
cacao]
Length=781

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/722 (71%), Positives = 603/722 (84%), Gaps = 8/722 (1%)
 Frame = -2

Query  3126  KRHQNLKFPRNIARRSPPCYCPRTIFGQAKYSEQSNSSGGNDDDFVTRVLKENPSQVETR  2947
             +R + L   R    R+   +   T+  + + S+   +S    DDFVTRVLK+NPSQVE R
Sbjct  12    RRIKPLNLTRKFQSRTSFLHRSFTVLCELQSSQPGETSKPKGDDFVTRVLKQNPSQVEPR  71

Query  2946  YKVGdklltlkekedlqkKSFDTGALEILRR-LNLKAFSRKSQEDGDQ-----GKPEEVY  2785
             Y VG+K+ TLKEKEDL K+  +   +EIL++ LN KA  +    + ++      + + VY
Sbjct  72    YLVGNKIYTLKEKEDLSKR-INLSLIEILKKKLNSKAKLKNESNESERETERSSENDNVY  130

Query  2784  LKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFEDFQKYLKTDKVKLLTFKE  2605
             L +ILRE++GKLYVPEQIF   LSEEEEFEKN+EELPKM  EDF+K +K+DKVKLLT KE
Sbjct  131   LSDILREYRGKLYVPEQIFGEELSEEEEFEKNLEELPKMSLEDFRKAMKSDKVKLLTSKE  190

Query  2604  DNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQSLLNEYTGPRYEVEKQMMT  2425
              +  +Y  G RDFVV+LK++PG KSLQRTKW MRLD  +AQ+LL+EY G RYE+E+ M +
Sbjct  191   VSGVSYVGGHRDFVVDLKDIPGDKSLQRTKWAMRLDETEAQTLLSEYAGKRYEIERHMTS  250

Query  2424  WVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsylasavfavtsfafavtvyv  2245
             WVGK+PE PHPVAS IS+R+MVELGM+TA+M AAA I G +LA+AVFAVTSF F  TVYV
Sbjct  251   WVGKVPEYPHPVASSISSRMMVELGMVTAVMAAAAVIVGGFLAAAVFAVTSFVFVTTVYV  310

Query  2244  VWPVAKPFMKFFSGLVFDVLERVWDKIYDAFA-FGVFAKFYQVYTFGGISASIEVLKPIL  2068
             VWP+ KPF+K F G++F +LERVWD + D F+  G+F+K Y+ YTFGG+SAS+E+LKPI 
Sbjct  311   VWPIVKPFVKLFLGIIFSILERVWDNLVDVFSDGGIFSKLYEFYTFGGVSASLEMLKPIT  370

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             +V LTMVLLVRFTLSRRPKNFRKWD+WQGI+FS+SK +ARVDG TGV F+DVAGI++AVE
Sbjct  371   VVLLTMVLLVRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVDGSTGVKFSDVAGIDEAVE  430

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQELV YLKNP+LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV
Sbjct  431   ELQELVRYLKNPDLFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  490

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             EVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF +S+D  YNAATQERETT
Sbjct  491   EVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIFKESTDHLYNAATQERETT  550

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRKIRIRPPNAKGRL ILK+H
Sbjct  551   LNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRKIRIRPPNAKGRLQILKIH  610

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             A KVK+SE+VDL+SYA NLPGW+GAKLAQL+QEAALVAVRK H+SIL+SDMDDAVDRLTV
Sbjct  611   ASKVKMSESVDLSSYANNLPGWTGAKLAQLVQEAALVAVRKRHDSILQSDMDDAVDRLTV  670

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             GPKRVGI+LGHQGQCRRATTE+G A+TSHLLR YENA+VECCDRISI PRGQ L   +F 
Sbjct  671   GPKRVGIELGHQGQCRRATTELGVAMTSHLLRRYENAEVECCDRISIVPRGQVLLVSLFS  730

Query  987   RL  982
              +
Sbjct  731   TI  732



>gb|KDO76577.1| hypothetical protein CISIN_1g002307mg [Citrus sinensis]
Length=539

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/516 (82%), Positives = 470/516 (91%), Gaps = 2/516 (0%)
 Frame = -2

Query  1941  GMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA  1762
             G TGV F+DVAGI++AVEELQELV YLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA
Sbjct  19    GSTGVKFSDVAGIDEAVEELQELVRYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA  78

Query  1761  IAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIF  1582
             IAGEAGVPFYQMAGSEFVEVLVGVG+ARIRDLFKRAKVNKPSVIFIDEIDALAT+RQGIF
Sbjct  79    IAGEAGVPFYQMAGSEFVEVLVGVGSARIRDLFKRAKVNKPSVIFIDEIDALATRRQGIF  138

Query  1581  NDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRK  1402
              D++D  YNAATQERETTLNQLL ELDGFDTGKGVIFL ATNR DLLDPALLRPGRFDRK
Sbjct  139   KDTTDHLYNAATQERETTLNQLLIELDGFDTGKGVIFLAATNRRDLLDPALLRPGRFDRK  198

Query  1401  IRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKG  1222
             IRIR PNAKGR  ILK+HA KVK+S++VDL+SYA+NLPGW+GA+LAQL+QEAALVAVRKG
Sbjct  199   IRIRAPNAKGRTEILKIHASKVKMSDSVDLSSYAKNLPGWTGARLAQLVQEAALVAVRKG  258

Query  1221  HNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECC  1042
             H SIL SDMDDAVDRLTVGPKR GI+LG+QGQ RRA TEVG A+ SHLLR YENAKVECC
Sbjct  259   HESILSSDMDDAVDRLTVGPKRRGIELGNQGQSRRAATEVGVAMISHLLRRYENAKVECC  318

Query  1041  DRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASV  862
             DRISI PRGQTLSQ+VFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG+DTS+ASV
Sbjct  319   DRISIVPRGQTLSQLVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGQDTSRASV  378

Query  861   SYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPL  682
             +YLADA+WLARK++T+WNLENPM IHGEP PWRK  KFVGPRLDFEGSLYDDY L EPP+
Sbjct  379   NYLADASWLARKILTIWNLENPMVIHGEPPPWRKKVKFVGPRLDFEGSLYDDYGLTEPPV  438

Query  681   NFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYP  502
             NF+LDDD++ RTE L+RD Y +T+ LLR+HHAALLKTVKVLL QKEI  EEIDFIL+NYP
Sbjct  439   NFNLDDDIAWRTEELLRDMYGRTVTLLRRHHAALLKTVKVLLNQKEIGREEIDFILNNYP  498

Query  501   PHTPASLLLEEGDPGSLPLFHQEQEEANEIEYSLLS  394
             P TP S LLEE +PG+LP   QEQ   +++E++L++
Sbjct  499   PQTPISRLLEEENPGTLPFIKQEQ--CSQVEHALVN  532



>ref|XP_001754170.1| predicted protein [Physcomitrella patens]
 gb|EDQ81071.1| predicted protein [Physcomitrella patens]
Length=958

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/863 (54%), Positives = 595/863 (69%), Gaps = 5/863 (1%)
 Frame = -2

Query  3024  SNSSGGNDDDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNL  2845
             S   GG  +D+++++L E PSQVE++Y VGD L TLKE  + +   +     + L    +
Sbjct  48    SARGGGEGEDYISKLLTETPSQVESKYLVGDTLYTLKELREAETPIW-RAVTDALWGTVV  106

Query  2844  KAFSRKSQEDGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKME  2665
             +    + Q   +      VYL ++LR  KG LYVPE++F S   E +E+ + +E LP+M 
Sbjct  107   QPLLERRQYVKEDAVDSRVYLNDLLRGFKGNLYVPEEVFESQTDEFKEYSRQLESLPEMS  166

Query  2664  FEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQA  2485
             FE+F +  +  ++  L  +          + DF+VELK +PG  +LQ  KW+M L   +A
Sbjct  167   FEEFLRAARAGEINFLVSRGVKTPEGKHAYYDFLVELKPVPGELTLQARKWSMHLSKEEA  226

Query  2484  QSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiags  2305
             +  L E  G + EVE     +V      PHPVA+ IS R+M+E+ ++ +L+ AAA   G 
Sbjct  227   EVALKECKGEQVEVESHYSPYVAVPEAAPHPVAAAISGRVMMEVTVIASLVGAAALSVGG  286

Query  2304  ylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFGVFAKFY  2125
               ++ +FA T     V + V+WP++ PF++   GLV  +   +   I +A   G  A+ +
Sbjct  287   MASAVLFAATGIVSFVILRVLWPLSSPFVRPLVGLVAAMGRNIGYMISEALIGGKGARMF  346

Query  2124  ----QVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKP  1957
                 ++ + G    S+  L  I+ V + M  L +FTL+RRPK+F KWD+WQ IEF QSKP
Sbjct  347   PGIREMLSSGTTYQSLRTLGAIIFVLVAMAALAKFTLTRRPKDFTKWDLWQAIEFGQSKP  406

Query  1956  QARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKT  1777
             QARV+G TGV F DVAGI+  V ELQELV+YLK+PE F++MG KPPHGVLLEGPPGCGKT
Sbjct  407   QARVEGSTGVGFADVAGIDDVVTELQELVSYLKDPERFNQMGTKPPHGVLLEGPPGCGKT  466

Query  1776  LVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATK  1597
             L+AKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVN+PSV+FIDEIDAL   
Sbjct  467   LLAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNRPSVVFIDEIDALGAM  526

Query  1596  RQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPG  1417
             R G   +   D YNA  QERETTLNQLL ELDGFDTGKGV+FLGATNRMD+LDPALLRPG
Sbjct  527   RHGAAGEEGMDTYNAGAQERETTLNQLLIELDGFDTGKGVVFLGATNRMDMLDPALLRPG  586

Query  1416  RFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalv  1237
             RFDRK+ IRPP AKGR  ILKVHA+ VKL ETV+L SYA+NLPGWSGA+LAQLLQEAALV
Sbjct  587   RFDRKVAIRPPRAKGRYEILKVHAKSVKLDETVNLESYAKNLPGWSGAELAQLLQEAALV  646

Query  1236  aVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENA  1057
             AVR G   I R DMD A+DRLT+GP+R+G+        R A  E+G ALTSHLLRH+E A
Sbjct  647   AVRHGGTIIERIDMDRALDRLTMGPERIGMRRRLPVHRRMAAHELGIALTSHLLRHFEQA  706

Query  1056  KVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDT  877
               E CDR+SI PRG TL++ + +RL+DE Y+FERRP LLHRLQVLLGGRA EEV+YGRDT
Sbjct  707   DTEFCDRVSIVPRGDTLARCIMNRLEDEYYLFERRPALLHRLQVLLGGRAGEEVMYGRDT  766

Query  876   SKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDL  697
             S  S+++L DATWLARK+++ WNLE  + + G+P PW       GP L FEG LYDDY  
Sbjct  767   SSYSLTHLPDATWLARKIVSTWNLEKGIALTGDPCPWDGGGSMTGPPLGFEGGLYDDYGF  826

Query  696   IEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFI  517
             ++ PLN+DL D   ++TE LI   Y KTL +L+QHHAAL K V V+++++EI GEEI+ I
Sbjct  827   VQKPLNYDLVDATMEQTENLIESMYTKTLKMLKQHHAALTKMVYVVMEREEIFGEEIEQI  886

Query  516   LSNYPPHTPASLLLEEGDPGSLP  448
             L  YP  T    +++E +PG LP
Sbjct  887   LELYPAGTSVQKVMDEEEPGDLP  909



>ref|XP_001769066.1| predicted protein [Physcomitrella patens]
 gb|EDQ66144.1| predicted protein [Physcomitrella patens]
Length=966

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/870 (53%), Positives = 603/870 (69%), Gaps = 15/870 (2%)
 Frame = -2

Query  3024  SNSSGGNDD-DFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSF--DTGAL--EIL  2860
             + + GGN++ D++T++L E PSQVE++Y VGD+L TLKE    +   +   T AL   ++
Sbjct  47    AAAGGGNEEEDYITKLLTETPSQVESKYLVGDRLYTLKELRKAEAPIWISTTDALWGNVV  106

Query  2859  RRLNLKAFSRKSQE-DGDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknve  2683
             + L     SR+S+E D +   P  VYL ++LR  KG LYVPE++F     E EE+ + +E
Sbjct  107   QPL---LESRQSEENDSEVQPPSSVYLNDLLRGFKGNLYVPEEVFEGQTDEVEEYSRQLE  163

Query  2682  ELPKMEFEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMR  2503
              LP++ FE+F K  +  +V +L  +      Y   + DF+VELK +PG ++ Q  +  M 
Sbjct  164   TLPEISFEEFLKAARAGEVSMLASRGVTTPEYRHAYYDFLVELKAVPGDQTWQARERAMH  223

Query  2502  LDLNQAQSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaa  2323
             L   +A   L E  G + EVE     +V      PHP+A+ IS R+M+E+ ++ +L+ AA
Sbjct  224   LSKEEADVALKECKGDQVEVESYYSPFVSLPQAAPHPIAAAISGRVMMEVTVVASLVGAA  283

Query  2322  aaiagsylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAFG  2143
             A   G   ++ +F  T     + + VVWP++ P ++ F GL       +   I DA   G
Sbjct  284   ALSVGGMASAVLFTSTGIVSFLILRVVWPLSSPLVRPFLGLAAATGRSIGFMISDALVGG  343

Query  2142  VFAKFY-----QVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGI  1978
                +F+      +++ G +  S+  L  I+ V + M  L +FTL+RRPK+F KWD+WQ I
Sbjct  344   KGIRFFPGIRGMIFS-GTMYQSLRTLGAIIFVLVAMAALAKFTLTRRPKDFTKWDLWQAI  402

Query  1977  EFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEG  1798
             EF QSKPQARV+G TGV F DVAGI+  V ELQELV+YLK+PE F++MG KPPHGVLLEG
Sbjct  403   EFGQSKPQARVEGTTGVGFADVAGIDDVVTELQELVSYLKDPERFNQMGTKPPHGVLLEG  462

Query  1797  PPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDE  1618
             PPGCGKTL+AKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVN+PSV+FIDE
Sbjct  463   PPGCGKTLLAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNRPSVVFIDE  522

Query  1617  IDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLD  1438
             IDAL   R G   +   D YNA  QERETTLNQLL ELDGFDTGKGV+FLGATNRMD+LD
Sbjct  523   IDALGAMRHGAAGEEGMDTYNAGAQERETTLNQLLIELDGFDTGKGVVFLGATNRMDMLD  582

Query  1437  PALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaql  1258
             PALLRPGRFDRK+ IRPP AKGR  ILKVHA+ VKL E+V+L SYA+NLPGWSGA+LAQL
Sbjct  583   PALLRPGRFDRKVAIRPPRAKGRYEILKVHAKSVKLDESVNLESYAKNLPGWSGAELAQL  642

Query  1257  lqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHL  1078
             LQEAALVAVR G   + R DMD A+DRLT+GP+R+G+        R A  E+G ALTSHL
Sbjct  643   LQEAALVAVRHGGTIVERIDMDRALDRLTMGPERIGMRRRLPVHRRMAAHELGIALTSHL  702

Query  1077  LRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEE  898
             LRH+E +  E CDR+SI PRG TL++ + +RL+DE Y+F+R+P LLHRLQVLLGGRA EE
Sbjct  703   LRHFEQSDTEFCDRVSIVPRGDTLARCIMNRLEDEYYLFQRKPALLHRLQVLLGGRAGEE  762

Query  897   VIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGS  718
             V+YGRDTS  S+++L DATWLARK+++ WNLE  +++ G+P PW       GP L FEG 
Sbjct  763   VMYGRDTSSYSLTHLPDATWLARKIVSTWNLEEGISLTGDPCPWDGGGSMTGPPLGFEGG  822

Query  717   LYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEIS  538
             LYDDY  ++ PLN+DL D   + T+ L+   Y KTL LL+QHHAAL K V V+++++EI 
Sbjct  823   LYDDYGFVQKPLNYDLVDITMESTQNLLESMYMKTLKLLKQHHAALTKMVFVVMEREEIF  882

Query  537   GEEIDFILSNYPPHTPASLLLEEGDPGSLP  448
             GEEI+ IL  YP  TP   +++E +P  LP
Sbjct  883   GEEIEQILELYPTGTPVQKVMDEEEPSDLP  912



>ref|XP_002972975.1| hypothetical protein SELMODRAFT_98591, partial [Selaginella moellendorffii]
 gb|EFJ26196.1| hypothetical protein SELMODRAFT_98591, partial [Selaginella moellendorffii]
Length=894

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/873 (49%), Positives = 583/873 (67%), Gaps = 35/873 (4%)
 Frame = -2

Query  3000  DDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQ  2821
             DDF+T++L+ENPS+VE +   GD++L+LKE    +   + +  L  +  L  KA   + Q
Sbjct  3     DDFMTQILRENPSRVERKCLSGDRMLSLKEWRSQRVPLW-SKLLAKIEPLVKKAREVRPQ  61

Query  2820  ED--------GDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKME  2665
             E             K   V+L ++LR +KG LYVP +IF  +++E EEF +   ELP M 
Sbjct  62    EKKTPESETTSQAAKGRSVFLPDLLRAYKGNLYVPVEIFMGHVAEAEEFAREFAELPVMI  121

Query  2664  FEDFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQA  2485
             F+DF   +++D+V  +  K             F+VELKE+ G +S Q  KW+M+L   QA
Sbjct  122   FQDFVNVMQSDQVAQIKSKGTQ----------FIVELKEISGERSAQAQKWSMQLTEAQA  171

Query  2484  QSLLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiags  2305
             + +L++Y G  +E++ +    V + P  P+PV+S IS RLM+EL  + +L++ AA   G 
Sbjct  172   KYVLSQYRGYHHEIQPRFAPTVIQPPPTPNPVSSAISNRLMLELSTVVSLISVAAFAVGK  231

Query  2304  ylasavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVW---DKIYDAFAFGVFA  2134
             + A    A+ S A  V   V+ P   P M+ F  L   V+  +    +        G+F 
Sbjct  232   FAAGVASALASVAAFVIFRVLLPTITPIMRPFLSLTMGVVRIILGTGEAGMRTGLLGLFT  291

Query  2133  KFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQ  1954
              F    T G + +++ ++  ++ V + M    +FT++RR ++ +KWDIWQ IEF QSKPQ
Sbjct  292   GFTGFVTSGDLLSALRIIISMIFVIVMMAAFAKFTITRRSRDHQKWDIWQAIEFGQSKPQ  351

Query  1953  ARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTL  1774
             ARV G TGV F DVAGI++ V+ELQELV YLK+PE F +MG KPPHGVLLEGPPGCGKTL
Sbjct  352   ARVKGSTGVMFKDVAGIDEVVKELQELVVYLKDPERFARMGTKPPHGVLLEGPPGCGKTL  411

Query  1773  VAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKR  1594
             +AKA+AGEAGVPFYQMAGSEFVEVLVGVGAAR+RDLF RAKVN+P+V+FIDEIDAL   R
Sbjct  412   LAKAVAGEAGVPFYQMAGSEFVEVLVGVGAARMRDLFLRAKVNRPAVVFIDEIDALGGAR  471

Query  1593  QGIFN----DSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALL  1426
                      D     ++A TQERETTLNQLL ELDGFDTGKGVIFLGATNR D+LDPALL
Sbjct  472   SEFHGKRAMDDKTATFHAGTQERETTLNQLLIELDGFDTGKGVIFLGATNRADMLDPALL  531

Query  1425  RPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqea  1246
             RPGRFDR+I I PP A  R  ILKVH+ KVKL  +VDL  YA++L GWSGA+LAQL+QE+
Sbjct  532   RPGRFDRRILISPPKASARYEILKVHSEKVKLDSSVDLWPYAKSLNGWSGAELAQLMQES  591

Query  1245  alvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHY  1066
             ALVA+RKGH SI R D+D AVDRLT+GP+  G+        R A+ E+G A+ +HLLR  
Sbjct  592   ALVAIRKGHKSITRHDVDTAVDRLTIGPEVYGVGRRQSVHRRMASIEIGMAMVAHLLRST  651

Query  1065  ENAKVECCDRISINPRGQ--------TLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
             ENA+VE CDRISI PRG+        T S+ ++H LDD++Y+F RRP L+HRL+V+LG R
Sbjct  652   ENAEVEPCDRISIVPRGKASIQKLFLTYSRTIYHTLDDDAYLFARRPTLIHRLKVMLGAR  711

Query  909   AAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLD  730
               EE+IYG DTS  S +YLADA+WLARK+ ++WN++  +++HGE  PW +S +F GP   
Sbjct  712   IGEELIYGHDTSTLSAAYLADASWLARKIFSIWNVDGRISMHGERSPWERSSQF-GPPTW  770

Query  729   FEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkq  550
             FEG LY+DYDL+   ++  +D+DV+ RT+AL++  Y +TL+LL+ + AAL K + V++++
Sbjct  771   FEGGLYNDYDLVGQSIDPRMDEDVAVRTKALMQKAYDETLSLLKPYKAALTKALHVIMEK  830

Query  549   KEISGEEIDFILSNYPPHTPASLLLEEGDPGSL  451
             +E+ GEE+D IL  YP      L+  E  PG L
Sbjct  831   EEMFGEELDVILKRYPSGYQVELVDSEEQPGYL  863



>ref|XP_002993396.1| hypothetical protein SELMODRAFT_137006, partial [Selaginella 
moellendorffii]
 gb|EFJ05581.1| hypothetical protein SELMODRAFT_137006, partial [Selaginella 
moellendorffii]
Length=892

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/871 (50%), Positives = 581/871 (67%), Gaps = 33/871 (4%)
 Frame = -2

Query  3000  DDFVTRVLKENPSQVETRYKVGdklltlkekedlqkKSFDTGALEILRRLNLKAFSRKSQ  2821
             DDF+T++L+ENPS+VE +   GD++L+LKE    +   + +  L  +  L  KA   + Q
Sbjct  3     DDFMTQILRENPSRVERKCLSGDRMLSLKEWRLQRVPLW-SKLLAKIEPLVEKAREVRPQ  61

Query  2820  ED------GDQGKPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFE  2659
             E           K   V+L ++LR +KG LYVPE+IF  +++E EEF +   ELP M F+
Sbjct  62    EKKTPETTSQAAKGRSVFLPDLLRAYKGNLYVPEEIFMGHVAEAEEFAREFAELPVMIFQ  121

Query  2658  DFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQS  2479
             DF   +++D+V  +  K             F+VELKE+ G +S Q  KW + L   QA+ 
Sbjct  122   DFVNVMQSDQVAQIKSKGTQ----------FIVELKELSGERSAQAQKWYVNLTEAQAKY  171

Query  2478  LLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsyl  2299
             +L++Y G  +E++ +    V + P  P+PV+S IS RLM+EL  + +L++ AA   G + 
Sbjct  172   VLSQYRGYHHEIQPRFAPTVIQPPPTPNPVSSAISNRLMLELSTVVSLISVAAFAVGKFA  231

Query  2298  asavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVW---DKIYDAFAFGVFAKF  2128
             A A  A+ S A  V   V+ P   P M  F  L   V+  +    +        G+F  F
Sbjct  232   AGAASALASVAAFVIFRVLLPTITPIMGPFLSLTMGVVRIILGTGEAGMRTGLLGLFTGF  291

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
                 T G + +++ ++  ++ V + M    +FT++RR ++ +KWDIWQ IEF QSKPQAR
Sbjct  292   TGFVTSGDLLSALRIIISMIFVIVMMAAFAKFTITRRSRDHQKWDIWQAIEFGQSKPQAR  351

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             V G TGV F DVAGI++ V+ELQELV YLK+PE F +MG KPPHGVLLEGPPGCGKTL+A
Sbjct  352   VKGSTGVMFKDVAGIDEVVKELQELVVYLKDPERFARMGTKPPHGVLLEGPPGCGKTLLA  411

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KA+AGEAGVPFYQMAGSEFVEVLVGVGAAR+RDLF RAKVN+P+V+FIDEIDAL   R  
Sbjct  412   KAVAGEAGVPFYQMAGSEFVEVLVGVGAARMRDLFLRAKVNRPAVVFIDEIDALGGARSE  471

Query  1587  IFN----DSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRP  1420
                    D     ++A TQERETTLNQLL ELDGFDTGKGVIFLGATNR D+LDPALLRP
Sbjct  472   FHGKRAMDDKTATFHAGTQERETTLNQLLIELDGFDTGKGVIFLGATNRADMLDPALLRP  531

Query  1419  GRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaal  1240
             GRFDR+I I PP A  R  ILKVH+ KVKL  +VDL  YA++L GWSGA+LAQL+QE+AL
Sbjct  532   GRFDRRILISPPKASARYEILKVHSEKVKLDSSVDLWPYAKSLNGWSGAELAQLMQESAL  591

Query  1239  vaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYEN  1060
             VA+RKGH SI R D+D AVDRLT+GP+  G+        R A+ E+G A+ +HLLR  EN
Sbjct  592   VAIRKGHKSITRHDVDTAVDRLTIGPEVYGVGRRQSVHRRLASIEIGMAMVAHLLRSTEN  651

Query  1059  AKVECCDRISINPRGQ--------TLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAA  904
             A+VE CDRISI PRG+        T S+ ++H LDD++Y+F RRP L+HRL+V+LG R  
Sbjct  652   AEVEPCDRISIVPRGKASIQKLFLTYSRTIYHTLDDDAYLFARRPTLIHRLKVMLGARIG  711

Query  903   EEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFE  724
             EE+IYG DTS  S +YLADA+WLARK+ ++WN++  +++HGE  PW +S +F GP   FE
Sbjct  712   EELIYGHDTSTLSAAYLADASWLARKIFSIWNVDGRISMHGERSPWERSSQF-GPPTWFE  770

Query  723   GSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKE  544
             G LY+DYDL+   ++  +D+DV+ RT+AL+   Y +TL+LL+ + AAL K + V+++++E
Sbjct  771   GGLYNDYDLVGQSIDPRMDEDVAVRTKALMEKAYDETLSLLKPYKAALTKALHVIMEKEE  830

Query  543   ISGEEIDFILSNYPPHTPASLLLEEGDPGSL  451
             + GEE+D IL  YP      L+  E  PG L
Sbjct  831   MFGEELDVILKRYPSGYQVELVDSEEQPGYL  861



>gb|KHG13773.1| ATP-dependent zinc metalloprotease FtsH [Gossypium arboreum]
Length=836

 Score =   534 bits (1376),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 295/421 (70%), Positives = 333/421 (79%), Gaps = 51/421 (12%)
 Frame = -2

Query  1656  AKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGV  1477
              +VNKPSVIF DEIDALAT+RQG+F +++D  YNAATQERETTLNQLL ELDGFDTGKGV
Sbjct  444   CEVNKPSVIFTDEIDALATRRQGVFKETTDHLYNAATQERETTLNQLLIELDGFDTGKGV  503

Query  1476  IFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQ  1297
             IFL ATN  DL DP LLRP                                         
Sbjct  504   IFLAATNCRDLSDPTLLRP-----------------------------------------  522

Query  1296  NLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR  1117
                GW+GAKLAQL+QEAALVAVRK H SIL+SDMDDAVDRLTVGPKRVGIDLGHQGQCRR
Sbjct  523   ---GWTGAKLAQLVQEAALVAVRKRHESILQSDMDDAVDRLTVGPKRVGIDLGHQGQCRR  579

Query  1116  ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLH  937
             ATTEVG A+TSHLLR YENA+VECCDRIS+ PRGQTLSQVVFHRLDDESYMFERRPQLLH
Sbjct  580   ATTEVGVAITSHLLRRYENAEVECCDRISVVPRGQTLSQVVFHRLDDESYMFERRPQLLH  639

Query  936   RLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITV-------WNLENPMTIHGE  778
             RLQV LGGRAAEEVIYGRDTS+AS+SYLADA+WLARK++T+       WNLENPM IHGE
Sbjct  640   RLQVFLGGRAAEEVIYGRDTSRASLSYLADASWLARKILTMSFMTSIRWNLENPMVIHGE  699

Query  777   PLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallr  598
             P PWRK  +FVGPRLDFEGSLYDDYDLIEPP+NF++DD+++KR+E L+RD Y +T++LLR
Sbjct  700   PPPWRKKGQFVGPRLDFEGSLYDDYDLIEPPVNFNMDDEIAKRSEELLRDMYGRTVSLLR  759

Query  597   qhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLLEEGDPGSLPLFHQEQEEAN  418
             +HHAALLK V VLL QKEI+G EID+IL+ YPP TP +L+LEE +PGSLP   QEQE+  
Sbjct  760   RHHAALLKAVTVLLNQKEINGGEIDYILNKYPPQTPLNLVLEEENPGSLPFIKQEQEQER  819

Query  417   E  415
             E
Sbjct  820   E  820



>gb|EYU23321.1| hypothetical protein MIMGU_mgv11b023061mg [Erythranthe guttata]
Length=258

 Score =   416 bits (1069),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 219/258 (85%), Positives = 235/258 (91%), Gaps = 8/258 (3%)
 Frame = -2

Query  1782  KTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALA  1603
             +TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVG+AR+RDLFKRAKVNKPSVIFIDEIDALA
Sbjct  5     QTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGSARVRDLFKRAKVNKPSVIFIDEIDALA  64

Query  1602  TKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLR  1423
             T+RQGIF +S+D  YNAATQERETTLNQLL ELDGFDTGKGVIFL        LDPALLR
Sbjct  65    TRRQGIFKESTDLLYNAATQERETTLNQLLIELDGFDTGKGVIFL--------LDPALLR  116

Query  1422  PGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaa  1243
             PGRFDRKIRI+PPNAKGRL ILKVHARKVKLS+TVDL+SYA NLPGW+GAKLAQLLQEAA
Sbjct  117   PGRFDRKIRIQPPNAKGRLDILKVHARKVKLSDTVDLSSYANNLPGWTGAKLAQLLQEAA  176

Query  1242  lvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYE  1063
             LVAVRKGH++IL SD+DD VDRLTVGPKRVG+DLGHQGQ RRAT EVGTALTSHLLR  E
Sbjct  177   LVAVRKGHSAILHSDLDDVVDRLTVGPKRVGVDLGHQGQLRRATVEVGTALTSHLLRRIE  236

Query  1062  NAKVECCDRISINPRGQT  1009
             NA VE CDR+SI+PRGQ 
Sbjct  237   NANVELCDRVSIHPRGQA  254



>ref|XP_002509020.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO70278.1| predicted protein, partial [Micromonas sp. RCC299]
Length=421

 Score =   365 bits (937),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 194/397 (49%), Positives = 264/397 (66%), Gaps = 9/397 (2%)
 Frame = -2

Query  1995  DIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPH  1816
             D  Q +EF+QS+  AR D    VT  DV G+E  VE+L E++ +LKNPE F ++G KPP 
Sbjct  34    DAIQAMEFAQSRADARKDAQVEVTLEDVGGLENIVEDLNEVIAFLKNPEKFKRLGAKPPK  93

Query  1815  GVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPS  1636
             G+L+EG PG GKTL+AKAIAGEA VPFY M+G+EFVE++VGVGAARIRDLFKRA++N P 
Sbjct  94    GLLMEGGPGVGKTLIAKAIAGEAQVPFYSMSGAEFVEIIVGVGAARIRDLFKRARMNAPC  153

Query  1635  VIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATN  1456
             ++F+DEIDAL T+R               T+E E TLNQLLTE+DGF    GV+F+GATN
Sbjct  154   LVFVDEIDALGTRRAA--------AGTKGTEEHEQTLNQLLTEMDGFTPDTGVVFVGATN  205

Query  1455  RMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSG  1276
             R DLLDPAL+RPGRFDRK+ +  P    R  IL++H  K  +   +D   +A+NLPG SG
Sbjct  206   RADLLDPALMRPGRFDRKVTVPQPGLDARAKILQIHLAKRNVDPEIDTLQFAKNLPGLSG  265

Query  1275  AKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGT  1096
             A+LA +  EAA ++VR+G + I   D+ +AVDR+T G ++   D   +   R    E+G 
Sbjct  266   AELANICNEAAAISVRRGSDIIETVDVMEAVDRVTNGLRQPLFDKDDETVHRLTRHELGH  325

Query  1095  ALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLG  916
             A+ + +L +     +E  +R+SI PRG+  +Q  ++R  DE YMF  R +LL R+QVL+ 
Sbjct  326   AVVATVL-YKSTGLIEAVERVSIIPRGRDPTQTSYNRKRDEDYMFPTRARLLERVQVLMA  384

Query  915   GRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNL  805
             GRAAEEV YG D ++ S + + DA  L R ++  + L
Sbjct  385   GRAAEEVYYGNDITEYSFADIRDANDLTRNVVVNYGL  421



>ref|XP_003061743.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH54373.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=549

 Score =   362 bits (929),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 195/399 (49%), Positives = 263/399 (66%), Gaps = 11/399 (3%)
 Frame = -2

Query  1980  IEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLE  1801
             +EF+QS+  AR D    VT  DV G+E  VE+L E++ +LKNPE F ++G KPP G+L+E
Sbjct  1     MEFAQSRADARKDAQVDVTLEDVGGLENIVEDLNEVIAFLKNPESFKRLGAKPPKGLLME  60

Query  1800  GPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFID  1621
             G PG GKTL+AKAIAGEA VPFY M+G+EFVE++VGVGAAR+RDLFKRA++N P +IF+D
Sbjct  61    GGPGVGKTLIAKAIAGEAAVPFYSMSGAEFVEIIVGVGAARVRDLFKRARLNAPCLIFVD  120

Query  1620  EIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLL  1441
             EIDAL TKR               T+E E TLNQLLTE+DGF    GV+F+GATNR DLL
Sbjct  121   EIDALGTKRAAAG--------TRGTEEHEQTLNQLLTEMDGFTPDTGVVFIGATNRADLL  172

Query  1440  DPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaq  1261
             DPAL+RPGRFDRK+ +  P  + R  IL++H  K  +   +D   +A+NLPG SGA+LA 
Sbjct  173   DPALMRPGRFDRKVTVPQPGLEARAKILQIHLAKRNVDPNIDTMQFAKNLPGLSGAELAN  232

Query  1260  llqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSH  1081
             +  EAA ++VR+G   I   D+ DAVDR+T G K+  +D  +    R    E+G A+ + 
Sbjct  233   ICNEAATISVRRGGEFIETCDVIDAVDRVTNGLKKPLMDKNNPVVHRLTRHELGHAIVAT  292

Query  1080  LL-RHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAA  904
             +L RH  N  +E  +R+SI PRG+  +Q  ++R  D  YMF  R +LL R+QVLL G AA
Sbjct  293   VLYRH--NKLIEAVERVSIIPRGRDPTQTTYNRKADAEYMFPTRQRLLERVQVLLAGLAA  350

Query  903   EEVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTI  787
             E+V +G + +  S   + DA  L R ++  + L  P  +
Sbjct  351   EQVYFGTNITTMSKDDVRDANDLVRNVVVNYALGQPNAV  389



>ref|XP_001420493.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98786.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=494

 Score =   352 bits (904),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 199/422 (47%), Positives = 266/422 (63%), Gaps = 13/422 (3%)
 Frame = -2

Query  1998  WDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPP  1819
              D +Q ++F+QS+  AR DG   VT  DV G+E  +E+L+E+V +LK PE F K+G +PP
Sbjct  30    QDQFQAMQFAQSRAGARRDGTVDVTLEDVGGLENIIEDLEEVVAFLKEPERFAKVGARPP  89

Query  1818  HGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKP  1639
              G+L+EG PG GKTL+AKAIAGEA VPFY M+GSEFVE++VGVGAAR+RDLFKRA++N P
Sbjct  90    KGLLMEGGPGVGKTLIAKAIAGEAKVPFYSMSGSEFVEIIVGVGAARVRDLFKRARINAP  149

Query  1638  SVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGAT  1459
              +IF+DEIDAL TKR               T+E E TLNQLLTE+DGF    GV+F+GAT
Sbjct  150   CLIFVDEIDALGTKRAA--------AGTRGTEEHEQTLNQLLTEMDGFTPDTGVVFIGAT  201

Query  1458  NRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWS  1279
             NR DLLDPALLRPGRFDRK+R+  PN + R  IL++H  K   +  +D    AQNLPG S
Sbjct  202   NRADLLDPALLRPGRFDRKVRVGLPNVEARAKILQIHLSKRNCNPEIDTKRLAQNLPGLS  261

Query  1278  GAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVG  1099
             GA++A +  EAA+  VR+    I   D+ DAV+R+  G +            + A  EVG
Sbjct  262   GAEIANICNEAAVHCVRRQGEQIEEHDVLDAVERVVSGIRLTAHPKESVTTRKLAAHEVG  321

Query  1098  TALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLL  919
              AL  +LL H  N  +E  + ISI PRG   +  +  R  DE Y +  R ++  R+QVLL
Sbjct  322   HALVQNLL-HKSNGLIEDIEMISIIPRGFEPAITLIQRKRDEDYRYPTRARMCERVQVLL  380

