BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78978_g1_i1 len=1241 path=[1:0-1240]

Length=1241
                                                                      Score     E

ref|XP_011077625.1|  PREDICTED: PRA1 family protein A1                  397   1e-134   
ref|XP_006429195.1|  hypothetical protein CICLE_v10012766mg             396   3e-134   
ref|XP_008442509.1|  PREDICTED: PRA1 family protein A1-like             393   5e-133   
gb|KGN58836.1|  hypothetical protein Csa_3G733900                       392   1e-132   
gb|KDP24547.1|  hypothetical protein JCGZ_25111                         392   1e-132   
emb|CDP06568.1|  unnamed protein product                                391   2e-132   
ref|XP_011094914.1|  PREDICTED: PRA1 family protein A1-like             391   2e-132   
gb|EYU41776.1|  hypothetical protein MIMGU_mgv1a013830mg                390   4e-132   
ref|XP_004137757.1|  PREDICTED: PRA1 family protein A2-like             389   1e-131   
ref|XP_004156583.1|  PREDICTED: PRA1 family protein A1-like             389   1e-131   
ref|XP_002273794.1|  PREDICTED: PRA1 family protein A1                  389   1e-131   Vitis vinifera
ref|XP_011019218.1|  PREDICTED: PRA1 family protein A1-like             388   4e-131   
emb|CAN72272.1|  hypothetical protein VITISV_025566                     387   5e-131   Vitis vinifera
ref|XP_004302701.1|  PREDICTED: PRA1 family protein A1-like             385   5e-130   
ref|XP_009345427.1|  PREDICTED: PRA1 family protein A1-like             385   5e-130   
ref|XP_007208689.1|  hypothetical protein PRUPE_ppa011474mg             385   6e-130   
ref|XP_007140465.1|  hypothetical protein PHAVU_008G114700g             384   2e-129   
ref|XP_003552205.1|  PREDICTED: PRA1 family protein A1-like             383   2e-129   
ref|XP_009620482.1|  PREDICTED: PRA1 family protein A1-like             383   3e-129   
gb|EYU26614.1|  hypothetical protein MIMGU_mgv1a013849mg                383   3e-129   
ref|XP_008240319.1|  PREDICTED: PRA1 family protein A1-like             383   4e-129   
ref|XP_008387832.1|  PREDICTED: PRA1 family protein A1-like             383   4e-129   
ref|XP_009358782.1|  PREDICTED: PRA1 family protein A1-like             383   4e-129   
ref|NP_001237681.1|  uncharacterized protein LOC100527037               382   7e-129   
ref|XP_002309088.2|  prenylated rab acceptor family protein             382   1e-128   Populus trichocarpa [western balsam poplar]
ref|XP_004515942.1|  PREDICTED: PRA1 family protein A1-like isofo...    382   1e-128   
ref|XP_008369948.1|  PREDICTED: PRA1 family protein A1-like             381   2e-128   
ref|XP_009792775.1|  PREDICTED: PRA1 family protein A1-like isofo...    381   2e-128   
gb|KEH23034.1|  PRA1 (prenylated RAB acceptor) family protein           379   1e-127   
gb|AFK38488.1|  unknown                                                 377   4e-127   
ref|XP_007026902.1|  Prenylated RAB acceptor 1.A1                       377   6e-127   
ref|XP_010262642.1|  PREDICTED: PRA1 family protein A1                  377   7e-127   
ref|XP_006846396.1|  hypothetical protein AMTR_s00012p00264280          377   8e-127   
ref|XP_004249545.1|  PREDICTED: PRA1 family protein A1-like             377   1e-126   
ref|XP_006340991.1|  PREDICTED: PRA1 family protein A1-like             376   1e-126   
ref|XP_009621146.1|  PREDICTED: PRA1 family protein A1-like isofo...    375   5e-126   
ref|XP_004246436.1|  PREDICTED: PRA1 family protein A1                  374   7e-126   
ref|XP_010037791.1|  PREDICTED: PRA1 family protein A1-like             373   3e-125   
ref|XP_006398667.1|  hypothetical protein EUTSA_v10014680mg             369   1e-123   
gb|KHG14192.1|  PRA1 family protein A1                                  368   3e-123   
ref|XP_010543267.1|  PREDICTED: PRA1 family protein A1-like             366   1e-122   
ref|XP_010558341.1|  PREDICTED: PRA1 family protein A1-like             365   2e-122   
ref|XP_009398802.1|  PREDICTED: PRA1 family protein A1-like             365   3e-122   
ref|XP_009130678.1|  PREDICTED: PRA1 family protein A1                  364   9e-122   
ref|XP_010088573.1|  hypothetical protein L484_016965                   363   1e-121   
emb|CDX80799.1|  BnaC03g00530D                                          362   7e-121   
ref|XP_010695670.1|  PREDICTED: PRA1 family protein A1-like isofo...    361   1e-120   
ref|XP_006645008.1|  PREDICTED: PRA1 family protein A1-like             360   3e-120   
ref|XP_010937541.1|  PREDICTED: PRA1 family protein A1-like             358   1e-119   
ref|XP_004961885.1|  PREDICTED: PRA1 family protein A1-like             358   1e-119   
ref|XP_008654326.1|  PREDICTED: hypothetical protein isoform X1         357   4e-119   
ref|XP_002870948.1|  prenylated rab acceptor family protein             357   6e-119   
ref|XP_006288417.1|  hypothetical protein CARUB_v10001675mg             358   1e-118   
ref|XP_010695667.1|  PREDICTED: PRA1 family protein A1-like isofo...    356   1e-118   
ref|XP_010920497.1|  PREDICTED: PRA1 family protein A1-like             355   3e-118   
ref|XP_008801639.1|  PREDICTED: PRA1 family protein A1-like             355   4e-118   
ref|XP_010256784.1|  PREDICTED: PRA1 family protein A1-like             355   4e-118   
ref|XP_006654502.1|  PREDICTED: PRA1 family protein A1-like             355   4e-118   
dbj|BAK02094.1|  predicted protein                                      354   6e-118   
ref|NP_001055724.2|  Os05g0455600                                       354   7e-118   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001288446.1|  uncharacterized protein LOC103630431               351   8e-117   
ref|XP_002458760.1|  hypothetical protein SORBIDRAFT_03g039810          350   2e-116   Sorghum bicolor [broomcorn]
ref|XP_010044003.1|  PREDICTED: PRA1 family protein A1-like             350   3e-116   
gb|EAY98283.1|  hypothetical protein OsI_20191                          350   9e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_004970571.1|  PREDICTED: PRA1 family protein A1-like isofo...    348   2e-115   
ref|NP_001044801.2|  Os01g0847900                                       345   2e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568326.1|  PREDICTED: PRA1 family protein A1-like             341   6e-113   
ref|XP_010452037.1|  PREDICTED: PRA1 family protein A1-like             338   1e-111   
ref|XP_010490619.1|  PREDICTED: PRA1 family protein A1-like             337   4e-111   
ref|XP_010423906.1|  PREDICTED: PRA1 family protein A1                  335   1e-110   
ref|XP_008363886.1|  PREDICTED: PRA1 family protein A1-like             333   3e-110   
gb|AAU90214.1|  unknow protein                                          333   7e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008803140.1|  PREDICTED: PRA1 family protein A1-like             333   1e-109   
ref|XP_002315199.1|  prenylated rab acceptor family protein             331   8e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011035742.1|  PREDICTED: PRA1 family protein A3-like             331   8e-109   
ref|XP_011036056.1|  PREDICTED: PRA1 family protein A2-like             330   3e-108   
ref|XP_002312119.1|  prenylated rab acceptor family protein             327   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_002524234.1|  conserved hypothetical protein                     326   9e-107   Ricinus communis
ref|XP_002871193.1|  prenylated rab acceptor family protein             324   3e-106   
emb|CDY04974.1|  BnaAnng01560D                                          322   4e-105   
ref|NP_850778.1|  PRA1 family protein A2                                321   6e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399062.1|  hypothetical protein EUTSA_v10014679mg             320   1e-104   
ref|XP_010452511.1|  PREDICTED: PRA1 family protein A2                  320   1e-104   
emb|CDY14095.1|  BnaC02g02120D                                          320   2e-104   
ref|XP_009125625.1|  PREDICTED: PRA1 family protein A2-like             320   2e-104   
ref|XP_010558103.1|  PREDICTED: PRA1 family protein A2 isoform X1       318   1e-103   
ref|XP_010423396.1|  PREDICTED: PRA1 family protein A2-like             317   2e-103   
ref|NP_195824.1|  prenylated RAB acceptor 1.A1                          316   4e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381216.1|  hypothetical protein POPTR_0006s09220g             314   1e-102   
ref|NP_974282.1|  prenylated RAB acceptor 1.A3                          315   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EPS58479.1|  hypothetical protein M569_16335                         313   3e-102   
ref|XP_010495295.1|  PREDICTED: PRA1 family protein A3                  314   4e-102   
gb|AAM63057.1|  unknown                                                 313   8e-102   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80980.1|  BnaC03g02340D                                          313   1e-101   
ref|XP_009130905.1|  PREDICTED: PRA1 family protein A2                  313   1e-101   
emb|CDY08532.1|  BnaA05g27680D                                          312   1e-101   