Query  918   GGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENP--MTIHG-EPLPWRKSPKF  748
              GR+ E+V++G  +++ S   + +A  L R MI  + L  P  MT +  +P    KS + 
Sbjct  381   AGRSCEKVLFGEASTRGS-EDVCEANDLLRNMIVNFGLGQPGMMTTYTYDPKHLNKSERR  439

Query  747   VG  742
             V 
Sbjct  440   VA  441



>gb|KFM28746.1| ATP-dependent zinc metalloprotease FtsH [Auxenochlorella protothecoides]
Length=872

 Score =   354 bits (909),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 228/536 (43%), Positives = 313/536 (58%), Gaps = 24/536 (4%)
 Frame = -2

Query  2073  ILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQA  1894
             I L FL +VL V      +P+     D++  +EF+QSK +AR DG TGV F DV GI  A
Sbjct  289   IALSFLAVVLAVGIF---KPRKQMPIDLFMALEFAQSKGKARKDGTTGVGFADVGGIGTA  345

Query  1893  VEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSE  1714
             + +L ++V +LK P  +  M  +PP G+LLEG PG GKTLVAKA+AGEAGV FYQMAGSE
Sbjct  346   IHDLNDVVAFLKAPLQYAGMKARPPKGILLEGDPGTGKTLVAKAVAGEAGVAFYQMAGSE  405

Query  1713  FVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERE  1534
             FVE +VGVGA+R+RDLFKRA VN P +IF+DEIDAL  KR         D      +ERE
Sbjct  406   FVEAIVGVGASRVRDLFKRAMVNAPCIIFVDEIDALGIKRA--------DAGVGTNEERE  457

Query  1533  TTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILK  1354
              TLNQLLTE+DGF    GV+F+GATNR DLLDPALLR GRFDR+IRI  P+  GR  IL+
Sbjct  458   QTLNQLLTEMDGFSPSLGVMFIGATNRADLLDPALLRAGRFDRRIRINLPDEVGREEILR  517

Query  1353  VHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRL  1174
             +HAR+  +   VDL   A++LPG SGA+L  ++ E+ L  +R+   ++ + D+D+ VDR+
Sbjct  518   IHARRTSMDPGVDLAQLAKDLPGLSGAELGNVINESILECLRRRGTTVTQRDVDNGVDRV  577

Query  1173  TVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
               G +   +   +  + R A  E GT + S LLR   +  VE  +R+S+  RG+ LS+ V
Sbjct  578   VQGVRLPPLPKHYAMRRRLALHEAGTGVLSTLLR-ARSGHVEAVERMSLVGRGRELSRTV  636

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITV  814
               R  DE+Y+   R +L  R++V L GRAAE +  G  +S      L DA  +A + +T 
Sbjct  637   LARGRDETYLLVTRARLRDRMRVALAGRAAEHLFLGEASSYCDKD-LQDARRIAMRTVTA  695

Query  813   WNLENPMTIHGEPLPWRKSPKFVGPRLDFEGS--LYDD--YDLIEPPLNFDLDD----DV  658
             + L +   +   P P    P        FE +    DD  +    P   F   D     V
Sbjct  696   YCLSDLGLVSYSPPP---VPSMENQMFGFEVNPDRIDDNLFGHAVPGGGFQPTDATWNAV  752

Query  657   SKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTP  490
              +    LI   Y   +  L +H  A+      LL+Q+ + GEE++ I++++PP  P
Sbjct  753   CRAASDLILAAYNDNMEELARHEPAVQAVADALLRQETVLGEELEAIMASHPPAAP  808



>ref|XP_005645365.1| AAA-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20821.1| AAA-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=906

 Score =   355 bits (910),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 206/414 (50%), Positives = 278/414 (67%), Gaps = 17/414 (4%)
 Frame = -2

Query  2019  RPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFD  1840
             +P+     D  Q IEF+QSK QAR DG TGVTF DVAG ++AV +L+ +V +LK+P  F 
Sbjct  365   KPRKQMPTDPIQAIEFAQSKGQARKDGRTGVTFADVAGCDEAVRQLRFVVEFLKDPAKFV  424

Query  1839  KMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFK  1660
              +G K P G+LLEG PG GKTLVAKA+AGEAGVPFYQMAGSEFVE +VGVGAAR+RDLFK
Sbjct  425   AVGGKLPKGILLEGDPGTGKTLVAKAVAGEAGVPFYQMAGSEFVEAIVGVGAARVRDLFK  484

Query  1659  RAKVNK-PSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGK  1483
             RA+V + P +IF+DEIDAL TKR       + ++ N   +ERE TLNQLL+E+DGF    
Sbjct  485   RARVQEGPCIIFVDEIDALGTKRA-----QAGEKTN---EEREQTLNQLLSEMDGFTVDS  536

Query  1482  GVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVD---L  1312
             GV+F+ ATNR+DLLDPAL+RPGRFD KI+I  P+  GR  ILKVH RK+KL E V    L
Sbjct  537   GVVFVAATNRIDLLDPALMRPGRFDEKIKIARPDTDGRFDILKVHTRKLKLDEDVTDDVL  596

Query  1311  TSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQ  1132
                A++LPG SGA+LA +L EAAL  VR+  + + R+D+ + +DR+  G +R  +    +
Sbjct  597   RQVARDLPGLSGAELANVLNEAALECVRRQGSLVCRADIYNGMDRILQGLRRPSMPATFR  656

Query  1131  GQCRRATTEVGTALTSHLLRHYENA-----KVECCDRISINPRGQTLSQVVFHRLDDESY  967
                + A  E+G AL + + R    +     ++E  +R+S+ PRG+  ++ +F R  DE Y
Sbjct  657   VSKQFAIHEMGKALVATVARQARESQGLKPRLERVERVSMVPRGRDWTRTIFLRGPDEDY  716

Query  966   MFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNL  805
                 + ++L RLQV++ GRAAEEV+     S  SVS L D   LA+K++  + +
Sbjct  717   TMSTKGRMLERLQVIMAGRAAEEVLLEEGPSTYSVSDLRDGVRLAQKIVASYGM  770



>ref|XP_004149014.1| PREDICTED: uncharacterized protein LOC101214425 [Cucumis sativus]
Length=547

 Score =   344 bits (882),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 252/325 (78%), Gaps = 7/325 (2%)
 Frame = -2

Query  2820  EDGDQG------KPEEVYLKEILREHKGKLYVPEQIFRSNLSeeeefeknveELPKMEFE  2659
             E+G +G      K E+VYLK+ILRE+KGKLYVPEQ+FRS LSE EEF++++E LPKM FE
Sbjct  7     EEGIEGRNEGGNKSEDVYLKDILREYKGKLYVPEQVFRSELSEGEEFDRSLEALPKMSFE  66

Query  2658  DFQKYLKTDKVKLLTFKEDNAANYGFGFRDFVVELKEMPGHKSLQRTKWTMRLDLNQAQS  2479
             DF K L+ DKVKLLT KE  A  YG  FRDF+V+LKE+PG KSLQRT+W +RLD  + Q+
Sbjct  67    DFVKALENDKVKLLTSKESRATFYGSMFRDFIVDLKEIPGEKSLQRTRWALRLDETEIQT  126

Query  2478  LLNEYTGPRYEVEKQMMTWVGKLPEQPHPVASKISTRLMVELGmltalmtaaaaiagsyl  2299
             +L +YTGP+Y++E    +WVGKLP  PHPVAS+IS+R+MVELG+ T ++ AAA + G +L
Sbjct  127   VLEQYTGPQYQIESHTSSWVGKLPNYPHPVASQISSRMMVELGVATIMIAAAAFLIGGFL  186

Query  2298  asavfavtsfafavtvyvVWPVAKPFMKFFSGLVFDVLERVWDKIYDAFAF-GVFAKFYQ  2122
             ASAVF+ T F F   V VVWP+ +PF+K   GL+F + ERVWD + D F + G F+K  +
Sbjct  187   ASAVFSFTGFVFFTVVNVVWPIIRPFLKLSLGLIFGICERVWDNVGDFFEYGGGFSKLQE  246

Query  2121  VYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVD  1942
             V+ + GIS S+E++ PI  + L MVLL+RFTLSRRPKNFRKWD+WQGI+FS+SK +ARVD
Sbjct  247   VFIYCGISDSLELIVPISTIVLIMVLLLRFTLSRRPKNFRKWDLWQGIDFSRSKAEARVD  306

Query  1941  GMTGVTFNDVAGIEQAVEELQELVT  1867
             G TGV F+DVAGI++AVEELQE ++
Sbjct  307   GSTGVKFSDVAGIDEAVEELQETLS  331


 Score =   285 bits (729),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -2

Query  1014  QTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWL  835
             +TLSQVVF RLDDESYMFERRPQLLHRLQV LG RAAEEVIYGRDTSKASVSYLADA+WL
Sbjct  328   ETLSQVVFRRLDDESYMFERRPQLLHRLQVFLGARAAEEVIYGRDTSKASVSYLADASWL  387

Query  834   ARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVS  655
             ARK+IT+WNLENPM IHGEP PWR+   F+GPRLDFEGSLY+DY+L EPPLNF+LDD+V+
Sbjct  388   ARKIITIWNLENPMVIHGEPPPWRREANFIGPRLDFEGSLYNDYNLTEPPLNFNLDDEVA  447

Query  654   KRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPPHTPASLLL  475
             +RTEALIRD Y +TLA+L++HHAALLK VKVL+ Q+EISGEEIDFIL NYP  TP S++L
Sbjct  448   RRTEALIRDMYDRTLAMLQRHHAALLKAVKVLITQEEISGEEIDFILDNYPQQTPISVVL  507

Query  474   EEGDPGSLPL  445
             +E +PGSLP 
Sbjct  508   QEENPGSLPF  517



>ref|WP_013910143.1| ATP-dependent metalloprotease [Thermodesulfobacterium geofontis]
 ref|YP_004628373.1| ATP-dependent metalloprotease FtsH [Thermodesulfobacterium geofontis 
OPF15]
 gb|AEH23445.1| ATP-dependent metalloprotease FtsH [Thermodesulfobacterium geofontis 
OPF15]
Length=599

 Score =   338 bits (866),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 272/427 (64%), Gaps = 27/427 (6%)
 Frame = -2

Query  2073  ILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQA  1894
             ++L+ L +V L +   S +P +F K           S+ +   +G T VTFNDVAGIE+ 
Sbjct  117   LILIVLWIVFLKQLQPSNKPFSFIK-----------SRAKLIKEGNTKVTFNDVAGIEEV  165

Query  1893  VEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSE  1714
              EELQ++V +LKNP+ F K+G + P G+LL GPPG GKTL+AKAIAGEAGVPF+ ++GS+
Sbjct  166   KEELQDIVEFLKNPQKFTKLGARIPKGILLVGPPGTGKTLLAKAIAGEAGVPFFSISGSD  225

Query  1713  FVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERE  1534
             FVE+ VGVGAAR+RDLF +AK + P +IFIDEIDA+  +R        D        ERE
Sbjct  226   FVEMFVGVGAARVRDLFSQAKAHAPCIIFIDEIDAVGRQRGAGLGGGHD--------ERE  277

Query  1533  TTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILK  1354
              TLNQLL E+DGFDTG+G++ L ATNR D+LDPALLRPGRFDR++ + PP+  GR  IL+
Sbjct  278   QTLNQLLVEMDGFDTGEGIVVLAATNRPDILDPALLRPGRFDRQVYVPPPDVNGREAILR  337

Query  1353  VHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRL  1174
             ++A+K K+ E++D  + A+  PG++GA L  +L EAAL+A +KG   I   D+++A D++
Sbjct  338   LYAKKFKVDESIDFKAIAKGTPGFTGADLENMLNEAALIAAKKGKEKIEIEDLEEAKDKI  397

Query  1173  TVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
              +G +R GI L  + +   A  E G AL ++ L        +   +ISI PRGQ L    
Sbjct  398   LIGKERKGIVLNEEERKIIAYHEAGHALVAYYL-----PDPDPVHKISIIPRGQALGVTQ  452

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITV  814
                LDD     E    LL ++ VLLGGR +EE+++ + +S A    L  AT +ARKM+  
Sbjct  453   QLPLDDRHIYTE--DYLLKKITVLLGGRVSEELVFNKVSSGAQ-DDLKRATQIARKMVCN  509

Query  813   WNLENPM  793
             W +   +
Sbjct  510   WGMSKKL  516



>ref|WP_012595157.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 ref|YP_002372041.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 ref|YP_003137600.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
 gb|ACK65885.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8801]
 gb|ACV00765.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 8802]
Length=640

 Score =   337 bits (863),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 196/434 (45%), Positives = 281/434 (65%), Gaps = 25/434 (6%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA+I ++  ++++FL   + +   + RR  N       Q + F +S+ + +++  TG++F
Sbjct  133   SAAISLVVNLIVLFLLFSIFI--AIIRRSANAS----GQAMNFGKSRARFQMEAKTGISF  186

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
              DVAGI++A EELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  187   EDVAGIDEAKEELQEVVTFLKQPEKFTAIGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGV  246

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R G+        
Sbjct  247   PFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQR-GV-------G  298

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+  +G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  299   YGGGNDEREQTLNQLLTEMDGFEGNRGIIVIAATNRPDVLDKALLRPGRFDRQVVVDYPD  358

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              KGR GIL+VHAR  K+ + V L + A+  PG++GA LA +L EAA+   R+   +I  +
Sbjct  359   LKGRQGILEVHARNKKVDQEVSLEAIARRTPGFTGADLANVLNEAAIFTARRRKEAITMT  418

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISIN  1024
             +++DA+DR+  G +  G  L      R  A  E+G A+   L   +     +  +++++ 
Sbjct  419   EINDAIDRVVAGME--GTPLVDSKSKRLIAYHEIGHAVVGSLHEGH-----DAVEKVTLI  471

Query  1023  PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLAD  847
             PRGQ      F  + DE Y    R QLL R+  LLGGRAAEEVI+G D  +  + + +  
Sbjct  472   PRGQAKGLTWF--MPDEEYGLVTRNQLLARIAGLLGGRAAEEVIFGEDEVTTGAGNDIEK  529

Query  846   ATWLARKMITVWNL  805
              T+LAR+M+T + +
Sbjct  530   VTYLARQMVTRFGM  543



>ref|WP_011242912.1| cell division protein FtsH [Synechococcus elongatus]
 ref|YP_171310.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 ref|YP_399959.1| FtsH peptidase [Synechococcus elongatus PCC 7942]
 dbj|BAD78790.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56972.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD58504.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=630

 Score =   336 bits (861),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 200/435 (46%), Positives = 283/435 (65%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  ++++  F L RR  N       Q ++F +SK + ++D  TGV F+DVAGIE+A E
Sbjct  126   LIFPILLIVGLFFLFRRSGNV-PGGPGQAMQFGKSKARFQMDAKTGVLFDDVAGIEEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LKN E F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKNSERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKENAPCIVFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL RPGRFDR+I +  P+ KGRL ILKVH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALTRPGRFDRQIIVDAPDIKGRLEILKVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+E V L   A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  357   ARNKKLAEDVSLDVIARRTPGFAGADLANLLNEAAILTARRRKDAITLTEIDDAVDRVVA  416

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +   +     G+ +R  A  EVG A+   L++ ++  +     ++++ PRGQ      
Sbjct  417   GMEGTPL---VDGKSKRLIAYHEVGHAIVGTLVKDHDPVQ-----KVTLIPRGQAQGLTW  468

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMIT  817
             F    DE      R Q+L R++  LGGRAAE+VI+G D  +  + + L   T +AR+M+T
Sbjct  469   FA--PDEEQGLTSRAQILARIKGALGGRAAEDVIFGHDEVTTGAGNDLQQVTGMARQMVT  526

Query  816   VWNLEN--PMTIHGE  778
              + + +  P+++ G+
Sbjct  527   RFGMSDLGPLSLEGQ  541



>ref|YP_008965670.1| probable chloroplast ATP-dependent protease (chloroplast) [Porphyridium 
purpureum]
 dbj|BAO23646.1| probable chloroplast ATP-dependent protease (chloroplast) [Porphyridium 
purpureum]
Length=627

 Score =   334 bits (857),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 217/535 (41%), Positives = 326/535 (61%), Gaps = 38/535 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             S+ +E ++  LLV + +V  + F   RRP N    +  Q   F QS    +++  TGV F
Sbjct  123   SSPVETIEN-LLVSIAIVAGLIFIF-RRPNNIGDPN-RQARAFGQSNANVQMEADTGVQF  179

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             +DVAG+++A EE QE+VT+LK PE+F  +G   P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  180   DDVAGVDEAKEEFQEVVTFLKKPEVFTDLGATVPKGVLLVGPPGTGKTLLAKAIAGEAGV  239

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D  
Sbjct  240   PFFSVSGSEFVEMFVGVGASRVRDLFKQAKANAPCIVFIDEIDAVGRQRGTGIGGGND--  297

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
                   ERE TLNQ+LTE+DGF+   GVI + ATNR D+LD ALLRPGRFDR+I +  P+
Sbjct  298   ------EREQTLNQMLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQITVDVPD  351

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              KGRL ILKVH+   K+   V L + A+  PG+SGA LA L+ EAA++ VR+G + I  S
Sbjct  352   CKGRLEILKVHSNNKKIDNDVSLQAIARRTPGFSGADLANLMNEAAILTVRRGKSLITSS  411

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             ++D A+DR+  G +   + +  + +   A  E+G A+   LL++++N +     ++++ P
Sbjct  412   EIDVAIDRIVAGMEGTPL-VDSKSKRLIAYHEIGHAIVGTLLKNHDNVQ-----KVTLMP  465

Query  1020  RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADA  844
             RGQ      F   +D++ +   R Q+L R+   LGGRAAE VI+G  + +  + + L   
Sbjct  466   RGQARGLTWFMPSEDQTLI--SRSQILARIVGALGGRAAETVIFGDSEVTTGAGNDLQQV  523

Query  843   TWLARKMITVWNLE--NPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDL  670
             T +AR+M+T + +    P+++  E         F+G R    GS        EP     +
Sbjct  524   TSMARQMVTRFGMSKVGPLSLESE-----SGDPFLG-RSMMSGS--------EPSER--V  567

Query  669   DDDVSKRTEALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNY  505
               D+ K+T A+I + Y + + +++ +   +   V +L++++ I G E+  I+SNY
Sbjct  568   VTDIDKQTRAIIAECYQQAINIIKANRVVIDYLVDLLIEKETIEGHELQEIISNY  622



>ref|XP_003082018.1| COG0465: ATP-dependent Zn proteases (ISS), partial [Ostreococcus 
tauri]
Length=885

 Score =   341 bits (875),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 190/400 (48%), Positives = 253/400 (63%), Gaps = 10/400 (3%)
 Frame = -2

Query  1995  DIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPH  1816
             D +Q ++F+QS+  AR DG   VT  DV G+E  +E+L+E+V +LK PE F K+G +PP 
Sbjct  158   DQFQAMQFAQSRAGARRDGTVNVTLEDVGGLENIIEDLEEVVAFLKEPERFSKVGARPPK  217

Query  1815  GVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPS  1636
             G+L+EG PG GKTL+AKAIAGEA VPFY M+GSEFVE++VGVGAAR+RDLFKRA++N P 
Sbjct  218   GLLMEGGPGVGKTLIAKAIAGEAKVPFYSMSGSEFVEIIVGVGAARVRDLFKRARINAPC  277

Query  1635  VIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATN  1456
             +IF+DEIDAL  KR               T+E E TLNQLLTE+DGF    GV+F+GATN
Sbjct  278   LIFVDEIDALGMKRAAAG--------TRGTEEHEQTLNQLLTEMDGFTPDTGVVFIGATN  329

Query  1455  RMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSG  1276
             R DLLDPALLRPGRFDRK+R+  PN + R  IL++H  K   +  +D    AQNLPG SG
Sbjct  330   RADLLDPALLRPGRFDRKVRVGLPNVEARAKILQIHLSKRNCNPEIDTKRLAQNLPGLSG  389

Query  1275  AKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGT  1096
             A++A +  EAA+  VR+    I   D+ +AV+R+  G +            + A  EVG 
Sbjct  390   AEIANICNEAAVHCVRRNGEQIEEFDVLNAVERVVSGIRLSPHPKDAPLTRKLAAHEVGH  449

Query  1095  ALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLG  916
             AL  +LL H     +E  + ISI PRG   +  +  R  DE Y +  R +   R+QVLL 
Sbjct  450   ALVQNLL-HKSTGLIENIELISIIPRGFEPTITLIQRKRDEEYQYPTRARYCERVQVLLA  508

Query  915   GRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENP  796
             GR  E+V++G  T++ +   + +A  L R MI  + L  P
Sbjct  509   GRTCEKVLFGETTTRGTED-IVEANDLLRNMIVNFGLGQP  547



>ref|WP_023066705.1| ATP-dependent zinc metalloprotease FtsH 2 [Lyngbya aestuarii]
 gb|ERT07068.1| ATP-dependent zinc metalloprotease FtsH 2 [Lyngbya aestuarii 
BL J]
Length=612

 Score =   334 bits (856),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 279/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAG+E+A E
Sbjct  109   LIFPILLIAGLFFLFRRSNNV-PGGPGQAMNFGKSKARFQMEAKTGVLFDDVAGVEEAKE  167

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  168   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  227

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P +IFIDEIDA+  +R       +D        ERE T
Sbjct  228   EMFVGVGASRVRDLFKKAKETAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  279

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  280   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVSVDAPDVKGRLEILDVH  339

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+E + L + A+  PG++GA LA LL EAA++  R+   +I  S++DDAVDR+  
Sbjct  340   ARNKKLAEDISLETIARRTPGFTGADLANLLNEAAILTARRRKEAITMSEIDDAVDRVVA  399

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   L++H++  +     ++++ PRGQ      
Sbjct  400   GME--GTPL-IDGKSKRLIAYHEVGHAIVGTLIKHHDPVQ-----KVTLIPRGQARGLTW  451

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAEEVI+G  + +  +   L     +AR+M+T
Sbjct  452   F--IPDEEQGLISRAQILARITGALGGRAAEEVIFGDAEVTTGAGGDLQQVAGMARQMVT  509

Query  816   VWNLEN--PMTIHGE  778
              + + +  P+++  +
Sbjct  510   RYGMSDLGPLSLESQ  524



>ref|WP_038061211.1| cell division protein FtsH [Thermodesulfobacterium commune]
Length=598

 Score =   333 bits (854),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 260/396 (66%), Gaps = 18/396 (5%)
 Frame = -2

Query  1974  FSQSKPQARV--DGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLE  1801
             FS  K +AR+  +G T VTF DVAGIE+A EELQE+V +LKNP+ F K+G + P G+LL 
Sbjct  134   FSFVKSRARLIKEGETKVTFKDVAGIEEAKEELQEVVEFLKNPQKFTKLGARIPKGILLV  193

Query  1800  GPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFID  1621
             GPPG GKTL+AKAIAGEAGVPF+ ++GS+FVE+ VGVGAAR+RDLF +AK + P +IFID
Sbjct  194   GPPGTGKTLLAKAIAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFSQAKAHAPCIIFID  253

Query  1620  EIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLL  1441
             EIDA+  +R        D        ERE TLNQLL E+DGFDT +G++ L ATNR D+L
Sbjct  254   EIDAVGRQRGAGLGGGHD--------EREQTLNQLLVEMDGFDTAEGIVVLAATNRPDIL  305

Query  1440  DPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaq  1261
             DPALLRPGRFDR++ + PP+  GR  ILK++ARK K+S ++DL S A+  PG++GA L  
Sbjct  306   DPALLRPGRFDRQVFVPPPDVNGREAILKLYARKFKVSPSLDLRSIAKATPGFTGANLEN  365

Query  1260  llqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSH  1081
             +L EAAL+A +KG   I + D+++A D++ +G +R G  L  + +   A  E G AL ++
Sbjct  366   MLNEAALIAAKKGKEFIEQEDLEEAKDKILMGKERKGFMLSEEEKKIIAYHEAGHALVAY  425

Query  1080  LLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAE  901
              L        +   +ISI PRGQ L       LDD     E    LL ++ VLLGGR +E
Sbjct  426   YL-----PDPDPVHKISIIPRGQALGVTQQLPLDDRHIYSEDY--LLKKITVLLGGRVSE  478

Query  900   EVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             EV++   ++ A    +  AT +A+KM+  W +   +
Sbjct  479   EVVFNSISTGAQ-DDIKKATQIAKKMVCEWGMSKKL  513



>ref|WP_009555904.1| membrane protease FtsH catalytic subunit [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68987.1| membrane protease FtsH catalytic subunit [Oscillatoriales cyanobacterium 
JSC-12]
Length=629

 Score =   334 bits (856),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 200/434 (46%), Positives = 278/434 (64%), Gaps = 22/434 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  126   LIFPVLLIGGLFFLFRRSGNV-PGGPGQAMSFGKSRARFQMEAKTGVMFDDVAGIEEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +LKVH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDVPDIKGRLEVLKVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V L + A+  PG+SGA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  357   ARNKKLASEVSLEAIARRTPGFSGADLANLLNEAAILTARRRKEAITMLEIDDAVDRVIA  416

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  E+G A+   L+R ++  +     ++++ PRGQ      F
Sbjct  417   GME--GTPLVDSKSKRLIAYHEIGHAIIGTLVRDHDPVQ-----KVTLIPRGQARGLTWF  469

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITV  814
                  E  M   R Q+L R+Q  LGGRAAEEV++G  + +  + + L   T +AR+M+T 
Sbjct  470   A--PSEEQMLISRSQILARIQGALGGRAAEEVVFGDAEVTTGAGNDLQQVTGMARQMVTR  527

Query  813   WNLEN--PMTIHGE  778
             + + N  P+++ G+
Sbjct  528   FGMSNLGPLSLEGQ  541



>ref|WP_015222134.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 ref|YP_007164465.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
 gb|AFZ46816.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=627

 Score =   334 bits (856),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 196/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + ++D  TG+ F+DVAGI++A E
Sbjct  124   LVFPVLLIASLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMDAKTGIKFDDVAGIDEAKE  182

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  183   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  242

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  243   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  294

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ + PP+ KGRLG+L VH
Sbjct  295   LNQLLTEMDGFEGNTGIIVIAATNRADVLDSALMRPGRFDRQVMVDPPDFKGRLGVLDVH  354

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KLS  V + + A+  PG+SGA LA LL EAA++  R+    I  S++DDAVDR+  
Sbjct  355   ARNKKLSSEVSIEAIARRTPGFSGADLANLLNEAAILTARRRKPEITMSEIDDAVDRVIA  414

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  415   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  468

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   +GGRAAEE I+G D  +  +   L   T +AR+M+T +
Sbjct  469   --PNEEQGLTTKAQLMARIAGAMGGRAAEEEIFGDDEVTTGAGGDLQQVTGMARQMVTRF  526

Query  810   NLEN--PMTIHGE  778
              + +  P+++ G+
Sbjct  527   GMSDMGPLSLEGQ  539



>ref|WP_039725895.1| cell division protein FtsH [Lyngbya confervoides]
 gb|KIF14187.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39124.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=628

 Score =   333 bits (855),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 201/438 (46%), Positives = 284/438 (65%), Gaps = 22/438 (5%)
 Frame = -2

Query  2085  VLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAG  1906
             VL  +L  FL +  L  F L RR  N       Q + F +SK +  ++  TGV F+DVAG
Sbjct  121   VLGNLLFPFLLIGGL--FFLFRRSNN-APGGPGQAMNFGKSKARFMMEAKTGVVFDDVAG  177

Query  1905  IEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQM  1726
             IE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ +
Sbjct  178   IEEAKEELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSI  237

Query  1725  AGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAAT  1546
             +GSEFVE+ VGVGA+R+RDLFK+AK + P +IFIDEIDA+  +R       +D       
Sbjct  238   SGSEFVEMFVGVGASRVRDLFKKAKESAPCIIFIDEIDAVGRQRGAGIGGGND-------  290

Query  1545  QERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRL  1366
              ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I + PP+ KGRL
Sbjct  291   -EREQTLNQLLTEMDGFEGNTGIIVIAATNRADVLDSALLRPGRFDRQITVDPPDVKGRL  349

Query  1365  GILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDA  1186
              IL VHAR  KLS+ V L + A+  PG+SGA LA LL EAA++  R+   +I  +++DDA
Sbjct  350   EILDVHARNKKLSDEVSLDAIARRTPGFSGADLANLLNEAAILTARRRKEAITMTEIDDA  409

Query  1185  VDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTL  1006
             VDR+  G +   + +  + +   A  EVG A+   L++ ++  +     ++++ PRGQ  
Sbjct  410   VDRVVAGMEGTPL-VDSKSKRLIAYHEVGHAIVGTLVKAHDPVQ-----KVTLIPRGQAQ  463

Query  1005  SQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLAR  829
                 F   +D++ +   R Q+L R++  LGGRAAE+VI+G  + +  + + L   T +AR
Sbjct  464   GLTWFMPSEDQTLI--SRAQILARIKGALGGRAAEDVIFGDAEVTTGAGNDLQQVTGMAR  521

Query  828   KMITVWNLEN--PMTIHG  781
             +M+T + + +  P+++ G
Sbjct  522   QMVTRFGMSDLGPLSLEG  539



>emb|CEF99656.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=915

 Score =   341 bits (875),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 190/400 (48%), Positives = 253/400 (63%), Gaps = 10/400 (3%)
 Frame = -2

Query  1995  DIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPH  1816
             D +Q ++F+QS+  AR DG   VT  DV G+E  +E+L+E+V +LK PE F K+G +PP 
Sbjct  188   DQFQAMQFAQSRAGARRDGTVNVTLEDVGGLENIIEDLEEVVAFLKEPERFSKVGARPPK  247

Query  1815  GVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPS  1636
             G+L+EG PG GKTL+AKAIAGEA VPFY M+GSEFVE++VGVGAAR+RDLFKRA++N P 
Sbjct  248   GLLMEGGPGVGKTLIAKAIAGEAKVPFYSMSGSEFVEIIVGVGAARVRDLFKRARINAPC  307

Query  1635  VIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATN  1456
             +IF+DEIDAL  KR               T+E E TLNQLLTE+DGF    GV+F+GATN
Sbjct  308   LIFVDEIDALGMKRAAAG--------TRGTEEHEQTLNQLLTEMDGFTPDTGVVFIGATN  359

Query  1455  RMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSG  1276
             R DLLDPALLRPGRFDRK+R+  PN + R  IL++H  K   +  +D    AQNLPG SG
Sbjct  360   RADLLDPALLRPGRFDRKVRVGLPNVEARAKILQIHLSKRNCNPEIDTKRLAQNLPGLSG  419

Query  1275  AKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGT  1096
             A++A +  EAA+  VR+    I   D+ +AV+R+  G +            + A  EVG 
Sbjct  420   AEIANICNEAAVHCVRRNGEQIEEFDVLNAVERVVSGIRLSPHPKDAPLTRKLAAHEVGH  479

Query  1095  ALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLG  916
             AL  +LL H     +E  + ISI PRG   +  +  R  DE Y +  R +   R+QVLL 
Sbjct  480   ALVQNLL-HKSTGLIENIELISIIPRGFEPTITLIQRKRDEEYQYPTRARYCERVQVLLA  538

Query  915   GRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENP  796
             GR  E+V++G  T++ +   + +A  L R MI  + L  P
Sbjct  539   GRTCEKVLFGETTTRGTED-IVEANDLLRNMIVNFGLGQP  577



>ref|WP_009787909.1| cell division protein FtsH [Lyngbya sp. PCC 8106]
 gb|EAW33525.1| cell division protein [Lyngbya sp. PCC 8106]
Length=628

 Score =   333 bits (854),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 279/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAG+E+A E
Sbjct  125   LIFPILLIAGLFFLFRRSNNV-PGGPGQAMSFGKSKARFQMEAKTGVLFDDVAGVEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKETAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVSVDAPDVKGRLEILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+E + L + A+  PG++GA LA LL EAA++  R+   +I  S++DDAVDR+  
Sbjct  356   ARNKKLAEDISLETIARRTPGFTGADLANLLNEAAILTARRRKEAITMSEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   L++H++  +     ++++ PRGQ      
Sbjct  416   GME--GTPL-IDGKSKRLIAYHEVGHAIVGTLIKHHDPVQ-----KVTLIPRGQARGLTW  467

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAEEVI+G  + +  +   L     +AR+M+T
Sbjct  468   F--IPDEEQGLISRAQILARITGALGGRAAEEVIFGDSEVTTGAGGDLQQVAGMARQMVT  525

Query  816   VWNLEN--PMTIHGE  778
              + + +  P+++  +
Sbjct  526   RYGMSDLGPLSLESQ  540



>ref|WP_009627771.1| membrane protease FtsH catalytic subunit [Pseudanabaena biceps]
 gb|ELS32118.1| membrane protease FtsH catalytic subunit [Pseudanabaena biceps 
PCC 7429]
Length=628

 Score =   333 bits (854),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 216/522 (41%), Positives = 314/522 (60%), Gaps = 33/522 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F   +L   F L RR          Q ++F +SK +  +D  TGV F+DVAGIE+A E
Sbjct  126   LIFPVALLAGLFFLFRRSNQM--GGPGQAMDFGKSKARFAMDAETGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQ+LTE+DGF+   GVI + ATNR D+LD ALLRPGRFDR+I + PP+ KGRL +L VH
Sbjct  296   LNQILTEMDGFEGNSGVIVIAATNRADVLDSALLRPGRFDRQIGVDPPDIKGRLQVLNVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K+S  V L + A+  PG++GA LA LL EAA++  R+  +++  +++DDAVDR+  
Sbjct  356   ARDKKISPEVSLEAIARRTPGFAGADLANLLNEAAILTARRRKDAMTMAEIDDAVDRIIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GLEGKAL-IDSRNKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAAGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
                DE      R Q+L R+   LGGRAAEE ++G  + +  +   L   + +AR+M+T +
Sbjct  470   --PDEEQTLVSRGQILARITAALGGRAAEEAVFGAAEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIR  631
              + N   I    L  + S  F+G  +   GS Y +          D+   + ++   +++
Sbjct  528   GMSN---IGQLALEGQSSEVFLGRSMG-GGSQYSE----------DISAKIDQQVREIVQ  573

Query  630   DTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNY  505
               Y   L ++ ++ AA+ + V +L++ + + GEE   I+S Y
Sbjct  574   KCYQTALQIVYENRAAIDRVVDLLVEAETLDGEEFRRIISEY  615



>ref|WP_022606194.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae]
 gb|ERN41856.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae KORDI 
51-2]
Length=628

 Score =   333 bits (854),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 201/434 (46%), Positives = 275/434 (63%), Gaps = 22/434 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK +  ++  TGVTF+DVAGIE+A  
Sbjct  125   LIFPVLLIAALFFLFRRSNN-APGGPGQAMNFGKSKARFLMEAKTGVTFDDVAGIEEAKL  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ + PP+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIVIAATNRADVLDSALLRPGRFDRQVSVDPPDYKGRLDILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+E V + S A+  PG++GA L+ LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLAEDVSIESIARRTPGFTGADLSNLLNEAAILTARRRKPAITLREIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  EVG AL   LL H++  +     ++++ PRGQ      F
Sbjct  416   GME--GTPLVDSKSKRLIAYHEVGHALIGTLLEHHDPVQ-----KVTLIPRGQARGLTWF  468

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITV  814
                +D+  M   R QL  R+   LGGRAAEE ++G  + +  +   L   T +AR+M+T 
Sbjct  469   TPGEDQ--MLVSRAQLKARITAALGGRAAEEEVFGDAEVTSGAGGDLQQLTGMARQMVTR  526

Query  813   WNLE--NPMTIHGE  778
             + +    P+++ G+
Sbjct  527   FGMSALGPLSLEGQ  540



>ref|WP_007353244.1| MULTISPECIES: cell division protein FtsH [Kamptonema]
 emb|CBN54017.1| FtsH peptidase [ [[Oscillatoria] sp. PCC 6506]
Length=640

 Score =   333 bits (854),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 204/438 (47%), Positives = 280/438 (64%), Gaps = 24/438 (5%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA++ +   +L++FL  VL V   + RR    +       + F +SK + +++  TGV F
Sbjct  127   SAAMGLAVNLLVIFL--VLGVLMAILRRSTQAQ----GNAMNFGKSKARFQMEAKTGVLF  180

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             +DVAGIE+A EELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  181   DDVAGIEEAKEELQEVVTFLKKPERFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  240

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLFK+AK + P ++FIDEIDA+  +R       +D  
Sbjct  241   PFFSISGSEFVEMFVGVGASRVRDLFKKAKEHAPCIVFIDEIDAVGRQRGAGIGGGND--  298

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
                   ERE TLNQLLTE+DGF+   GVI + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  299   ------EREQTLNQLLTEMDGFEGNNGVIIIAATNRPDVLDTALLRPGRFDRQVMVDLPS  352

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              KGRLGIL+VHAR  KL   V L + A+  PG+SGA L+ LL EAA++  R+  +SI   
Sbjct  353   FKGRLGILQVHARNKKLDPEVSLETIARRTPGFSGADLSNLLNEAAILTARRRKDSIANL  412

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             +++DA+DR+T+G K   + L  + +   A  EVG AL + LL +      +  ++++I P
Sbjct  413   EINDAIDRITIGLKLNPL-LDSKKKWMTAYHEVGHALVATLLPNS-----DPVEKVTIIP  466

Query  1020  RGQTLSQVVFHRLDDE---SYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             R   +       LDDE   S     R  LL+R+ V LGGRAAE  IYG D     + S +
Sbjct  467   RSGGVEGFTSFTLDDEMVDSEGLRSRALLLNRITVALGGRAAEAEIYGPDEIDTGAGSDI  526

Query  852   ADATWLARKMITVWNLEN  799
                T LAR M+T++ + +
Sbjct  527   RHVTALARDMVTLYGMSD  544



>ref|WP_038057282.1| cell division protein FtsH [Thermodesulfobacterium hydrogeniphilum]
Length=596

 Score =   332 bits (850),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 198/448 (44%), Positives = 280/448 (63%), Gaps = 30/448 (7%)
 Frame = -2

Query  2067  LVFLTMVLL-VRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAV  1891
             L F+ +++L + F    +P N       +   F +S+ +   +G + VTF DVAGIE+A 
Sbjct  111   LPFIVLIVLWIGFLRQMQPGN-------KPFTFIKSRARLIKEGESKVTFKDVAGIEEAK  163

Query  1890  EELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEF  1711
             EELQE+V +LKNP  F K+G + P G+LL GPPG GKTL+AKAIAGEAGVPF+ ++GS+F
Sbjct  164   EELQEVVEFLKNPSKFTKLGARIPKGILLVGPPGTGKTLLAKAIAGEAGVPFFSISGSDF  223

Query  1710  VEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERET  1531
             VE+ VGVGAAR+RDLF +AK + P +IFIDEIDA+  +R        D        ERE 
Sbjct  224   VEMFVGVGAARVRDLFAQAKSHAPCIIFIDEIDAVGRQRGAGLGGGHD--------EREQ  275

Query  1530  TLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKV  1351
             TLNQLL E+DGFDT +G++ + ATNR D+LDPALLRPGRFDR++ + PP+ KGR  ILK+
Sbjct  276   TLNQLLVEMDGFDTAEGIVVIAATNRPDILDPALLRPGRFDRQVVVPPPDVKGREAILKL  335

Query  1350  HARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLT  1171
             +A+K K+ E++D  + A+  PG++GA L  +L EAAL+A +KG   I   D+++A D++ 
Sbjct  336   YAKKFKIDESIDFRTIAKGTPGFTGANLENMLNEAALIAAKKGKEKIELEDIEEAKDKIL  395

Query  1170  VGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             +G +R G+ L  + +   A  E G AL ++ L        +   +ISI PRGQ L     
Sbjct  396   MGKERKGMVLNDEEKKIIAYHEAGHALVAYYL-----PDPDPVHKISIIPRGQALGVTQQ  450

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVW  811
               LDD     E    LL ++ VLLGGR +EE+I+ + ++ A    L  AT +ARKM+  W
Sbjct  451   LPLDDRHIYTE--DYLLKKITVLLGGRVSEEIIFNKLSTGAQ-DDLKKATQIARKMVCDW  507

Query  810   NLENPMTIHGEPLPWRKSPK--FVGPRL  733
              +   +     PL + K  +  F+G  L
Sbjct  508   GMSKKLG----PLAYGKGDEHIFLGKEL  531



>ref|WP_038041290.1| cell division protein FtsH [Thermodesulfobacterium hveragerdense]
Length=598

 Score =   331 bits (849),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 259/396 (65%), Gaps = 18/396 (5%)
 Frame = -2

Query  1974  FSQSKPQARV--DGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLE  1801
             FS  K +AR+  +G T VTF DVAGIE+A EELQE+V +LKNP+ F K+G + P G+LL 
Sbjct  134   FSFVKSRARLIKEGETKVTFKDVAGIEEAKEELQEVVEFLKNPQKFTKLGARIPKGILLV  193

Query  1800  GPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFID  1621
             GPPG GKTL+AKAIAGEAGVPF+ ++GS+FVE+ VGVGAAR+RDLF +AK + P +IFID
Sbjct  194   GPPGTGKTLLAKAIAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFSQAKAHAPCIIFID  253

Query  1620  EIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLL  1441
             EIDA+  +R        D        ERE TLNQLL E+DGFDT +G++ L ATNR D+L
Sbjct  254   EIDAVGRQRGAGLGGGHD--------EREQTLNQLLVEMDGFDTAEGIVVLAATNRPDIL  305

Query  1440  DPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaq  1261
             DPALLRPGRFDR++ + PP+  GR  ILK++ARK K+S  +DL S A+  PG++GA L  
Sbjct  306   DPALLRPGRFDRQVFVPPPDVNGREAILKLYARKFKVSPNLDLRSIAKATPGFTGANLEN  365

Query  1260  llqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSH  1081
             +L EAAL+A +KG   I + D+++A D++ +G +R G  L  + +   A  E G AL ++
Sbjct  366   MLNEAALIAAKKGKELIEQEDLEEAKDKILMGKERKGFMLSEEEKKIIAYHEAGHALVAY  425

Query  1080  LLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAE  901
              L        +   +ISI PRGQ L       LDD     E    LL ++ VLLGGR +E
Sbjct  426   YL-----PDPDPVHKISIIPRGQALGVTQQLPLDDRHIYPED--YLLKKITVLLGGRVSE  478

Query  900   EVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             EV++   ++ A    +  AT +A+KM+  W +   +
Sbjct  479   EVVFNSISTGAQ-DDIKRATQIAKKMVCEWGMSKKL  513



>ref|WP_022855152.1| ATP-dependent metalloprotease [Thermodesulfobacterium thermophilum]
Length=598

 Score =   331 bits (848),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 191/396 (48%), Positives = 259/396 (65%), Gaps = 18/396 (5%)
 Frame = -2

Query  1974  FSQSKPQARV--DGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLE  1801
             FS  K +AR+  +G T VTF DVAGIE+A EELQE+V +LKNP+ F K+G + P G+LL 
Sbjct  134   FSFVKSRARLIKEGETKVTFKDVAGIEEAKEELQEVVEFLKNPQKFTKLGARIPKGILLV  193

Query  1800  GPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFID  1621
             GPPG GKTL+AKAIAGEAGVPF+ ++GS+FVE+ VGVGAAR+RDLF +AK + P +IFID
Sbjct  194   GPPGTGKTLLAKAIAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFSQAKAHAPCIIFID  253

Query  1620  EIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLL  1441
             EIDA+  +R        D        ERE TLNQLL E+DGFDT +G++ L ATNR D+L
Sbjct  254   EIDAVGRQRGAGLGGGHD--------EREQTLNQLLVEMDGFDTAEGIVVLAATNRPDIL  305

Query  1440  DPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaq  1261
             DPALLRPGRFDR+I + PP+  GR  ILK+++RK K+S  +DL S A+  PG++GA L  
Sbjct  306   DPALLRPGRFDRQIFVPPPDVNGREAILKLYSRKFKVSPNLDLRSIAKATPGFTGANLEN  365

Query  1260  llqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSH  1081
             +L EAAL+A +KG   I + D+++A D++ +G +R G  L  + +   A  E G AL ++
Sbjct  366   MLNEAALIAAKKGKELIEQEDLEEAKDKILMGKERKGFVLSEEEKKIIAYHEAGHALVAY  425

Query  1080  LLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAE  901
              L        +   +ISI PRGQ L       LDD     E    LL ++ VLLGGR +E
Sbjct  426   YL-----PDPDPVHKISIIPRGQALGVTQQLPLDDRHIYPEDY--LLKKITVLLGGRVSE  478

Query  900   EVIYGRDTSKASVSYLADATWLARKMITVWNLENPM  793
             EV++   ++ A    +  AT +A+KM+  W +   +
Sbjct  479   EVVFNSISTGAQ-DDIKRATQIAKKMVCEWGMSKKL  513



>ref|WP_015198769.1| membrane protease FtsH catalytic subunit [Calothrix parietina]
 ref|YP_007138112.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 6303]
 gb|AFZ02140.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 6303]
Length=642

 Score =   331 bits (848),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 283/435 (65%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  139   LIFPILLITGLFFLFRRSSNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  197

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  198   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  257

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  258   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  309

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  310   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVH  369

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             +R  KL ++V L + A+  PG++GA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  370   SRNKKLDDSVSLETIARRTPGFTGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVVA  429

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  E+G AL   LL+ ++  +     ++++ PRGQ      
Sbjct  430   GME--GTPL-VDGKSKRLIAYHEIGHALIGTLLKDHDPVQ-----KVTLIPRGQAQGLTW  481

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMIT  817
             F   ++ S +   R QL  R+   LGGRAAE+VI+GR + +  + + L   T +AR+M+T
Sbjct  482   FTPSEEMSLV--TRSQLRARITGALGGRAAEDVIFGRAEVTTGAGNDLQQVTGMARQMVT  539

Query  816   VWNLEN--PMTIHGE  778
              + + +  PM++  +
Sbjct  540   RFGMSDLGPMSLESQ  554



>ref|WP_012629618.1| cell division protein FtsH [Cyanothece sp. PCC 7425]
 ref|YP_002484929.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7425]
 gb|ACL46568.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7425]
Length=632

 Score =   330 bits (846),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  129   LIFPILLITGLFFLFRRSSNV-PGGPGQAMNFGKSKARFQMEAKTGVMFDDVAGIEEAKE  187

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  188   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  247

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  248   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  299

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  300   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILGVH  359

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  360   ARNKKLAPEVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITMLEIDDAVDRVVA  419

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  420   GMEGTPL-VDSKSKRLIAYHEIGHAIVGTLLKDHDPVQ-----KVTLIPRGQARGLTWFM  473

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               DD+S +   R QL+ R+   LGGRAAE V++G  + +  + + L   T +AR+M+T +
Sbjct  474   PPDDQSLI--SRSQLMARMAGALGGRAAEYVVFGESEVTTGAGNDLQQVTGMARQMVTRF  531

Query  810   NLEN--PMTIHGE  778
              + +  P+++ G+
Sbjct  532   GMSDLGPLSLEGQ  544



>ref|WP_016876491.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=628

 Score =   330 bits (846),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 197/433 (45%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVIVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL   V L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  356   ARNKKLDTGVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTVLKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+GRD  +  + + L   T +AR+M+T +
Sbjct  470   PNEEQGLI--TRAQLKARITGALGGRAAEDVIFGRDEVTTGAGNDLQQVTNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  PM++  +
Sbjct  528   GMSDLGPMSLESQ  540



>ref|WP_027845285.1| cell division protein FtsH [Mastigocoleus testarum]
Length=628

 Score =   330 bits (845),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNSGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLRVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K+ E+V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKIDESVSLETIARRTPGFTGADLANLLNEAAILTARRRKEAITLLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
               ++   +   R QL  R+   LGGRAAE+VI+GRD  +  + + L   T +AR+M+T +
Sbjct  470   PSEESGLI--TRSQLKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_023070843.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA38370.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=630

 Score =   330 bits (845),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 194/438 (44%), Positives = 280/438 (64%), Gaps = 23/438 (5%)
 Frame = -2

Query  2097  ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFN  1918
             A + +L  +L  FL +  L  F L RR          Q + F +SK +  ++  TG+ F+
Sbjct  117   AFVGILGNLLFPFLLIAGL--FFLFRRSNGGVGGGPGQAMNFGKSKARFMMEAKTGIMFD  174

Query  1917  DVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVP  1738
             DVAGI++A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVP
Sbjct  175   DVAGIDEAKEELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVP  234

Query  1737  FYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQY  1558
             F+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+   R       +D   
Sbjct  235   FFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRSRGSGIGGGND---  291

Query  1557  NAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNA  1378
                  ERE TLNQ+LTE+DGF+   G+I + ATNR+D+LD ALLRPGRFDR++ + PP+ 
Sbjct  292   -----EREQTLNQMLTEMDGFEGNSGIIVIAATNRVDVLDSALLRPGRFDRQVSVDPPDV  346

Query  1377  KGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSD  1198
             KGR+ +L+VHAR  KL++ + L + A+  PG++GA LA LL EAA++  R+   +I   +
Sbjct  347   KGRIAVLEVHARNKKLADEISLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITMLE  406

Query  1197  MDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISIN  1024
             +DDAVDR+  G +   +     G+ +R  A  EVG AL   L++ ++  +     ++++ 
Sbjct  407   IDDAVDRVIAGMEGTPL---VDGKSKRLIAYHEVGHALIGTLVKAHDPVQ-----KVTLI  458

Query  1023  PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLAD  847
             PRGQ      F   +D+  M   R QLL R+   LGGRAAE++I+G  + +  + + L  
Sbjct  459   PRGQAQGLTWFTPSEDQ--MLISRAQLLARITGALGGRAAEDIIFGEAEVTTGAGNDLQQ  516

Query  846   ATWLARKMITVWNLENPM  793
              T +AR+M+T + + + +
Sbjct  517   VTSMARQMVTRFGMSSEL  534



>ref|WP_019498223.1| cell division protein FtsH [Pseudanabaena sp. PCC 6802]
Length=628

 Score =   330 bits (845),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 187/406 (46%), Positives = 273/406 (67%), Gaps = 19/406 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F +SK +  +D  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMDFGKSKARFSMDAQTGVKFDDVAGIEEAKEELQEVVTFLKKPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK + P +IF
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVEMFVGVGASRVRDLFKKAKESAPCIIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQ+LTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGAGIGGGND--------EREQTLNQILTEMDGFEGNTGIIIIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I + PP+ KGRL +L VHAR  K+S  V L + A+  PG++GA L
Sbjct  323   VLDAALLRPGRFDRQILVDPPDIKGRLQVLNVHARGKKVSPEVSLEAIARRTPGFTGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  ++I  S++DDAVDR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKDAIAMSEIDDAVDRVIAGLEGKAL-VDSKNKRLIAYHEVGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               L++ ++  +     ++++ PRGQ  + + +    +E ++   R Q+L R+   LGGRA
Sbjct  442   GTLIKDHDPVQ-----KVTLIPRGQA-AGLTWFTPSEEQFLIS-RSQILARICGALGGRA  494

Query  906   AEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             AE+V++G  + +  + + L   T +AR+M+T + + +  P+++ G+
Sbjct  495   AEQVVFGNSEITTGAGNDLQQVTRMARQMVTRFGMSDIGPLSLEGQ  540



>ref|WP_023075021.1| cell division protein [Leptolyngbya sp. Heron Island J]
 gb|ESA34224.1| cell division protein [Leptolyngbya sp. Heron Island J]
Length=638

 Score =   330 bits (845),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 193/436 (44%), Positives = 280/436 (64%), Gaps = 33/436 (8%)
 Frame = -2

Query  2094  SIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFND  1915
             ++  L  +++VF  +++L      RR  N         + F +S+ + +++  TGV F+D
Sbjct  135   AVNALLAMIVVFALLMIL------RRSANSASG----AMNFGRSRARFQMEAKTGVMFDD  184

Query  1914  VAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPF  1735
             VAGIE+A EELQE+VT+LKNPE F  +G + P GVLL G PG GKTL+AKAIAGEAGVPF
Sbjct  185   VAGIEEAKEELQEVVTFLKNPEKFTAIGARIPKGVLLVGQPGTGKTLLAKAIAGEAGVPF  244

Query  1734  YQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYN  1555
             + ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D    
Sbjct  245   FSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVFIDEIDAVGRQRGAGIGGGND----  300

Query  1554  AATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAK  1375
                 ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P   
Sbjct  301   ----EREQTLNQLLTEMDGFEGNSGIIVIAATNRPDVLDAALLRPGRFDRQITVDLPGYN  356

Query  1374  GRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDM  1195
             GRLGIL VHAR  K++E V+L + A+  PG+SGA+LA LL EAA++  R+  +++   ++
Sbjct  357   GRLGILDVHARDKKIAEDVNLEAIARRTPGFSGAQLANLLNEAAILTARRRKDAVTMEEI  416

Query  1194  DDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRG  1015
             DDA+DRLT+G     + L  + +   A  EVG AL S +L+H      +   +++I PR 
Sbjct  417   DDAIDRLTIGLTLTPL-LDSKKKRLIAYHEVGHALVSTMLKHS-----DPLAKVTIIPRS  470

Query  1014  QTLSQVVFH-----RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
               +     +     R+DD    +    +L+ R+ + LGGRAAEE+++G D  ++ + + +
Sbjct  471   GGVGGFASYLPKEDRVDDGLISY---AELIDRITMALGGRAAEEIVFGPDEVTQGAANDI  527

Query  852   ADATWLARKMITVWNL  805
                T +AR+MIT + +
Sbjct  528   QQVTNIARQMITRFGM  543



>ref|WP_012953740.1| cell division protein FtsH [Candidatus Atelocyanobacterium thalassa]
 ref|YP_003421433.1| membrane protease FtsH catalytic subunit [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95075.1| membrane protease FtsH catalytic subunit [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=586

 Score =   328 bits (841),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 269/407 (66%), Gaps = 21/407 (5%)
 Frame = -2

Query  2022  RRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELF  1843
             RR  N       Q   FS+SK + +++  TG++F DVAGI++A EELQE+VT+LK PE F
Sbjct  106   RRSTNIS----GQTTNFSKSKARFQMEVTTGISFEDVAGIDEAKEELQEIVTFLKEPEKF  161

Query  1842  DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLF  1663
               +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLF
Sbjct  162   TAIGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLF  221

Query  1662  KRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGK  1483
             K+AK N P +IFIDEIDA+  +R G+        Y     ERE TLNQLLTE+DGF+   
Sbjct  222   KKAKENTPCLIFIDEIDAVGRQR-GV-------GYGGGNDEREQTLNQLLTEMDGFEGNS  273

Query  1482  GVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSY  1303
             G+I + ATNR D+LD AL RPGRFDR++ +  P+ KGR GIL+VH+R  K+SE+V L + 
Sbjct  274   GIILIAATNRPDVLDAALSRPGRFDRQVIVDYPDLKGRQGILEVHSRNKKISESVSLETI  333

Query  1302  AQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQC  1123
             A+  PG++GA LA LL EAA+   R+   +I  +++ DA+DR+  G +   + +  + + 
Sbjct  334   ARRTPGFTGADLANLLNEAAIFTARRRKKTISMTEIYDAIDRVVAGMEGAPL-IDSKSKR  392

Query  1122  RRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQL  943
               A  E+G AL   ++  +E+      +++++ PRGQ      F   ++ES +  R  Q+
Sbjct  393   LIAYHEIGHALVGTIIPEHES-----VEKVTLIPRGQAKGLTWFTP-EEESALITRN-QI  445

Query  942   LHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVWNL  805
             L R+  LLGGR AEEVI+G+D  +  + + L   T+LAR+M+T + +
Sbjct  446   LARISGLLGGRVAEEVIFGQDEVTTGAGNDLEKVTYLARQMVTRFGM  492



>ref|WP_006515547.1| ATP-dependent metalloprotease FtsH [Leptolyngbya sp. PCC 7375]
 gb|EKV01143.1| ATP-dependent metalloprotease FtsH [Leptolyngbya sp. PCC 7375]
Length=638

 Score =   330 bits (845),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 192/436 (44%), Positives = 281/436 (64%), Gaps = 33/436 (8%)
 Frame = -2

Query  2094  SIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFND  1915
             ++  L  +++VF  +++L      RR  N         + F +S+ + +++  TGV F+D
Sbjct  135   AVNALLALIVVFALLMIL------RRSANSASG----AMNFGRSRARFQMEAKTGVMFDD  184

Query  1914  VAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPF  1735
             VAGIE+A EELQE+V +LKNPE F  +G + P GVLL G PG GKTL+AKAIAGEAGVPF
Sbjct  185   VAGIEEAKEELQEVVIFLKNPEKFTAIGARIPKGVLLVGQPGTGKTLLAKAIAGEAGVPF  244

Query  1734  YQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYN  1555
             + ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D    
Sbjct  245   FSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVFIDEIDAVGRQRGAGIGGGND----  300

Query  1554  AATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAK  1375
                 ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P  K
Sbjct  301   ----EREQTLNQLLTEMDGFEGNSGIIVIAATNRPDVLDAALLRPGRFDRQITVDLPGYK  356

Query  1374  GRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDM  1195
             GRLGIL VHAR  K+++ V+L + A+  PG+SGA+LA LL EAA++  R+  +++  +++
Sbjct  357   GRLGILDVHARDKKIADDVNLDAIARRTPGFSGAQLANLLNEAAILTARRRKDAVTMAEI  416

Query  1194  DDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRG  1015
             DDA+DRLT+G     + L  + +   A  EVG AL S +L+H      +   +++I PR 
Sbjct  417   DDAIDRLTIGLTLTPL-LDSKKKRLIAYHEVGHALVSTMLKHS-----DPLAKVTIIPRS  470

Query  1014  QTLSQVVFH-----RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
               +     +     R+DD    +    +L+ R+ + LGGRAAEE+++G D  ++ + + +
Sbjct  471   GGVGGFASYLPKEDRVDDGLISY---AELIDRITMALGGRAAEEIVFGSDEVTQGAANDI  527

Query  852   ADATWLARKMITVWNL  805
                T +AR+MIT + +
Sbjct  528   QQVTNIARQMITRFGM  543



>ref|WP_019504593.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=631

 Score =   329 bits (844),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 278/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TG+ F+DVAGI++A E
Sbjct  128   LIFPIILIGALFFLFRRSNNM-PGGPGQAMSFGKSKAKFQMEAKTGIMFDDVAGIDEAKE  186

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  187   ELQEVVTFLKQPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  246

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  247   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  298

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH
Sbjct  299   LNQLLTEMDGFEGNTGIIIIAATNRADVLDSALMRPGRFDRQVMVDNPDIKGRLEILEVH  358

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K++  V L + A+  PG+SGA LA LL EAA++  R+   ++   ++DDAVDR+  
Sbjct  359   ARNKKIAPEVSLDAIARRTPGFSGADLANLLNEAAILTARRRKEAVTMLEIDDAVDRVVA  418

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +   +     G+ +R  A  E+G A+   L++ +     +   ++++ PRGQ      
Sbjct  419   GMEGTPL---TDGKSKRLIAYHEIGHAIVGTLVKDH-----DPVQKVTLIPRGQAQGLTW  470

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMIT  817
             F   +D+  +   R QL+ R+   +GGRAAEE I+G D  +  +   L   T +AR+M+T
Sbjct  471   FTPNEDQGLI--SRSQLMARIAGAMGGRAAEEEIFGNDEVTTGAGGDLQQVTEMARQMVT  528

Query  816   VWNLEN--PMTIHGE  778
             ++ + +  P+ + G+
Sbjct  529   IYGMSDLGPVALGGQ  543



>ref|WP_006635543.1| cell division protein FtsH [Microcoleus vaginatus]
 gb|EGK84090.1| ATP-dependent metalloprotease FtsH [Microcoleus vaginatus FGP-2]
Length=664

 Score =   330 bits (846),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 197/447 (44%), Positives = 284/447 (64%), Gaps = 24/447 (5%)
 Frame = -2

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             ++V      +A++ ++  +L++F   VL V   + RR    +       + F +S+ + +
Sbjct  143   FEVKQTADNTAAVSLVVNLLVIF--AVLAVLMAILRRSTQSQ----GNAMNFGKSRARFQ  196

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TGV F+DVAGIE+A EELQE+VT+LK PE F+ +G K P GVLL GPPG GKT++A
Sbjct  197   MEAKTGVMFDDVAGIEEAKEELQEVVTFLKKPERFNAIGAKIPRGVLLIGPPGTGKTMLA  256

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLF++AK N P ++FIDEIDA+  +R  
Sbjct  257   KAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFRKAKENSPCIVFIDEIDAVGRQRGA  316

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   GVI + ATNR D+LD ALLRPGRFD
Sbjct  317   GIGGGND--------EREQTLNQLLTEMDGFEGNSGVIVIAATNRPDVLDTALLRPGRFD  368

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+ KGRLGIL+VHAR  KL   V L + A+  PG+SGA LA LL EAA++  R
Sbjct  369   RQVTVDLPSYKGRLGILQVHARNKKLDPEVALDTIARRTPGFSGADLANLLNEAAILTAR  428

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +  ++I   ++ DA+DR+T+G     + L  + +   A  EVG AL + +L++      +
Sbjct  429   RRKDTITNLEVHDAIDRITIGLTLNPL-LDSKKKWMTAYHEVGHALVATMLKN-----AD  482

Query  1047  CCDRISINPRGQTLSQVVFHRLDDE---SYMFERRPQLLHRLQVLLGGRAAEEVIYG-RD  880
               ++++I PR   +       LDDE   S     R  LL+R++V LGGRAAE  IYG  +
Sbjct  483   PVEKVTIIPRSGGIEGFTSFVLDDEMLDSEGLRSRALLLNRIKVALGGRAAEAEIYGDAE  542

Query  879   TSKASVSYLADATWLARKMITVWNLEN  799
                 + S L   + LAR+M+T++ + +
Sbjct  543   IDTGAGSDLRKVSSLAREMVTLYGMSD  569



>ref|WP_029632082.1| cell division protein FtsH [[Scytonema hofmanni] UTEX B 1581]
Length=628

 Score =   329 bits (843),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 198/445 (44%), Positives = 282/445 (63%), Gaps = 30/445 (7%)
 Frame = -2

Query  2112  FGGIS-----ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             FG +S     A++ +L  ++ +   + L++ F   RR  N       Q + F +SK + +
Sbjct  110   FGEVSSANSRAAVGLLINLMWILPLVALMLLFL--RRSTNASS----QAMNFGKSKARFQ  163

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TGVTFNDVAGIE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+A
Sbjct  164   MEAKTGVTFNDVAGIEEAKEELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLA  223

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R  
Sbjct  224   KAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGA  283

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFD
Sbjct  284   GIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFD  335

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+ KGRL IL+VH+R  K+ ++V L + A+  PG++GA LA LL EAA++  R
Sbjct  336   RQVIVDAPDMKGRLEILEVHSRNKKVDKSVSLEAIARRTPGFTGADLANLLNEAAILTAR  395

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKV  1051
             +   SI   ++DDAVDR+  G +  G  L      R  A  EVG AL   LL+ +     
Sbjct  396   RRKESITLLEIDDAVDRVVAGME--GTPLVDSKSKRLIAYHEVGHALVGTLLKEH-----  448

Query  1050  ECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTS  874
             +   ++++ PRGQ      F   +++  +   R QLL R+   L GRAAEE+++G+ + +
Sbjct  449   DPVQKVTLIPRGQAQGLTWFTPNEEQGLI--SRSQLLSRITSTLAGRAAEEIVFGKPEVT  506

Query  873   KASVSYLADATWLARKMITVWNLEN  799
               +   L   + +AR+M+T + + +
Sbjct  507   TGAGDDLQKVSGMARQMVTRFGMSD  531



>ref|WP_006517061.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV02685.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=630

 Score =   329 bits (843),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 281/446 (63%), Gaps = 32/446 (7%)
 Frame = -2

Query  2097  ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFN  1918
             A + +L  +L  FL +  L  F L RR          Q + F +SK +  ++  TG+ F+
Sbjct  117   ALVGILGNLLFPFLLIAGL--FFLFRRSNGGVGGGPGQAMNFGKSKARFMMEAKTGIMFD  174

Query  1917  DVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVP  1738
             DVAGI++A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVP
Sbjct  175   DVAGIDEAKEELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVP  234

Query  1737  FYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQY  1558
             F+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+   R       +D   
Sbjct  235   FFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRSRGSGIGGGND---  291

Query  1557  NAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNA  1378
                  ERE TLNQ+LTE+DGF+   G+I + ATNR+D+LD ALLRPGRFDR++ + PP+ 
Sbjct  292   -----EREQTLNQMLTEMDGFEGNSGIIVIAATNRVDVLDSALLRPGRFDRQVSVDPPDV  346

Query  1377  KGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSD  1198
             KGR+ +L+VHAR  KL++ + L + A+  PG++GA LA LL EAA++  R+   +I   +
Sbjct  347   KGRIAVLEVHARNKKLADEISLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITMLE  406

Query  1197  MDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISIN  1024
             +DDAVDR+  G +   +     G+ +R  A  EVG AL   L++ ++  +     ++++ 
Sbjct  407   IDDAVDRVIAGMEGTPL---VDGKSKRLIAYHEVGHALIGTLVKAHDPVQ-----KVTLI  458

Query  1023  PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLAD  847
             PRGQ      F   +D+  M   R QLL R+   LGGRAAE++I+G  + +  + + L  
Sbjct  459   PRGQAQGLTWFTPSEDQ--MLISRAQLLARITGALGGRAAEDIIFGEAEVTTGAGNDLQQ  516

Query  846   ATWLARKMITVWN---------LENP  796
              T +AR+M+T +          LENP
Sbjct  517   VTSMARQMVTRFGMSAELGALALENP  542



>ref|WP_017654114.1| cell division protein FtsH [Microchaete sp. PCC 7126]
Length=629

 Score =   329 bits (843),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 199/457 (44%), Positives = 285/457 (62%), Gaps = 35/457 (8%)
 Frame = -2

Query  2139  FAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSK  1960
             FA+     +   +   I ++  + LV L ++ L      RR  N       Q + F +S+
Sbjct  112   FAEVSSANSRAAVGLLINLMWILPLVALMLLFL------RRSTNASS----QAMNFGKSR  161

Query  1959  PQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGK  1780
              + +++  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GK
Sbjct  162   ARFQMEAKTGVKFDDVAGIEEAKEELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGK  221

Query  1779  TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALAT  1600
             TL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  
Sbjct  222   TLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCLIFIDEIDAVGR  281

Query  1599  KRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRP  1420
             +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRP
Sbjct  282   QRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRP  333

Query  1419  GRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaal  1240
             GRFDR++ +  P+ KGRL ILKVHAR  K+  +V L + A+  PG++GA LA LL EAA+
Sbjct  334   GRFDRQVIVDAPDLKGRLEILKVHARNKKIDSSVSLDAIARRTPGFTGADLANLLNEAAI  393

Query  1239  vaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYEN  1060
             +  R+   +I   ++DDAVDR+  G +   + +  + +   A  EVG AL   LL+ ++ 
Sbjct  394   LTARRRKEAITLLEIDDAVDRVVAGMEGTAL-VDSKNKRLIAYHEVGHALVGTLLKDHDP  452

Query  1059  AKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-  883
              +     ++++ PRGQ L    F   +++  +   R QL  R+   LGGRAAEE+++G+ 
Sbjct  453   VQ-----KVTLIPRGQALGLTWFTPNEEQGLI--SRSQLKDRITATLGGRAAEEIVFGKP  505

Query  882   DTSKASVSYLADATWLARKMITVW--------NLENP  796
             + +  + + L   T +AR+M+T +        +LENP
Sbjct  506   EVTTGAGNDLQQVTSMARQMVTRFGMSELGPLSLENP  542



>ref|WP_006511814.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01042.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=642

 Score =   329 bits (844),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 196/469 (42%), Positives = 291/469 (62%), Gaps = 34/469 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA   +L  +L++FL +  LV   + +R  +       Q   F++S+ + +++  TG+ F
Sbjct  134   SAVTSILVNLLIIFLLLTALV--MIIKRSASAS----GQAFNFAKSRARFQMEAKTGIQF  187

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             +DVAGIE+A EELQE+VT+LK PE F  +G K P G+LL GPPG GKTL+A+AIAGEA V
Sbjct  188   DDVAGIEEAKEELQEVVTFLKEPEKFTALGAKIPRGMLLIGPPGTGKTLLARAIAGEASV  247

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D  
Sbjct  248   PFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--  305

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
                   ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  306   ------EREQTLNQLLTEMDGFEGNAGIIVIAATNRPDVLDKALLRPGRFDRQVFVDYPD  359

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              +GRLGIL+VHAR  K++  VDL + A+  PG+SGA LA LL EAA+   R+   +I   
Sbjct  360   YQGRLGILEVHARDKKVATEVDLEAIARRTPGFSGADLANLLNEAAIFTARRRKEAITMQ  419

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             +++DAVDR+  G + V + +  + +   A  E+G A+ + L  ++     +  +++++ P
Sbjct  420   EINDAVDRIVAGMEGVPL-VDSKAKRLIAYHEIGHAIVATLTPNH-----DPVEKVTLIP  473

Query  1020  RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADA  844
             RGQ      F    DE      R Q+L ++   LGGRAAEEVI+G  + +  + + +   
Sbjct  474   RGQAKGLTWFT--PDEERGLITRNQILGKIASTLGGRAAEEVIFGDAEITTGASNDIEQL  531

Query  843   TWLARKMITVWNL-----------ENPMTIHGEPLPWRKSPKFVGPRLD  730
             T +AR M+T + +           + P+ +  EP+P  +  + +  R+D
Sbjct  532   TSMARNMVTKFGMSELGPLALEKADQPVFLRNEPMPRSEYSEEIAARID  580



>ref|WP_015176808.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis]
 ref|YP_007115948.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ07532.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis 
PCC 7112]
Length=644

 Score =   329 bits (844),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 283/447 (63%), Gaps = 24/447 (5%)
 Frame = -2

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             ++V      +A++ ++  +L++F   VL V   + RR    +       + F +S+ + +
Sbjct  123   FEVKQTADNAAAVSLVVNLLVIF--AVLAVLMAILRRSTQSQ----GNAMNFGKSRARFQ  176

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TGV F+DVAGIE+A EELQE+VT+LK PE F+ +G K P GVLL GPPG GKT++A
Sbjct  177   MEAKTGVMFDDVAGIEEAKEELQEVVTFLKKPERFNAIGAKIPRGVLLIGPPGTGKTMLA  236

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R  
Sbjct  237   KAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVFIDEIDAVGRQRGA  296

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   GVI + ATNR D+LD ALLRPGRFD
Sbjct  297   GIGGGND--------EREQTLNQLLTEMDGFEGNSGVIVIAATNRPDVLDTALLRPGRFD  348

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+ KGRLGIL+VHAR  KL   V L + A+  PG+SGA LA LL EAA++  R
Sbjct  349   RQVTVDLPSYKGRLGILQVHARNKKLDPEVALDTIARRTPGFSGADLANLLNEAAILTAR  408

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +  ++I   ++ DA+DR+T+G     + L  + +   A  EVG AL + +L++      +
Sbjct  409   RRKDTISNLEVHDAIDRITIGLTLNPL-LDSKKKWMTAYHEVGHALVATMLKN-----AD  462

Query  1047  CCDRISINPRGQTLSQVVFHRLDDE---SYMFERRPQLLHRLQVLLGGRAAEEVIYG-RD  880
               ++++I PR   +       LDDE   S     R  LL+R+ V LGGRAAE  IYG  +
Sbjct  463   PVEKVTIIPRSGGIEGFTSFVLDDEMLDSEGLRSRALLLNRITVALGGRAAEAEIYGDAE  522

Query  879   TSKASVSYLADATWLARKMITVWNLEN  799
                 + S L   + LAR+M+T++ + +
Sbjct  523   IDTGAGSDLRKVSSLAREMVTLYGMSD  549



>ref|WP_017322954.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=629

 Score =   329 bits (843),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 196/433 (45%), Positives = 280/433 (65%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  126   LVFPILLIAGLFFLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F+ +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKQPEKFNAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVIVDAPDIKGRLEILKVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  357   ARNKKLDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITLTEIDDAVDRVVA  416

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  417   GMEGTPL-VDSKSKRLIAYHEVGHALVGTVLKDHDPVQ-----KVTLVPRGQAQGLTWFT  470

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+GRD  +  + + L   T +AR+M+T +
Sbjct  471   PNEEQGLI--TRAQLKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVTNMARQMVTRF  528

Query  810   NLE--NPMTIHGE  778
              +    P+++  +
Sbjct  529   GMSELGPISLESQ  541



>gb|KFF41954.1| ATP-dependent metalloprotease FtsH [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=635

 Score =   329 bits (843),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 266/407 (65%), Gaps = 21/407 (5%)
 Frame = -2

Query  2022  RRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELF  1843
             RR  N       Q   FS+SK + +++  TG++F DVAGI++A EELQE+VT+LK PE F
Sbjct  155   RRSTNIS----GQTTNFSKSKARFQMEASTGISFEDVAGIDEAKEELQEIVTFLKEPEKF  210

Query  1842  DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLF  1663
               +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLF
Sbjct  211   TAIGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLF  270

Query  1662  KRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGK  1483
             K+AK N P +IFIDEIDA+  +R G+        Y     ERE TLNQLLTE+DGF+   
Sbjct  271   KKAKENTPCLIFIDEIDAVGRQR-GV-------GYGGGNDEREQTLNQLLTEMDGFEGNS  322

Query  1482  GVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSY  1303
             G+I + ATNR D+LD AL RPGRFDR++ +  P+ KGR GIL+VH+R  K+SE V L + 
Sbjct  323   GIILIAATNRPDVLDAALSRPGRFDRQVIVDYPDLKGREGILEVHSRDKKISENVSLETV  382