gb|ABK27091.1|  unknown                                                 311   4e-101   Picea sitchensis
ref|XP_010486790.1|  PREDICTED: PRA1 family protein A3-like             311   5e-101   
ref|XP_010543766.1|  PREDICTED: PRA1 family protein A2                  310   9e-101   
gb|KDP44875.1|  hypothetical protein JCGZ_01375                         310   1e-100   
ref|XP_002882727.1|  prenylated rab acceptor family protein             310   1e-100   
gb|KCW49533.1|  hypothetical protein EUGRSUZ_K03055                     307   6e-100   
gb|KCW49530.1|  hypothetical protein EUGRSUZ_K03055                     306   1e-99    
ref|XP_009792776.1|  PREDICTED: PRA1 family protein A1-like isofo...    305   3e-99    
gb|KFK38504.1|  hypothetical protein AALP_AA3G121600                    306   5e-99    
ref|XP_009621147.1|  PREDICTED: PRA1 family protein A1-like isofo...    301   2e-97    
ref|NP_001189860.1|  cysteine/histidine-rich C1 domain-containing...    321   5e-97    
ref|XP_006407452.1|  hypothetical protein EUTSA_v10021519mg             300   8e-97    
ref|XP_009146733.1|  PREDICTED: PRA1 family protein A3                  300   1e-96    
ref|XP_002529863.1|  hypothetical protein RCOM_1157320                  304   4e-96    Ricinus communis
ref|XP_010468120.1|  PREDICTED: uncharacterized protein LOC104748136    314   7e-94    
ref|XP_006286388.1|  hypothetical protein CARUB_v10001963mg             291   5e-93    
gb|KDO36511.1|  hypothetical protein CISIN_1g031200mg                   289   5e-93    
ref|XP_006299182.1|  hypothetical protein CARUB_v10015327mg             310   7e-93    
ref|XP_001785203.1|  predicted protein                                  257   6e-80    
ref|XP_001777603.1|  predicted protein                                  253   2e-78    
emb|CDY53323.1|  BnaCnng24850D                                          250   1e-77    
ref|XP_002962538.1|  hypothetical protein SELMODRAFT_141259             250   3e-77    
ref|XP_002962756.1|  hypothetical protein SELMODRAFT_78966              249   4e-77    
ref|XP_010495083.1|  PREDICTED: PRA1 family protein A2-like             248   7e-77    
gb|KCW86015.1|  hypothetical protein EUGRSUZ_B02720                     240   3e-74    
emb|CDY01015.1|  BnaC05g41850D                                          244   1e-73    
gb|ACU24194.1|  unknown                                                 239   1e-73    Glycine max [soybeans]
ref|XP_010558105.1|  PREDICTED: PRA1 family protein A2 isoform X2       239   1e-73    
gb|AAL06948.1|  AT5g02040/T7H20_90                                      238   1e-72    Arabidopsis thaliana [mouse-ear cress]
gb|EMS47117.1|  hypothetical protein TRIUR3_07819                       235   1e-71    
emb|CDM85014.1|  unnamed protein product                                231   7e-70    
ref|XP_006286386.1|  hypothetical protein CARUB_v10001963mg             219   5e-66    
ref|NP_001131465.1|  hypothetical protein                               214   1e-64    Zea mays [maize]
ref|XP_001761322.1|  predicted protein                                  214   1e-63    
ref|XP_010532359.1|  PREDICTED: PRA1 family protein A3-like             207   9e-62    
ref|XP_002500004.1|  hypothetical protein MICPUN_104760                 201   4e-58    Micromonas commoda
ref|XP_008674824.1|  PREDICTED: LOW QUALITY PROTEIN: PRA1 family ...    194   6e-57    
emb|CDY16186.1|  BnaA09g29200D                                          197   8e-57    
gb|AFW78233.1|  hypothetical protein ZEAMMB73_090719                    191   8e-56    
gb|KHG11674.1|  PRA1 family protein A2                                  176   2e-50    
emb|CDX73879.1|  BnaA03g31680D                                          171   7e-48    
gb|AFW78232.1|  hypothetical protein ZEAMMB73_090719                    161   2e-44    
ref|XP_005642700.1|  hypothetical protein COCSUDRAFT_31816              158   4e-42    
ref|XP_001696250.1|  hypothetical protein CHLREDRAFT_187088             150   5e-39    Chlamydomonas reinhardtii
gb|EMT22695.1|  hypothetical protein F775_11037                         125   6e-31    
gb|EMS58313.1|  hypothetical protein TRIUR3_22546                       115   1e-27    
tpg|DAA56838.1|  TPA: hypothetical protein ZEAMMB73_451006              115   1e-27    
ref|XP_002323524.2|  hypothetical protein POPTR_0016s10360g             108   3e-25    Populus trichocarpa [western balsam poplar]
emb|CDX69570.1|  BnaA10g19190D                                        97.8    1e-21    
ref|XP_002945943.1|  hypothetical protein VOLCADRAFT_115862           86.3    1e-15    
emb|CDY04976.1|  BnaAnng01580D                                        65.1    6e-10    
ref|XP_005188407.1|  PREDICTED: PRA1 family protein 3-like            59.3    5e-07    
ref|NP_001158615.1|  PRA1 family protein 3                            57.4    2e-06    Oncorhynchus mykiss
emb|CDQ61672.1|  unnamed protein product                              56.6    4e-06    
ref|XP_008277450.1|  PREDICTED: PRA1 family protein 3-like            56.2    5e-06    
ref|XP_010745648.1|  PREDICTED: PRA1 family protein 3                 56.2    6e-06    
ref|NP_001290772.1|  PRA1 family protein 3                            55.5    1e-05    
ref|XP_007560833.1|  PREDICTED: PRA1 family protein 3                 55.1    1e-05    
ref|XP_003136756.1|  PRA1 family protein                              55.1    1e-05    
emb|CAG04015.1|  unnamed protein product                              54.7    2e-05    Tetraodon nigroviridis
gb|ACI69213.1|  PRA1 family protein 3                                 54.3    3e-05    Salmo salar
gb|ACI33741.1|  PRA1 family protein 3                                 54.3    3e-05    Salmo salar
emb|CBN80979.1|  PRA1 family protein 3                                54.3    3e-05    
gb|EFO27323.2|  PRA1 family protein                                   53.9    3e-05    
ref|XP_005926317.1|  PREDICTED: PRA1 family protein 3-like            53.9    3e-05    
ref|XP_005801778.1|  PREDICTED: PRA1 family protein 3-like            53.9    3e-05    
ref|XP_003442836.1|  PREDICTED: PRA1 family protein 3-like            53.5    4e-05    
ref|XP_006794277.1|  PREDICTED: PRA1 family protein 3-like            53.5    5e-05    
ref|XP_004546348.1|  PREDICTED: PRA1 family protein 3-like            53.1    5e-05    
ref|XP_008412473.1|  PREDICTED: PRA1 family protein 3                 52.8    9e-05    
ref|XP_010732963.1|  PREDICTED: LOW QUALITY PROTEIN: PRA1 family ...  52.4    1e-04    
ref|XP_001862330.1|  PRA1 family protein 2                            52.4    1e-04    Culex quinquefasciatus
ref|NP_001187580.1|  pra1 family protein 3                            52.0    2e-04    
gb|KEH23866.1|  PRA1 family protein                                   52.0    2e-04    
ref|XP_008318681.1|  PREDICTED: PRA1 family protein 3-like            51.6    2e-04    
ref|XP_002001647.1|  GI16873                                          52.0    2e-04    Drosophila mojavensis
ref|XP_001961664.1|  GF19689                                          51.6    2e-04    Drosophila ananassae
emb|CAF96929.1|  unnamed protein product                              50.8    3e-04    Tetraodon nigroviridis
ref|XP_004018384.1|  PREDICTED: PRA1 family protein 3                 50.8    3e-04    
ref|XP_006630680.1|  PREDICTED: PRA1 family protein 3-like            50.8    4e-04    
ref|XP_005695807.1|  PREDICTED: PRA1 family protein 3                 50.8    4e-04    
ref|XP_005985463.1|  PREDICTED: PRA1 family protein 3                 50.8    4e-04    
ref|XP_010780797.1|  PREDICTED: PRA1 family protein 3                 50.8    4e-04    
ref|XP_009019141.1|  hypothetical protein HELRODRAFT_81043            50.4    4e-04    
gb|ACN60174.1|  PRA1 family protein 3                                 50.4    5e-04    Salmo salar
ref|XP_010873776.1|  PREDICTED: PRA1 family protein 3                 50.4    5e-04    
gb|ACI66695.1|  PRA1 family protein 3                                 50.4    5e-04    Salmo salar
ref|XP_002732529.1|  PREDICTED: PRA1 family protein 3-like            50.1    5e-04    Saccoglossus kowalevskii
ref|XP_002892203.1|  hypothetical protein ARALYDRAFT_470402           50.1    6e-04    
ref|XP_002015306.1|  GL18490                                          50.4    6e-04    Drosophila persimilis
ref|XP_002051820.1|  GJ17203                                          50.4    6e-04    Drosophila virilis
dbj|BAG51976.1|  unnamed protein product                              50.1    6e-04    Homo sapiens [man]
ref|XP_003973801.1|  PREDICTED: PRA1 family protein 3-like            50.1    6e-04    
gb|KFK31706.1|  hypothetical protein AALP_AA6G148400                  50.1    7e-04    
ref|XP_007447707.1|  PREDICTED: PRA1 family protein 3                 50.1    8e-04    
emb|CDQ75843.1|  unnamed protein product                              49.7    9e-04    
ref|XP_002430606.1|  pra1 protein, putative                           49.7    9e-04    Pediculus humanus corporis [human body lice]
ref|XP_004070879.1|  PREDICTED: PRA1 family protein 3-like            49.7    0.001    