Query  1302  AQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQC  1123
             A+  PG++GA LA LL EAA+   R+   +I  +++ DA+DR+  G +   + +  + + 
Sbjct  383   ARRTPGFTGADLANLLNEAAIFTARRRKKTISMTEIYDAIDRVVAGMEGAPL-IDSKSKR  441

Query  1122  RRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQL  943
               A  E+G AL   ++  +E+      +++++ PRGQ      F   ++ES +  R  Q+
Sbjct  442   LIAYHEIGHALVGSIIPEHES-----VEKVTLIPRGQAKGLTWFTP-EEESALITRN-QI  494

Query  942   LHRLQVLLGGRAAEEVIYGRDTSKASVSY-LADATWLARKMITVWNL  805
             L R+  LLGGR AEEV++G+D      S  L   T+LAR+M+T + +
Sbjct  495   LARISGLLGGRVAEEVVFGQDEVTTGASNDLEKVTYLARQMVTRFGM  541



>gb|AFC39995.1| cell division protein [Porphyra umbilicalis]
Length=628

 Score =   328 bits (842),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 186/406 (46%), Positives = 266/406 (66%), Gaps = 19/406 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ +GRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFRGRLAILEVHAKNKKMESKVSLETIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIHGE  778
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++  +
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQ  540



>ref|WP_017286410.1| cell division protein FtsH [Leptolyngbya boryana]
Length=628

 Score =   328 bits (842),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 190/407 (47%), Positives = 268/407 (66%), Gaps = 21/407 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMNFGKSRARFQMEAKTGVLFDDVAGIEEAKEELQEVVTFLKKPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAG PF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGTPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIIIAATNRPD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL +L VHAR  K+SE V L + A+  PG+SGA L
Sbjct  323   VLDSALLRPGRFDRQVTVDVPDIKGRLEVLNVHARNKKISEEVSLDAIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTAL  1090
             A LL EAA++  R+  ++I  S++DDAVDR+  G +  G  L      R  A  EVG A+
Sbjct  383   ANLLNEAAILTARRRKDAITMSEIDDAVDRVVAGME--GTPLTDSKSKRLIAYHEVGHAI  440

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
                L++ ++  +     ++++ PRGQ      F   +D+  +   R Q+L R++  LGGR
Sbjct  441   VGTLVKEHDPVQ-----KVTLIPRGQARGLTWFMPSEDQGLI--SRAQILARIKGALGGR  493

Query  909   AAEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             AAEEVI+G  + +  +   +   T +AR+M+T + + +  P+++  +
Sbjct  494   AAEEVIFGDAEVTTGAGGDIQQVTSMARQMVTRYGMSDLGPLSLESQ  540



>ref|WP_015213897.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica]
 ref|YP_007156159.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
 gb|AFZ57249.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
Length=631

 Score =   328 bits (842),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 194/451 (43%), Positives = 289/451 (64%), Gaps = 30/451 (7%)
 Frame = -2

Query  2112  FGGIS-----ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             FG +S     A++ +L  ++ +   + L++ F   RR  N       Q + F +S+ + +
Sbjct  112   FGEVSSANSRAAVGLLINLMWILPLVALMLLFL--RRSSNASN----QAMNFGKSRARFQ  165

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TGV F++VAG+E+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+A
Sbjct  166   MEAKTGVKFDEVAGVEEAKEELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGKTLLA  225

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R  
Sbjct  226   KAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGA  285

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFD
Sbjct  286   GIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFD  337

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R+I +  P+ KGRL IL+VHA+  KL  +V L + A+  PG++GA LA LL EAA++  R
Sbjct  338   RQITVDAPDIKGRLEILQVHAKNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTAR  397

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +   +I  S++DDAVDR+  G +   + +  + +   A  EVG AL   L++ +     +
Sbjct  398   RRKETITISEIDDAVDRVVAGMEGAAL-VDSKNKRLIAYHEVGHALVGTLIKDH-----D  451

Query  1047  CCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSK  871
                ++++ PRGQ L    F   +++  +   R Q+L R+   LGGRAAEE+++G+ + + 
Sbjct  452   PVQKVTLIPRGQALGLTWFTPNEEQGLI--SRSQILARIIAALGGRAAEEIVFGKAEVTT  509

Query  870   ASVSYLADATWLARKMITVWNLEN--PMTIH  784
              + + L   T +AR+M+T + + +  P+++ 
Sbjct  510   GAGNDLQQVTSMARQMVTRFGMSDLGPLSLE  540



>ref|YP_009051040.1| putative plastid division protein [Galdieria sulphuraria]
 ref|XP_005705001.1| [pt] AAA-type ATPase [Galdieria sulphuraria]
 gb|EME28481.1| [pt] AAA-type ATPase [Galdieria sulphuraria]
 gb|AIG92486.1| putative plastid division protein [Galdieria sulphuraria]
Length=634

 Score =   328 bits (842),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 185/409 (45%), Positives = 274/409 (67%), Gaps = 25/409 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK +  ++  TGVTF+D+AGIE+A EE QE+VT+LK PE F  +G + P GVL
Sbjct  154   QAMSFGKSKARFNIEAKTGVTFDDIAGIEEAKEEFQEIVTFLKKPERFTAIGARIPKGVL  213

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L G PG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  214   LVGAPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  273

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR+D
Sbjct  274   IDEIDAVGRQRGTGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIVVAATNRID  325

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I +  P+ KGR+ ILKVH++  KL++T+ + S A+  PG+SGA L
Sbjct  326   VLDVALLRPGRFDRQITVDLPDLKGRIAILKVHSKNKKLAQTISIESIARRTPGFSGADL  385

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGT  1096
             A L+ EAA++  R+  +SI  S++D ++DR+  G + RV  D     + +R  A  EVG 
Sbjct  386   ANLMNEAAILTARRKKDSITMSEIDVSIDRIIAGLEGRVLTD----SKTKRLIAYHEVGH  441

Query  1095  ALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLG  916
             A+   LL++++  +     ++++ PRGQ      F   ++++ +   R Q+L R+   LG
Sbjct  442   AIIGTLLKNHDPVQ-----KVTLIPRGQAKGLTWFTPSEEQTLI--SRGQILARIIAALG  494

Query  915   GRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             GRA+EEV++G  + +  + + L   T +AR+M+T + + N  P+++  +
Sbjct  495   GRASEEVVFGNLEITTGASNDLQQVTSMARQMVTRFGMSNIGPLSLENQ  543



>ref|WP_008226785.1| Cell division protein FtsH [Richelia intracellularis]
 emb|CCH65009.1| Cell division protein FtsH [Richelia intracellularis HM01]
Length=594

 Score =   327 bits (838),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 197/434 (45%), Positives = 279/434 (64%), Gaps = 22/434 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  91    LIFPILLITGLFFLFRR-SNSMPGGPGQAMNFGKSKARFQMEAKTGVIFDDVAGIEEAKE  149

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  150   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  209

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  210   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  261

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGRL +LKVH
Sbjct  262   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQIIVDAPDIKGRLEVLKVH  321

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+ ++ L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  322   ARNKKLAPSISLETIARRTPGFTGADLANLLNEAAILTARRRKEAITLAEIDDAVDRVVA  381

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  E+G AL   LL++++  +     ++++ PRGQ      F
Sbjct  382   GME--GTPLVDSKSKRLIAYHEIGHALVGTLLKYHDPVQ-----KVTLIPRGQAQGLTWF  434

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITV  814
                +++  +     QL  R+   LGGRAAEEVI+G  + +  + + L   T +AR+M+T 
Sbjct  435   TPNEEQGLI--THGQLKARITGALGGRAAEEVIFGNAEITTGAGNDLQQVTGMARQMVTR  492

Query  813   WNLEN--PMTIHGE  778
             + + +  P+++  +
Sbjct  493   FGMSDLGPLSLEAQ  506



>ref|YP_001293616.1| cell division protein [Rhodomonas salina]
 gb|ABO70796.1| cell division protein [Rhodomonas salina]
Length=628

 Score =   328 bits (841),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 184/406 (45%), Positives = 268/406 (66%), Gaps = 19/406 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGVTF DVAG+++A EE +E+V++LK PE F  +G K P GVL
Sbjct  151   QAMNFGKSKARFQMEATTGVTFEDVAGVDEAKEEFEEVVSFLKRPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGE+GVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGESGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR+D
Sbjct  271   IDEIDAVGRQRGTGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRVD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ +GRL IL VHAR  KLSE + L   A+  PG+SGA L
Sbjct  323   VLDAALLRPGRFDRQVTVNVPDVRGRLEILNVHARNKKLSEEISLEVIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   ++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKKAVTMSEVDASIDRVIAGMEGTAL-VDSKTKRLIAYHEVGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL+ ++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GTLLQEHDPVQ-----KVTLIPRGQAKGLTWFTPSDDQSLI--SRSQILARIMGALGGRA  494

Query  906   AEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             AEEV++G  + +  + + L   T +AR+M+T + + N  P+ + G+
Sbjct  495   AEEVVFGYPEVTTGAGNDLQQVTSMARQMVTRFGMSNIGPLALEGQ  540



>gb|AIA21561.1| putative plastid division protein [Pyropia fucicola]
Length=628

 Score =   328 bits (840),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 268/414 (65%), Gaps = 22/414 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMESKVSLETIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIH---GEPLPWR  763
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++    G+P   R
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQGGDPFLGR  548



>ref|WP_016950305.1| cell division protein FtsH [Anabaena sp. PCC 7108]
Length=631

 Score =   328 bits (840),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 197/449 (44%), Positives = 286/449 (64%), Gaps = 26/449 (6%)
 Frame = -2

Query  2112  FGGISASIEVLKPILLVFLTMVL-LVRFTLS--RRPKNFRKWDIWQGIEFSQSKPQARVD  1942
             FG +S++       LL+ L  +L LV   L   RR  N       Q + F +S+ + +++
Sbjct  112   FGEVSSANSRAAVGLLINLMWILPLVALMLLFLRRSTNASN----QAMNFGKSRARFQME  167

Query  1941  GMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKA  1762
               TGV F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKA
Sbjct  168   AKTGVKFDDVAGIEEAKEELQEVVTFLKQPEKFTAVGAKIPKGVLLIGPPGTGKTLLAKA  227

Query  1761  IAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIF  1582
             IAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R    
Sbjct  228   IAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGI  287

Query  1581  NDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRK  1402
                +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+
Sbjct  288   GGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQ  339

Query  1401  IRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKG  1222
             + +  P+ KGRL IL+VHAR  KL ++V L + A+  PG++GA LA LL EAA++  R+ 
Sbjct  340   VTVDAPDIKGRLEILEVHARNKKLDKSVSLEAIARRTPGFTGADLANLLNEAAILTARRR  399

Query  1221  HNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECC  1042
               +I   ++DDAVDR+  G +   + +  + +   A  EVG AL   L++ +     +  
Sbjct  400   KEAITILEIDDAVDRVVAGMEGTAL-VDSKNKRLIAYHEVGHALVGTLVKEH-----DPV  453

Query  1041  DRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKAS  865
              ++++ PRGQ L    F   +++  +   R Q+L R+   LGGRAAE++++G+ + +  +
Sbjct  454   QKVTLIPRGQALGLTWFTPNEEQGLI--SRSQILARIMAALGGRAAEDIVFGKAEVTTGA  511

Query  864   VSYLADATWLARKMITVWNLEN--PMTIH  784
              + L   T +AR+M+T + + +  P+++ 
Sbjct  512   GNDLQQVTNMARQMVTRFGMSDLGPLSLE  540



>ref|WP_011613887.1| cell division protein FtsH [Trichodesmium erythraeum]
 ref|YP_724043.1| FtsH peptidase [Trichodesmium erythraeum IMS101]
 gb|ABG53570.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Trichodesmium erythraeum IMS101]
Length=628

 Score =   328 bits (840),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 194/426 (46%), Positives = 275/426 (65%), Gaps = 22/426 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  ++++  F L RR  N       Q + F +SK +  ++  TGV F+DVAG+++A E
Sbjct  125   LIFPILLIVGLFFLFRRSSNV-PGGPGQAMNFGKSKARFSMEAKTGVLFDDVAGVDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNSGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLSILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KLS  + L + A+  PG++GA LA LL EAA++  R+   +I   +++DAVDR+  
Sbjct  356   ARDKKLSSEISLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITMLEINDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   LL+ ++  +     ++++ PRGQ      
Sbjct  416   GME--GTPL-MDGKSKRLIAYHEVGHAIVGTLLKEHDPVQ-----KVTLVPRGQARGLTW  467

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F   +D+  +   R Q+L R+   LGGRAAE+VI+G  + +  + + L   T +AR+M+T
Sbjct  468   FMPNEDQGLI--SRSQILARITGALGGRAAEKVIFGDAEVTTGASNDLQQVTGMARQMVT  525

Query  816   VWNLEN  799
              + + +
Sbjct  526   RYGMSD  531



>ref|WP_022534834.1| ATPase AAA [Ralstonia pickettii]
 ref|YP_008595577.1| ATPase AAA [Ralstonia pickettii DTP0602]
 gb|AGW90143.1| ATPase AAA [Ralstonia pickettii DTP0602]
Length=646

 Score =   328 bits (841),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 197/417 (47%), Positives = 266/417 (64%), Gaps = 19/417 (5%)
 Frame = -2

Query  1980  IEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLE  1801
             +E  +SK +  +   TGVTF DVAGI++A EEL E+V +LK+P+ + ++G K P GVLL 
Sbjct  152   MEIGRSKAKVYMQKETGVTFADVAGIDEAKEELAEIVNFLKDPQRYRRLGGKIPKGVLLL  211

Query  1800  GPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFID  1621
             G PG GKTL+AKA+AGEAGVPF+ M+GSEFVE+ VGVGAAR+RDLF +A+   P +IFID
Sbjct  212   GAPGTGKTLLAKAVAGEAGVPFFTMSGSEFVEMFVGVGAARVRDLFDQAETKAPCIIFID  271

Query  1620  EIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLL  1441
             E+DAL   R    N        A   ERE TLNQLL E+DGFDT KGVI + ATNR ++L
Sbjct  272   ELDALGKTRA--LNAV------AGNDEREQTLNQLLVEMDGFDTNKGVIIMAATNRPEIL  323

Query  1440  DPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaq  1261
             DPALLRPGRFDR I +  P+ KGR  ILKVH + V L+ TVDLT  A   PG++GA LA 
Sbjct  324   DPALLRPGRFDRHIALDRPDLKGREQILKVHVKNVVLAPTVDLTKLAGRTPGFAGADLAN  383

Query  1260  llqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSH  1081
             L+ EAAL+A RKG +++   D D+A+DR+  G ++    +  Q +   A  E G A+ + 
Sbjct  384   LVNEAALLAARKGKDAVEMPDFDEALDRIVGGLEKKSRVMNQQEKETIAYHEAGHAIVAE  443

Query  1080  LLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAE  901
             L  H +        ++SI PRG            ++ Y+  ++ +LL RL VLLGGR AE
Sbjct  444   LRPHADR-----VSKVSIIPRGVAALGYTQQTPTEDRYLL-KQSELLDRLDVLLGGRIAE  497

Query  900   EVIYGRDTSKASVSYLADATWLARKMITVWNLENPMTIHG-EPLPWRKSPKFVGPRL  733
             +++YG D S  + + L  AT +AR+MIT + +   + +   E +P   +P F GP L
Sbjct  498   QIVYG-DVSTGAQNDLQRATDMARQMITQFGMSEQLGLAAYEDMP---NPLFTGPGL  550



>ref|WP_002789390.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI19355.1| ATP-dependent zinc metalloprotease FtsH 1 [Microcystis aeruginosa 
PCC 9807]
Length=631

 Score =   328 bits (840),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 195/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNLLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEENTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              KGRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  349   CKGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ L    F    DE      R QLL R+  LLGGR AEE ++G D  +  + S +
Sbjct  460   LIPRGQALGLTWFT--PDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGARSDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   ERITYLARQMVT  529



>ref|WP_015148162.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata]
 ref|YP_007085438.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata 
PCC 6304]
 gb|AFY81518.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata 
PCC 6304]
Length=628

 Score =   327 bits (839),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 188/404 (47%), Positives = 267/404 (66%), Gaps = 19/404 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMNFGKSKARFQMEAKTGVMFDDVAGIEEAKEELQEVVTFLKKPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  211   LIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL VHAR  KLS+ V L + A+  PG++GA L
Sbjct  323   VLDSALLRPGRFDRQVMVDAPDIKGRLEILDVHARNKKLSDQVSLEAIARRTPGFTGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   +I   ++DDAVDR+  G +   + +  + +   A  E+G A+ 
Sbjct  383   ANLLNEAAILTARRRKEAITILEIDDAVDRVVAGMEGTPL-VDSKSKRLIAYHEIGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               L++ ++  +     ++++ PRGQ      F  + +E  M   + QL+ R++  LGGRA
Sbjct  442   GTLVKDHDPVQ-----KVTLIPRGQAQGLTWF--MPNEDQMLISKSQLMARIKGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIH  784
             AEE+I+G  + +  +   L   T +AR+M+T + + +  PM++ 
Sbjct  495   AEEIIFGDSEVTTGAGGDLQQVTGMARQMVTRFGMSDLGPMSLE  538



>ref|WP_026732891.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=628

 Score =   327 bits (839),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVIVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDTIARRTPGFTGADLANLLNEAAILTARRRKDAITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTVLKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                 E      R QL  R+   LGGRAAE+VI+GRD  +  + + L   T +AR+M+T +
Sbjct  470   --PSEEMGLITRSQLKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_015189824.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 ref|YP_007129115.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ31955.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=630

 Score =   327 bits (839),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 198/445 (44%), Positives = 280/445 (63%), Gaps = 25/445 (6%)
 Frame = -2

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             ++V +      +I +L  +L +   M L++ F   RR  N       Q + F +S+ + +
Sbjct  112   FEVISAADSRVAIGILANLLWILPLMALMLLFL--RRSGNASN----QAMNFGKSRARFQ  165

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TG+TF DVAGIE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+A
Sbjct  166   MEAKTGITFVDVAGIEEAKEELQEVVTFLKQPERFTAIGARIPKGVLLVGPPGTGKTLLA  225

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R  
Sbjct  226   KAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGT  285

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFD
Sbjct  286   GIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFD  337

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+ KGR  IL+VHAR  KL   V L + A+  PG++GA LA LL EAA++  R
Sbjct  338   RQVIVDAPDLKGRQEILQVHARNKKLDPNVSLDAVARRTPGFTGADLANLLNEAAILTAR  397

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKV  1051
             +   +I   ++DDA+DR+  G +  G  L      R  A  EVG AL + LL+ ++  + 
Sbjct  398   RRKEAITLLEIDDAIDRVVAGME--GTPLVDSKSKRLIAYHEVGHALLATLLKDHDPVQ-  454

Query  1050  ECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTS  874
                 ++++ PRGQ      F   +D+  +   R QLL R+   LGGRAAEE+++G+ + +
Sbjct  455   ----KVTLIPRGQARGLTWFTPSEDQGLI--SRAQLLARITATLGGRAAEEIVFGKEEVT  508

Query  873   KASVSYLADATWLARKMITVWNLEN  799
               +   L   T LAR+M+T + + +
Sbjct  509   TGAGQDLQQLTNLARQMVTRFGMSD  533



>ref|YP_537009.1| cell division protein [Pyropia yezoensis]
 sp|Q1XDF9.1|FTSH_PYRYE RecName: Full=ATP-dependent zinc metalloprotease FtsH (chloroplast) 
[Pyropia yezoensis]
 dbj|BAE92452.1| unnamed protein product [Pyropia yezoensis]
 gb|AGH27655.1| cell division protein (chloroplast) [Pyropia yezoensis]
Length=628

 Score =   327 bits (839),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 287/464 (62%), Gaps = 41/464 (9%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMEPKVSLETIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIH---GEPLPWRKSPKFV  745
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++    G+P        F+
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQGGDP--------FL  546

Query  744   GPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKT  613
             G  +   GS Y D          ++  ++ K+   ++ + YA+ 
Sbjct  547   GRGMG-GGSEYSD----------EVATNIDKQVREIVSECYAQA  579



>gb|AHB35104.1| putative plastid division protein (chloroplast) [Pyropia perforata]
 gb|AHB35313.1| putative plastid division protein (chloroplast) [Pyropia perforata]
 gb|AIA19684.1| putative plastid division protein [Pyropia perforata]
 gb|AIA19893.1| putative plastid division protein [Pyropia perforata]
 gb|AIA20102.1| putative plastid division protein [Pyropia perforata]
 gb|AIA20311.1| putative plastid division protein [Pyropia perforata]
 gb|AIA20520.1| putative plastid division protein [Pyropia perforata]
 gb|AIA20729.1| putative plastid division protein [Pyropia perforata]
 gb|AIA20938.1| putative plastid division protein [Pyropia perforata]
 gb|AIA21147.1| putative plastid division protein [Pyropia perforata]
Length=628

 Score =   327 bits (839),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 268/414 (65%), Gaps = 22/414 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMEPKVSLETIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIH---GEPLPWR  763
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++    G+P   R
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQGGDPFLGR  548



>ref|YP_007947857.1| cell division protein (chloroplast) [Pyropia haitanensis]
 gb|AGG37106.1| cell division protein (chloroplast) [Pyropia haitanensis]
Length=628

 Score =   327 bits (839),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 189/414 (46%), Positives = 268/414 (65%), Gaps = 22/414 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMEPKVSLETIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIH---GEPLPWR  763
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++    G+P   R
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQGGDPFLGR  548



>ref|WP_017287528.1| hypothetical protein [Leptolyngbya boryana]
Length=634

 Score =   327 bits (839),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 187/409 (46%), Positives = 273/409 (67%), Gaps = 19/409 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G + P GVL
Sbjct  155   QAMNFGKSRARFQMEAKTGVMFDDVAGIEEAKEELQEVVTFLKKPERFTAVGARIPKGVL  214

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L G PG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  215   LVGSPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  274

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  275   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNAGIIIIAATNRPD  326

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I +  P+ KGRL IL+VHAR  KL++ VDL   A+  PG+SGA+L
Sbjct  327   VLDSALLRPGRFDRQISVDLPDRKGRLKILEVHARNKKLADEVDLEKIARQTPGFSGAEL  386

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  +++   ++DDA+DR+++G  +  + L    +   A  E+G AL 
Sbjct  387   ANLLNEAAILTARRRKDAVTMLEIDDAIDRVSIGLSKNPL-LDSNRKRMTAYHEIGHALL  445

Query  1086  SHLLRHYENAKVECCDRISINPRG---QTLSQVVFHRLDDESYMFERRPQLLHRLQVLLG  916
             + +L   ENA  +  ++++I PR    +  SQ + +    +S ++  R  +L R++V+LG
Sbjct  446   TTIL---ENA--DPLNKVTIIPRAGGIEGFSQTIPNEETIDSGLYT-RAWMLDRIKVILG  499

Query  915   GRAAEEVIYGRDT-SKASVSYLADATWLARKMITVWNLENPMTIHGEPL  772
             GRA E  +YG D     + S +   T +AR+M+T++ + +  ++  E +
Sbjct  500   GRAVEAEVYGEDAIDTGAASDIGKVTQIARQMVTIFGMSDLGSVAFESM  548



>ref|WP_015168714.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. PCC 7502]
 ref|YP_007106192.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. PCC 7502]
 gb|AFY74057.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. PCC 7502]
Length=628

 Score =   327 bits (838),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 186/397 (47%), Positives = 264/397 (66%), Gaps = 17/397 (4%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F +SK +  +D  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMDFGKSKARFSMDAKTGVLFDDVAGIEEAKEELQEVVTFLKKPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  211   LIGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQ+LTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGIGGGND--------EREQTLNQILTEMDGFEGNTGVIVIAATNRPD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I + PP+ KGRL +L VHA+  K++  + L + A+  PG+SGA L
Sbjct  323   VLDSALLRPGRFDRQISVDPPDIKGRLQVLGVHAKGKKIASDISLEAIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  +++   ++DDAVDR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKDAMTMLEIDDAVDRVIAGLEGKAL-VDSRNKRLIAYHEVGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               L++ ++  +     ++++ PRGQ      F   D++S +   R Q++ R+   LGGRA
Sbjct  442   GTLIKDHDPVQ-----KVTLIPRGQAAGLTWFTPSDEQSLI--SRSQIIARITGALGGRA  494

Query  906   AEEVIYGRD-TSKASVSYLADATWLARKMITVWNLEN  799
             AEEV++G D  +  + + L   T +AR+M+T + +  
Sbjct  495   AEEVVFGNDEVTTGAGNDLQQVTNIARQMVTRFGMST  531



>ref|WP_015119379.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
 ref|YP_007056358.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
 gb|AFY55811.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
Length=628

 Score =   327 bits (838),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPILLITGLFLLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGVMFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             EL E+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELGEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVIVDAPDIKGRLEILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL + V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDKGVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   L++ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTLVKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
               +D+  +   R QL  R+   LGGRAAE+VI+GRD  +  + + L   T +AR+M+T +
Sbjct  470   PSEDQGLI--SRSQLKARISGALGGRAAEQVIFGRDEITTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_015203025.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 ref|YP_007142419.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
 gb|AFZ12909.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=628

 Score =   327 bits (838),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 271/422 (64%), Gaps = 18/422 (4%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPVLLIAGLFFLFRRSNNL-PGGPGQAMNFGKSKARFQMEAKTGVLFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVSVDTPDLKGRLQILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  + L + A+  PG+SGA LA LL EAA++  R+   +I   +++DAVDR+  
Sbjct  356   ARNKKLAPEISLEAIARRTPGFSGADLANLLNEAAILTARRRKEAITMLEINDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G  +   LL+H++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHGIIGTLLKHHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QLL R+   LGGRAAE+VI+G  + +  +   L   T LAR+M+T +
Sbjct  470   PSEEQGLI--SRGQLLARISAALGGRAAEQVIFGDAEVTTGAGGDLQQVTSLARQMVTRY  527

Query  810   NL  805
              +
Sbjct  528   GM  529



>ref|WP_026788731.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=627

 Score =   327 bits (838),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 277/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + ++D  TGV F+DVAG+E+A E
Sbjct  125   LIFPILLIAGLFFLFRRSNNV-PGGPGQAMNFGKSKAKFQMDAKTGVLFDDVAGVEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P ++FIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKETAPCIVFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQITVDAPDIKGRLAVLEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K+SE V L + A+  PG++GA LA LL EAA++  R+    +   ++DDAVDR+  
Sbjct  356   ARNKKISEEVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGMTMIEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   L++ ++  +     ++++ PRGQ      
Sbjct  416   GME--GTPL-IDGKSKRLIAYHEVGHAIVGTLIKEHDPVQ-----KVTLIPRGQAQGLTW  467

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAE++I+G  + +  +   L     +AR+M+T
Sbjct  468   F--MPDEDQGLISRSQILARITGALGGRAAEDIIFGDSEVTTGAGGDLQQVAGMARQMVT  525

Query  816   VWNLEN--PMTIHGE  778
              + + +  P+++  +
Sbjct  526   RYGMSDLGPLSLESQ  540



>ref|WP_013193262.1| cell division protein FtsH [Trichormus azollae]
 ref|YP_003723376.1| ATP-dependent metalloprotease FtsH ['Nostoc azollae' 0708]
 gb|ADI66253.1| ATP-dependent metalloprotease FtsH ['Nostoc azollae' 0708]
Length=631

 Score =   327 bits (838),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 194/451 (43%), Positives = 290/451 (64%), Gaps = 30/451 (7%)
 Frame = -2

Query  2112  FGGIS-----ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             FG +S     A++ +L  ++ +   + L++ F   RR  N       Q + F +S+ + +
Sbjct  112   FGQVSSANSRAAVGLLINMMWILPLVALMLLFL--RRSTNGSN----QAMNFGKSRARFQ  165

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+A
Sbjct  166   MEAKTGVKFDDVAGIEEAKEELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLA  225

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R  
Sbjct  226   KAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGA  285

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFD
Sbjct  286   GIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFD  337

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+ KGRL IL+VH+R  KL  +V L + A+  PG++GA LA LL EAA++  R
Sbjct  338   RQVTVDAPDIKGRLEILEVHSRNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTAR  397

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +  ++I   ++DDAVDR+  G +   + +  + +   A  EVG AL   L++ ++  +  
Sbjct  398   RRKDTITILEIDDAVDRVVAGMEGAAL-VDSKNKRLIAYHEVGHALVGTLIKDHDPVQ--  454

Query  1047  CCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSK  871
                ++++ PRGQ L    F   +++  +   R Q+L R+   LGGRAAEE+++G+ + + 
Sbjct  455   ---KVTLIPRGQALGLTWFTPNEEQGLI--SRSQILARIMAALGGRAAEEIVFGKAEVTT  509

Query  870   ASVSYLADATWLARKMITVWNLEN--PMTIH  784
              + + L   T +AR+M+T + + +  P+++ 
Sbjct  510   GAGNDLEQVTNMARQMVTRFGMSDLGPLSLE  540



>emb|CAO89717.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS50195.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
DIANCHI905]
Length=600

 Score =   326 bits (836),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  92    SALINVLTNVLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  145

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  146   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  205

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  206   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  257

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  258   YGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  317

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             +KGRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  318   SKGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  377

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  378   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  428

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  429   LIPRGQAQGLTWFT--PDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  486

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  487   EKITYLARQMVT  498



>ref|WP_011125073.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 ref|NP_875313.1| Cell division protein FtsH [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|AAP99965.1| Cell division protein FtsH [Prochlorococcus marinus subsp. marinus 
str. CCMP1375]
 gb|KGG11691.1| Cell division protein FtsH [Prochlorococcus marinus str. LG]
 gb|KGG18897.1| Cell division protein FtsH [Prochlorococcus marinus str. SS2]
 gb|KGG23565.1| Cell division protein FtsH [Prochlorococcus marinus str. SS35]
 gb|KGG32199.1| Cell division protein FtsH [Prochlorococcus marinus str. SS51]
 gb|KGG35109.1| Cell division protein FtsH [Prochlorococcus sp. SS52]
Length=638

 Score =   327 bits (839),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 214/526 (41%), Positives = 321/526 (61%), Gaps = 40/526 (8%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++     L+RR  N       Q ++F ++K +  ++  TGV F+DVAG+E+A E
Sbjct  133   LIFPVILIGGLIFLARR-SNSMPGGPGQAMQFGKTKARFAMEAETGVQFDDVAGVEEAKE  191

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             +L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  192   DLEEVVTFLKQPERFTSVGAKIPRGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFV  251

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFKRAK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  252   EMFVGVGASRVRDLFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  303

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  304   LNQLLTEMDGFEGNSGIIIIAATNRPDVLDSALLRPGRFDRQVSVDAPDIKGRLSILTVH  363

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             ++  KL E + L S A+  PG++GA LA LL EAA++  R+   +I  S++DDAVDR+  
Sbjct  364   SKNKKLEEVLSLESIARRTPGFTGADLANLLNEAAILTARRRKEAIGISEIDDAVDRIIA  423

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  E+G A+   LL+ ++  +     ++++ PRGQ      
Sbjct  424   GME--GQPL-TDGRSKRLIAYHEIGHAIVGTLLKDHDPVQ-----KVTLIPRGQAKGLTW  475

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMIT  817
             F    DE  M   R QL  R+   LGGRAAE+V++GR + +  +   +     +AR+M+T
Sbjct  476   FS--PDEDQMLVSRAQLKARIMGALGGRAAEDVVFGRGEVTTGAGGDIQQVASMARQMVT  533

Query  816   VWNLE--NPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTE  643
              + +    P+++  +         F+G  L     + D        ++  +D+ V K   
Sbjct  534   RFGMSRLGPISLEND-----SQEVFIGRDLMTRSDISDS-------ISQQIDEQVRK---  578

Query  642   ALIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNY  505
              ++++ Y  T  L++ +  ++ K V++L++++ I+GEE+  +LS Y
Sbjct  579   -IVKECYQATFELVKSNRQSIDKLVELLIEKETINGEELVNVLSQY  623



>ref|WP_026797044.1| cell division protein FtsH [Planktothrix prolifica]
 gb|KEI68860.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=627

 Score =   327 bits (838),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 277/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + ++D  TGV F+DVAG+E+A E
Sbjct  125   LIFPILLIAGLFFLFRRSNNV-PGGPGQAMNFGKSKAKFQMDAKTGVLFDDVAGVEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P ++FIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKETAPCIVFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQITVDAPDIKGRLAVLEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K+SE V L + A+  PG++GA LA LL EAA++  R+    +   ++DDAVDR+  
Sbjct  356   ARNKKISEEVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGMTMIEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   L++ ++  +     ++++ PRGQ      
Sbjct  416   GME--GTPL-IDGKSKRLIAYHEVGHAIVGTLIKEHDPVQ-----KVTLIPRGQAQGLTW  467

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAE++I+G  + +  +   L     +AR+M+T
Sbjct  468   F--MPDEDQGLISRSQILARITGALGGRAAEDIIFGDSEVTTGAGGDLQQVAGMARQMVT  525

Query  816   VWNLEN--PMTIHGE  778
              + + +  P+++  +
Sbjct  526   RYGMSDLGPLSLESQ  540



>gb|AHJ28404.1| Cell division protein FtsH [Nodularia spumigena CCY9414]
Length=595

 Score =   326 bits (835),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 274/433 (63%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + ++D  TGV F+DVAGIE+A E
Sbjct  92    LIFPILLITGLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMDAKTGVKFDDVAGIEEAKE  150

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  151   ELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  210

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  211   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  262

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGRL +L+VH
Sbjct  263   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQITVDAPDIKGRLEVLQVH  322

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I   ++DDAVDR+  
Sbjct  323   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITIREIDDAVDRVVA  382

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  383   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKEHDPVQ-----KVTLIPRGQAQGLTWFT  436

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
                DE      R QL  R+   LGGRAAEEV++G  + +  +   L   + +AR+M+T +
Sbjct  437   --PDEEQGLISRSQLKARITGALGGRAAEEVVFGAAEVTTGAGGDLQQLSGMARQMVTRF  494

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  495   GMSDLGPLSLESQ  507



>ref|WP_039738453.1| cell division protein FtsH [Hassallia byssoidea]
 gb|KIF37414.1| cell division protein FtsH [Hassallia byssoidea VB512170]
Length=629

 Score =   327 bits (837),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 188/398 (47%), Positives = 263/398 (66%), Gaps = 19/398 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGVTFNDVAGIE+A EELQE+VT+LK PE F  +G + P GVL
Sbjct  153   QAMNFGKSKARFQMEAKTGVTFNDVAGIEEAKEELQEVVTFLKQPEKFTAVGARIPKGVL  212

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  213   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCLIF  272

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  273   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPD  324

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL+VH+R  K+ ++V L + A+  PG++GA L
Sbjct  325   VLDAALLRPGRFDRQVIVDAPDLKGRLEILQVHSRNKKVDKSVSLEAIARRTPGFTGADL  384

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTAL  1090
             A LL EAA++  R+   SI   ++DDAVDR+  G +  G  L      R  A  EVG AL
Sbjct  385   ANLLNEAAILTARRRKESITLLEIDDAVDRVVAGME--GTPLVDSKSKRLIAYHEVGHAL  442

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
                LL+++     +   ++++ PRGQ      F   +++  +   R QLL R+   L GR
Sbjct  443   VGTLLKNH-----DPVQKVTLIPRGQAQGLTWFTPNEEQGLL--SRSQLLARITSTLAGR  495

Query  909   AAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             AAEE+++G+ + +  +   L   + +AR+M+T + + +
Sbjct  496   AAEEIVFGKPEVTTGAGDDLQKVSGMARQMVTRFGMSD  533



>ref|YP_063571.1| cell division protein [Gracilaria tenuistipitata var. liui]
 gb|AAT79646.1| ftsH protease homolog [Gracilaria tenuistipitata var. liui]
Length=626

 Score =   327 bits (837),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 203/499 (41%), Positives = 305/499 (61%), Gaps = 35/499 (7%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + FS+SK   +++  TGV FNDVAGI++A EE +E+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFSKSKALFQMEAKTGVVFNDVAGIDEAKEEFEEVVTFLKKPERFTTVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LIGPPGTGKTLLAKAIAGEANVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGIGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL ILKVHA+  K+   + L+  A+  PG+SGA L
Sbjct  323   ILDAALLRPGRFDRQVSVEIPDFKGRLDILKVHAKNKKMEPNISLSMIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N I  S++D ++DR+  G +   + +  + +   A  E+G A+ 
Sbjct  383   ANLLNEAAILTARRRKNYIAMSEIDASIDRIVAGMEGTPL-IDSKSKRLIAYHEIGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL+ +     +   ++++ PRGQ      F   +D++ +   R Q+L R+   LGGRA
Sbjct  442   GTLLQDH-----DAVQKVTLIPRGQARGLTWFTPGEDQNLI--SRSQILSRIMGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIHGEPLPWRKSPKFVGPR  736
             AEEV++G  + +  + + L   T +AR+M+T + + N  P+ +  E      S  F+G  
Sbjct  495   AEEVVFGDTEVTTGASNDLQQVTSMARQMVTRFGMSNIGPLCLENE-----DSNPFLGRS  549