>ref|XP_011077625.1| PREDICTED: PRA1 family protein A1 [Sesamum indicum]
Length=209

 Score =   397 bits (1019),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVTAEDL+EALREVDWSSPPRPLSEFFSRFTVPRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWSNVTAEDLVEALREVDWSSPPRPLSEFFSRFTVPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILGMGFLRRPLAI+AAL+TALSIAFLNDSFAG FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVFILGMGFLRRPLAILAALMTALSIAFLNDSFAGTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI++CG+PRWVFVLVFS VS ILWFVSCGLLTV WA ++GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIHVCGQPRWVFVLVFSAVSFILWFVSCGLLTVLWAFALGLLATLIH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006429195.1| hypothetical protein CICLE_v10012766mg [Citrus clementina]
 ref|XP_006493591.1| PREDICTED: PRA1 family protein A1-like [Citrus sinensis]
 gb|ESR42435.1| hypothetical protein CICLE_v10012766mg [Citrus clementina]
Length=209

 Score =   396 bits (1017),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 192/209 (92%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVPRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI  ILG+GFLRRP+AI+AALLTALSIAFLNDSFAG FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MITVILGLGFLRRPVAIIAALLTALSIAFLNDSFAGTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVL+FS VS ILW+VSCGLLTV WAL+VGLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLIFSCVSFILWYVSCGLLTVLWALAVGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_008442509.1| PREDICTED: PRA1 family protein A1-like [Cucumis melo]
Length=209

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWSSPPRP+SEFFSRFT+PRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLVDALREVDWSSPPRPISEFFSRFTIPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFIL +GFLRRPLAIVAA LTALSIAFLNDSFAG F+EKVTRTVRQFSPH+AAKMRPP
Sbjct  61   MIVFILALGFLRRPLAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVLVFS+VS +LWF+SCGLLTV W+LS GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSSVSFLLWFISCGLLTVLWSLSFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|KGN58836.1| hypothetical protein Csa_3G733900 [Cucumis sativus]
Length=209

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRP+SEFFSRFT+PRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPISEFFSRFTIPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFIL +GFLRRPLAIVAA LTALSIAFLNDSFAG F+EKVTRTVRQFSPH+AAKMRPP
Sbjct  61   MIVFILALGFLRRPLAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVLVFS+VS + WF+SCGLLTV W+LS GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSSVSFLFWFISCGLLTVLWSLSFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|KDP24547.1| hypothetical protein JCGZ_25111 [Jatropha curcas]
Length=209

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 204/209 (98%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVP+S AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPKSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFLRRP+A+VAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVFILGLGFLRRPVAMVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS+KR+I+ICGRPRWVFVLVFS+ S ILW+VSCGLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSSKRSIHICGRPRWVFVLVFSSASFILWYVSCGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>emb|CDP06568.1| unnamed protein product [Coffea canephora]
Length=209

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLIEALREVDWSSPPRP SEFFSRFTVPRSY+KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIEALREVDWSSPPRPPSEFFSRFTVPRSYSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI  ILG+GFLRRPLAIVAALLTALSIAFLNDSFAG F+EK+TRTVRQFSPHLAAKMRPP
Sbjct  61   MITVILGLGFLRRPLAIVAALLTALSIAFLNDSFAGTFSEKITRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKR I+ICGRPRWVFVLVFSTVS ILWFVSCG+LT+ WA ++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRTIHICGRPRWVFVLVFSTVSFILWFVSCGILTLLWAFAIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_011094914.1| PREDICTED: PRA1 family protein A1-like [Sesamum indicum]
Length=209

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVTAEDLIEALREVDWSSPPRP+SEFFSRFT+PRSYAKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWSNVTAEDLIEALREVDWSSPPRPISEFFSRFTLPRSYAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILGM FLRRPLAIVAAL TALSIAFLNDSFAG F+EK+TRTVRQFSPHLAAKMRPP
Sbjct  61   MIVFILGMAFLRRPLAIVAALTTALSIAFLNDSFAGTFSEKITRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFVLVFS VS ILW VSCG+LTV WA ++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIHICGRPRWVFVLVFSIVSFILWSVSCGILTVLWAFTIGLLATVIH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|EYU41776.1| hypothetical protein MIMGU_mgv1a013830mg [Erythranthe guttata]
Length=209

 Score =   390 bits (1002),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 191/209 (91%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVTAEDLI+ALREVDWSSPPRPL EFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWSNVTAEDLIDALREVDWSSPPRPLPEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILGMGFLRRPLAIVAAL+TAL+IAFLNDSFAG F+EKVTR+VRQFSPHLAAKMRP 
Sbjct  61   MIVFILGMGFLRRPLAIVAALMTALTIAFLNDSFAGTFSEKVTRSVRQFSPHLAAKMRPH  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS KRAIYICG PRWVFVLVFS+VS ILWFVSCGLLT+SWAL  GLLAT++H
Sbjct  121  LTPVIRGRPSVKRAIYICGWPRWVFVLVFSSVSFILWFVSCGLLTLSWALLTGLLATIIH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_004137757.1| PREDICTED: PRA1 family protein A2-like [Cucumis sativus]
Length=209

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRP+SEFFSRFT+PRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPISEFFSRFTIPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFIL +GFLRRPLAIVAA LTALSIAFLNDSFAG F+EKVTRTVRQFSPH+AAKMRPP
Sbjct  61   MIVFILALGFLRRPLAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVLVFS+VS + WF+SCGLLTV W+LS GLL  LVH
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSSVSFLFWFISCGLLTVLWSLSFGLLGMLVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_004156583.1| PREDICTED: PRA1 family protein A1-like [Cucumis sativus]
Length=209

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 188/209 (90%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRP+SEFFSRFT+PRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPISEFFSRFTIPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFIL +GFLRRPLAIVAA LTALSIAFLNDSFAG F+EKVTRTVRQFSPH+AAKMRPP
Sbjct  61   MIVFILALGFLRRPLAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVLVFS+VS + WF+SCGLLTV W+LS GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSSVSFLFWFISCGLLTVLWSLSFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLK RLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKPRLNTFREEFRAVWRNYSEL  209



>ref|XP_002273794.1| PREDICTED: PRA1 family protein A1 [Vitis vinifera]
 ref|XP_003632665.1| PREDICTED: PRA1 family protein A1 [Vitis vinifera]
 emb|CBI30487.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   389 bits (999),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWS+PPRPLSEFFSRFT+PRSY+KW+SRLKCN YYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSTPPRPLSEFFSRFTLPRSYSKWSSRLKCNFYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILGMGFLRRP+AIVAA LTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVFILGMGFLRRPIAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKR+I ICGRPRWVFVL+FS+VS ILWFVSC +LTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRSILICGRPRWVFVLIFSSVSFILWFVSCSILTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_011019218.1| PREDICTED: PRA1 family protein A1-like [Populus euphratica]
 ref|XP_011019219.1| PREDICTED: PRA1 family protein A1-like [Populus euphratica]
 ref|XP_011019220.1| PREDICTED: PRA1 family protein A1-like [Populus euphratica]
 ref|XP_011019221.1| PREDICTED: PRA1 family protein A1-like [Populus euphratica]
Length=209

 Score =   388 bits (996),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFT+P+S +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTLPKSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            M+V ILG+GFLRRPLAIVAALLTALSIAF+NDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MMVLILGLGFLRRPLAIVAALLTALSIAFMNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRW FV++FS VS  LW+VSCGLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWFFVMIFSLVSFTLWYVSCGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>emb|CAN72272.1| hypothetical protein VITISV_025566 [Vitis vinifera]
Length=209

 Score =   387 bits (995),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWS+PPRPLSEFFSRFT+PRSY+KW+SRLKCN YYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSTPPRPLSEFFSRFTLPRSYSKWSSRLKCNFYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILGMGFLRRP+AIVAA LTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVFILGMGFLRRPIAIVAAFLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKR+I ICGRPRWVFVL+FS+VS ILWFVSC +LTV WAL++GLL T++H
Sbjct  121  LTPVIRGRPSAKRSILICGRPRWVFVLIFSSVSFILWFVSCSILTVLWALAIGLLGTILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_004302701.1| PREDICTED: PRA1 family protein A1-like [Fragaria vesca subsp. 
vesca]
Length=209

 Score =   385 bits (989),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWSSPPRP SEFFSRFTVPRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTAEDLVDALREVDWSSPPRPFSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV ILG+ FL RPLAIVAA LTALSIAFLNDSFAG F+EKVTR+VRQFSPHLAAKMRPP
Sbjct  61   LIVLILGLAFLTRPLAIVAAFLTALSIAFLNDSFAGTFSEKVTRSVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFVL+FS+VS ILWFVSCGLL VSWALS GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVLIFSSVSFILWFVSCGLLVVSWALSFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFR VWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRQVWRNYSEL  209



>ref|XP_009345427.1| PREDICTED: PRA1 family protein A1-like [Pyrus x bretschneideri]
 ref|XP_009345428.1| PREDICTED: PRA1 family protein A1-like [Pyrus x bretschneideri]
Length=209

 Score =   385 bits (989),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAED+I+ALREVDWSSPPRPLSEFFSRFTVPRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTAEDVIDALREVDWSSPPRPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +LG+ FLRRPLA++AA+LTALSIAFLNDSFAG F+EKV+RTVRQFSPHLAAKMRPP
Sbjct  61   LIVLVLGLAFLRRPLALIAAVLTALSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV++FS+VS ILWFVSCGLLTV WAL+ GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVMIFSSVSFILWFVSCGLLTVLWALAFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNT+REEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTYREEFRAVWRNYSEL  209



>ref|XP_007208689.1| hypothetical protein PRUPE_ppa011474mg [Prunus persica]
 gb|EMJ09888.1| hypothetical protein PRUPE_ppa011474mg [Prunus persica]
Length=209

 Score =   385 bits (988),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFS+FTVPRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSKFTVPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+F+LG+ FLRRPLAIVAALLTALSIA LNDSFAG F+EKV+RTVRQFSPHLAAKMRPP
Sbjct  61   LIIFVLGLAFLRRPLAIVAALLTALSIAILNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV +FS+VS  LWFVSCGLLTV WAL+ GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVFLFSSVSFFLWFVSCGLLTVLWALAFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_007140465.1| hypothetical protein PHAVU_008G114700g [Phaseolus vulgaris]
 gb|ESW12459.1| hypothetical protein PHAVU_008G114700g [Phaseolus vulgaris]
Length=209

 Score =   384 bits (985),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWS PPRPLSEFFSRFTVPRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTAEDLVDALREVDWSLPPRPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +L +GFLRRPLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIVSVLILGFLRRPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVL+FS+ S ILWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLLFSSASFILWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_003552205.1| PREDICTED: PRA1 family protein A1-like [Glycine max]
 gb|KHN34107.1| PRA1 family protein A1 [Glycine soja]
Length=209

 Score =   383 bits (984),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 186/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVPRS +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +L +GFLRRPLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIVSVLILGFLRRPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS+KRAIYICGRPRWVFVL+FS+ S  LWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSSKRAIYICGRPRWVFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_009620482.1| PREDICTED: PRA1 family protein A1-like [Nicotiana tomentosiformis]
 ref|XP_009620483.1| PREDICTED: PRA1 family protein A1-like [Nicotiana tomentosiformis]
 ref|XP_009620484.1| PREDICTED: PRA1 family protein A1-like [Nicotiana tomentosiformis]
 ref|XP_009796099.1| PREDICTED: PRA1 family protein A1-like [Nicotiana sylvestris]
 ref|XP_009796100.1| PREDICTED: PRA1 family protein A1-like [Nicotiana sylvestris]
Length=209

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VT EDLIEALREVDWSSPPRPLSEFFSRFT PRS +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGTVTTEDLIEALREVDWSSPPRPLSEFFSRFTFPRSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLRRPLAIVAALLT LSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVTILALGFLRRPLAIVAALLTTLSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVL FS  S  LWFVSCGLLTV WAL++GLL+TL+H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLAFSLASFTLWFVSCGLLTVLWALAIGLLSTLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|EYU26614.1| hypothetical protein MIMGU_mgv1a013849mg [Erythranthe guttata]
Length=209