Query  735   LDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvll  556
             +    S Y D   I+          + K+   ++ + Y + + +++ +   + + V +L+
Sbjct  550   MG-NTSEYSDEIAIK----------IDKQIHRIVEECYQEAIKIIKDNRIVIDRLVDLLI  598

Query  555   kqKEISGEEIDFILSNYPP  499
             +++ I GEE   I++ Y P
Sbjct  599   EKETIDGEEFREIINEYTP  617



>ref|WP_015219750.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 ref|YP_007162069.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ54025.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=626

 Score =   327 bits (837),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 193/434 (44%), Positives = 276/434 (64%), Gaps = 22/434 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK +  ++  TGV F+DVAGI++A E
Sbjct  123   LVFPVLLIASLFFLFRRSSNM-PGGPGQAMNFGKSKARFMMEAKTGVMFDDVAGIDEAKE  181

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  182   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  241

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  242   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  293

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ + PP+ KGR+G+L+VH
Sbjct  294   LNQLLTEMDGFEGNTGIIVIAATNRADVLDSALMRPGRFDRQVMVDPPDFKGRVGVLEVH  353

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K++  + + + A+  PG+SGA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  354   ARNKKIAPEISIEAIARRTPGFSGADLANLLNEAAILTARRRKPEITMAEIDDAVDRVIA  413

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  EVG A+   LL+ +     +   ++++ PRGQ      F
Sbjct  414   GME--GTPLVDSKSKRLIAYHEVGHAIVGTLLKDH-----DPVQKVTLIPRGQAQGLTWF  466

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITV  814
                +++  +   + QL+ R+   +GGRAAEE I+G D  +  +   L   T +AR+M+T 
Sbjct  467   TPNEEQGLI--TKAQLMARIAGAMGGRAAEEEIFGDDEVTTGAGGDLQQVTGMARQMVTR  524

Query  813   WNLE--NPMTIHGE  778
             + +    P+++ G+
Sbjct  525   FGMSELGPLSLEGQ  538



>ref|NP_053937.1| cell division protein [Porphyra purpurea]
 sp|P51327.1|FTSH_PORPU RecName: Full=ATP-dependent zinc metalloprotease FtsH (chloroplast) 
[Porphyra purpurea]
 gb|AAC08213.1| hypothetical chloroplast ORF 25 (chloroplast) [Porphyra purpurea]
Length=628

 Score =   327 bits (837),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 185/406 (46%), Positives = 266/406 (66%), Gaps = 19/406 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ +GRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFRGRLAILEVHAKNKKMESKVSLETIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  +++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKSAMTMSEIDTSIDRVVAGLEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIHGE  778
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++  +
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQ  540



>ref|WP_017651155.1| cell division protein FtsH [Microchaete sp. PCC 7126]
Length=628

 Score =   327 bits (837),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV FNDVAGIE+A E
Sbjct  125   LVFPILLITGLFFLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGVKFNDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I  S++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITLSEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVIFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_019491912.1| cell division protein FtsH [Calothrix sp. PCC 7103]
Length=628

 Score =   327 bits (837),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 272/424 (64%), Gaps = 22/424 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ +  ++  TGV F+DVAGIE+A E
Sbjct  125   LIFPVLLITGLFFLFRRSSNL-PGGPGQAMNFGKSRARFAMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +LKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  356   ARNKKLDASVSLETIARRTPGFTGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  E+G AL   LL+ ++  +     ++++ PRGQ      
Sbjct  416   GME--GTPL-VDGKSKRLIAYHEIGHALIGTLLKDHDPVQ-----KVTLIPRGQAQGLTW  467

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMIT  817
             F    +E      R QL  R+   LGGRAAEEVI+G  + +  + + L   T +AR+M+T
Sbjct  468   FT--PNEEMGLVTRAQLRARITGALGGRAAEEVIFGSAEVTTGAGNDLQQVTGMARQMVT  525

Query  816   VWNL  805
              + +
Sbjct  526   RFGM  529



>dbj|GAL92236.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=631

 Score =   327 bits (837),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 194/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV   + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNLLVIIIVLGLLV--FIIRRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+LQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLQEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              KGRLGIL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I  +
Sbjct  349   FKGRLGILEVHSRDKKVAADVVLEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITMA  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  460   LIPRGQAQGLTWFT--PDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   EKITYLARQMVT  529



>ref|NP_050804.1| cell division protein (chloroplast) [Guillardia theta]
 sp|O78516.1|FTSH_GUITH RecName: Full=ATP-dependent zinc metalloprotease FtsH (chloroplast) 
[Guillardia theta]
 gb|AAC35738.1| hypothetical chloroplast RF25 (chloroplast) [Guillardia theta]
Length=631

 Score =   327 bits (837),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 185/406 (46%), Positives = 268/406 (66%), Gaps = 19/406 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGVTFNDVAG+++A EE +E+V++LK PE F  +G K P GVL
Sbjct  151   QAMNFGKSKARFQMEAKTGVTFNDVAGVDEAKEEFEEVVSFLKKPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR+D
Sbjct  271   IDEIDAVGRQRGTGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRVD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL VHAR  KL  ++ L   A+  PG+SGA L
Sbjct  323   VLDAALLRPGRFDRQVTVDVPDVKGRLEILNVHARNKKLDLSISLELIAKRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+    I  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKKQITISEIDASIDRVIAGMEGKAL-VDSKTKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL+H++  +     ++++ PRGQ      F   +D+S +   R Q+L R+   LGGRA
Sbjct  442   GTLLKHHDPVQ-----KVTLVPRGQAKGLTWFTPSEDQSLI--SRSQILARIMGALGGRA  494

Query  906   AEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             AEEV++G  + +  + + L   T +AR+M+T + + N  P+++  +
Sbjct  495   AEEVVFGLPEVTTGAGNDLQQVTSMARQMVTRFGMSNIGPLSLESQ  540



>ref|WP_029633486.1| cell division protein FtsH [[Scytonema hofmanni] UTEX B 1581]
Length=628

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ + PP+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDPPDIKGRLEILQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG++GA LA LL EAA++  R+    +  +++DDAVDR+  
Sbjct  356   ARNKKLDKSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGMTLAEVDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEDVIFGHAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_009459923.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC08659.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=628

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTVLKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                 E      R QL  R+   LGGRAAE+VI+GRD  +  + + L   T +AR+M+T +
Sbjct  470   --PSEEMGLITRSQLKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVTNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_035150451.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB82266.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=628

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPVLLITGLFFLFRRSSNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +LKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL   V L + A+  PG++GA LA LL EAA++  R+    I  S++DDAVDR+  
Sbjct  356   ARNKKLDPGVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLSEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE++++GR + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--TRSQLKARITGALGGRAAEDIVFGRAEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPVSLESQ  540



>ref|WP_006620106.1| FtsH peptidase [Arthrospira platensis]
 ref|YP_005070464.1| cell division protein FtsH [Arthrospira platensis NIES-39]
 dbj|BAI91926.1| cell division protein FtsH [Arthrospira platensis NIES-39]
 gb|KDR56962.1| cell division protein FtsH [Arthrospira platensis str. Paraca]
Length=629

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 278/433 (64%), Gaps = 24/433 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  ++++  F L RR  N       Q + F +SK +  ++  TGV F+DVAG+E+A E
Sbjct  126   LVFPILLIVGLFFLFRRSNNV-PGGPGQAMNFGKSKARFSMEAKTGVLFDDVAGVEEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P ++FIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKETAPCIVFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGRL +L+VH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQIIVDAPDIKGRLSVLEVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL++ V L + A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  357   ARNKKLADKVSLEAIARRTPGFTGADLANLLNEAAILTARRRKDAITMAEIDDAVDRVVA  416

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +   +     G+ +R  A  EVG A+   L++ ++  +     ++++ PRGQ      
Sbjct  417   GMEGTPL---LDGKTKRLIAYHEVGHAIVGTLIKDHDPVQ-----KVTLVPRGQARGLTW  468

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAE++I+G  + +  +   L     +AR+M+T
Sbjct  469   F--MPDEDQGLISRSQILARITGALGGRAAEDIIFGDAEVTTGAGGDLQQVAGMARQMVT  526

Query  816   VWNLEN--PMTIH  784
              + + +  P+++ 
Sbjct  527   RYGMSDLGPLSLE  539



>ref|WP_017744879.1| cell division protein FtsH [Scytonema hofmanni]
Length=628

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TG+ F+DVAGIE+A E
Sbjct  125   LVFPVLLITGLFFLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGIKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVIVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLEAIARRCPGFTGADLANLLNEAAILTARRRKDAITNAEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFI  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +D+  +   R QL  R+   LGGRAAE++I+G  + +  +   L   T +AR+M+T +
Sbjct  470   PSEDQGLI--TRSQLKARITGALGGRAAEDIIFGAAEVTTGAGGDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPVSLESQ  540



>gb|EKD08345.1| ATP-dependent metalloprotease FtsH [Arthrospira platensis C1]
Length=613

 Score =   326 bits (835),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 278/433 (64%), Gaps = 24/433 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  ++++  F L RR  N       Q + F +SK +  ++  TGV F+DVAG+E+A E
Sbjct  110   LVFPILLIVGLFFLFRRSNNV-PGGPGQAMNFGKSKARFSMEAKTGVLFDDVAGVEEAKE  168

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  169   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  228

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P ++FIDEIDA+  +R       +D        ERE T
Sbjct  229   EMFVGVGASRVRDLFKKAKETAPCIVFIDEIDAVGRQRGAGIGGGND--------EREQT  280

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  281   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVIVDAPDIKGRLSVLEVH  340

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL++ V L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  341   ARNKKLADQVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITMAEIDDAVDRVVA  400

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  E+G A+   L++ ++  +     ++++ PRGQ      
Sbjct  401   GME--GTPL-LDGKTKRLIAYHEIGHAIVGTLIKDHDPVQ-----KVTLVPRGQARGLTW  452

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAE+VI+G  + +  +   L     +AR+M+T
Sbjct  453   F--MPDEDQGLISRSQILARITGALGGRAAEDVIFGDAEVTTGAGGDLQQVAGMARQMVT  510

Query  816   VWNLEN--PMTIH  784
              + + +  P+++ 
Sbjct  511   RYGMSDLGPLSLE  523



>gb|AIA21355.1| putative plastid division protein [Pyropia kanakaensis]
Length=628

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 268/414 (65%), Gaps = 22/414 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ +GRL IL+VHA+  K+   V L + A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFRGRLAILEVHAKNKKMESKVSLDTIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPGDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIH---GEPLPWR  763
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++    G+P   R
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQGGDPFLGR  548



>ref|WP_015203255.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 ref|YP_007142651.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
 gb|AFZ13141.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=641

 Score =   327 bits (837),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 277/433 (64%), Gaps = 29/433 (7%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L F+ +VL     L RR  N       Q + F +S+ + +++  TGV F+DVAGI +A E
Sbjct  144   LFFIFLVLAAVTMLFRRSSNAS----GQALNFGKSRARFQMEAKTGVLFDDVAGIAEAKE  199

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  200   ELQEVVTFLKQPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  259

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D        ERE T
Sbjct  260   EMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRQRGTGIGGGND--------EREQT  311

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  312   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVMVDAPDLKGRLSILEVH  371

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K+   V L + A+  PG++GA LA LL EAA++  R+  +++   ++DDA+DR+  
Sbjct  372   ARNKKIDPEVSLEAIARRTPGFTGADLANLLNEAAILTARRRKDAVTMLEIDDAIDRVVA  431

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +R  + +  + +   A  E+G A+   LL+H++  +     ++++ PRGQ      F 
Sbjct  432   GMERTPL-VDSKNKRLIAYHEIGHAIIGTLLKHHDPVQ-----KVTLIPRGQAQGLTWFT  485

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QLL R+   LGGRAAE++I+G  + +  + + L   + LAR+M+T +
Sbjct  486   PGEEQGLI--SRGQLLARISGALGGRAAEQIIFGDAEVTTGAGADLEYISSLARQMVTRF  543

Query  810   --------NLENP  796
                     +LENP
Sbjct  544   GMSTLGPVSLENP  556



>ref|WP_008317744.1| ATP-dependent metalloprotease FtsH [Leptolyngbya sp. PCC 6406]
Length=628

 Score =   326 bits (836),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/437 (45%), Positives = 283/437 (65%), Gaps = 22/437 (5%)
 Frame = -2

Query  2085  VLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAG  1906
             +L  +L  FL +  L  F L RR  N       Q + F +SK +  ++  TGV F+DVAG
Sbjct  121   ILGNLLFPFLLIGGL--FFLFRRSSNV-PGGPGQAMNFGKSKARFMMEAKTGVMFDDVAG  177

Query  1905  IEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQM  1726
             IE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAI+GEAGVPF+ +
Sbjct  178   IEEAKEELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAISGEAGVPFFSI  237

Query  1725  AGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAAT  1546
             +GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D       
Sbjct  238   SGSEFVEMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND-------  290

Query  1545  QERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRL  1366
              ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I + PP+ KGRL
Sbjct  291   -EREQTLNQLLTEMDGFEGNTGIIIIAATNRADVLDSALLRPGRFDRQIMVDPPDVKGRL  349

Query  1365  GILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDA  1186
              IL VHAR  KL++ + L + A+  PG++GA LA LL EAA++  R+  ++I  +++D A
Sbjct  350   EILNVHARNKKLADEISLEAIARRTPGFTGADLANLLNEAAILTARRRKDAITMAEVDAA  409

Query  1185  VDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTL  1006
             VDR+  G +   + +  + +   A  EVG A+   L++ ++  +     ++++ PRGQ  
Sbjct  410   VDRVVAGMEGTPL-VDSKSKRLIAYHEVGHAIIGTLVKAHDPVQ-----KVTLIPRGQAQ  463

Query  1005  SQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLAR  829
                 F   +++S +   R Q+L R++  LGGRAAE+VI+G  + +  + + L   T +AR
Sbjct  464   GLTWFTPSEEQSLI--SRAQILARIKGALGGRAAEDVIFGDSEVTTGAGNDLQQVTAMAR  521

Query  828   KMITVWNLEN--PMTIH  784
             +M+T + + +  P+++ 
Sbjct  522   QMVTRFGMSDLGPLSLE  538



>ref|WP_015078430.1| ATP-dependent metallopeptidase [Anabaena sp. 90]
 ref|YP_006995079.1| ATP-dependent metallopeptidase [Anabaena sp. 90]
 gb|AFW93266.1| ATP-dependent metallopeptidase [Anabaena sp. 90]
Length=586

 Score =   325 bits (832),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  83    LIFPVLLITGLFFLFRRSNNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  141

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  142   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  201

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  202   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  253

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  254   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVH  313

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I   ++DDAVDR+  
Sbjct  314   ARNKKLDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLLEIDDAVDRVVA  373

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  374   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF-  426

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
              + +E      R QL  R+   LGGRAAEEVI+GR + +  +   L   + +AR+M+T +
Sbjct  427   -MPNEEQGLISRSQLKARITGALGGRAAEEVIFGRAEVTTGAGGDLQQLSGMARQMVTRF  485

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  486   GMSDLGPLSLESQ  498



>ref|WP_006278637.1| cell division protein FtsH [Cylindrospermopsis raciborskii]
 gb|EFA68565.1| Peptidase M41, FtsH [Cylindrospermopsis raciborskii CS-505]
Length=628

 Score =   326 bits (835),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 196/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPVLLIGGLFFLFRRSNNL-PGGPGQAMSFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDTPDIKGRLEILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG+SGA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLDQSVSLEAIARRTPGFSGADLANLLNEAAILTARRRKEAITLLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALIGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF-  468

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
              + +E      R QL  R+   LGGRAAE+VI+G  + +  + + L   T +AR+M+T +
Sbjct  469   -MPNEEQGLITRSQLKARITGALGGRAAEDVIFGAAEVTTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLE--NPMTIHGE  778
              +    P+++  +
Sbjct  528   GMSELGPLSLESQ  540



>ref|WP_010997786.1| cell division protein FtsH [Nostoc sp. PCC 7120]
 ref|NP_487682.1| cell division protein [Nostoc sp. PCC 7120]
 dbj|BAB75341.1| cell division protein [Nostoc sp. PCC 7120]
Length=628

 Score =   326 bits (835),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPILLITGLFFLFRRSNNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  S++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLSEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEE+I+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEIIFGSAEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_013323344.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 ref|YP_003888550.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
 gb|ADN15275.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=639

 Score =   326 bits (836),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 188/444 (42%), Positives = 280/444 (63%), Gaps = 23/444 (5%)
 Frame = -2

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             + V +    SA I ++  +L++FL   +++   + RR  N       Q + F +S+ + +
Sbjct  124   FDVQSSSDHSAVIGIMTNLLVLFLLFGIVI--VILRRSANAS----GQAMNFGKSRARFQ  177

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TG+ F DVAGI++A EELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+A
Sbjct  178   MEAKTGINFEDVAGIDEAKEELQEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLA  237

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R G
Sbjct  238   KAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRQR-G  296

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
             +        Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFD
Sbjct  297   V-------SYGGGNDEREQTLNQLLTEMDGFEGNNGIIIIAATNRPDVLDVALMRPGRFD  349

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+ KGRLGIL+VHAR  ++   V L + A+  PG++GA LA +L EAA+   R
Sbjct  350   RQVIVDYPDMKGRLGILEVHARNKRIDSAVSLEAIARRTPGFTGADLANVLNEAAIFTAR  409

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +   +I   +++DA+DR+  G +   + +  + +   A  E+G A+ + L   +     +
Sbjct  410   RRKEAITSQEINDAIDRVVAGMEGTPL-VDSKAKRLIAYHEIGHAIVATLCPGH-----D  463

Query  1047  CCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSK  871
               +++++ PRGQ      F    DE      R Q+L R+  LLGGR AEEVI+G  + + 
Sbjct  464   TLEKVTLVPRGQARGLTWF--TPDEEQGLMSRSQILARISGLLGGRVAEEVIFGDTEITT  521

Query  870   ASVSYLADATWLARKMITVWNLEN  799
              + + +   T+LAR+M+T + + +
Sbjct  522   GAGNDIEKITYLARQMVTRFGMSD  545



>ref|WP_038077545.1| cell division protein FtsH [Tolypothrix bouteillei]
 gb|KIE12279.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=628

 Score =   326 bits (835),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPVLLITGLFFLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVIVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLETIARRCPGFTGADLANLLNEAAILTARRRKDAITNTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF-  468

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
              + +E      R QL  R+   LGGRAAE++I+G  + +  +   L   T +AR+M+T +
Sbjct  469   -IPNEEQGLITRSQLKARITGALGGRAAEDIIFGAAEVTTGAGGDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPVSLESQ  540



>ref|WP_002739047.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa]
 gb|ELP52944.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
TAIHU98]
Length=631

 Score =   326 bits (835),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNLLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEVNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             +KGRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  349   SKGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  460   LIPRGQAQGLTWF--TPDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   EKITYLARQMVT  529



>ref|WP_015170903.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
 ref|YP_007108388.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
 gb|AFY65336.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
Length=628

 Score =   326 bits (835),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 274/424 (65%), Gaps = 18/424 (4%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LLFPILLIAGLFFLFRRSNNV-PGGPGQAMSFGKSRARFQMEAKTGVMFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFKRAK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKRAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEVLEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLAPEVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITMLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   L++ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLVKEHDPVQ-----KVTLVPRGQARGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
               +D+  +   R Q+L R+   LGGRAAE+VI+G D  +  + + L   T +AR+M+T +
Sbjct  470   PSEDQGLI--SRSQILARITGALGGRAAEKVIFGDDEVTTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLEN  799
              + +
Sbjct  528   GMSD  531



>ref|WP_029551302.1| cell division protein FtsH [Thermocrinis sp. GBS]
Length=626

 Score =   325 bits (834),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 198/440 (45%), Positives = 283/440 (64%), Gaps = 26/440 (6%)
 Frame = -2

Query  1974  FSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGP  1795
             F +S+ +  +D    VT NDVAG+++  EE++E++ YLK+P  F ++G +PP GVLL G 
Sbjct  139   FGKSRAKVYIDEKPKVTLNDVAGMDEVKEEVKEIIEYLKDPVRFQRLGGRPPKGVLLYGE  198

Query  1794  PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEI  1615
             PG GKTL+AKAIAGEA VPF  ++GS+FVE+ VGVGAAR+RDLF+ AK + P +IFIDEI
Sbjct  199   PGVGKTLLAKAIAGEAHVPFISVSGSDFVEMFVGVGAARVRDLFETAKKHAPCIIFIDEI  258

Query  1614  DALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDP  1435
             DA+   R G FN            ERE TLNQLL E+DGFDT +G+I + ATNR D+LDP
Sbjct  259   DAVGRSR-GAFN------IGGGHDEREQTLNQLLVEMDGFDTSEGIIVIAATNRPDILDP  311

Query  1434  ALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqll  1255
             ALLRPGRFDR+I I  P+ KGR  ILKVHAR  KL+  VDL   A+  PG++GA L  +L
Sbjct  312   ALLRPGRFDRQIFIPKPDVKGRYEILKVHARNKKLAPNVDLEIVARATPGFNGADLENVL  371

Query  1254  qeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLL  1075
              EAAL+A RKG ++I   D+++A+DR+T+G +R G+ +  + + + A  E G A+ S ++
Sbjct  372   NEAALLAARKGKDAIEMEDIEEAIDRITMGLERKGMVISPKEKEKIAYHEAGHAIMSLMV  431

Query  1074  RHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEV  895
                     +   ++SI PRG  L       +DD+ +M++++  L+ RL VL GGRAAEEV
Sbjct  432   -----PGSDALHKVSIIPRGMALGVTQQLPIDDK-HMYDKQ-DLMGRLVVLFGGRAAEEV  484

Query  894   IYGRD-TSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGS  718
              YG++  +  + + L  AT LA +M+++W +   +     P+  R   + V P   F G 
Sbjct  485   FYGKEGITTGAENDLQRATELAYRMVSMWGMSENVG----PVAVR---RVVNP---FLGG  534

Query  717   LYDDYDLIEPPLNFDLDDDV  658
             +    D+ E  L  ++D++V
Sbjct  535   MTTSIDISE-ALKREIDEEV  553



>ref|WP_030006124.1| cell division protein FtsH [Synechococcus sp. NKBG042902]
Length=628

 Score =   325 bits (834),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 275/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK +  ++  TG+ F+DVAGIE+A E
Sbjct  125   LIFPILLISALFFLFRRSSNM-PGGPGQAMNFGKSKAKFMMEAQTGIMFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDTPDIKGRLSILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL++ + L   A+  PG+SGA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  356   ARNKKLADEISLDVIARRTPGFSGADLANLLNEAAILTARRRKEAITMAEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  470   --PNEEQGLTTKAQLMARIAGALGGRAAEEEIFGHDEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_036533052.1| cell division protein FtsH, partial [Neosynechococcus sphagnicola]
Length=621

 Score =   325 bits (834),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 187/407 (46%), Positives = 270/407 (66%), Gaps = 21/407 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK +  ++  TGV F+DVAGIE+A EELQE+VT+LK PE F  +G + P GVL
Sbjct  151   QAMSFGKSKARFMMEAKTGVMFDDVAGIEEAKEELQEVVTFLKKPERFTAVGARIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIVIAATNRPD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL +L+VHAR  KL+E+V L + A+  PG+SGA L
Sbjct  323   VLDSALLRPGRFDRQVTVDVPDVKGRLKVLEVHARNKKLAESVSLEAIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTAL  1090
             A LL EAA++  R+  ++I   ++DDAVDR+  G +  G  L      R  A  E+G A+
Sbjct  383   ANLLNEAAILTARRRKDAITMLEVDDAVDRVVAGME--GTPLVDSKSKRLIAYHEIGHAI  440

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
                L++ ++  +     ++++ PRGQ      F   +++  +   R Q+L R+   LGGR
Sbjct  441   VGTLVKDHDPVQ-----KVTLVPRGQARGLTWFAPSEEQGLI--SRAQILARITGALGGR  493

Query  909   AAEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             AAE+V++G  + +  + + L   T +AR+M+T + + +  P+++ G+
Sbjct  494   AAEDVVFGDAEVTTGAGNDLQQVTSMARQMVTRFGMSDLGPLSLEGQ  540



>ref|WP_017719679.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=628

 Score =   325 bits (834),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 197/434 (45%), Positives = 275/434 (63%), Gaps = 22/434 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ +  ++  TGV F+DVAGIE+A E
Sbjct  125   LVFPILLMAGLFFLFRRSNNV-PGGPGQAMNFGKSRARFSMEAKTGVLFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDTPDIKGRLEILNVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  + L + A+  PG+SGA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLAPEISLEAIARRTPGFSGADLANLLNEAAILTARRRKEAITMLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  E+G A+   LL+ ++  +     ++++ PRGQ      F
Sbjct  416   GME--GTPLVDSKSKRLIAYHEIGHAIVGTLLKEHDPVQ-----KVTLVPRGQARGLTWF  468

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITV  814
                +D+S +   R QL  R+   LGGRAAE+VI+G  + +  + + L   T +AR+M+T 
Sbjct  469   MPGEDQSLI--SRSQLKARITGALGGRAAEDVIFGDAEVTTGAGNDLQQVTGMARQMVTR  526

Query  813   WNLE--NPMTIHGE  778
             + +    P+++  +
Sbjct  527   FGMSELGPLSLESQ  540



>ref|WP_017312271.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=628

 Score =   325 bits (834),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTVLKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                 E      R Q+  R+   LGGRAAE+VI+GRD  +  + + L   + +AR+M+T +
Sbjct  470   --PSEEMGLITRSQIKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVSNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_015132046.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
 ref|YP_007069091.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
 gb|AFY36257.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
Length=628

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV FNDVAGIE+A E
Sbjct  125   LVFPILLITGLFFLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGVKFNDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEILQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITLGEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVIFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_011933123.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 ref|YP_001224939.1| cell division protein FtsH [Synechococcus sp. WH 7803]
 emb|CAK23642.1| Cell division protein FtsH [Synechococcus sp. WH 7803]
Length=637

 Score =   326 bits (835),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 193/421 (46%), Positives = 271/421 (64%), Gaps = 24/421 (6%)
 Frame = -2

Query  2028  LSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPE  1849
             L+RR  N       Q ++F ++K +  ++  TGV F+DVAG+ +A ++LQE+VT+LK PE
Sbjct  146   LARRSNNM-PGGPGQAMQFGKTKARFAMEAETGVMFDDVAGVNEAKQDLQEVVTFLKQPE  204

Query  1848  LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRD  1669
              F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RD
Sbjct  205   KFTSVGAQIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRD  264

Query  1668  LFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDT  1489
             LFKRAK N P +IFIDEIDA+  +R       +D        ERE TLNQLLTE+DGF+ 
Sbjct  265   LFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEG  316

Query  1488  GKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLT  1309
               G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH+R  KL   + L 
Sbjct  317   NSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHSRNKKLDPELSLD  376

Query  1308  SYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQG  1129
             S A+  PG++GA LA LL EAA++  R+   +I  S++DDAVDR+  G +  G  L   G
Sbjct  377   SIARRTPGFTGADLANLLNEAAILTARRRKETISLSEIDDAVDRIIAGME--GQPL-TDG  433

Query  1128  QCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFER  955
             + +R  A  EVG AL   L++ ++  +     ++++ PRGQ      F    DE  M   
Sbjct  434   RSKRLIAYHEVGHALVGTLVKDHDPVQ-----KVTLIPRGQAQGLTWFS--PDEEQMLVS  486

Query  954   RPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIH  784
             R QL  R+   LGGRAAE+V++GR + +  +   +     +AR+M+T + + N  PM++ 
Sbjct  487   RSQLKARIMGALGGRAAEDVVFGRSEVTTGAGGDIQQVASMARQMVTRFGMSNLGPMSLE  546

Query  783   G  781
             G
Sbjct  547   G  547



>ref|WP_024544588.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=628

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 268/422 (64%), Gaps = 18/422 (4%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK +  ++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLISGLFFLFRRSNNM-PGGPGQAMNFGKSKAKFMMEAQTGVMFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDTPDIKGRLNILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+E + L   A+  PG+SGA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  356   ARNKKLAEEISLDVIARRTPGFSGADLANLLNEAAILTARRRKEAITMAEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ +     +   ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDH-----DPVQKVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  470   --PNEEQGLTTKSQLMARISGALGGRAAEEEIFGHDEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NL  805
              +
Sbjct  528   GM  529



>ref|YP_009019579.1| ftsH protease-like protein (chloroplast) [Gracilaria salicornia]
 gb|AHH24547.1| ftsH protease-like protein (chloroplast) [Gracilaria salicornia]
Length=626

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 207/526 (39%), Positives = 318/526 (60%), Gaps = 36/526 (7%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++L    L RR  N       Q + FS+SK   +++  TG+ F DVAGI++A E
Sbjct  125   LLFPILLILGLAFLFRRSNN-SSGGPGQAMSFSKSKALFQMEAKTGIAFKDVAGIDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             E +E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEA VPF+ ++GSEFV
Sbjct  184   EFEEVVTFLKKPEKFTAVGAKIPKGVLLIGPPGTGKTLLAKAIAGEANVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCIVFIDEIDAVGRQRGTGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   GVI + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGVIVIAATNRADILDSALLRPGRFDRQVAVEIPDFKGRLDILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             A+  K+  ++ L+  A+  PG+SGA LA LL EAA++  R+    I  +++D ++DR+  
Sbjct  356   AKNKKMENSISLSIIARRTPGFSGADLANLLNEAAILTARRRKKYITLNEIDASIDRIVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTAL-IDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAKGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +D++ +   R Q++ R+   LGGRAAEEV++G  + +  + + L   T +AR+M+T +
Sbjct  470   PGEDQNLI--SRSQIISRIMGALGGRAAEEVVFGDTEVTTGASNDLQQVTSMARQMVTRF  527

Query  810   NLEN--PMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEAL  637
              + N  P+ +  E     ++  F+G  +   GS Y D   I+          + K+   +
Sbjct  528   GMSNIGPLCLESE-----EANPFLGRSMG-SGSEYSDEIAIK----------IDKQIYNI  571

Query  636   IRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILSNYPP  499
             + + Y  T+ +++ +   + + V +L++++ I GEE   I++ Y P
Sbjct  572   VEECYQATIKIIQDNRIVIDRLVDLLIEKETIDGEEFQEIINEYTP  617



>ref|WP_002778402.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI08595.1| ATP-dependent zinc metalloprotease FtsH 1 [Microcystis aeruginosa 
PCC 7941]
Length=631

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNLLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEVNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             +KGRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  349   SKGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  460   LIPRGQAQGLTWF--TPDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   EKITYLARQMVT  529



>ref|WP_012305983.1| cell division protein FtsH [Synechococcus sp. PCC 7002]
 ref|YP_001733615.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. PCC 7002]
 gb|ACA98359.1| ATP-dependent metalloprotease, FtsH family [Synechococcus sp. 
PCC 7002]
Length=628

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 275/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK +  ++  TG+ F+DVAGIE+A E
Sbjct  125   LIFPILLISALFFLFRRSSNM-PGGPGQAMNFGKSKAKFMMEAQTGIMFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDTPDIKGRLSILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL++ + L   A+  PG+SGA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  356   ARNKKLADEISLDVIARRTPGFSGADLANLLNEAAILTARRRKEAITMAEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  470   --PNEEQGLTTKSQLMARIAGALGGRAAEEEIFGHDEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_016516233.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa]
 gb|EPF20201.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
SPC777]
Length=631

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNLLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEVNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             +KGRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  349   SKGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  460   LIPRGQAQGLTWF--TPDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   EKITYLARQMVT  529



>ref|WP_016858941.1| cell division protein FtsH [Fischerella muscicola]
Length=628

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTVLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                 E      R Q+  R+   LGGRAAE+VI+GRD  +  + + L   + +AR+M+T +
Sbjct  470   --PSEEMGLITRSQIKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVSNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_009545756.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 ref|YP_001803369.1| cell division protein [Cyanothece sp. ATCC 51142]
 gb|ACB51303.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=636

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 186/414 (45%), Positives = 268/414 (65%), Gaps = 21/414 (5%)
 Frame = -2

Query  2043  LVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTY  1864
              V   + RR  N       Q + FS+S+ + +++  TG++F DVAGI++A EELQE+VT+
Sbjct  152   FVVIAIVRRSANVS----GQAMSFSKSRARFQMEAKTGISFTDVAGIDEAKEELQEVVTF  207

Query  1863  LKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGA  1684
             LK PE F  +G K P GVLL GPPG GKTL+AKA+AGEAGVPF+ ++GSEFVE+ VGVGA
Sbjct  208   LKEPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGA  267

Query  1683  ARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTEL  1504
             +R+RDLFK+AK N P +IFIDEIDA+  +R G+        Y     ERE TLNQLLTE+
Sbjct  268   SRVRDLFKKAKENAPCLIFIDEIDAVGRQR-GV-------GYGGGNDEREQTLNQLLTEM  319

Query  1503  DGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSE  1324
             DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGR GIL+VHAR  K+  
Sbjct  320   DGFEGNTGIIVIAATNRPDVLDKALMRPGRFDRQVMVDYPDFKGRQGILEVHARDKKIDS  379

Query  1323  TVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGID  1144
              V L + A+  PG++GA L+ LL EAA+   R+   +I  ++++DA+DR+  G +   + 
Sbjct  380   EVSLEAVARRTPGFTGADLSNLLNEAAIFTARRRKEAITMTEINDAIDRVVAGMEGTPL-  438

Query  1143  LGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYM  964
             +  + +   A  E+G AL + ++  +     +  +++++ PRGQ      F    DE   
Sbjct  439   VDSKSKRLIAYHEIGHALVASMMTGH-----DPVEKVTLIPRGQAKGLTWF--TPDEDSG  491

Query  963   FERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVWNL  805
                R QLL R+  LLGGR+AEEVI+G D  +  + + +   T+LAR+M+T + +
Sbjct  492   LVTRNQLLARIAGLLGGRSAEEVIFGDDEVTTGAGNDIEKVTYLARQMVTRFGM  545



>ref|WP_026719681.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=628

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTVLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                 E      R Q+  R+   LGGRAAE+VI+GRD  +  + + L   + +AR+M+T +
Sbjct  470   --PSEEMGLITRSQIKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVSNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_011242858.1| cell division protein FtsH [Synechococcus elongatus]
 ref|YP_171256.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 dbj|BAD78736.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
Length=632

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 266/400 (67%), Gaps = 19/400 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F DVAGIE+A EELQE+V++L++ + F  +G + P GVL
Sbjct  146   QALNFGKSRARFQMEAKTGVMFEDVAGIEEAKEELQEVVSFLRSSDRFTAVGARIPRGVL  205

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ M+GSEFVE+ VGVGA+R+RDLF++AK N P ++F
Sbjct  206   LVGPPGTGKTLLAKAIAGEAGVPFFSMSGSEFVEMFVGVGASRVRDLFRKAKENSPCIVF  265

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  266   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEENSGVIIIAATNRPD  317

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I +  P+  GRLGIL+VHAR  KL+E V L + A+  PG+SGA+L
Sbjct  318   VLDSALLRPGRFDRQITVDLPSYNGRLGILQVHARNKKLAEEVSLEAIARRTPGFSGAEL  377

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   ++  +D+DDA+DR+T+G     + L  Q +   A  E+G AL 
Sbjct  378   ANLLNEAAILTARRNKTAVDETDIDDAIDRVTIGMTLSPL-LDSQKKRLIAYHEIGHALL  436

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE---SYMFERRPQLLHRLQVLLG  916
               LL+H +       D+++I PR   +        ++E   S ++  R  L  R+ V LG
Sbjct  437   MTLLKHSDR-----LDKVTIIPRSGGIGGFAKPIPNEELIDSGLYS-RAWLRDRIVVALG  490

Query  915   GRAAEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN  799
             GRAAEEV++G  + ++ + S +   T LAR+MIT + + +
Sbjct  491   GRAAEEVVFGDAEVTQGAASDIEMITNLAREMITRYGMSD  530



>ref|WP_006199059.1| cell division protein FtsH [Nodularia spumigena]
 gb|EAW42816.1| Peptidase M41, FtsH [Nodularia spumigena CCY9414]
Length=628

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 195/433 (45%), Positives = 274/433 (63%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + ++D  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMDAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQITVDAPDIKGRLEVLQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I   ++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITIREIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKEHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
                DE      R QL  R+   LGGRAAEEV++G  + +  +   L   + +AR+M+T +
Sbjct  470   --PDEEQGLISRSQLKARITGALGGRAAEEVVFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_036399244.1| cell division protein FtsH [Microcystis aeruginosa]
Length=631

 Score =   325 bits (834),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 193/432 (45%), Positives = 278/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNVLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             +KGRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  349   SKGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  460   LIPRGQAQGLTWF--TPDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   EKITYLARQMVT  529



>ref|WP_015194229.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 ref|YP_007133529.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36563.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=629

 Score =   325 bits (833),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 280/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGI++A E
Sbjct  126   LVFPILLIAALFFLFRRSSNI-PGGPGQAMNFGKSRARFQMEAKTGVMFDDVAGIDEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKDNAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVIVDNPDIKGRLEILEVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             +R  KL+  + L + A+  PG+SGA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  357   SRNKKLAPEISLDAIARRTPGFSGADLANLLNEAAILTARRRKEAITMAEIDDAVDRVVA  416

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   L++ +     +   ++++ PRGQ      
Sbjct  417   GME--GTPL-VDGKSKRLIAYHEVGHAIVGTLIKDH-----DPVQKVTLIPRGQAQGLTW  468

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMIT  817
             F   +D+  +   + QL+ R+   +GGRAAEE I+G D  +  +   L   T +AR+M+T
Sbjct  469   FTPNEDQGLI--TKSQLMARIAGAMGGRAAEEEIFGYDEVTTGAGGDLQQVTEMARQMVT  526

Query  816   VWNLEN--PMTIHGE  778
              + + +  P+++ G+
Sbjct  527   RFGMSDLGPVSLEGQ  541



>ref|WP_015229408.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina]
 ref|YP_007171768.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50411.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina PCC 
8305]
Length=631

 Score =   325 bits (834),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 275/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAG+E+A E
Sbjct  126   LIFPVLLIGALFFLFRRSNN-AGGGPGQAMNFGKSRARFQMEAKTGVLFDDVAGVEEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P G LL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKQPERFTAVGAKIPKGALLIGPPGTGKTLMAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR+I +  P+ KGR+ IL VH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDTALLRPGRFDRQISVDAPDVKGRVSILNVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KLS  V L S A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  357   ARNKKLSPEVSLESIARRTPGFTGADLANLLNEAAILTARRRKDAITLAEIDDAVDRVVA  416

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   L++ ++  +     ++++ PRGQ      F 
Sbjct  417   GMEGTPL-VDSKSKRLIAYHEVGHAIIGTLVKDHDPVQ-----KVTLIPRGQAQGLTWF-  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
                +E  M   R QL  R+   LGGRAAEE ++G  + +  +   L   T +AR+M+T +
Sbjct  470   -TPNEEQMLISRSQLKARITGALGGRAAEEEVFGDAEVTSGAGGDLQQLTAMARQMVTRF  528

Query  810   NLEN--PMTIHGE  778
              + +  PM++  +
Sbjct  529   GMSDLGPMSLESQ  541



>ref|YP_009027610.1| putative plastid division protein [Pyropia perforata]
 gb|AGQ17141.1| putative plastid division protein [Pyropia perforata]
 gb|AIA19475.1| putative plastid division protein [Pyropia perforata]
Length=628

 Score =   325 bits (833),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 188/414 (45%), Positives = 267/414 (64%), Gaps = 22/414 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAG+E+A EE QE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGVEEAKEEFQEVVTFLKQPESFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGVIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL+VHA+  K+   V L + A+  P +SGA L
Sbjct  323   ILDSALLRPGRFDRQVSVDVPDFKGRLAILEVHAKNKKMEPKVSLETIARRTPSFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  N++  S++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKNAMTMSEIDTSIDRVVAGMEGTPL-IDSKSKRLIAYHEVGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL H++  +     ++++ PRGQ      F   DD+S +   R Q+L R+   LGGRA
Sbjct  442   GSLLEHHDPVQ-----KVTLIPRGQARGLTWFTPSDDQSLI--SRSQILARIVGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIH---GEPLPWR  763
             AEE+I+G  + +  + + L   T +AR+M+T + +    P+++    G+P   R
Sbjct  495   AEEIIFGDAEVTTGASNDLQQVTSMARQMVTRFGMSKIGPLSLESQGGDPFLGR  548



>ref|WP_011377820.1| cell division protein FtsH [Synechococcus elongatus]
 ref|YP_400015.1| FtsH peptidase [Synechococcus elongatus PCC 7942]
 gb|ABB57028.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD58451.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=632

 Score =   325 bits (833),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 266/400 (67%), Gaps = 19/400 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F DVAGIE+A EELQE+V++L++ + F  +G + P GVL
Sbjct  146   QALNFGKSRARFQMEAKTGVMFEDVAGIEEAKEELQEVVSFLRSSDRFTAVGARIPRGVL  205

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ M+GSEFVE+ VGVGA+R+RDLF++AK N P ++F
Sbjct  206   LVGPPGTGKTLLAKAIAGEAGVPFFSMSGSEFVEMFVGVGASRVRDLFRKAKENSPCIVF  265

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  266   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEENSGVIIIAATNRPD  317

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I +  P+  GRLGIL+VHAR  KL+E V L + A+  PG+SGA+L
Sbjct  318   VLDSALLRPGRFDRQITVDLPSYNGRLGILQVHARNKKLAEEVSLEAIARRTPGFSGAEL  377

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   ++  +D+DDA+DR+T+G     + L  Q +   A  E+G AL 
Sbjct  378   ANLLNEAAILTARRNKTAVDETDIDDAIDRVTIGMTLSPL-LDSQKKRLIAYHEIGHALL  436

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE---SYMFERRPQLLHRLQVLLG  916
               LL+H +       D+++I PR   +        ++E   S ++  R  L  R+ V LG
Sbjct  437   MTLLKHSDR-----LDKVTIIPRSGGIGGFAKPIPNEELIDSGLYS-RAWLRDRIVVALG  490

Query  915   GRAAEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN  799
             GRAAEEV++G  + ++ + S +   T LAR+MIT + + +
Sbjct  491   GRAAEEVVFGDAEVTQGAASDIEMITNLAREMITRYGMSD  530



>ref|WP_015160893.1| ATP-dependent metalloprotease FtsH [Chamaesiphon minutus]
 ref|YP_007098300.1| ATP-dependent metalloprotease FtsH [Chamaesiphon minutus PCC 
6605]
 gb|AFY94773.1| ATP-dependent metalloprotease FtsH [Chamaesiphon minutus PCC 
6605]
Length=628

 Score =   325 bits (833),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 190/408 (47%), Positives = 266/408 (65%), Gaps = 23/408 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + ++D  TGV F+DVAGI +A EELQE+VT+LK PE F  +G K P GVL
Sbjct  151   QAMNFGKSKAKFQMDAKTGVMFDDVAGIAEAKEELQEVVTFLKQPERFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQ+LTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGAGIGGGND--------EREQTLNQMLTEMDGFEGNTGIIIIAATNRPD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++++ PP+  GR+ IL VHAR  KL   + L + A+  PG+SGA L
Sbjct  323   VLDSALLRPGRFDRQVQVDPPDVAGRVEILNVHARNKKLGADISLDAIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+  ++I   ++DDAVDR+  G +  G  L   G+ +R  A  EVG A
Sbjct  383   ANLLNEAAILTARRRKDAITNLEIDDAVDRVVAGME--GTPL-VDGKSKRLIAYHEVGHA  439

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             + + L+  +     +   ++++ PRGQ      F   +D+S +   R QL  R+   LGG
Sbjct  440   IVATLIPAH-----DPLQKVTLIPRGQAAGLTWFTPAEDQSLI--SRTQLRARICGALGG  492

Query  912   RAAEEVIYG-RDTSKASVSYLADATWLARKMITVWNLE--NPMTIHGE  778
             RAAEE+I+G  + +  +   L   T +AR+M+T + +    P+++  +
Sbjct  493   RAAEEIIFGDSEVTTGAGGDLQQVTSMARQMVTRFGMSKLGPLSLESQ  540



>ref|WP_019474838.1| cell division protein FtsH, partial [Prochlorococcus sp. W2]
Length=504

 Score =   321 bits (823),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 185/407 (45%), Positives = 266/407 (65%), Gaps = 23/407 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F ++K +  ++  TGV F+DVAG+ +A ++L+E+VT+LK PE F  +G + P GVL
Sbjct  26    QAMQFGKTKARFAMEADTGVVFDDVAGVNEAKQDLEEVVTFLKKPEKFTSVGARIPKGVL  85

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  86    LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  145

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  146   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIIIAATNRPD  197

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL IL+VH+R  KL E + L S A+  PG++GA L
Sbjct  198   VLDSALMRPGRFDRQVTVDAPDIKGRLSILQVHSRNKKLDENLTLESIARRTPGFTGADL  257

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+  N I  S++DD+VDR+  G +  G  L   G+ +R  A  EVG A
Sbjct  258   ANLLNEAAILTARRRKNCISISEIDDSVDRIIAGME--GSPL-TDGRSKRLIAYHEVGHA  314

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             +   L++ ++  +     ++++ PRGQ      F   D++S +   R QL  R+   LGG
Sbjct  315   IIGSLVKAHDPVQ-----KVTVIPRGQAKGLTWFTPDDEQSLI--SRAQLKARIMGALGG  367

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHG  781
             RAAE+V++G  + +  +         +AR+M+T + + N  P+ + G
Sbjct  368   RAAEDVVFGEGEITTGAGGDFQQVASMARQMVTRFGMSNLGPIALEG  414



>ref|WP_006668579.1| MULTISPECIES: cell division protein FtsH [Arthrospira]
 gb|EDZ96177.1| ATP-dependent metalloprotease FtsH [Arthrospira maxima CS-328]
 emb|CCE18650.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
 emb|CDM97372.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
Length=629

 Score =   325 bits (833),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 278/433 (64%), Gaps = 24/433 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  ++++  F L RR  N       Q + F +SK +  ++  TGV F+DVAG+E+A E
Sbjct  126   LVFPILLIVGLFFLFRRSNNV-PGGPGQAMNFGKSKARFSMEAKTGVLFDDVAGVEEAKE  184

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  185   ELQEVVTFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  244

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK   P ++FIDEIDA+  +R       +D        ERE T
Sbjct  245   EMFVGVGASRVRDLFKKAKETAPCIVFIDEIDAVGRQRGAGIGGGND--------EREQT  296

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  297   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVIVDAPDIKGRLSVLEVH  356

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL++ V L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  357   ARNKKLADQVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITMAEIDDAVDRVVA  416

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  E+G A+   L++ ++  +     ++++ PRGQ      
Sbjct  417   GME--GTPL-LDGKTKRLIAYHEIGHAIVGTLIKDHDPVQ-----KVTLVPRGQARGLTW  468

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMIT  817
             F  + DE      R Q+L R+   LGGRAAE+VI+G  + +  +   L     +AR+M+T
Sbjct  469   F--MPDEDQGLISRSQILARITGALGGRAAEDVIFGDAEVTTGAGGDLQQVAGMARQMVT  526

Query  816   VWNLEN--PMTIH  784
              + + +  P+++ 
Sbjct  527   RYGMSDLGPLSLE  539



>ref|WP_026082835.1| cell division protein FtsH [Mastigocladopsis repens]
Length=628

 Score =   325 bits (833),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPILLITGLFLLFRRSSNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +LKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVMVDAPDVKGRLDVLKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL   V L + A+  PG++GA LA LL EAA++  R+  + I   ++DDAVDR+  
Sbjct  356   ARNKKLDPGVSLEAIARRTPGFTGADLANLLNEAAILTARRRKDGITNVEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALAGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  + + L   + +AR+M+T +
Sbjct  470   PNEEQGLI--TRGQLKARITGALGGRAAEEVIFGSAEVTTGAGNDLQQVSNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPISLESQ  540



>ref|WP_011319922.1| cell division protein FtsH [Anabaena variabilis]
 ref|YP_323693.1| FtsH peptidase [Anabaena variabilis ATCC 29413]
 gb|ABA22798.1| membrane protease FtsH catalytic subunit [Anabaena variabilis 
ATCC 29413]
Length=628

 Score =   325 bits (833),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPILLITGLFFLFRRSNNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  S++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLSEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEE+I+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEIIFGSAEVTTGAGGDLQQVSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>gb|EAZ93206.1| cell division protein; FtsH [Cyanothece sp. CCY0110]
Length=621

 Score =   325 bits (832),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 183/395 (46%), Positives = 263/395 (67%), Gaps = 17/395 (4%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + FS+S+ + +++  TG++F DVAGI++A EELQE+VT+LK  E F  +G K P GVL
Sbjct  151   QAMSFSKSRARFQMEAKTGISFTDVAGIDEAKEELQEVVTFLKESEKFTAIGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKA+AGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  211   LIGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R G+        Y     ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQR-GV-------GYGGGNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRPD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGR GIL+VHAR  K+ E V L + A+  PG++GA L
Sbjct  323   VLDKALMRPGRFDRQVMVDYPDFKGRQGILEVHARDKKIDEEVSLEAIARRTPGFTGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             + LL EAA+   R+   +I  ++++DA+DR+  G +   + +  + +   A  E+G AL 
Sbjct  383   SNLLNEAAIFTGRRRKEAITMAEINDAIDRVVAGMEGTPL-VDSKSKRLIAYHEIGHALV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
             + ++  ++       +++++ PRGQ      F    DE      R QLL R+  LLGGRA
Sbjct  442   ATVMTGHDR-----VEKVTLIPRGQAKGLTWF--TPDEDSGLVTRNQLLARIAGLLGGRA  494

Query  906   AEEVIYGRD-TSKASVSYLADATWLARKMITVWNL  805
             AEEVI+G D  +  + + +   T+LAR+M+T + +
Sbjct  495   AEEVIFGEDEVTTGAGNDIEKVTYLARQMVTRFGM  529



>emb|CDN10469.1| Cell division protein FtsH [Richelia intracellularis]
Length=616

 Score =   324 bits (831),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  ++++  F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  113   LLFPILLIVGLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMEAKTGVMFDDVAGIEEAKE  171

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEA VPF+ ++GSEFV
Sbjct  172   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAAVPFFSISGSEFV  231

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  232   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  283

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  284   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVMVDAPDIKGRLEVLRVH  343

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  344   ARNKKLDPSVSLDTIARRTPGFTGADLANLLNEAAILTARRRKEAITLTEIDDAVDRVVA  403

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  404   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKEHDPVQ-----KVTLIPRGQAQGLTWFT  457

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+G  + +  + + L   T +AR+M+T +
Sbjct  458   PNEEQGLI--TRGQLKARITGALGGRAAEDVIFGDAEVTTGAGNDLQQVTGMARQMVTRF  515

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  516   GMSDLGPLSLESQ  528



>ref|WP_035986767.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=628

 Score =   325 bits (832),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 184/404 (46%), Positives = 269/404 (67%), Gaps = 19/404 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK +  ++  TGV F+DVAGI++A EELQE+VT+LK PE F  +G + P GVL
Sbjct  151   QAMNFGKSKARFMMEAKTGVMFDDVAGIDEAKEELQEVVTFLKKPERFTAIGARIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  211   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR+D
Sbjct  271   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRVD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ + PP+ KGR+ IL+VHAR  KLSE + L + A+  PG++GA L
Sbjct  323   VLDSALLRPGRFDRQVMVDPPDIKGRIEILEVHARNKKLSEDISLEAIARRTPGFTGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+  +++  +++DDAVDR+  G +   + +  + +   A  E+G A+ 
Sbjct  383   ANLLNEAAILTARRRKDAMTMAEVDDAVDRVIAGMEGTPL-VDSKSKRLIAYHEIGHAII  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               L++ ++  +     ++++ PRGQ      F     E  M   R Q+L R+   LGGRA
Sbjct  442   GTLVKDHDPVQ-----KVTLIPRGQAQGLTWFT--PSEEQMLISRAQILARITGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIH  784
             AE+VI+G  + +  + + L   + +AR+M+T + + +  P+++ 
Sbjct  495   AEDVIFGDAEVTTGAGNDLQQVSNMARQMVTRFGMSDLGPLSLE  538



>ref|WP_015137807.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
 ref|YP_007074951.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
 gb|AFY47354.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
Length=628

 Score =   325 bits (832),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSNNI-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITLGEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+G  + +  +   L   T +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEDVIFGAAEVTTGAGGDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_015130520.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
 ref|YP_007067555.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
 gb|AFY34721.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
Length=629

 Score =   325 bits (832),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 195/457 (43%), Positives = 282/457 (62%), Gaps = 29/457 (6%)
 Frame = -2

Query  2139  FAKFYQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSK  1960
             FA+     +   +   I ++  + LV L ++ L      RR  N       Q + F +S+
Sbjct  112   FAEVSSANSRAAVGLLINLMWILPLVALMLLFL------RRSTNASS----QAMNFGKSR  161

Query  1959  PQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGK  1780
              + +++  TGV F+DVAG+E+A EELQE+VT+LK PE F  +G + P GVLL GPPG GK
Sbjct  162   ARFQMEAKTGVKFDDVAGVEEAKEELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGK  221

Query  1779  TLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALAT  1600
             TL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  
Sbjct  222   TLLAKAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCLIFIDEIDAVGR  281

Query  1599  KRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRP  1420
             +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRP
Sbjct  282   QRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDTALLRP  333

Query  1419  GRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaal  1240
             GRFDR++ +  P+ KGRL ILKVHAR  K+  +V L + A+  PG++GA LA LL EAA+
Sbjct  334   GRFDRQVMVDAPDLKGRLEILKVHARNKKIDPSVSLEAIARRTPGFTGADLANLLNEAAI  393

Query  1239  vaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYEN  1060
             +  R+   +I   ++DDAVDR+  G +   + +  + +   A  EVG AL   LL+ +  
Sbjct  394   LTARRRKEAITILEIDDAVDRVVAGMEGTAL-VDSKSKRLIAYHEVGHALIGTLLKDH--  450

Query  1059  AKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-  883
                +   ++++ PRGQ L    F    +E      R QL  R+   LGGRAAEE+++G+ 
Sbjct  451   ---DPVQKVTLIPRGQALGLTWFT--PNEEQGLVSRSQLKARITATLGGRAAEEIVFGKP  505

Query  882   DTSKASVSYLADATWLARKMITVWNLE--NPMTIHGE  778
             + +  + + L   T +AR+M+T + +    P+++  +
Sbjct  506   EVTTGAGNDLQQVTNMARQMVTRFGMSELGPLSLESQ  542



>ref|WP_015173264.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
 ref|YP_007110752.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
 gb|AFY67700.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
Length=635

 Score =   325 bits (833),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 198/433 (46%), Positives = 283/433 (65%), Gaps = 25/433 (6%)
 Frame = -2

Query  2085  VLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAG  1906
             ++  +LLVFL ++ L+   + RR  N       Q + F +S+ + +++  TGV F+DVAG
Sbjct  127   LIANLLLVFLLIIGLM--MILRRSTNASN----QAMNFGKSRARFQMEAKTGVMFDDVAG  180

Query  1905  IEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQM  1726
             IE+A EELQE+V++LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ +
Sbjct  181   IEEAKEELQEVVSFLKKPERFTAIGAKIPRGVLLVGPPGTGKTLLAKAIAGEAGVPFFSI  240

Query  1725  AGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAAT  1546
             +GSEFVE+ VGVGA+R+RDLFK+AK + P ++FIDEIDA+  +R       +D       
Sbjct  241   SGSEFVEMFVGVGASRVRDLFKKAKESAPCIVFIDEIDAVGRQRGAGIGGGND-------  293

Query  1545  QERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRL  1366
              ERE TLNQLLTE+DGF+   GVI + ATNR D+LD ALLRPGRFDR++ +  P  +GRL
Sbjct  294   -EREQTLNQLLTEMDGFEGNAGVIIIAATNRPDVLDTALLRPGRFDRQVIVDLPGYQGRL  352

Query  1365  GILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDA  1186
             GIL+VHAR  KLS  V L + A+  PG+SGA+LA LL EAA++  R+  ++I   ++DDA
Sbjct  353   GILEVHARNKKLSSDVSLEAIARRTPGFSGAELANLLNEAAILTARRRKDAITPLEVDDA  412

Query  1185  VDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTL  1006
             +DR+T+G     + L  + +   A  EVG AL   LL      K +  D+++I PR   +
Sbjct  413   IDRVTIGLSLTPL-LDSKKKRIIAYHEVGHALLMTLLE-----KSDILDKVTIIPRSGGI  466

Query  1005  ---SQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATW  838
                ++ V +    +S ++  R  L+ R+ V LGGRA EEV++G  + ++ + S +   T 
Sbjct  467   GGFAKPVPNEDIIDSGLYS-RSWLMDRITVALGGRAIEEVVFGAEEVTQGASSDIEYVTN  525

Query  837   LARKMITVWNLEN  799
             LAR+M+T + + +
Sbjct  526   LAREMVTRYGMSD  538



>gb|AHE96232.1| ATP-dependent metalloprotease [Thermocrinis ruber]
Length=624

 Score =   325 bits (832),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 261/391 (67%), Gaps = 15/391 (4%)
 Frame = -2

Query  1974  FSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGP  1795
             F +S+ +  +D    VT NDVAG+++  EE++E++ YLK+P  F K+G +PP GVLL G 
Sbjct  139   FGKSRAKVYIDEKPKVTLNDVAGMDEVKEEVKEIIEYLKDPIRFQKLGGRPPKGVLLYGE  198

Query  1794  PGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEI  1615
             PG GKTL+AKAIAGEA VPF  ++GS+FVE+ VGVGAAR+RDLF+ AK + P +IFIDEI
Sbjct  199   PGVGKTLLAKAIAGEAHVPFISVSGSDFVEMFVGVGAARVRDLFETAKKHAPCIIFIDEI  258

Query  1614  DALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDP  1435
             DA+   R G FN            ERE TLNQLL E+DGFDT +G+I + ATNR D+LDP
Sbjct  259   DAVGRSR-GAFN------LGGGHDEREQTLNQLLVEMDGFDTSEGIIVIAATNRPDILDP  311

Query  1434  ALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqll  1255
             ALLRPGRFDR+I I  P+ +GR  ILKVHAR  KL+  VDL   A+  PG++GA L  +L
Sbjct  312   ALLRPGRFDRQIYIPKPDVRGRYEILKVHARNKKLAPNVDLEIVARATPGFNGADLENIL  371

Query  1254  qeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLL  1075
              EAAL+A RKG   I   D+++A+DR+T+G +R G+ +  + + + A  E G A+ S ++
Sbjct  372   NEAALLAARKGKEYIEMEDIEEAIDRVTMGLERKGMVISPKEKEKIAYHEAGHAIMSLMV  431

Query  1074  RHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEV  895
                     +   ++SI PRG  L       +DD+ +M++R+  L+ RL VL GGRAAEEV
Sbjct  432   -----PGSDALHKVSIIPRGMALGVTQQLPIDDK-HMYDRQ-DLMGRLIVLFGGRAAEEV  484

Query  894   IYGRD-TSKASVSYLADATWLARKMITVWNL  805
              YG++  +  + + L  AT LA +M+++W +
Sbjct  485   FYGKEGITTGAENDLQRATELAYRMVSMWGM  515



>ref|WP_009343692.1| cell division protein FtsH [Raphidiopsis brookii]
 gb|EFA72418.1| Peptidase M41, FtsH [Raphidiopsis brookii D9]
Length=635

 Score =   325 bits (832),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 261/399 (65%), Gaps = 21/399 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F+DVAGI +A EELQE+VT+L+ PE F  +G K P GVL
Sbjct  162   QALNFGRSRARFQMEAKTGVKFDDVAGITEAKEELQEVVTFLQQPEKFTAVGAKIPKGVL  221

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  222   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  281

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  282   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNNGIIIIAATNRPD  333

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL VHAR  KL  T+ L   AQ  PG++GA L
Sbjct  334   VLDSALLRPGRFDRQVIVDAPDLKGRLDILAVHARNKKLDPTISLEEIAQRTPGFTGADL  393

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+    I   +++DAVDR+  G +   +     G+ +R  A  EVG A
Sbjct  394   ANLLNEAAILTARRRKEEITMLEINDAVDRVVAGMEGTAL---VDGKSKRLIAYHEVGHA  450

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             L   L++ ++  +     ++++ PRGQ L    F   +D+  +   R Q+L R+   LGG
Sbjct  451   LVGTLVKDHDPVQ-----KVTLIPRGQALGLTWFTPNEDQGLV--SRSQMLARIMGALGG  503

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             RAAEE+++G+ + +  + + L   T +AR+M+T + + +
Sbjct  504   RAAEEIVFGKAEVTTGAGNDLQQVTTMARQMVTRFGMSD  542



>ref|WP_029956900.1| cell division protein FtsH, partial [Prochlorococcus sp. scB241_527L16]
Length=518

 Score =   321 bits (823),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 191/418 (46%), Positives = 267/418 (64%), Gaps = 21/418 (5%)
 Frame = -2

Query  2049  VLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELV  1870
             +L+    L  R  N       Q ++F ++K +  ++  TGV F+DVAG+ +A +ELQE+V
Sbjct  19    ILIGGLILLARRSNGMPGGPGQAMQFGKTKARFAMEAETGVVFDDVAGVNEAKQELQEVV  78

Query  1869  TYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGV  1690
             T+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGV
Sbjct  79    TFLKKPEKFTSVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGV  138

Query  1689  GAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLT  1510
             GA+R+RDLFKRAK N P +IFIDEIDA+  +R       +D        ERE TLNQLLT
Sbjct  139   GASRVRDLFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND--------EREQTLNQLLT  190

Query  1509  ELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKL  1330
             E+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VHAR  KL
Sbjct  191   EMDGFEGNSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHARNKKL  250

Query  1329  SETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVG  1150
              E + L S A+  PG++GA LA LL EAA++  R+  +SI  S++DD+VDR+  G +  G
Sbjct  251   QEDLTLESIARRTPGFTGADLANLLNEAAILTARRRKDSISISEIDDSVDRIVAGME--G  308

Query  1149  IDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDD  976
               L   G+ +R  A  EVG AL   L++ ++  +     ++++ PRGQ      F   DD
Sbjct  309   SPL-TDGRSKRLIAYHEVGHALIGSLVKAHDPVQ-----KVTVIPRGQAKGLTWFTP-DD  361

Query  975   ESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNL  805
             E  +   R QL  R+   LGGRAAE+V++G  + +  +         +AR+M+T + +
Sbjct  362   EQTLVS-RAQLKARIMGALGGRAAEDVVFGEGEITTGAGGDFQQVASMARQMVTRFGM  418



>ref|WP_015193120.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 ref|YP_007132415.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ35449.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=647

 Score =   325 bits (833),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 192/447 (43%), Positives = 284/447 (64%), Gaps = 25/447 (6%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             +A++ +L  + +VFL +  LV   + RR  +       Q   F +S+ + +++  TG+ F
Sbjct  139   TAAVGILLNLFIVFLLLAGLV--MIIRRSASAS----GQAFNFGKSRARFQMEAKTGIQF  192

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
              DVAGIE+A EELQE+VT+LK PE F  +G K P G+LL GPPG GKTL+AKAIAGEAGV
Sbjct  193   GDVAGIEEAKEELQEIVTFLKQPEKFTAIGAKIPRGMLLVGPPGTGKTLLAKAIAGEAGV  252

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++AK N P +IFIDEIDA+  +R       +D  
Sbjct  253   PFFSISGSEFVEMFVGVGASRVRDLFRKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--  310

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
                   ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  311   ------EREQTLNQLLTEMDGFEGNAGIIVIAATNRPDVLDSALLRPGRFDRQVMVDYPD  364

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              +GRLGIL+VHAR  K++  + L + A+  PG+SGA LA LL EAA++  R+  ++I   
Sbjct  365   FEGRLGILEVHARNKKVAPEISLDAIARRTPGFSGADLANLLNEAAILTARRRKDAITML  424

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             +++DA+DR+  G +   + +  + +   A  EVG AL + L+  +     +  +++++ P
Sbjct  425   EINDAIDRVVAGMEGASL-VDSKAKRLIAYHEVGHALVATLIPDH-----DPLEKVTLIP  478

Query  1020  RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADA  844
             RGQ      F    DE      + Q+L  +   LGGRAAEE+I+G  + +  + + L   
Sbjct  479   RGQAKGLTWFT--PDEEQGLITKNQILAMITSTLGGRAAEEIIFGDSEITTGASNDLEKV  536

Query  843   TWLARKMITVWNLEN--PMTIHGEPLP  769
             T LAR+M+T + + +  P+ + G+  P
Sbjct  537   TSLARQMVTKFGMSDLGPLALEGQEQP  563



>ref|WP_016869882.1| cell division protein FtsH [Fischerella muscicola]
Length=628

 Score =   324 bits (831),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEGITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   +L+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTVLKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                 E      R Q+  R+   LGGRAAE+VI+GRD  +  + + L   + +AR+M+T +
Sbjct  470   --PSEEMGLITRSQIKARITGALGGRAAEDVIFGRDEITTGAGNDLQQVSNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_022847537.1| ATP-dependent metalloprotease [Desulfurobacterium sp. TC5-1]
Length=628

 Score =   324 bits (831),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 210/536 (39%), Positives = 313/536 (58%), Gaps = 47/536 (9%)
 Frame = -2

Query  2073  ILLVFLTMVLLVRFTLSRRPKNFRKWDIW--QGIEFSQSKPQARVDGMTGVTFNDVAGIE  1900
             +L+ +L M+ L+   +S      R+ +    + + F++S+ +  +D    VTF DVAGI+
Sbjct  107   VLVSWLPMIFLIVIWISM----MRQMNAGGSKALSFAKSRAKIFIDNKPKVTFKDVAGID  162

Query  1899  QAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAG  1720
             +  EE+ E+V +L+NP+ + ++G K P G+LL G PG GKTL+AKAIAGEA VPF  ++G
Sbjct  163   EIKEEVAEIVEFLRNPKKYQQLGGKIPKGILLAGAPGTGKTLLAKAIAGEANVPFLSVSG  222

Query  1719  SEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQE  1540
             SEFVE+ VGVGA+R+RDLF +AK N P ++FIDEIDA+  KR   F    D        E
Sbjct  223   SEFVEMFVGVGASRVRDLFDQAKKNAPCIVFIDEIDAVGRKRGAGFTGGHD--------E  274

Query  1539  RETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGI  1360
             RE TLNQLL E+DGF++ +G+I +GATNR D+LD ALLRPGRFDR+I +  P+ KGRL I
Sbjct  275   REQTLNQLLVEMDGFESNEGIIVIGATNRPDILDRALLRPGRFDRQIYVPLPDVKGRLEI  334

Query  1359  LKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVD  1180
             LK+H +   L+E VDL   A++ PG+SGA LA ++ EAAL+A RKGH  I+  D ++A D
Sbjct  335   LKIHTKNKPLAEDVDLEVIARSTPGFSGADLANIVNEAALIAARKGHGKIMMEDFEEAKD  394

Query  1179  RLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQ  1000
             ++T+G +R  + L  + +   A  E G  L + LL + +        +++I PRG+ L  
Sbjct  395   KVTMGIERKSMVLNEREKITTAYHEAGHTLVAKLLPNADR-----VHKVTIIPRGKALG-  448

Query  999   VVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMI  820
             +     +D+ Y + +   LL +L VL GGR AEEV  G  ++ A  + +  AT +ARKM+
Sbjct  449   ITQQLPEDDKYTYTKE-YLLDKLCVLFGGRVAEEVALGTISTGAG-NDIERATEIARKMV  506

Query  819   TVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEA  640
               W +   +     P+  +   +F  P                  ++ DL   V K  + 
Sbjct  507   AEWGMSEKIG----PIAIKMKEQFGEPT---------------EIVSEDLKRLVDKEVKR  547

Query  639   LIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFILS------NYPPHTP  490
             +I +TY K   L+  +   L    K LL+++ ++GEEID  ++        PP  P
Sbjct  548   IITETYEKAKELITNNFEKLENLAKALLERETLTGEEIDLAMNGELSSEKKPPENP  603



>ref|WP_039716067.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18552.1| cell division protein FtsH [Scytonema millei VB511283]
Length=628

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/424 (45%), Positives = 276/424 (65%), Gaps = 18/424 (4%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TG+ F+DVAGI++A E
Sbjct  125   LIFPVLLIGGLFFLFRRSSNI-PGGPGQALNFGKSRARFQMEAKTGIKFDDVAGIDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+ETV L + ++  PG++GA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  356   ARNKKLAETVSLEAISRRTPGFTGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   L++ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALIGTLIKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE++I+G  + +  + + L   T +AR+M+T +
Sbjct  470   PSEEQGLI--SRSQLKARISGALGGRAAEDIIFGTAEVTTGAGNDLQQVTGMARQMVTKF  527

Query  810   NLEN  799
              + +
Sbjct  528   GMSD  531



>ref|WP_022485169.1| aTP-dependent metallopeptidase HflB [Fusobacterium sp. CAG:815]
 emb|CDE91543.1| aTP-dependent metallopeptidase HflB [Fusobacterium sp. CAG:815]
Length=634

 Score =   325 bits (832),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 196/446 (44%), Positives = 273/446 (61%), Gaps = 25/446 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK +  +D     TF DVAGI++  +EL+E+V +LKN E + K+G K P GVL
Sbjct  163   QAMSFGKSKAKMLLDSKVKTTFKDVAGIDEEKKELEEIVDFLKNGEKYMKLGAKIPKGVL  222

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKA+AGEA VPF+ ++GS+FVE+ VGVGA+R+RDLF++AK ++P +IF
Sbjct  223   LVGPPGTGKTLMAKAVAGEASVPFFSISGSDFVEMFVGVGASRVRDLFEQAKKHQPCIIF  282

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R        D        ERE TLNQLL E+DGFD    +I + ATNR D
Sbjct  283   IDEIDAVGRQRGAGLGGGHD--------EREQTLNQLLVEMDGFDVNTNIIVIAATNRPD  334

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR+I I  P+ KGR  IL+VHA+  KL + VDL   A+  PG++GA L
Sbjct  335   ILDNALLRPGRFDRQIYINAPDVKGREQILEVHAKNKKLDKDVDLKVLAKRTPGFTGADL  394

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
               LL E+AL+A RKG + I   D+D ++DR+  G ++    L  + +   +  EVG AL 
Sbjct  395   QNLLNESALLAARKGEDKISMDDVDSSIDRVIAGVEKRSKVLTDKDKELTSYHEVGHALI  454

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL            ++SI PRG  L  V + R  DES     + +LL ++ V LGGRA
Sbjct  455   DKLLPDANE-----LHKVSIIPRGMALG-VTWTRPKDESVHVS-KAKLLAKITVSLGGRA  507

Query  906   AEEVIYGR-DTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLD  730
             AEE+IYG+ D S  +   L + T +ARKM+T W +   +     P+ + K+ + V    D
Sbjct  508   AEEIIYGQDDVSTGASQDLINVTDIARKMVTAWGMSEKLG----PMAYGKNQENVFMGRD  563

Query  729   FEGSLYDDYDLIEPPLNFDLDDDVSK  652
             F      DY      + F++D+++ K
Sbjct  564   F--GHQRDY---SEQVAFEIDEEIKK  584



>ref|WP_035798335.1| cell division protein FtsH [Cyanothece sp. CCY0110]
Length=637

 Score =   325 bits (832),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 186/407 (46%), Positives = 266/407 (65%), Gaps = 21/407 (5%)
 Frame = -2

Query  2022  RRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELF  1843
             RR  N       Q + FS+S+ + +++  TG++F DVAGI++A EELQE+VT+LK  E F
Sbjct  159   RRSANMS----GQAMSFSKSRARFQMEAKTGISFTDVAGIDEAKEELQEVVTFLKESEKF  214

Query  1842  DKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLF  1663
               +G K P GVLL GPPG GKTL+AKA+AGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLF
Sbjct  215   TAIGAKIPKGVLLIGPPGTGKTLLAKAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLF  274

Query  1662  KRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGK  1483
             K+AK N P +IFIDEIDA+  +R G+        Y     ERE TLNQLLTE+DGF+   
Sbjct  275   KKAKENAPCLIFIDEIDAVGRQR-GV-------GYGGGNDEREQTLNQLLTEMDGFEGNT  326

Query  1482  GVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSY  1303
             G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGR GIL+VHAR  K+ E V L + 
Sbjct  327   GIIVIAATNRPDVLDKALMRPGRFDRQVMVDYPDFKGRQGILEVHARDKKIDEEVSLEAI  386

Query  1302  AQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQC  1123
             A+  PG++GA L+ LL EAA+   R+   +I  ++++DA+DR+  G +   + +  + + 
Sbjct  387   ARRTPGFTGADLSNLLNEAAIFTGRRRKEAITMAEINDAIDRVVAGMEGTPL-VDSKSKR  445

Query  1122  RRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQL  943
               A  E+G AL + ++  ++       +++++ PRGQ      F    DE      R QL
Sbjct  446   LIAYHEIGHALVATVMTGHDR-----VEKVTLIPRGQAKGLTWF--TPDEDSGLVTRNQL  498

Query  942   LHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVWNL  805
             L R+  LLGGRAAEEVI+G D  +  + + +   T+LAR+M+T + +
Sbjct  499   LARIAGLLGGRAAEEVIFGEDEVTTGAGNDIEKVTYLARQMVTRFGM  545



>ref|WP_015163831.1| membrane protease FtsH catalytic subunit [Pseudanabaena sp. PCC 
7367]
 ref|YP_007101285.1| membrane protease FtsH catalytic subunit [Pseudanabaena sp. PCC 
7367]
 gb|AFY68857.1| membrane protease FtsH catalytic subunit [Pseudanabaena sp. PCC 
7367]
Length=628