 Score =   383 bits (983),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VTAEDL+EALREVDWSSPPRPL+EFFSRFT+PRSYAKWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGTVTAEDLVEALREVDWSSPPRPLAEFFSRFTLPRSYAKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GF+RRPLAIVAAL+T+L IA LNDSFAG F+EKVTRTVRQFSPHLAAKMRP 
Sbjct  61   MIVFILGIGFIRRPLAIVAALVTSLGIALLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPS  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS KRAI+ICGRPRWVFVL+FSTV  +LWF+SCG++TV WA ++GLLATL+H
Sbjct  121  LTPVIRGRPSVKRAIHICGRPRWVFVLLFSTVGFLLWFLSCGIVTVLWAFAIGLLATLIH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_008240319.1| PREDICTED: PRA1 family protein A1-like [Prunus mume]
 ref|XP_008240322.1| PREDICTED: PRA1 family protein A1-like [Prunus mume]
Length=209

 Score =   383 bits (983),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFS+FTVPRS +KWNSRLKCN YYYRTNYFL
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSKFTVPRSSSKWNSRLKCNFYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+F+LG+ FLRRPLAIVAALLTALSIA LNDSFAG F+EKV RTVRQFSPHLAAKMRPP
Sbjct  61   LIIFVLGLAFLRRPLAIVAALLTALSIAILNDSFAGTFSEKVLRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV +FS+VS  LWFVSCGLLTV WAL+ GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVFIFSSVSFFLWFVSCGLLTVLWALAFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_008387832.1| PREDICTED: PRA1 family protein A1-like [Malus domestica]
 ref|XP_008387833.1| PREDICTED: PRA1 family protein A1-like [Malus domestica]
 ref|XP_008350458.1| PREDICTED: PRA1 family protein A1-like [Malus domestica]
 ref|XP_008350459.1| PREDICTED: PRA1 family protein A1-like [Malus domestica]
Length=209

 Score =   383 bits (983),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAED+I+ALREVDWSSPPRPLSEFFSRFT+PRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTAEDVIDALREVDWSSPPRPLSEFFSRFTIPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +LG+ FLR PLA++AA+LTALSIAFLNDSFAG F+EKV+RTVRQFSPHLAAKMRPP
Sbjct  61   LIVLVLGLAFLRSPLALIAAVLTALSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV++FS+VS ILWFVSCGLLTV WAL+ GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVMIFSSVSFILWFVSCGLLTVLWALAFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNT+REEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTYREEFRAVWRNYSEL  209



>ref|XP_009358782.1| PREDICTED: PRA1 family protein A1-like [Pyrus x bretschneideri]
 ref|XP_009358783.1| PREDICTED: PRA1 family protein A1-like [Pyrus x bretschneideri]
 ref|XP_009358784.1| PREDICTED: PRA1 family protein A1-like [Pyrus x bretschneideri]
Length=209

 Score =   383 bits (983),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 202/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAED+I+ALREVDWSSPPRPLSEFFSRFT+PRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTAEDVIDALREVDWSSPPRPLSEFFSRFTIPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +LG+ FLRRPLA++AA+LTALSIAFLNDSFAG F+EKV+RTVRQFSPHLAAKMRPP
Sbjct  61   LIVLVLGLAFLRRPLALIAAVLTALSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV++FS++S ILWFV+CGLLTV WAL+ GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVMIFSSMSFILWFVTCGLLTVLWALAFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNT+REEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTYREEFRAVWRNYSEL  209



>ref|NP_001237681.1| uncharacterized protein LOC100527037 [Glycine max]
 ref|XP_006582872.1| PREDICTED: uncharacterized protein LOC100527037 isoform X1 [Glycine 
max]
 gb|ACU16075.1| unknown [Glycine max]
 gb|KHN05099.1| PRA1 family protein A1 [Glycine soja]
Length=209

 Score =   382 bits (981),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVPRS +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +L +GFLRRPLAIVAALLTAL+IAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIVSVLILGFLRRPLAIVAALLTALNIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS+KRAIYICGRPRWVFVL+FS+ S  LWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSSKRAIYICGRPRWVFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_002309088.2| prenylated rab acceptor family protein [Populus trichocarpa]
 gb|EEE92611.2| prenylated rab acceptor family protein [Populus trichocarpa]
Length=209

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFT+P+S +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTLPKSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            M+V I+G+GFLRRPLAIVAALLTALSIAF+NDSFAG F+EKV RTVRQFSPHLAAKMRPP
Sbjct  61   MMVLIMGLGFLRRPLAIVAALLTALSIAFMNDSFAGTFSEKVMRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTP IRGRPSAKRAIYICGRPRW FV++FS VS  LW+VSCGLLTV WAL++GLLAT++H
Sbjct  121  LTPGIRGRPSAKRAIYICGRPRWFFVMIFSFVSFTLWYVSCGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_004515942.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Cicer arietinum]
 ref|XP_004515943.1| PREDICTED: PRA1 family protein A1-like isoform X2 [Cicer arietinum]
Length=209

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 200/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWSSPPRPLSEFFSRFT+PRS +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLVDALREVDWSSPPRPLSEFFSRFTLPRSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +L +GFLRRPL+IVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIVSVLILGFLRRPLSIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFVL+FS+ S  LWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_008369948.1| PREDICTED: PRA1 family protein A1-like [Malus domestica]
 ref|XP_008369949.1| PREDICTED: PRA1 family protein A1-like [Malus domestica]
Length=209

 Score =   381 bits (979),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 201/209 (96%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG+VTAED+I+ALREVDWSSPPRPLSEFFSRFTVPRS +KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGSVTAEDVIDALREVDWSSPPRPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +LG+ FLRRPLA++AA+LTALSIAFLNDSFAG F+EKV+RTVRQFSPHLAAKMRPP
Sbjct  61   LIVLVLGLAFLRRPLALIAAVLTALSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV++FS+VS ILWFVSCGLLTV WA+  GLLATL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVMIFSSVSFILWFVSCGLLTVLWAVXFGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNT+REEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTYREEFRAVWRNYSEL  209



>ref|XP_009792775.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Nicotiana 
sylvestris]
Length=209

 Score =   381 bits (978),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/209 (89%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNV+ +DLIEALREV+WSSPPRP SEFFSRFT PRSY KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVSTQDLIEALREVEWSSPPRPPSEFFSRFTFPRSYTKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLR PLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVVILALGFLRGPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV VFS VS  LWFVSCGLLTV WAL +GLLATLVH
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVFVFSIVSFFLWFVSCGLLTVLWALGIGLLATLVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|KEH23034.1| PRA1 (prenylated RAB acceptor) family protein [Medicago truncatula]
Length=209

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVPRS  KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSNKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +L +GFLRRPLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIVSVLILGFLRRPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFV +FS+ S  LWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVSIFSSASFFLWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|AFK38488.1| unknown [Medicago truncatula]
Length=209

 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVPRS  KWNSRLKCN YYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSSNKWNSRLKCNFYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV +L +GFLRRPLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIVSVLILGFLRRPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICGRPRWVFV +FS+ S  LWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGRPRWVFVSIFSSASFFLWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_007026902.1| Prenylated RAB acceptor 1.A1 [Theobroma cacao]
 gb|EOY07404.1| Prenylated RAB acceptor 1.A1 [Theobroma cacao]
Length=209

 Score =   377 bits (968),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 203/209 (97%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILGMGFLRRP+AI+AA+LTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVLILGMGFLRRPVAILAAILTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV +FS+VS ILW+VSCGLLTV WAL++ LLAT++H
Sbjct  121  LTPVIRGRPSAKRAIHICGRPRWVFVFIFSSVSFILWYVSCGLLTVLWALAIALLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010262642.1| PREDICTED: PRA1 family protein A1 [Nelumbo nucifera]
Length=209

 Score =   377 bits (968),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDLI+ALREVDWSSPPRPL+EFFS+FT PRS+AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTTEDLIDALREVDWSSPPRPLAEFFSKFTFPRSHAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILGMGFLRRPLAIVA+L+TAL+IAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIIFILGMGFLRRPLAIVASLVTALNIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            + PVIRGRPS ++AI+ICG+PRW+FVL+FS VS ILW  SCGLLTV WA ++GLLAT++H
Sbjct  121  MVPVIRGRPSPRKAIHICGKPRWMFVLIFSAVSCILWITSCGLLTVLWAFAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006846396.1| hypothetical protein AMTR_s00012p00264280 [Amborella trichopoda]
 gb|ERN08071.1| hypothetical protein AMTR_s00012p00264280 [Amborella trichopoda]
Length=209

 Score =   377 bits (967),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 179/209 (86%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL +ALREVDWSSPPRP+SEFFSRFT+PRSYAKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLADALREVDWSSPPRPVSEFFSRFTIPRSYAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            M++FILG+GFLR+PLAIVAALLT LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MVIFILGLGFLRKPLAIVAALLTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            + PVIRGRPS KR I+ICGRPRW+FV VFS  S  LWF SCGLLTV WA  +GLLAT++H
Sbjct  121  VAPVIRGRPSVKRQIHICGRPRWMFVFVFSAASFFLWFASCGLLTVLWAFVIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_004249545.1| PREDICTED: PRA1 family protein A1-like [Solanum lycopersicum]
 ref|XP_006339010.1| PREDICTED: PRA1 family protein A1-like [Solanum tuberosum]
Length=209

 Score =   377 bits (967),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VT EDLIEALREV+WSSPPRP SEFFSRFT PRSY+KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGTVTTEDLIEALREVEWSSPPRPFSEFFSRFTFPRSYSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLR+PLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRP 
Sbjct  61   MIVAILALGFLRKPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPA  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS KRAI+ICGRPRWVFV VFS VS  LWFVSCGLLTV WA  +GLLATL H
Sbjct  121  LTPVIRGRPSTKRAIFICGRPRWVFVFVFSIVSFFLWFVSCGLLTVLWAFGIGLLATLAH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFR+PNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRSPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006340991.1| PREDICTED: PRA1 family protein A1-like [Solanum tuberosum]
Length=209

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/209 (88%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VT EDLIEALREVDWSSPPRP SEFFSRFT PRS +KWNSR+KCNLYYYRTNYF+
Sbjct  1    MDWGTVTTEDLIEALREVDWSSPPRPPSEFFSRFTFPRSSSKWNSRVKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLRRPLAIVAA LT LSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVAILALGFLRRPLAIVAAFLTTLSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFVLVFS  S  LWFVSCGLLTV WAL++GLL+TL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVLVFSLASFFLWFVSCGLLTVLWALAIGLLSTLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_009621146.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=209

 Score =   375 bits (962),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNV+ +DLIEALREV+WSSPPRP SEFFSRFT PRSY KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVSTQDLIEALREVEWSSPPRPPSEFFSRFTFPRSYTKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLR PLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVVILALGFLRGPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPR VFV VFS VS  LWFVSCGLLTV WAL +GLLATLVH
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRSVFVFVFSIVSFFLWFVSCGLLTVLWALGIGLLATLVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFR VWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRPVWRNYSEL  209



>ref|XP_004246436.1| PREDICTED: PRA1 family protein A1 [Solanum lycopersicum]
 ref|XP_010325832.1| PREDICTED: PRA1 family protein A1 [Solanum lycopersicum]
Length=209

 Score =   374 bits (961),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VT EDLIEALREVDWSSPPRP SEFFSRFT PRS +KWNSR+KCNLYYYRTNYF+
Sbjct  1    MDWGTVTTEDLIEALREVDWSSPPRPPSEFFSRFTFPRSSSKWNSRVKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLRRPLAIVAA LT LSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVAILALGFLRRPLAIVAAFLTTLSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFVL+FS  S  LWF SCGLLTV WAL++GLL+TL+H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVLIFSLASFFLWFASCGLLTVLWALAIGLLSTLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010037791.1| PREDICTED: PRA1 family protein A1-like [Eucalyptus grandis]
 gb|KCW49531.1| hypothetical protein EUGRSUZ_K03055 [Eucalyptus grandis]
 gb|KCW49532.1| hypothetical protein EUGRSUZ_K03055 [Eucalyptus grandis]
Length=209

 Score =   373 bits (957),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWS PPRPL EFFSRFTVPRSYAKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLMDALREVDWSLPPRPLPEFFSRFTVPRSYAKWSSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLRRPLAI+AALLT LSIAFLNDSFAG F+EKVTR+VRQFSPHLAAKMRP 
Sbjct  61   MIVVILALGFLRRPLAIIAALLTTLSIAFLNDSFAGTFSEKVTRSVRQFSPHLAAKMRPS  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKR +++CG+PRWVFVL+FS+ S +LW++SCGLLTV WAL +GL ATL+H
Sbjct  121  LTPVIRGRPSAKRTVHVCGQPRWVFVLIFSSASLVLWYLSCGLLTVLWALLIGLSATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006398667.1| hypothetical protein EUTSA_v10014680mg [Eutrema salsugineum]
 ref|XP_006398668.1| hypothetical protein EUTSA_v10014680mg [Eutrema salsugineum]
 gb|ESQ40120.1| hypothetical protein EUTSA_v10014680mg [Eutrema salsugineum]
 gb|ESQ40121.1| hypothetical protein EUTSA_v10014680mg [Eutrema salsugineum]
Length=209

 Score =   369 bits (946),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 175/209 (84%), Positives = 197/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL++ALREVDWSSPPRPLSEFFSRFTVP+S AKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVDALREVDWSSPPRPLSEFFSRFTVPKSLAKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFL RPLAI+++LLTALS+AFLNDSFAG+F+EK TRT+R+FSP LAAKMRPP
Sbjct  61   MIVFILGLGFLTRPLAILSSLLTALSVAFLNDSFAGSFSEKATRTIRRFSPPLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAIYICG+PRWVFVL+FS VS  LW++SCGL TVS AL +GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIYICGQPRWVFVLIFSLVSFALWYISCGLFTVSLALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEI  209



>gb|KHG14192.1| PRA1 family protein A1 [Gossypium arboreum]
Length=209

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 198/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPL EFFSRFT PRSYAKWNSR KCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLPEFFSRFTFPRSYAKWNSRFKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+GFLRRP+AI+AA+LTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVVILGLGFLRRPVAILAAMLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKR I+ICGRPRWVFV V STVS ILW+VSCGLLTV WAL++ LLAT++H
Sbjct  121  LTPVIRGRPSAKRTIHICGRPRWVFVFVLSTVSFILWYVSCGLLTVLWALAIALLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010543267.1| PREDICTED: PRA1 family protein A1-like [Tarenaya hassleriana]
Length=210

 Score =   366 bits (940),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 176/210 (84%), Positives = 197/210 (94%), Gaps = 1/210 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT +DL++ALREVDWSSPPRPLSEFFSRFTVP+S AKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVDDLVDALREVDWSSPPRPLSEFFSRFTVPKSCAKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFL RPLAI+AALLTAL++AFLNDSFAG F+EKVTRTVR+FSPHLAAKMRPP
Sbjct  61   MIVFILGLGFLTRPLAIIAALLTALTVAFLNDSFAGTFSEKVTRTVRKFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGR SAKRAI+ICG+PRWVFVLVFS VS  LW++SCGL TVS AL +GLLAT++H
Sbjct  121  LTPVIRGRTSAKRAIHICGQPRWVFVLVFSLVSFTLWYISCGLFTVSLALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWR-NYSEL  348
            AS RTPNLKARLNTFREEFRAVWR NY+E+
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNNYTEI  210



>ref|XP_010558341.1| PREDICTED: PRA1 family protein A1-like [Tarenaya hassleriana]
Length=209

 Score =   365 bits (938),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/209 (82%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL++ALREVDWSSPPRPLSEFFSRFTVP+S+AKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVDALREVDWSSPPRPLSEFFSRFTVPKSFAKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+GFL RPLAIVAALLT LS+AFLNDSFAGAF+EKVTRTVR+FSPHLAA+MRPP
Sbjct  61   MIVAILGLGFLTRPLAIVAALLTVLSVAFLNDSFAGAFSEKVTRTVRKFSPHLAARMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGR SAKR+I+ICG+PRWVFV+ FS VS +LW++SCGL  VS AL +GLLAT++H
Sbjct  121  LTPVIRGRRSAKRSIHICGQPRWVFVMAFSLVSFVLWYISCGLFMVSLALLIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNY+++
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYTDI  209