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 210/503 (42%), Positives = 306/503 (61%), Gaps = 46/503 (9%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F +SK +  +D  TG+ F+DVAGIE+A EELQE+V +LK PE F  +G K P GVL
Sbjct  150   QAMDFGKSKARFSMDASTGIKFDDVAGIEEAKEELQEIVGFLKKPERFTAVGAKIPKGVL  209

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK + P +IF
Sbjct  210   LIGPPGTGKTLLAKAIAGEAGVPFFSVSGSEFVEMFVGVGASRVRDLFKKAKESAPCIIF  269

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             +DEIDA+  +R       +D        ERE TLNQ+LTE+DGF+   G+I + ATNR D
Sbjct  270   VDEIDAVGRQRGAGIGGGND--------EREQTLNQILTEMDGFEGNTGIIVIAATNRPD  321

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL VHAR  K++E V L S A+  PG++GA L
Sbjct  322   VLDAALLRPGRFDRQVTVDAPDMKGRLQILHVHARGKKIAEDVSLDSIARRTPGFTGADL  381

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCR-RATTEVGTAL  1090
             + LL EAA++  R+  ++I   ++DDAVDR+  G +  G  L      R  A  EVG A+
Sbjct  382   SNLLNEAAILTARRRKDAITLLEIDDAVDRVIAGLE--GKPLVDSKYKRIIAYHEVGHAI  439

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
                L++ ++  +     ++++ PRGQ      F     E  M   R Q+L R+   LGGR
Sbjct  440   VGSLIKEHDPVQ-----KVTLIPRGQAAGLTWFA--PSEEQMLISRAQILARITGALGGR  492

Query  909   AAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN---PMTIHGEPLPWRKSPKFVG  742
             AAEE ++G  + +  + + L   T +AR+M+T + + +   P+++ G+      S  F+G
Sbjct  493   AAEEAVFGHGEVTTGAGNDLQQVTGMARQMVTRFGMSDVIGPLSLEGQ-----SSQVFLG  547

Query  741   PRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRD----TYAKTlallrqhhaallk  574
                          DL+      +  +D+S R +  +RD     Y K L ++  +  A+ +
Sbjct  548   ------------RDLMS---RSEFSEDISSRVDNQVRDIVNSCYNKALQIMNDNREAIDR  592

Query  573   tvkvllkqKEISGEEIDFILSNY  505
              V +L++++ I GEE   IL+ Y
Sbjct  593   VVDILVEKESIDGEEFRQILAEY  615



>ref|WP_017292732.1| cell division protein FtsH [Geminocystis herdmanii]
Length=626

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 268/423 (63%), Gaps = 20/423 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK +  ++  TG+ F+DVAGI++A E
Sbjct  123   LVFPVLLIGSLFFLFRRSSNM-PGGPGQAMNFGKSKARFMMEAKTGIMFDDVAGIDEAKE  181

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  182   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  241

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  242   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  293

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ + PP+ KGRLG+L VH
Sbjct  294   LNQLLTEMDGFEGNTGIIVIAATNRADVLDSALMRPGRFDRQVMVDPPDFKGRLGVLDVH  353

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K++ +V L + A+  PG+SGA LA LL EAA++  R+    I  S++D AVDR+  
Sbjct  354   ARNKKIASSVSLEAIARRTPGFSGADLANLLNEAAILTARRRKPEITISEIDAAVDRVIA  413

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  EVG A+   LL+ ++  +     ++++ PRGQ      F
Sbjct  414   GME--GTPLVDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF  466

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITV  814
                 +E      + QL+ R+   +GGRAAEE ++G D  +  +   L   T +AR+M+T 
Sbjct  467   T--PNEEQGLTTKAQLMARIAGAMGGRAAEEEVFGHDEVTTGAGGDLQQVTGMARQMVTR  524

Query  813   WNL  805
             + +
Sbjct  525   FGM  527



>ref|YP_008144816.1| ATP-dependent zinc metalloprotease FtsH [Grateloupia taiwanensis]
 gb|AGO19769.1| ATP-dependent zinc metalloprotease FtsH [Grateloupia taiwanensis]
Length=626

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 199/499 (40%), Positives = 310/499 (62%), Gaps = 35/499 (7%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q I F +SK   +++  TGV F+DVAGI++A EE +E+VT+LK PE F  +G K P GVL
Sbjct  151   QAISFGKSKALFQMEAKTGVVFDDVAGIDEAKEEFEEVVTFLKQPECFTAVGAKIPKGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEANVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGTGVGGGND--------EREQTLNQLLTEMDGFEGNTGIIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL VHAR  K+ +++ L+  A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVAVEVPDFKGRLAILNVHARNKKMDDSISLSMIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   +I  +++D ++DR+  G +   + +  + +   A  EVG A+ 
Sbjct  383   ANLLNEAAILTARRRKKAITLNEVDASIDRIVAGMEGTPL-IDSKSKRLIAYHEVGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL+ ++  +     ++++ PRGQ      F   +D+S +   R Q++ R+   LGGRA
Sbjct  442   GTLLKDHDPVQ-----KVTLIPRGQARGLTWFTPSEDQSLI--SRSQIISRIMGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIHGEPLPWRKSPKFVGPR  736
             AEEV++G  + +  + + L   T +AR+M+T + +    P+++  E     ++  F+G  
Sbjct  495   AEEVVFGDAEVTTGASNDLQQVTSMARQMVTRFGMSTIGPLSLESE-----ETNPFLGRG  549

Query  735   LDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvll  556
             +    S Y D   I+          + ++ ++++ + + KT  ++R +   + + V +L+
Sbjct  550   MG-SSSEYSDEIAIK----------IDQQIQSIVEECHKKTTQIIRDNRVVIDRLVDLLI  598

Query  555   kqKEISGEEIDFILSNYPP  499
             +++ I+GEE   I++ Y P
Sbjct  599   ERETINGEEFRQIINEYTP  617



>ref|WP_028089678.1| cell division protein FtsH [Dolichospermum circinale]
Length=628

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPVLLITGLFFLFRRSNNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDDSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLAEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVIFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_006041393.1| cell division protein FtsH [Synechococcus sp. WH 7805]
 gb|EAR18746.1| hypothetical protein WH7805_02887 [Synechococcus sp. WH 7805]
Length=637

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 192/421 (46%), Positives = 271/421 (64%), Gaps = 24/421 (6%)
 Frame = -2

Query  2028  LSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPE  1849
             L+RR  N       Q ++F ++K +  ++  TGV F+DVAG+ +A ++L+E+VT+LK PE
Sbjct  146   LARRSNNM-PGGPGQAMQFGKTKARFAMEAETGVMFDDVAGVNEAKQDLEEVVTFLKQPE  204

Query  1848  LFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRD  1669
              F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RD
Sbjct  205   KFTSVGAQIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRD  264

Query  1668  LFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDT  1489
             LFKRAK N P +IFIDEIDA+  +R       +D        ERE TLNQLLTE+DGF+ 
Sbjct  265   LFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEG  316

Query  1488  GKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLT  1309
               G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VH+R  KL   + L 
Sbjct  317   NSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHSRNKKLDPDLSLD  376

Query  1308  SYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQG  1129
             S A+  PG++GA LA LL EAA++  R+   +I  S++DDAVDR+  G +  G  L   G
Sbjct  377   SIARRTPGFTGADLANLLNEAAILTARRRKETISLSEIDDAVDRIIAGME--GQPL-TDG  433

Query  1128  QCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFER  955
             + +R  A  EVG AL   L++ ++  +     ++++ PRGQ      F    DE  M   
Sbjct  434   RSKRLIAYHEVGHALVGTLVKDHDPVQ-----KVTLIPRGQAQGLTWFS--PDEEQMLVS  486

Query  954   RPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIH  784
             R QL  R+   LGGRAAE+V++GR + +  +   +     +AR+M+T + + N  PM++ 
Sbjct  487   RSQLKARIMGALGGRAAEDVVFGRAEVTTGAGGDIQQVASMARQMVTRFGMSNLGPMSLE  546

Query  783   G  781
             G
Sbjct  547   G  547



>ref|WP_017711703.1| hypothetical protein [Prochlorothrix hollandica]
Length=681

 Score =   326 bits (835),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 197/437 (45%), Positives = 277/437 (63%), Gaps = 25/437 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F+DVAGIE+A EELQE+VT+LK PE F ++G K P GVL
Sbjct  186   QAMNFGKSRARFQMEAKTGVVFDDVAGIEEAKEELQEVVTFLKQPEQFIRLGAKIPKGVL  245

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ M+GSEFVE+ VGVGA+R+RDLF++AK N P +IF
Sbjct  246   LVGPPGTGKTLLAKAIAGEAEVPFFSMSGSEFVEMFVGVGASRVRDLFRKAKENSPCIIF  305

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   GVI + ATNR D
Sbjct  306   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEDNSGVIVIAATNRPD  357

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P  +GRLGIL+VHAR   L  +V L S A+  PG+SGA L
Sbjct  358   VLDSALLRPGRFDRQVTVDLPTFQGRLGILEVHARDKMLDSSVSLDSVARRTPGFSGADL  417

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+    I  +++ DA+DR+T+G     +     G+ +R  A  EVG A
Sbjct  418   ANLLNEAAILTARRRKEHITLAEISDAIDRITIGSSLTPL---LDGKKKRLIAYHEVGHA  474

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDE---SYMFERRPQLLHRLQVL  922
             L   +L H      +  D+++I PR   +        ++E   S ++  R  L  R+ +L
Sbjct  475   LIMTVLEH-----ADLLDKVTIIPRSGGIGGFAKPVPNEEVIDSGLYS-RAWLRDRMVML  528

Query  921   LGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVWNLEN--PMTIHGEPLPWRKSPK  751
             +GGRAAEEVI+GRD  +  ++  +   T LAR+M+T + + +  P+ ++           
Sbjct  529   MGGRAAEEVIFGRDEVTPGAMGDIRQLTNLAREMVTRYGMSDLGPLALNDNEPDSPMGRT  588

Query  750   FVGPRLDFEGSLYDDYD  700
             ++ PR D+  S+  + D
Sbjct  589   WMSPRPDYSESMAVNID  605



>ref|WP_037216619.1| cell division protein FtsH [Richelia intracellularis]
Length=628

 Score =   324 bits (830),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  ++++  F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LLFPILLIVGLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMEAKTGVMFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEA VPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAAVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVMVDAPDIKGRLEVLRVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I  +++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLDTIARRTPGFTGADLANLLNEAAILTARRRKEAITLTEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKEHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+G  + +  + + L   T +AR+M+T +
Sbjct  470   PNEEQGLI--TRGQLKARITGALGGRAAEDVIFGDAEVTTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>gb|KEF42784.1| cell division protein FtsH [Cyanobium sp. CACIAM 14]
Length=664

 Score =   325 bits (833),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 265/406 (65%), Gaps = 23/406 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F +SK +  ++  TGV F+DVAG+E+A ++LQE+VT+LK PE F  +G K P GVL
Sbjct  159   QAMQFGKSKARFAMEAETGVMFDDVAGVEEAKQDLQEVVTFLKTPERFTSVGAKIPRGVL  218

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  219   LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  278

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  279   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIIIAATNRPD  330

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL ILKVH+R  KL++ V L   A+  PG++GA L
Sbjct  331   VLDSALMRPGRFDRQVTVDAPDIKGRLSILKVHSRNKKLADDVSLEMIARRTPGFTGADL  390

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+   +   +++DDAVDR+  G +  G  L   G+ +R  A  EVG A
Sbjct  391   ANLLNEAAILTARRRKEATGLAEIDDAVDRIIAGME--GKPL-TDGRSKRLIAYHEVGHA  447

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             L   L++H++  +     ++++ PRGQ      F    DE  M   R QL  R+   LGG
Sbjct  448   LVGTLVKHHDPVQ-----KVTLIPRGQAQGLTWFA--PDEEQMLVSRAQLRARIMGALGG  500

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLE--NPMTIH  784
             RAAE+V++G  + +  +   +     +AR+M+T + +    PM++ 
Sbjct  501   RAAEDVVFGHAEVTTGAGGDIQQVASMARQMVTRFGMSELGPMSLE  546



>ref|WP_006276440.1| cell division protein FtsH [Cylindrospermopsis raciborskii]
 gb|EFA70630.1| Peptidase M41, FtsH [Cylindrospermopsis raciborskii CS-505]
Length=635

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 185/399 (46%), Positives = 261/399 (65%), Gaps = 21/399 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +S+ + +++  TGV F+DVAGI +A EELQE+VT+L+ PE F  +G K P GVL
Sbjct  162   QALNFGRSRARFQMEAKTGVKFDDVAGITEAKEELQEVVTFLQQPEKFTAVGAKIPKGVL  221

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  222   LVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF  281

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  282   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNNGIIIIAATNRPD  333

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL IL VHAR  KL  T+ L   AQ  PG++GA L
Sbjct  334   VLDSALLRPGRFDRQVIVDAPDLKGRLDILAVHARNKKLDPTISLEEIAQRTPGFTGADL  393

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+    I   +++DAVDR+  G +   +     G+ +R  A  EVG A
Sbjct  394   ANLLNEAAILTARRRKEEITMLEINDAVDRVVAGMEGTAL---VDGKSKRLIAYHEVGHA  450

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             L   L++ ++  +     ++++ PRGQ L    F   +D+  +   R Q+L R+   LGG
Sbjct  451   LIGTLVKDHDPVQ-----KVTLIPRGQALGLTWFTPNEDQGLV--SRSQMLARIMGALGG  503

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             RAAEE+++G+ + +  + + L   T +AR+M+T + + +
Sbjct  504   RAAEEIVFGKAEVTTGAGNDLQQVTTMARQMVTRFGMSD  542



>ref|WP_028083738.1| cell division protein FtsH [Dolichospermum circinale]
Length=628

 Score =   324 bits (830),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPVLLITGLFFLFRRSNNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEVLQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG++GA LA LL EAA++  R+    I  +++DDAVDR+  
Sbjct  356   ARNKKLDDSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLAEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVIFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_012597876.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 ref|YP_002375797.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
 gb|ACK68929.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=655

 Score =   325 bits (832),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/444 (43%), Positives = 281/444 (63%), Gaps = 25/444 (6%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             S +I ++  +L++FL   +++   + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  149   SEAIGIMTNLLVLFLLFGIVI--VILRRSANAS----GQAMNFGKSRARFQMEAKTGINF  202

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
              DVAGI++A EELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEA V
Sbjct  203   EDVAGIDEAKEELQEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAAV  262

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R G+        
Sbjct  263   PFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRQR-GV-------S  314

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+
Sbjct  315   YGGGNDEREQTLNQLLTEMDGFEGNNGIIIIAATNRPDVLDVALMRPGRFDRQVMVDYPD  374

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
              KGRLGIL+VH+R  K+   V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  375   MKGRLGILEVHSRNKKVDPGVSLEAIARRTPGFTGADLANVLNEAAIFTGRRRKEAITTQ  434

Query  1200  DMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINP  1021
             +++DA+DR+  G +   + +  + +   A  EVG A+ + L   +     +  +++++ P
Sbjct  435   EINDAIDRVVAGMEGTPL-VDSKAKRLIAYHEVGHAIVATLCPGH-----DAVEKVTLIP  488

Query  1020  RGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADA  844
             RGQ      F    DE      R QLL R+  LLGGR AEE+I+G  + +  + + +   
Sbjct  489   RGQARGLTWF--TPDEEQGLTSRAQLLARISGLLGGRVAEEIIFGDTEVTTGAGNDIEKI  546

Query  843   TWLARKMITVWNLEN--PMTIHGE  778
             T+LAR+M+T + + +  P+ +  E
Sbjct  547   TYLARQMVTRFGMSDLGPVALEDE  570



>ref|WP_018399208.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=628

 Score =   324 bits (830),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 192/423 (45%), Positives = 268/423 (63%), Gaps = 20/423 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK +  ++  TG+ F+DVAGIE+A E
Sbjct  125   LIFPILLIGALFFLFRRSSNM-PGGPGQAMNFGKSKARFMMEAKTGILFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGKTLMAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGR+G+L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVSVDAPDFKGRIGVLEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KLS  + + S A+  PG++GA LA LL EAA++  R+   +I  ++++DAVDR+  
Sbjct  356   ARNKKLSSEISIESIARRTPGFTGADLANLLNEAAILTARRRKEAITMAEINDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRR-ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVF  991
             G +  G  L      R  A  EVG A+   LL+ +     +   ++++ PRGQ      F
Sbjct  416   GME--GTPLVDSKSKRLIAYHEVGHAIVGTLLKDH-----DPVQKVTLIPRGQAQGLTWF  468

Query  990   HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITV  814
                 +E      R QL+ R+   +GGRAAEE ++G  + +  +   L   T LAR+M+T 
Sbjct  469   T--PNEEQGLTTRSQLMARIAGAMGGRAAEEEVFGYHEVTTGAGGDLQQVTGLARQMVTR  526

Query  813   WNL  805
             + +
Sbjct  527   FGM  529



>ref|WP_016951384.1| cell division protein FtsH [Anabaena sp. PCC 7108]
Length=628

 Score =   324 bits (830),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPVLLITGLFFLFRRSNNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEVLQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG++GA LA LL EAA++  R+    I   ++DDAVDR+  
Sbjct  356   ARNKKLDKSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITILEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF-  468

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
              + +E      R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  469   -MPNEEQGLISRSQLKARITGALGGRAAEEVIFGPAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_035830157.1| cell division protein FtsH, partial [Cyanobium sp. CACIAM 14]
Length=636

 Score =   324 bits (831),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 265/406 (65%), Gaps = 23/406 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F +SK +  ++  TGV F+DVAG+E+A ++LQE+VT+LK PE F  +G K P GVL
Sbjct  159   QAMQFGKSKARFAMEAETGVMFDDVAGVEEAKQDLQEVVTFLKTPERFTSVGAKIPRGVL  218

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  219   LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  278

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  279   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIIIAATNRPD  330

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL ILKVH+R  KL++ V L   A+  PG++GA L
Sbjct  331   VLDSALMRPGRFDRQVTVDAPDIKGRLSILKVHSRNKKLADDVSLEMIARRTPGFTGADL  390

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+   +   +++DDAVDR+  G +  G  L   G+ +R  A  EVG A
Sbjct  391   ANLLNEAAILTARRRKEATGLAEIDDAVDRIIAGME--GKPL-TDGRSKRLIAYHEVGHA  447

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             L   L++H++  +     ++++ PRGQ      F    DE  M   R QL  R+   LGG
Sbjct  448   LVGTLVKHHDPVQ-----KVTLIPRGQAQGLTWFA--PDEEQMLVSRAQLRARIMGALGG  500

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLE--NPMTIH  784
             RAAE+V++G  + +  +   +     +AR+M+T + +    PM++ 
Sbjct  501   RAAEDVVFGHAEVTTGAGGDIQQVASMARQMVTRFGMSELGPMSLE  546



>ref|WP_002756164.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCH94459.1| ATP-dependent zinc metalloprotease FtsH 1 [Microcystis aeruginosa 
PCC 9432]
Length=631

 Score =   324 bits (830),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 192/432 (44%), Positives = 277/432 (64%), Gaps = 29/432 (7%)
 Frame = -2

Query  2100  SASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTF  1921
             SA I VL  +L++ + + LLV F + RR  N       Q + F +S+ + +++  TG+ F
Sbjct  123   SALINVLTNLLVIIIVLGLLV-FII-RRSANAS----GQAMNFGKSRARFQMEAKTGIEF  176

Query  1920  NDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGV  1741
             NDVAG+++A E+L+E+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGV
Sbjct  177   NDVAGVDEAKEDLEEVVTFLKQPEKFTAIGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGV  236

Query  1740  PFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQ  1561
             PF+ ++GSEFVE+ VGVGA+R+RDLF++A+ N P ++FIDEIDA+  +R GI        
Sbjct  237   PFFSISGSEFVEMFVGVGASRVRDLFRKAQENAPCLVFIDEIDAVGRQR-GI-------G  288

Query  1560  YNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPN  1381
             Y     ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+
Sbjct  289   YGGGNDEREQTLNQLLTEMDGFEVNTGIIVIAATNRPDVLDSALLRPGRFDRQVVVDYPD  348

Query  1380  AKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRS  1201
             + GRL IL+VH+R  K++  V L + A+  PG++GA LA +L EAA+   R+   +I   
Sbjct  349   SNGRLAILEVHSRDKKVAADVALEAIARRTPGFTGADLANMLNEAAIFTARRRKEAITME  408

Query  1200  DMDDAVDRLTVGPK-RVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRIS  1030
             +++DA+DR+  G + R  +D     + +R  A  EVG A+   L   ++       ++++
Sbjct  409   EVNDAIDRIVAGMEGRALVD----SKAKRLIAYHEVGHAIVGTLCPGHDQ-----VEKVT  459

Query  1029  INPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYL  853
             + PRGQ      F    DE      R QLL R+  LLGGR AEE ++G D  +  + + +
Sbjct  460   LIPRGQAQGLTWF--TPDEEQGLTSRSQLLARIAGLLGGRVAEECVFGEDEVTTGAGNDI  517

Query  852   ADATWLARKMIT  817
                T+LAR+M+T
Sbjct  518   EKITYLARQMVT  529



>ref|WP_015112002.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
 ref|YP_007048918.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
 gb|AFY41768.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
Length=628

 Score =   324 bits (830),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPILLITGLFFLFRRSSNL-PGGPGQAMSFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEILSVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLDTSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITLREIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEV++G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVVFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_039738012.1| cell division protein FtsH [Hassallia byssoidea]
 gb|KIF38181.1| cell division protein FtsH [Hassallia byssoidea VB512170]
Length=628

 Score =   323 bits (829),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 278/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LIFPILLITGLFFLFRRSSNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILQVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG++GA LA LL EAA++  R+    +  +++DDAVDR+  
Sbjct  356   ARNKKLDKSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGMTLAEVDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALIGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE+VI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEDVIFGHAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|YP_007627352.1| cell division protein [Chondrus crispus]
 emb|CCP38099.1| cell division protein [Chondrus crispus]
Length=626

 Score =   323 bits (829),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 183/406 (45%), Positives = 265/406 (65%), Gaps = 19/406 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK   +++  TGV FNDVAGI++A EE +E+VT+LK PE F  +G + P GVL
Sbjct  151   QAMSFGKSKALFQMEAKTGVVFNDVAGIDEAKEEFEEVVTFLKQPECFTAVGARIPTGVL  210

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  211   LVGPPGTGKTLLAKAIAGEANVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  270

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  271   IDEIDAVGRQRGTGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIVIAATNRAD  322

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL ILKVHAR  K+ E+V L   A+  PG+SGA L
Sbjct  323   ILDSALLRPGRFDRQVAVEVPDFKGRLAILKVHARNKKIDESVSLNIIARRTPGFSGADL  382

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   +I  +++D ++DR+  G +   + +  + +   A  E+G A+ 
Sbjct  383   ANLLNEAAILTARRRKQTITLNEIDASIDRVVAGMEGTPL-IDSKSKRLIAYHEIGHAIV  441

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL+ ++  +     ++++ PRGQ      F   +D+S +   R Q+  R+   LGGRA
Sbjct  442   GTLLQDHDPVQ-----KVTLIPRGQARGLTWFTPSEDQSLI--SRSQIKSRIMGALGGRA  494

Query  906   AEEVIYG-RDTSKASVSYLADATWLARKMITVWNLEN--PMTIHGE  778
             AEEV++G  + +  + + L   T +AR+M+T + + N  P+++  E
Sbjct  495   AEEVVFGDAEVTTGASNDLQQVTSMARQMVTRFGMSNIGPLSLENE  540



>gb|ELS49502.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
DIANCHI905]
Length=586

 Score =   322 bits (825),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TG+TF+DVAGI++A E
Sbjct  83    LLFPFLLIAALFFLFRRSNNM-PGGPGQAMSFGKSKARFQMEAKTGITFDDVAGIDEAKE  141

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  142   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  201

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  202   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  253

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL VH
Sbjct  254   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDFKGRLEILDVH  313

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V + + A+  PG+SGA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  314   ARNKKLANDVSIEAIARRTPGFSGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVIA  373

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  374   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF-  426

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  427   -TPNEEQGLTTKAQLMARISGALGGRAAEEEIFGYDEVTTGAGGDLQQVSDMARQMVTRF  485

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  486   GMSDLGPLSLESQ  498



>ref|WP_013638629.1| ATP-dependent metalloprotease [Desulfurobacterium thermolithotrophum]
 ref|YP_004281736.1| ATP-dependent metalloprotease FtsH [Desulfurobacterium thermolithotrophum 
DSM 11699]
 gb|ADY73677.1| ATP-dependent metalloprotease FtsH [Desulfurobacterium thermolithotrophum 
DSM 11699]
Length=626

 Score =   323 bits (828),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 207/522 (40%), Positives = 313/522 (60%), Gaps = 41/522 (8%)
 Frame = -2

Query  2073  ILLVFLTMVLLVRFTLSRRPKNFRKWDIW--QGIEFSQSKPQARVDGMTGVTFNDVAGIE  1900
             +L+ +L M+ L+   +S      R+  +   + + F++S+ +  +D    VTF DVAGI+
Sbjct  108   VLVSWLPMIFLILLWISM----MRQMSMGSNKALSFAKSRAKVFIDNKPKVTFKDVAGID  163

Query  1899  QAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAG  1720
             +  EE+ E+V +LKNP+ F ++G + P GVLL G PG GKTL+AKAIAGEA VPF  ++G
Sbjct  164   EVKEEVSEIVDFLKNPKKFQQLGGRIPKGVLLAGAPGTGKTLLAKAIAGEANVPFLSVSG  223

Query  1719  SEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQE  1540
             SEFVE+ VGVGA+R+RDLF++AK + P ++FIDEIDA+  KR   F    D        E
Sbjct  224   SEFVEMFVGVGASRVRDLFEQAKRHAPCIVFIDEIDAVGRKRGAGFTGGHD--------E  275

Query  1539  RETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGI  1360
             RE TLNQLL E+DGF++ +G+I + ATNR D+LDPALLRPGRFDR+I +  P+ +GRL I
Sbjct  276   REQTLNQLLVEMDGFESSEGIIVIAATNRPDILDPALLRPGRFDRQIHVPLPDVRGRLEI  335

Query  1359  LKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVD  1180
             LK+H +   L+E VDL   A++ PG+SGA LA ++ EAAL+A RK H  I   D ++A D
Sbjct  336   LKIHTKDKPLAEDVDLEVIARSTPGFSGADLANIVNEAALIAARKNHGKITMEDFEEAKD  395

Query  1179  RLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQ  1000
             ++T+G +R  + L  + +   A  E G  L + LL + +        +++I PRG+ L  
Sbjct  396   KVTMGIERKSMVLSEEEKVTTAYHEAGHTLIAKLLPNADK-----VHKVTIIPRGKALG-  449

Query  999   VVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMI  820
              +  +L +E      +  LL RL VL GGR AEE+  G  ++ A  + +  AT +A+KM+
Sbjct  450   -ITQQLPEEDRYTYTKDYLLDRLCVLFGGRVAEELALGTISTGAG-NDIERATEIAKKMV  507

Query  819   TVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEA  640
               W + + +     P+  +   +F  P            +LI   +   +D +V K    
Sbjct  508   AEWGMSDTIG----PIAVKIREQFGEP-----------AELISEEMKKLIDKEVRK----  548

Query  639   LIRDTYAKTlallrqhhaallktvkvllkqKEISGEEIDFIL  514
             +I++TY +T  L+ Q+   L    K LL+++ ++GEEID  +
Sbjct  549   IIQETYERTKELISQNMDKLENLAKALLERETLTGEEIDMAM  590



>ref|WP_025951898.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_497I20]
Length=594

 Score =   322 bits (826),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 198/457 (43%), Positives = 282/457 (62%), Gaps = 28/457 (6%)
 Frame = -2

Query  2145  GVFAKFYQVYTFGGISASIEVLK---PILLVFLTM----VLLVRFTLSRRPKNFRKWDIW  1987
             G+  +   +   GGIS  +  +K   P L +   +    +L+    L  R  N       
Sbjct  56    GLTPELINILKNGGISFDVHPIKTAPPALGILGNLLFPAILIGGLILLARRSNGMPGGPG  115

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F ++K +  ++  TGV F+DVAG+ +A ++LQE+VT+LK PE F  +G + P GVL
Sbjct  116   QAMQFGKTKARFAMEAETGVVFDDVAGVNEAKQDLQEVVTFLKKPEKFTSVGARIPKGVL  175

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  176   LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  235

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  236   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIIIAATNRPD  287

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL IL+VHAR  KL E + L S A+  PG++GA L
Sbjct  288   VLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHARNKKLQEDLTLESIARRTPGFTGADL  347

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+  +SI  S++DD+VDR+  G +  G  L   G+ +R  A  EVG A
Sbjct  348   ANLLNEAAILTARRRKDSISISEIDDSVDRIVAGME--GSPL-TDGRSKRLIAYHEVGHA  404

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             L   L++ ++  +     ++++ PRGQ      F   DDE  +   R QL  R+   LGG
Sbjct  405   LIGSLVKAHDPVQ-----KVTVIPRGQAKGLTWFTP-DDEQTLVS-RAQLKARIMGALGG  457

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNL  805
             RAAE+V++G  + +  +         +AR+M+T + +
Sbjct  458   RAAEDVVFGEGEITTGAGGDFQQVASMARQMVTRFGM  494



>ref|WP_036485806.1| cell division protein FtsH [Myxosarcina sp. GI1]
Length=630

 Score =   323 bits (828),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 191/435 (44%), Positives = 279/435 (64%), Gaps = 24/435 (6%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TG+ F+DVAGI++A E
Sbjct  127   LLFPILLIGALFFLFRRSNNM-PGGPGQAMNFGKSRARFQMEAKTGIMFDDVAGIDEAKE  185

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  186   ELQEVVTFLKQPERFTAVGAKIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  245

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  246   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  297

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ +GRL IL+VH
Sbjct  298   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVGVDSPDIRGRLEILEVH  357

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  K++  V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  358   ARNKKVAPEVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITMLEIDDAVDRVVA  417

Query  1167  GPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVV  994
             G +  G  L   G+ +R  A  EVG A+   L++ +     +   ++++ PRGQ      
Sbjct  418   GME--GTPL-VDGKSKRLIAYHEVGHAIVGTLVKDH-----DPVQKVTLIPRGQAQGLTW  469

Query  993   FHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMIT  817
             F   +++  +   R QL+ R+   +GGRAAEE ++G D  +  +   L   T +AR+M+T
Sbjct  470   FTPSEEQGLI--ARSQLMARIAGAMGGRAAEEEVFGHDEVTTGAGGDLQQVTQMARQMVT  527

Query  816   VWNLEN--PMTIHGE  778
             ++ + +  P+ + G+
Sbjct  528   IYGMSDLGPIALGGQ  542



>ref|WP_036917622.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG15241.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0602]
 gb|KGG17518.1| Cell division protein FtsH [Prochlorococcus sp. MIT 0603]
Length=638

 Score =   323 bits (829),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 196/434 (45%), Positives = 276/434 (64%), Gaps = 24/434 (6%)
 Frame = -2

Query  2097  ASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFN  1918
             ASI  L  ++   L +V LV   L+RR  N       Q ++F ++K +  ++  TGV F+
Sbjct  125   ASIGFLGNLIFPILLIVGLV--FLARR-SNSMPGGPGQAMQFGKTKARFAMEAETGVMFD  181

Query  1917  DVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVP  1738
             DVAG+E+A ++LQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVP
Sbjct  182   DVAGVEEAKQDLQEVVTFLKQPERFTSVGAQIPKGVLLVGPPGTGKTLLAKAIAGEAGVP  241

Query  1737  FYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQY  1558
             F+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IFIDEIDA+  +R       +D   
Sbjct  242   FFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND---  298

Query  1557  NAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNA  1378
                  ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ 
Sbjct  299   -----EREQTLNQLLTEMDGFEGNSGIIIIAATNRPDVLDSALLRPGRFDRQVSVDAPDI  353

Query  1377  KGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSD  1198
             KGRL ILKVH++  K+ E + L S A+  PG++GA LA LL EAA++  R+    I  S+
Sbjct  354   KGRLSILKVHSKNKKIDENLSLESIARRTPGFTGADLANLLNEAAILTARRRKEKIGISE  413

Query  1197  MDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISIN  1024
             +DDAVDR+  G +  G  L   G+ +R  A  E+G A+   LL+ ++  +     ++++ 
Sbjct  414   IDDAVDRIIAGME--GQPL-TDGRSKRLIAYHEIGHAIVGTLLKDHDPVQ-----KVTLI  465

Query  1023  PRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLAD  847
             PRGQ      F    DE      R QL  R+   LGGRAAE++++GR + +  +   +  
Sbjct  466   PRGQAKGLTWFS--PDEDQTLVSRAQLKARIMGALGGRAAEDIVFGRGEVTTGAGGDIQQ  523

Query  846   ATWLARKMITVWNL  805
                +AR+M+T + +
Sbjct  524   VASMARQMVTRFGM  537



>ref|WP_008227570.1| Cell division protein FtsH [Richelia intracellularis]
 emb|CCH65209.1| Cell division protein FtsH [Richelia intracellularis HM01]
Length=634

 Score =   323 bits (829),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 267/402 (66%), Gaps = 23/402 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGV FNDVAGIE+A EELQE++T+LK PE F  +G K P GVL
Sbjct  154   QAMNFGKSKARFQMEAKTGVMFNDVAGIEEAKEELQEVITFLKQPEKFTAIGAKIPKGVL  213

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF  ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  214   LVGPPGTGKTLLAKAIAGEAGVPFLSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIIF  273

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  274   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPD  325

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL ILKVH+R  K+     LT  A+  PG++GA L
Sbjct  326   VLDSALLRPGRFDRQVFVDAPDRKGRLAILKVHSRGKKIDPLASLTIVARRTPGFTGADL  385

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+   +I ++++DDA+DRLT+G   + ++    G+ +R  A  E+G A
Sbjct  386   ANLLNEAAILTARRRKEAITQTEIDDAIDRLTIG---LTLNPLLDGRKKRLIAYHEIGHA  442

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTL---SQVVFHRLDDESYMFERRPQLLHRLQVL  922
             L + LL H      +  ++++I PR   L   SQ++ +    +S ++     L   + ++
Sbjct  443   LLATLLEHS-----DPLNKVTIIPRSGGLGGFSQLIPNEEIIDSGLYT-CAWLKSNITMI  496

Query  921   LGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             LGG+AAE  ++G  +T+  + S L   T LARKM+T++ + +
Sbjct  497   LGGKAAETEVFGEAETTGGASSDLKTVTTLARKMVTMYGMSD  538



>ref|WP_036799574.1| cell division protein FtsH, partial [Pleurocapsa sp. PCC 7319]
Length=613

 Score =   323 bits (827),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 182/409 (44%), Positives = 268/409 (66%), Gaps = 19/409 (5%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TG+ F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVL
Sbjct  149   QALSFGRSKAKFQMEANTGIQFDDVAGIEEAKEELQEVVTFLKEPEKFTAIGAKIPRGVL  208

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEA VPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  209   LVGPPGTGKTLLAKAIAGEAAVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCLVF  268

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  269   IDEIDAVGRQRGTGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIVIAATNRPD  320

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ +GRLGIL+VHAR  K+   V L + A+  PG+SGA L
Sbjct  321   VLDQALLRPGRFDRQVIVDYPDLQGRLGILEVHARGKKIDSEVSLEAIARRTPGFSGADL  380

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++  R+   ++   +++DAVDR+  G + + + +  + +   A  E+G A+ 
Sbjct  381   ANLLNEAAILTARRHKEAVTMQEVNDAVDRIVAGMEGIPL-VDSKAKKLTAYHEIGHAIV  439

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
             + +  ++     +  ++++I PRG       F    DE    E + ++L ++   LGGRA
Sbjct  440   ATMTPNH-----DPVEKVTIIPRGGAGGLTWFT--PDEEMGLETKSKILAKITSALGGRA  492

Query  906   AEEVIYGRD-TSKASVSYLADATWLARKMITVWNLEN--PMTIHGEPLP  769
             AEE+++G+D  ++ +   +   T LARKM+T + + +  P+ + G+  P
Sbjct  493   AEEIVFGQDEITQGAGQDIQVLTSLARKMVTKFGMSDLGPLALEGQEQP  541



>ref|XP_007509442.1| ATP-dependent metalloprotease FtsH [Bathycoccus prasinos]
 emb|CCO19245.1| ATP-dependent metalloprotease FtsH [Bathycoccus prasinos]
Length=1011

 Score =   333 bits (853),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 188/406 (46%), Positives = 249/406 (61%), Gaps = 10/406 (2%)
 Frame = -2

Query  2013  KNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKM  1834
             KN    D+ Q ++F+QS   AR DG   VT  D+ G+E   E+L E++ +LK+P  F K+
Sbjct  261   KNAIPTDLIQAVQFAQSGVSARKDGTVNVTLEDIGGLENIKEDLDEIIRFLKDPTTFTKV  320