>ref|XP_009398802.1| PREDICTED: PRA1 family protein A1-like [Musa acuminata subsp. 
malaccensis]
Length=209

 Score =   365 bits (937),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDLI+ALREVDWSSPPRP+SEFFSRFT+PRSY+KWNSRLKCNLYYYRTNYFL
Sbjct  1    MDWGNVTTEDLIDALREVDWSSPPRPVSEFFSRFTLPRSYSKWNSRLKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+F+LG+GFLR+PLAI+AA LT LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAK+RPP
Sbjct  61   LIIFVLGLGFLRKPLAIIAAFLTGLSIAFLNDSFAVCFNEKVTRTVRQFSPHLAAKLRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+R R SAKRAI+ICG  RWVFVL+FS  S ILW  SC LLT+ WAL +GLLA L+H
Sbjct  121  MTPVLRARSSAKRAIHICGCRRWVFVLIFSAASCILWLTSCNLLTILWALVIGLLAILLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_009130678.1| PREDICTED: PRA1 family protein A1 [Brassica rapa]
 emb|CDY55115.1| BnaA03g54940D [Brassica napus]
Length=209

 Score =   364 bits (934),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 195/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWSSPPRPLSEFFSRFTVP+S AKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLVDALREVDWSSPPRPLSEFFSRFTVPKSLAKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFL RPLAI++A LTA+++AFLNDSFAG+F+EK TRT+R+FSP LAAKMRPP
Sbjct  61   MIVFILGLGFLTRPLAILSAFLTAVTVAFLNDSFAGSFSEKATRTIRRFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PVIRGRPSAKRAIYICG+PRWVFVL+ S VS  LW++SCGL TVS AL +GLLAT++H
Sbjct  121  LAPVIRGRPSAKRAIYICGQPRWVFVLISSLVSFALWYISCGLFTVSLALLIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            A+ RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ATLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_010088573.1| hypothetical protein L484_016965 [Morus notabilis]
 gb|EXB36714.1| hypothetical protein L484_016965 [Morus notabilis]
Length=209

 Score =   363 bits (933),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 199/209 (95%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVTAEDLI+ALREVDWSSPPRPLSEFFSRFT PRSY+KWNSRLKCN+YYYRTNYF+
Sbjct  1    MDWSNVTAEDLIDALREVDWSSPPRPLSEFFSRFTFPRSYSKWNSRLKCNIYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILG+GFL RPLA++AA LTALSIAFLNDSFAG FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIIFILGLGFLWRPLALLAAFLTALSIAFLNDSFAGTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKR+IYICGRPRWVFVL+ S+VS ILWFVS GLLTV WAL++GLLAT++H
Sbjct  121  LTPVIRGRPSAKRSIYICGRPRWVFVLIVSSVSFILWFVSAGLLTVLWALAIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYS+L
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSDL  209



>emb|CDX80799.1| BnaC03g00530D [Brassica napus]
Length=209

 Score =   362 bits (928),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG+VTAEDL++ALREVDWSSPPRPLSEFFSRFTVP+S AKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGSVTAEDLVDALREVDWSSPPRPLSEFFSRFTVPKSLAKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFL RPLAI++A LTA+++AFLNDSFAG+F+EK TRT+R FSP LAAKMRPP
Sbjct  61   MIVFILGLGFLTRPLAILSAFLTAVTVAFLNDSFAGSFSEKATRTIRSFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PVIRGRPSAKRAIYICG+PRWVFVL+ S VS  LW++SCGL TVS AL +GLLAT++H
Sbjct  121  LAPVIRGRPSAKRAIYICGQPRWVFVLISSLVSFALWYISCGLFTVSLALLIGLLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            A+ RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ATLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_010695670.1| PREDICTED: PRA1 family protein A1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695671.1| PREDICTED: PRA1 family protein A1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score =   361 bits (926),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG+VTAEDLI+ALREVDWSSPPRP SEFFSRFT+PRSY KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGSVTAEDLIDALREVDWSSPPRPFSEFFSRFTLPRSYPKWNSRLKCNLYYYRTNYFV  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILG+GFLRRPLAIVAA LTAL+IA LNDSFAG FNEKVTRTVRQFSPH+AAKMRPP
Sbjct  61   MIIFILGLGFLRRPLAIVAAALTALTIAVLNDSFAGTFNEKVTRTVRQFSPHIAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPSAKRAI+ICGRPRWVFV +FST S +LWF SCGLLTV  A  +GLLAT++H
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVSIFSTASFLLWFASCGLLTVLLAFFIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006645008.1| PREDICTED: PRA1 family protein A1-like [Oryza brachyantha]
Length=209

 Score =   360 bits (924),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +VTAEDL++ALREVDWS+PPRP+SEFFSRFT PRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSSVTAEDLVDALREVDWSTPPRPVSEFFSRFTAPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFLRRP++I+AA  T LSIAFLNDSFA  FNEKVTRTVR+FSPHLAAKMRPP
Sbjct  61   LIMFILGMGFLRRPVSILAAFSTGLSIAFLNDSFAVTFNEKVTRTVRKFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PVIRGRPS K++I+ICGRPRWVFVL FS VS ILW  SC LLTV WAL +GLLAT++H
Sbjct  121  LRPVIRGRPSTKKSIHICGRPRWVFVLFFSIVSCILWMTSCSLLTVLWALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSE  351
            ASFRTPNLKARLNTFREEFRAVWRNYSE
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSE  208



>ref|XP_010937541.1| PREDICTED: PRA1 family protein A1-like [Elaeis guineensis]
Length=209

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/209 (86%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRP+SEFFSRFTVPRSY+KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPVSEFFSRFTVPRSYSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFIL +GFL RPLAI+A +LT LSIAFLNDSFA  FNEKVTRTVRQFSPHLA K+RPP
Sbjct  61   MIVFILAIGFLLRPLAILATILTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAVKLRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPSAKRAI+ICGRPRWVFVLVFS  S +LW  SC LLTV WAL +GLLATL+H
Sbjct  121  ITPVLRGRPSAKRAIHICGRPRWVFVLVFSAASCVLWLTSCRLLTVLWALLIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_004961885.1| PREDICTED: PRA1 family protein A1-like [Setaria italica]
Length=209

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFL +P+AI+AA +T LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGMGFLWKPVAILAAFMTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRWVFVL FS VS ILW  SC LLTV WAL + L AT++H
Sbjct  121  ITPVLRGRPSSKRSIHICGRPRWVFVLFFSAVSCILWLTSCSLLTVLWALLIALFATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_008654326.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87851.1| unknown [Zea mays]
 gb|ACG45727.1| PRA1 family protein [Zea mays]
 gb|AFW81696.1| PRA1 family isoform 1 [Zea mays]
 gb|AFW81697.1| PRA1 family isoform 2 [Zea mays]
Length=209

 Score =   357 bits (917),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSMPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFL +P+AIVAA +T LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAK+RPP
Sbjct  61   LIMFILGMGFLWKPVAIVAAFMTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKLRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRWVFVL FS VS ILW  SC LLTV WAL + L AT++H
Sbjct  121  ITPVLRGRPSSKRSIHICGRPRWVFVLFFSAVSCILWLTSCSLLTVLWALLIALFATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_002870948.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47207.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   357 bits (915),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL++ALREVDWSSPPRP SEFFSRFTVP+S+AKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVDALREVDWSSPPRPPSEFFSRFTVPKSFAKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+GFL RPLAI +ALLTALS+AFLNDSFAG+F+EK TRT R+FSP LAAKMRPP
Sbjct  61   MIVVILGLGFLTRPLAIFSALLTALSVAFLNDSFAGSFSEKATRTTRRFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPVIRGRPS+KRAI++CG+PRW+FVL  S VS  LW++SCGL TVS AL +GLLAT++H
Sbjct  121  LTPVIRGRPSSKRAIHVCGQPRWIFVLTCSLVSFALWYISCGLFTVSLALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_006288417.1| hypothetical protein CARUB_v10001675mg [Capsella rubella]
 gb|EOA21315.1| hypothetical protein CARUB_v10001675mg [Capsella rubella]
Length=277