Query  1833  GIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRA  1654
             G KPP G+L+EG PG GKTL+AKAIAGEA VPFY MAGSEFVE++VGVGAAR+RDLFKRA
Sbjct  321   GAKPPKGILMEGGPGVGKTLLAKAIAGEAKVPFYSMAGSEFVEIIVGVGAARVRDLFKRA  380

Query  1653  KVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVI  1474
             ++N P +IF+DEIDAL T R               T+E E TLNQLLTE+DGF    GV+
Sbjct  381   RLNAPCLIFVDEIDALGTARASAG--------TRGTEEHEQTLNQLLTEMDGFTPDTGVV  432

Query  1473  FLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQN  1294
             F+GATNR DLLDPALLRPGRFDRKI +  PN   R  IL++H  K  ++  +D    A+N
Sbjct  433   FIGATNRADLLDPALLRPGRFDRKIEVNKPNVDARQKILQIHLSKRNVNPDIDTARLARN  492

Query  1293  LPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRA  1114
             LPG +GA++A ++ EAA+  VR+  + I   D+    DR+  G +    D         A
Sbjct  493   LPGMTGAEIASVVNEAAVHCVRREGSQIEEEDVMYGSDRVLYGVRGKAHDKDELLTKLIA  552

Query  1113  TTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHR  934
               EVG A+    LR  E   +E C+ ISI PRG   +  +F R DD  YM+  R +L+ R
Sbjct  553   CHEVGRAVVQETLRK-ETKLLEPCEFISIVPRGFQAATTLFSRFDDNEYMYPTRERLMER  611

Query  933   LQVLLGGRAAEEVIYGRDTSKASVSYLADATWLARKMITVWNLENP  796
             ++VL  G  AE+++Y  + S     Y  +A  L R ++    L  P
Sbjct  612   VEVLTAGVEAEKLVYD-EVSSYGTDYGKEAIDLLRNVVINQGLGQP  656



>ref|WP_015207685.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale]
 ref|YP_007147111.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale 
PCC 7417]
 gb|AFZ24431.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale 
PCC 7417]
Length=628

 Score =   323 bits (828),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 194/433 (45%), Positives = 275/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPVLLITGLFFLFRRSNNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEILGVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   ARNKKLDPSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEAITLGEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG AL   L++ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHALVGTLIKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVIFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              +    P+++  +
Sbjct  528   GMSTLGPLSLESQ  540



>ref|WP_008195899.1| cell division protein FtsH [Microcystis sp. T1-4]
 emb|CCI30291.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis sp. T1-4]
Length=628

 Score =   323 bits (828),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TG+TF+DVAGI++A E
Sbjct  125   LVFPFLLIAALFFLFRRSNNM-PGGPGQAMSFGKSKARFQMEAKTGITFDDVAGIDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDFKGRLEILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V + + A+  PG+SGA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  356   ARNKKLANDVSIEAIARRTPGFSGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  470   --PNEEQGLTTKAQLMARISGALGGRAAEEEIFGYDEVTTGAGGDLQQVSDMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_012408087.1| cell division protein FtsH [Nostoc punctiforme]
 ref|YP_001865009.1| ATP-dependent metalloprotease FtsH [Nostoc punctiforme PCC 73102]
 gb|ACC80066.1| ATP-dependent metalloprotease FtsH [Nostoc punctiforme PCC 73102]
Length=628

 Score =   323 bits (828),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 277/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPVLLITGLFFLFRRSSNL-PGGPGQAMNFGKSKARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             +R  KL  +V L + A+  PG++GA LA LL EAA++  R+   +I   ++DDAVDR+  
Sbjct  356   SRNKKLDPSVSLDAIARRTPGFTGADLANLLNEAAILTARRRKEAITLREIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  470   PNEEQGLI--SRSQLKARITGALGGRAAEEVIFGAAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_015216796.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica]
 ref|YP_007159090.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
 gb|AFZ60180.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
Length=628

 Score =   323 bits (828),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAGIE+A E
Sbjct  125   LVFPVLLITGLFFLFRRSNNL-PGGPGQAMNFGKSRARFQMEAKTGVKFDDVAGIEEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLIGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL +L+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVTVDAPDIKGRLEVLEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL ++V L + A+  PG++GA LA LL EAA++  R+    I   ++DDAVDR+  
Sbjct  356   ARNKKLDKSVSLEAIARRTPGFTGADLANLLNEAAILTARRRKEGITLLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWF-  468

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
              + +E      R QL  R+   LGGRAAEEVI+G  + +  +   L   + +AR+M+T +
Sbjct  469   -MPNEEQGLISRSQLKARITGALGGRAAEEVIFGPAEVTTGAGGDLQQLSGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_008235692.1| Cell division protein FtsH [Richelia intracellularis]
 emb|CCH68222.1| Cell division protein FtsH [Richelia intracellularis HH01]
Length=625

 Score =   323 bits (827),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 189/402 (47%), Positives = 267/402 (66%), Gaps = 23/402 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGV FNDVAGIE+A EELQE++T+LK PE F  +G K P GVL
Sbjct  145   QAMNFGKSKARFQMEAKTGVMFNDVAGIEEAKEELQEVITFLKQPEKFTAIGAKIPKGVL  204

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF  ++GSEFVE+ VGVGA+R+RDLFK+AK N P +IF
Sbjct  205   LVGPPGTGKTLLAKAIAGEAGVPFLSISGSEFVEMFVGVGASRVRDLFKKAKENSPCIIF  264

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  265   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPD  316

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ +  P+ KGRL ILKVH+R  K+     LT  A+  PG++GA L
Sbjct  317   VLDSALLRPGRFDRQVFVDAPDRKGRLAILKVHSRGKKIDPLASLTIVARRTPGFTGADL  376

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+   +I ++++DDA+DRLT+G   + ++    G+ +R  A  E+G A
Sbjct  377   ANLLNEAAILTARRRKEAITQTEIDDAIDRLTIG---LTLNPLLDGRKKRLIAYHEIGHA  433

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTL---SQVVFHRLDDESYMFERRPQLLHRLQVL  922
             L + LL H      +  ++++I PR   L   SQ++ +    +S ++     L   + ++
Sbjct  434   LLATLLEHS-----DPLNKVTIIPRSGGLGGFSQLIPNEEIIDSGLYT-CAWLKSNITMI  487

Query  921   LGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             LGG+AAE  ++G  +T+  + S L   T LARKM+T++ + +
Sbjct  488   LGGKAAETEVFGEAETTGGASSDLKTVTTLARKMVTMYGMSD  529



>ref|YP_008519880.1| cell division protein (chloroplast) [Nannochloropsis limnetica]
 gb|AGI99234.1| cell division protein (chloroplast) [Nannochloropsis limnetica]
Length=699

 Score =   325 bits (833),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 189/396 (48%), Positives = 264/396 (67%), Gaps = 26/396 (7%)
 Frame = -2

Query  1977  EFSQSKPQARVDGM--TGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLL  1804
             +F Q+K  AR D +  TGVTF+DVAGI++  EE QE+VT+LK PE + ++G K P GVLL
Sbjct  160   QFFQTK--ARYDSVPVTGVTFDDVAGIDEVKEEFQEIVTFLKKPERYTRVGAKIPKGVLL  217

Query  1803  EGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFI  1624
              GPPG GKTL+AKAIAGEA VPF+  + SEFVE+ VG+GA+RIRDLFKRAK   P +IFI
Sbjct  218   SGPPGTGKTLLAKAIAGEAKVPFFSCSASEFVELFVGIGASRIRDLFKRAKAKTPCIIFI  277

Query  1623  DEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDL  1444
             DEIDA+  +R       +D        ERE TLNQLLTE+DGF+T  GVI + ATNR+D+
Sbjct  278   DEIDAVGRQRGSGVGGGND--------EREQTLNQLLTEMDGFETNNGVIVIAATNRVDI  329

Query  1443  LDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKla  1264
             LD ALLRPGRFDR++ +  P++K RL ILKVHA+  K+   V L + A+  PG+SGA LA
Sbjct  330   LDSALLRPGRFDRQLVVGFPDSKARLSILKVHAKDKKIDSEVQLDTVAKRTPGFSGADLA  389

Query  1263  qllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTAL  1090
              ++ EAA++  R    SI    +++A+D++T G  +  ++   + + +R  A  EVG AL
Sbjct  390   NVMNEAAILTARYNETSITTKRLNEALDKVTGGIPKPPME---ENRYKRILAYHEVGHAL  446

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
             T+ LL ++     +  + +S+ PRG+T S   +  +  E  M+ R  QLL RL  LL GR
Sbjct  447   TASLLEYH-----DPVEMVSLIPRGRTKSSTTY--VPSEETMYSRN-QLLTRLVSLLAGR  498

Query  909   AAEEVIYGR-DTSKASVSYLADATWLARKMITVWNL  805
             AAEEV++G+ + +   V  +  AT+LAR+++T + +
Sbjct  499   AAEEVVFGKAEVTTVGVDDIQRATFLARQIVTEYGM  534



>ref|WP_015153530.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 ref|YP_007090851.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
 gb|AFY86982.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=628

 Score =   323 bits (827),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 189/433 (44%), Positives = 281/433 (65%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +S+ + +++  TG+ F+DVAGI++A E
Sbjct  125   LIFPVLLIGGLFFLFRRSSNI-PGGPGQALNFGKSRARFQMEAKTGIKFDDVAGIDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKDNAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL ILKVH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVTVDAPDIKGRLEILKVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL++TV L + ++  PG++GA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  356   ARNKKLADTVSLEAISRRTPGFTGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  E+G AL   L++ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEIGHALIGTLIKDHDPVQ-----KVTLVPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVW  811
               +++  +   R QL  R+   LGGRAAE++I+G  + +  + + L   T +AR+M+T +
Sbjct  470   PSEEQGLI--SRSQLKARISGALGGRAAEDIIFGTAEVTTGAGNDLQQVTGMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLDSQ  540



>ref|WP_011376306.1| cell division protein FtsH [Prochlorococcus marinus]
 ref|YP_397247.1| FtsH peptidase [Prochlorococcus marinus str. MIT 9312]
 gb|ABB49811.1| membrane protease FtsH catalytic subunit [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGF99203.1| FtsH ATP-dependent protease precursor [Prochlorococcus marinus 
str. MIT 9311]
Length=637

 Score =   323 bits (828),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 193/428 (45%), Positives = 273/428 (64%), Gaps = 23/428 (5%)
 Frame = -2

Query  2049  VLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELV  1870
             +L+    L  R  N       Q ++F ++K +  ++  TGV F+DVAG+ +A ++LQE+V
Sbjct  138   ILIGGLILLARRSNGMPGGPGQAMQFGKTKARFAMEAETGVVFDDVAGVNEAKQDLQEVV  197

Query  1869  TYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGV  1690
             T+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGV
Sbjct  198   TFLKKPEKFTSVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGV  257

Query  1689  GAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLT  1510
             GA+R+RDLFKRAK N P +IFIDEIDA+  +R       +D        ERE TLNQLLT
Sbjct  258   GASRVRDLFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND--------EREQTLNQLLT  309

Query  1509  ELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKL  1330
             E+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VHAR  KL
Sbjct  310   EMDGFEGNSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHARNKKL  369

Query  1329  SETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVG  1150
              E + L S A+  PG++GA LA LL EAA++  R+  +SI  S++DD+VDR+  G +  G
Sbjct  370   QEDLTLESIARRTPGFTGADLANLLNEAAILTARRRKDSISISEIDDSVDRIVAGME--G  427

Query  1149  IDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDD  976
               L   G+ +R  A  EVG AL   L++ ++  +     ++++ PRGQ      F   DD
Sbjct  428   SPL-TDGRSKRLIAYHEVGHALIGSLVKAHDPVQ-----KVTVIPRGQAKGLTWFTP-DD  480

Query  975   ESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             E  +   R QL  R+   LGGRAAE+V++G+ + +  +         +AR+M+T + + N
Sbjct  481   EQTLVS-RAQLKARIMGALGGRAAEDVVFGKGEITTGAGGDFQQVASMARQMVTRFGMSN  539

Query  798   --PMTIHG  781
               P+ + G
Sbjct  540   LGPIALEG  547



>ref|WP_002782455.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI12224.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
PCC 9806]
 emb|CCI24956.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
PCC 9808]
Length=628

 Score =   323 bits (827),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + +++  TG+TF+DVAGI++A E
Sbjct  125   LVFPFLLIAALFFLFRRSNNM-PGGPGQAMSFGKSKARFQMEAKTGITFDDVAGIDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDFKGRLEILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V + + A+  PG+SGA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  356   ARNKKLANDVSIEAIARRTPGFSGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  470   --PNEEQGLTTKAQLMARISGALGGRAAEEEIFGYDEVTTGAGGDLQQVSDMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_023174351.1| ATP-dependent metalloprotease FtsH [Gloeobacter kilaueensis]
 ref|YP_008712832.1| ATP-dependent metalloprotease FtsH [Gloeobacter kilaueensis JS1]
 gb|AGY59125.1| ATP-dependent metalloprotease FtsH [Gloeobacter kilaueensis JS1]
Length=630

 Score =   323 bits (827),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 189/397 (48%), Positives = 259/397 (65%), Gaps = 17/397 (4%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q + F +SK + +++  TGV F+DVAGI++A EELQE+V +LK PE F  +G K P GVL
Sbjct  152   QAMNFGKSKARFQMEAKTGVKFDDVAGIDEAKEELQEVVQFLKRPERFTAVGAKIPKGVL  211

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++F
Sbjct  212   LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVF  271

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLL E+DGF+   G+I + ATNR D
Sbjct  272   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLVEMDGFEGNTGIIIIAATNRPD  323

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD A+LRPGRFDR+I +  P+  GRL +LKVHAR  KL+  +DL   A+  PG++GA L
Sbjct  324   VLDAAILRPGRFDRQITVDRPDMAGRLEVLKVHARNKKLAADIDLDVIARRTPGFAGADL  383

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALT  1087
             A LL EAA++A R+  N I   D+DDA DR+  G ++  + +  + +   A  EVG AL 
Sbjct  384   ANLLNEAAILAARRRQNEITMRDIDDATDRVIAGLEKQPL-VDSKKKRLIAYHEVGHALV  442

Query  1086  SHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGRA  907
               LL  ++  +     +++I PRG+      F     E  M   R QLL R++  LGGRA
Sbjct  443   GTLLPDHDPVQ-----KVTIIPRGRAGGLTWFT--PSEEQMLITRNQLLARIKGALGGRA  495

Query  906   AEEVIYGRD-TSKASVSYLADATWLARKMITVWNLEN  799
             AEEV++G D  +  + S L   + LAR+M+T + + +
Sbjct  496   AEEVVFGDDEVTTGASSDLMQISNLARQMVTRFGMSD  532



>ref|WP_017662490.1| cell division protein FtsH [Geitlerinema sp. PCC 7105]
Length=628

 Score =   323 bits (827),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 279/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +S+ + +++  TGV F+DVAG+++A E
Sbjct  125   LVFPVLLIAGLFFLFRRSSN-APGGPGQAMNFGKSRARFQMEAKTGVLFDDVAGVDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G + P GVLL G PG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKKPERFTAVGARIPKGVLLIGQPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCIIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFDR++ +  P+ KGRL IL+VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALLRPGRFDRQVSVDAPDIKGRLSILEVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V L + A+  PG++GA LA LL EAA++  R+  ++I  +++DDAVDR+  
Sbjct  356   ARNKKLASEVSLDAIARRTPGFTGADLANLLNEAAILTARRRKDAITMAEIDDAVDRVVA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +      EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIGYHEVGHAIVGTLLKDHDPVQ-----KVTLVPRGQARGLTWFV  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RDTSKASVSYLADATWLARKMITVW  811
               +D++ +   R Q+  R+   LGGRAAEEVI+G  + +  + + L   T +AR+M+T +
Sbjct  470   PSEDQTLI--SRSQIRARITGALGGRAAEEVIFGDAEVTTGAGNDLQQVTNMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  PM++  +
Sbjct  528   GMSDLGPMSLESQ  540



>ref|WP_011619340.1| cell division protein FtsH [Synechococcus sp. CC9311]
 ref|YP_730623.1| metalloprotease ATP-dependent, FtsH family protein [Synechococcus 
sp. CC9311]
 gb|ABI47263.1| metalloprotease, ATP-dependent, FtsH family protein [Synechococcus 
sp. CC9311]
Length=643

 Score =   323 bits (828),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 190/410 (46%), Positives = 264/410 (64%), Gaps = 29/410 (7%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F ++K +  V+  TGV F+DVAG+ +A ++L+E+VT+LK PE F  +G + P GVL
Sbjct  165   QAMQFGKTKARFAVEADTGVKFDDVAGVSEAKQDLEEVVTFLKQPERFTSVGAQIPKGVL  224

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  225   LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  284

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I L ATNR D
Sbjct  285   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIILAATNRPD  336

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL IL+VH+R  KL E + L S A+  PG++GA L
Sbjct  337   VLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHSRNKKLDEQLTLDSIARRTPGFTGADL  396

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGH---QGQCRR--ATTEV  1102
             A LL EAA++  R+   SI  S++DDAVDR+  G +      GH    G+ +R  A  EV
Sbjct  397   ANLLNEAAILTARRRKESIGISEIDDAVDRIIAGME------GHPLTDGRSKRLIAYHEV  450

Query  1101  GTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVL  922
             G AL   L++ ++  +     ++++ PRGQ      F    DE  M   R QL  R+   
Sbjct  451   GHALVGTLVKDHDPVQ-----KVTLIPRGQAQGLTWFS--PDEEQMLVSRAQLKARIMGA  503

Query  921   LGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHG  781
             LGGRAAE+V++G  + +  +   +     +AR+M+T + +    PM + G
Sbjct  504   LGGRAAEDVVFGHSEVTTGAGGDIQMVASMARQMVTQFGMSQLGPMALEG  553



>ref|WP_002803112.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI37488.1| ATP-dependent zinc metalloprotease FtsH 2 [Microcystis aeruginosa 
PCC 9701]
Length=628

 Score =   323 bits (827),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 193/433 (45%), Positives = 276/433 (64%), Gaps = 20/433 (5%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             L+F  +++   F L RR  N       Q + F +SK + +++  TG+TF+DVAGI++A E
Sbjct  125   LLFPFLLIAALFFLFRRSNNI-PGGPGQAMSFGKSKARFQMEAKTGITFDDVAGIDEAKE  183

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  184   ELQEVVTFLKQPEKFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  243

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  244   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  295

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR+I +  P+ KGRL IL VH
Sbjct  296   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQITVDAPDFKGRLEILDVH  355

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V + + A+  PG+SGA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  356   ARNKKLANDVSIEAIARRTPGFSGADLANLLNEAAILTARRRKDAITLLEIDDAVDRVIA  415

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + +  + +   A  EVG A+   LL+ ++  +     ++++ PRGQ      F 
Sbjct  416   GMEGTPL-VDSKSKRLIAYHEVGHAIVGTLLKDHDPVQ-----KVTLIPRGQAQGLTWFT  469

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   LGGRAAEE I+G D  +  +   L   + +AR+M+T +
Sbjct  470   --PNEEQGLTTKAQLMARISGALGGRAAEEEIFGYDEVTTGAGGDLQQVSDMARQMVTRF  527

Query  810   NLEN--PMTIHGE  778
              + +  P+++  +
Sbjct  528   GMSDLGPLSLESQ  540



>ref|WP_006852631.1| cell division protein FtsH [Synechococcus sp. WH 8016]
 gb|EHA63449.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. WH 8016]
Length=643

 Score =   323 bits (828),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 189/410 (46%), Positives = 265/410 (65%), Gaps = 29/410 (7%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F ++K +  ++  TGV F+DVAG+ +A ++LQE+VT+LK PE F  +G + P GVL
Sbjct  165   QAMQFGKTKARFAMEADTGVKFDDVAGVSEAKQDLQEVVTFLKQPERFTSVGAQIPKGVL  224

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  225   LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  284

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I L ATNR D
Sbjct  285   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIILAATNRPD  336

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL IL+VH+R  KL + + L S A+  PG++GA L
Sbjct  337   VLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHSRNKKLDDQLTLDSIARRTPGFTGADL  396

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGH---QGQCRR--ATTEV  1102
             A LL EAA++  R+  +SI  S++DDAVDR+  G +      GH    G+ +R  A  EV
Sbjct  397   ANLLNEAAILTARRRKDSIGISEIDDAVDRIIAGME------GHPLTDGRSKRLIAYHEV  450

Query  1101  GTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVL  922
             G AL   L++ ++  +     ++++ PRGQ      F    DE  M   R QL  R+   
Sbjct  451   GHALVGTLVKDHDPVQ-----KVTLIPRGQAQGLTWFS--PDEEQMLVSRAQLKARIMGA  503

Query  921   LGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHG  781
             LGGRAAE+V++G  + +  +   +     +AR+M+T + +    PM + G
Sbjct  504   LGGRAAEDVVFGHSEVTTGAGGDIQMVASMARQMVTQFGMSQLGPMALEG  553



>ref|WP_012628968.1| cell division protein FtsH [Cyanothece sp. PCC 7425]
 ref|YP_002484271.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7425]
 gb|ACL45910.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7425]
Length=631

 Score =   323 bits (827),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 217/486 (45%), Positives = 297/486 (61%), Gaps = 32/486 (7%)
 Frame = -2

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             + V    G  A   +L  +LL F  +V+L+   L RR  N       Q + F +S+ + +
Sbjct  100   FTVVPNSGDGAVYGILSNLLLGFFFVVILL--MLLRRSAN-APGGPGQILNFGKSRARFQ  156

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TG+ F DVAGIE+A EELQE+VT+LK PE F  +G + P GVLL GPPG GKTL+A
Sbjct  157   MEAKTGINFEDVAGIEEAKEELQEVVTFLKKPEKFTAVGARIPKGVLLIGPPGTGKTLLA  216

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFK+AK N P ++FIDEIDA+  +R  
Sbjct  217   KAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKDNAPCLVFIDEIDAVGRQRGT  276

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFD
Sbjct  277   GIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFD  328

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R+I +  P  KGRLGIL+VHAR+ KL+  V L + A+  PG+SGA+LA LL EAA++  R
Sbjct  329   RQITVDLPAYKGRLGILQVHAREKKLAPEVSLEAIARRTPGFSGAELANLLNEAAILTAR  388

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +  ++I   ++DDA+DR+T+G     + L  + +   A  E+G AL   LL+H      +
Sbjct  389   RRKDAITPLEVDDAIDRVTIGLTLTPL-LDSKKKWLIAYHEIGHALLMTLLKH-----AD  442

Query  1047  CCDRISINPRGQTL---SQVVF--HRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGR  883
               ++++I PR   +   +Q VF   R+D   Y    R  LL R+ VLLGGRA+EE ++G 
Sbjct  443   PLNKVTIIPRSGGIGGFAQQVFSEERVDSGLYT---RAWLLDRITVLLGGRASEEEVFGT  499

Query  882   D--TSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPRLDFEGSLYD  709
                TS AS  + A    LA +M+    + +   I    L  R    F+G R  F  S Y 
Sbjct  500   AEVTSGASSDFKA-VYELAWEMVARLGMSDLGHIS---LEMRGGDTFLG-RDFFNHSEYS  554

Query  708   DYDLIE  691
             D  L +
Sbjct  555   DEMLTQ  560



>gb|AIE73046.1| Cell division protein FtsH [Synechocystis sp. PCC 6714]
Length=627

 Score =   322 bits (826),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 269/424 (63%), Gaps = 18/424 (4%)
 Frame = -2

Query  2067  LVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVE  1888
             LVF  +++   F L RR  N       Q + F +SK + ++D  TGV F+DVAGI++A E
Sbjct  124   LVFPVLLIASLFFLFRRSSNM-PGGPGQAMNFGKSKARFQMDAKTGVMFDDVAGIDEAKE  182

Query  1887  ELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFV  1708
             ELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFV
Sbjct  183   ELQEVVTFLKQPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFV  242

Query  1707  EVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETT  1528
             E+ VGVGA+R+RDLFK+AK N P +IFIDEIDA+  +R       +D        ERE T
Sbjct  243   EMFVGVGASRVRDLFKKAKENAPCLIFIDEIDAVGRQRGAGIGGGND--------EREQT  294

Query  1527  LNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVH  1348
             LNQLLTE+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+  GR  IL+VH
Sbjct  295   LNQLLTEMDGFEGNTGIIIIAATNRPDVLDSALMRPGRFDRQVMVDAPDYGGRKEILEVH  354

Query  1347  ARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTV  1168
             AR  KL+  V + S A+  PG+SGA LA LL EAA++  R+  ++I   ++DDAVDR+  
Sbjct  355   ARNKKLAPEVSIDSIARRTPGFSGADLANLLNEAAILTARRRKSAITLLEIDDAVDRVVA  414

Query  1167  GPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFH  988
             G +   + + ++ +   A  EVG A+   LL+ +     +   ++++ PRGQ      F 
Sbjct  415   GMEGTPL-VDNKSKRLIAYHEVGHAIVGTLLKDH-----DPVQKVTLIPRGQAQGLTWFT  468

Query  987   RLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYGRD-TSKASVSYLADATWLARKMITVW  811
                +E      + QL+ R+   +GGRAAEE ++G D  +  +   L   T +AR+M+T +
Sbjct  469   --PNEEQGLTTKAQLMARIAGAMGGRAAEEEVFGDDEVTTGAGGDLQQVTEMARQMVTRF  526

Query  810   NLEN  799
              + N
Sbjct  527   GMSN  530



>ref|YP_002048840.1| FtsH ATP-dependent protease-like protein [Paulinella chromatophora]
 gb|ACB42630.1| FtsH ATP-dependent protease-like protein [Paulinella chromatophora]
Length=629

 Score =   323 bits (827),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 274/438 (63%), Gaps = 28/438 (6%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F ++K +  ++  TG+ FNDVAG+++A ++L+E+VT+LK P+ F  +G K P G L
Sbjct  158   QAMQFGKTKARFLMESETGIMFNDVAGVDEAKQDLEEIVTFLKTPDKFTSLGAKIPKGAL  217

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKA+AGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  218   LVGPPGTGKTLLAKAVAGEAGVPFFALSGSEFVEMFVGVGASRVRDLFKRAKENSPCMIF  277

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I L ATNR+D
Sbjct  278   IDEIDAVGRQRGSGVGGGND--------EREQTLNQLLTEMDGFEGNSGIILLAATNRVD  329

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD ALLRPGRFDR++ + PP+  GRL ILKVH+R  KL+  V L + A+  PG+SGA L
Sbjct  330   VLDSALLRPGRFDRQVNVDPPDINGRLSILKVHSRNKKLAPGVSLEAIARRTPGFSGADL  389

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR-ATTEVGTAL  1090
             A LL EAA++  R+  +S    ++DDAVDR+  G +  G  L      R  A  EVG AL
Sbjct  390   ANLLNEAAILTARRRKSSTTLIEIDDAVDRIIAGME--GKPLADGANKRLIAYHEVGHAL  447

Query  1089  TSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGGR  910
                L++ ++  +     ++++ PRGQ      F    DE      R QL  R+   LGGR
Sbjct  448   VGTLVKQHDPVQ-----KVTLIPRGQAQGLTWFS--PDEDQTLVSRGQLKARIMGALGGR  500

Query  909   AAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN--PMTIHGEPLPWRKS--PKFV  745
             AAE V++G  + +  + S +     LAR+M+T + + N  P+++  + +   +      +
Sbjct  501   AAEAVVFGHSEITTGAGSDIQQVASLARQMVTRFGMSNLGPVSLESQEMSLGRDGMSDAI  560

Query  744   GPRLDFE-----GSLYDD  706
               R+D +      +LYDD
Sbjct  561   AKRIDDQVREIVQNLYDD  578



>ref|WP_032516957.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGG04524.1| FtsH ATP-dependent protease precursor [Prochlorococcus marinus 
str. MIT 9322]
 gb|KGG05021.1| FtsH ATP-dependent protease precursor [Prochlorococcus marinus 
str. MIT 9321]
 gb|KGG07206.1| FtsH ATP-dependent protease precursor [Prochlorococcus marinus 
str. MIT 9401]
Length=637

 Score =   323 bits (827),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 191/420 (45%), Positives = 269/420 (64%), Gaps = 21/420 (5%)
 Frame = -2

Query  2049  VLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELV  1870
             +L+    L  R  N       Q ++F ++K +  ++  TGV F+DVAG+ +A ++LQE+V
Sbjct  138   ILIGGLILLARRSNGMPGGPGQAMQFGKTKARFAMEAETGVVFDDVAGVNEAKQDLQEVV  197

Query  1869  TYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGV  1690
             T+LK PE F  +G + P GVLL GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGV
Sbjct  198   TFLKKPEKFTSVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGV  257

Query  1689  GAARIRDLFKRAKVNKPSVIFIDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLT  1510
             GA+R+RDLFKRAK N P +IFIDEIDA+  +R       +D        ERE TLNQLLT
Sbjct  258   GASRVRDLFKRAKENSPCLIFIDEIDAVGRQRGAGIGGGND--------EREQTLNQLLT  309

Query  1509  ELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKL  1330
             E+DGF+   G+I + ATNR D+LD AL+RPGRFDR++ +  P+ KGRL IL+VHAR  KL
Sbjct  310   EMDGFEGNSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHARNKKL  369

Query  1329  SETVDLTSYAQNLPGWSGAKlaqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVG  1150
              E + L S A+  PG++GA LA LL EAA++  R+  +SI  S++DD+VDR+  G +  G
Sbjct  370   QEDLTLESIARRTPGFTGADLANLLNEAAILTARRRKDSISISEIDDSVDRIVAGME--G  427

Query  1149  IDLGHQGQCRR--ATTEVGTALTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDD  976
               L   G+ +R  A  EVG AL   L++ ++  +     ++++ PRGQ      F   DD
Sbjct  428   SPL-TDGRSKRLIAYHEVGHALIGSLVKAHDPVQ-----KVTVIPRGQAKGLTWFTP-DD  480

Query  975   ESYMFERRPQLLHRLQVLLGGRAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLEN  799
             E  +   R QL  R+   LGGRAAE+V++G+ + +  +         +AR+M+T + + N
Sbjct  481   EQTLIS-RAQLKARIMGALGGRAAEDVVFGKGEITTGAGGDFQQVASMARQMVTRFGMSN  539



>ref|WP_032524286.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|KGF87738.1| FtsH ATP-dependent protease precursor [Prochlorococcus marinus 
str. GP2]
Length=637

 Score =   323 bits (827),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 207/497 (42%), Positives = 305/497 (61%), Gaps = 35/497 (7%)
 Frame = -2

Query  1986  QGIEFSQSKPQARVDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVL  1807
             Q ++F ++K +  ++  TGV F+DVAG+ +A ++LQE+VT+LK PE F  +G + P GVL
Sbjct  159   QAMQFGKTKARFAMEAETGVVFDDVAGVNEAKQDLQEVVTFLKKPEKFTSVGARIPKGVL  218

Query  1806  LEGPPGCGKTLVAKAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIF  1627
             L GPPG GKTL+AKAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLFKRAK N P +IF
Sbjct  219   LVGPPGTGKTLLAKAIAGEAGVPFFSLSGSEFVEMFVGVGASRVRDLFKRAKENSPCLIF  278

Query  1626  IDEIDALATKRQGIFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMD  1447
             IDEIDA+  +R       +D        ERE TLNQLLTE+DGF+   G+I + ATNR D
Sbjct  279   IDEIDAVGRQRGAGIGGGND--------EREQTLNQLLTEMDGFEGNSGIIIIAATNRPD  330

Query  1446  LLDPALLRPGRFDRKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKl  1267
             +LD AL+RPGRFDR++ +  P+ KGRL IL+VHAR  KL + + L S A+  PG++GA L
Sbjct  331   VLDSALMRPGRFDRQVTVDAPDIKGRLSILEVHARNKKLQDDLTLESIARRTPGFTGADL  390

Query  1266  aqllqeaalvaVRKGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRR--ATTEVGTA  1093
             A LL EAA++  R+  +SI  S++DD+VDR+  G +  G  L   G+ +R  A  EVG A
Sbjct  391   ANLLNEAAILTARRRKDSISISEIDDSVDRIVAGME--GSPL-TDGRSKRLIAYHEVGHA  447

Query  1092  LTSHLLRHYENAKVECCDRISINPRGQTLSQVVFHRLDDESYMFERRPQLLHRLQVLLGG  913
             L   L++ ++  +     ++++ PRGQ      F   DDE  +   R QL  R+   LGG
Sbjct  448   LIGSLVKDHDPVQ-----KVTVIPRGQAKGLTWFTP-DDEQTLVS-RAQLKARIMGALGG  500

Query  912   RAAEEVIYGR-DTSKASVSYLADATWLARKMITVWNLENPMTIHGEPLPWRKSPKFVGPR  736
             RAAE+V++G+ + +  +         +AR+M+T + + N   I    L       FVG  
Sbjct  501   RAAEDVVFGKGEITTGAGGDFQQVASMARQMVTRFGMSNLGPI---ALESGNQEVFVGRD  557

Query  735   LDFEGSLYDDYDLIEPPLNFDLDDDVSKRTEALIRDTYAKTlallrqhhaallktvkvll  556
             L     + D            +   + +    ++++ Y +T A++ ++  A+ K V +L+
Sbjct  558   LMTRSEVSD-----------SISKQIDESVRVMVKECYKETYAIVSKNREAMDKIVDLLI  606

Query  555   kqKEISGEEIDFILSNY  505
             +++ + GEE   ILSN+
Sbjct  607   EKETLDGEEFTRILSNF  623



>ref|WP_009787350.1| cell division protein FtsH [Lyngbya sp. PCC 8106]
 gb|EAW34085.1| ATP-dependent Zn protease [Lyngbya sp. PCC 8106]
Length=618

 Score =   322 bits (825),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 196/454 (43%), Positives = 292/454 (64%), Gaps = 27/454 (6%)
 Frame = -2

Query  2127  YQVYTFGGISASIEVLKPILLVFLTMVLLVRFTLSRRPKNFRKWDIWQGIEFSQSKPQAR  1948
             Y+V      SA++ ++  +L++F+ +  L    + RR          Q + F +S+ + +
Sbjct  96    YEVTPTADNSAAMGLIVNLLVIFVVLAFL--LMILRRSTQAS----GQAMNFGKSRAKFQ  149

Query  1947  VDGMTGVTFNDVAGIEQAVEELQELVTYLKNPELFDKMGIKPPHGVLLEGPPGCGKTLVA  1768
             ++  TG+ F+DVAGIE+A EELQE+VT+LK PE F  +G K P GVLL GPPG GKTL+A
Sbjct  150   MEAKTGILFDDVAGIEEAKEELQEVVTFLKQPERFTAIGAKIPKGVLLVGPPGTGKTLLA  209

Query  1767  KAIAGEAGVPFYQMAGSEFVEVLVGVGAARIRDLFKRAKVNKPSVIFIDEIDALATKRQG  1588
             KAIAGEAGVPF+ ++GSEFVE+ VGVGA+R+RDLF++AK N P ++FIDEIDA+  +R  
Sbjct  210   KAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFRKAKENSPCIVFIDEIDAVGRQRGA  269

Query  1587  IFNDSSDDQYNAATQERETTLNQLLTELDGFDTGKGVIFLGATNRMDLLDPALLRPGRFD  1408
                  +D        ERE TLNQLLTE+DGF+   G+I + ATNR D+LD ALLRPGRFD
Sbjct  270   GIGGGND--------EREQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDTALLRPGRFD  321

Query  1407  RKIRIRPPNAKGRLGILKVHARKVKLSETVDLTSYAQNLPGWSGAKlaqllqeaalvaVR  1228
             R++ +  P+  GRLGIL+VHAR  KL + V L + A+  PG+SGA LA LL EAA++  R
Sbjct  322   RQVIVDLPSYNGRLGILQVHARNKKLHDDVSLEAIARRTPGFSGADLANLLNEAAILTAR  381

Query  1227  KGHNSILRSDMDDAVDRLTVGPKRVGIDLGHQGQCRRATTEVGTALTSHLLRHYENAKVE  1048
             +   +I   ++DDAVDR+T+G     + L  + +   A  E+G AL   LL   EN+  +
Sbjct  382   RRKEAISLGEIDDAVDRITIGLSLAPL-LDSKKKRLIAYHEIGHALLMTLL---ENS--D  435

Query  1047  CCDRISINPRGQTL---SQVVFHRLDDESYMFERRPQLLHRLQVLLGGRAAEEVIYG-RD  880
               ++++I PR   +   +Q VF+    +S ++  R  L+ ++ + LGGRA+E+VI+G  +
Sbjct  436   PLNKVTIIPRSGGVGGFAQQVFNEEMVDSGLYT-RSWLIDQITIALGGRASEDVIFGDSE  494

Query  879   TSKASVSYLADATWLARKMITVWNLEN--PMTIH  784
              +  + + +   T LAR+M+T + + +  P+++ 
Sbjct  495   VTVGASNDIQRVTNLAREMVTRYGMSDLGPLSLE  528



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11070421262576