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -1

Query  983  IGGMDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTN  804
            +  MDWGNVT EDL++ALREVDWSSPPRP SEFFSRFTVP+S+AKW+SRLKCNLYYYRTN
Sbjct  66   LEAMDWGNVTVEDLVDALREVDWSSPPRPPSEFFSRFTVPKSFAKWDSRLKCNLYYYRTN  125

Query  803  YFLMIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKM  624
            YF+MIV ILG+GFL RPLAI +A+LTALS+AFLNDSFAG+F+EK TRT RQFSP LAAKM
Sbjct  126  YFIMIVVILGLGFLTRPLAIFSAVLTALSVAFLNDSFAGSFSEKATRTTRQFSPQLAAKM  185

Query  623  RPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLAT  444
            RPPLTP +RGRPSAKRAI++CG+PRWVFVL  S VS  LW++SCGL TVS AL +GLLAT
Sbjct  186  RPPLTPGVRGRPSAKRAIHVCGQPRWVFVLTCSLVSFALWYISCGLFTVSLALLIGLLAT  245

Query  443  LVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ++HAS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  246  VLHASLRTPNLKARLNTFREEFRAVWRNYSEI  277



>ref|XP_010695667.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695668.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010695669.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=210

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/210 (87%), Positives = 196/210 (93%), Gaps = 1/210 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG+VTAEDLI+ALREVDWSSPPRP SEFFSRFT+PRSY KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGSVTAEDLIDALREVDWSSPPRPFSEFFSRFTLPRSYPKWNSRLKCNLYYYRTNYFV  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILG+GFLRRPLAIVAA LTAL+IA LNDSFAG FNEKVTRTVRQFSPH+AAKMRPP
Sbjct  61   MIIFILGLGFLRRPLAIVAAALTALTIAVLNDSFAGTFNEKVTRTVRQFSPHIAAKMRPP  120

Query  614  LT-PVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLV  438
            LT PVIRGRPSAKRAI+ICGRPRWVFV +FST S +LWF SCGLLTV  A  +GLLAT++
Sbjct  121  LTRPVIRGRPSAKRAIFICGRPRWVFVSIFSTASFLLWFASCGLLTVLLAFFIGLLATVL  180

Query  437  HASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            HASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  HASFRTPNLKARLNTFREEFRAVWRNYSEL  210



>ref|XP_010920497.1| PREDICTED: PRA1 family protein A1-like [Elaeis guineensis]
 ref|XP_010920498.1| PREDICTED: PRA1 family protein A1-like [Elaeis guineensis]
 ref|XP_010920499.1| PREDICTED: PRA1 family protein A1-like [Elaeis guineensis]
 ref|XP_010920500.1| PREDICTED: PRA1 family protein A1-like [Elaeis guineensis]
 ref|XP_010920501.1| PREDICTED: PRA1 family protein A1-like [Elaeis guineensis]
Length=209

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDLI+ALREVDWSSPPRP++EFFSRFTVPRSY+KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTTEDLIDALREVDWSSPPRPVTEFFSRFTVPRSYSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFL RPLAI+A +LT+LSIAFLNDSFA  FNEKVTRTVRQFSPH+AAK+RP 
Sbjct  61   MIVFILGIGFLFRPLAILATILTSLSIAFLNDSFAVTFNEKVTRTVRQFSPHVAAKLRPS  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRP+AKRAI+ICGRPRWVFVLVFS  S ILW  SC LLTV W L +GLLATL+H
Sbjct  121  ITPVLRGRPAAKRAIHICGRPRWVFVLVFSAASCILWLTSCSLLTVLWVLLIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_008801639.1| PREDICTED: PRA1 family protein A1-like [Phoenix dactylifera]
Length=209

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDLI+AL+EVDWSSPPRP+SEFFSRFTVPRSY+KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTTEDLIDALKEVDWSSPPRPVSEFFSRFTVPRSYSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIVFILG+GFL RPLAI+A +LT LSIAFLNDSFA  FNEKVTRTVRQFSPH+AAK+RPP
Sbjct  61   MIVFILGIGFLFRPLAILATILTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHVAAKLRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RG+ SAKRAI+ICGRPRWVFVLVFS  S ILW  SC LLTV WAL +GLLATL+H
Sbjct  121  ITPVLRGQSSAKRAIHICGRPRWVFVLVFSAASCILWLTSCRLLTVLWALLIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010256784.1| PREDICTED: PRA1 family protein A1-like [Nelumbo nucifera]
Length=209

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/209 (88%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREV+WSSPPRPL+EFFS+FTVPRSYAKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVEWSSPPRPLTEFFSKFTVPRSYAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FI+GMGFLRRPLAI+AALLTALSIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIIFIIGMGFLRRPLAIIAALLTALSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPVIRGRPS KR I+ICG PRW+FVLVFS  S ILW  SCGLLTV WA  +GLLATL+H
Sbjct  121  VTPVIRGRPSPKRTIHICGWPRWMFVLVFSAASCILWITSCGLLTVLWAFVIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006654502.1| PREDICTED: PRA1 family protein A1-like [Oryza brachyantha]
Length=209

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILG+GF+ +P+AI+AA +T +SIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGIGFIWKPVAILAAFMTGVSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRW+FVL+FS VS +LW  SC LLTV WAL + L ATL+H
Sbjct  121  ITPVLRGRPSSKRSIHICGRPRWLFVLLFSAVSCMLWLTSCSLLTVLWALLIALFATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>dbj|BAK02094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score =   354 bits (909),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL+ ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVAALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILG+GFL +P+AI+AA +T  SIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGLGFLWKPVAILAAFMTGFSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPVIRGRPS+KR+I+ICGRPRW+FVL+FS VS +LW  SC LLTV WAL + LL T++H
Sbjct  121  ITPVIRGRPSSKRSIHICGRPRWLFVLLFSAVSCMLWLTSCSLLTVLWALLIALLTTVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|NP_001055724.2| Os05g0455600 [Oryza sativa Japonica Group]
 dbj|BAG95987.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97490.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87347.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF17638.2| Os05g0455600 [Oryza sativa Japonica Group]
Length=209

 Score =   354 bits (908),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILG+GF+ +P+AI+AA +T +SIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGIGFIWKPVAILAAFMTGISIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRW+FVL+FS VS +LW  SC LLTV WAL + + ATL+H
Sbjct  121  ITPVLRGRPSSKRSIHICGRPRWLFVLLFSAVSCMLWLTSCSLLTVLWALLIAIFATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|NP_001288446.1| uncharacterized protein LOC103630431 [Zea mays]
 gb|ACN28580.1| unknown [Zea mays]
 gb|AFW78231.1| hypothetical protein ZEAMMB73_090719 [Zea mays]
Length=209

 Score =   351 bits (901),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPR +SEFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRTVSEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFL +P+AI+AA +T LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGMGFLWKPVAILAAFMTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRP++KR+I+ICGRPR VFV+ FS VS ILW  SC LLTV WAL + L AT++H
Sbjct  121  ITPVLRGRPNSKRSIHICGRPRRVFVIFFSAVSCILWLTSCSLLTVLWALLIALFATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_002458760.1| hypothetical protein SORBIDRAFT_03g039810 [Sorghum bicolor]
 gb|EES03880.1| hypothetical protein SORBIDRAFT_03g039810 [Sorghum bicolor]
Length=209

 Score =   350 bits (898),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 194/209 (93%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +VTAEDL++ALREVDWS+PPRP+SEFFSRFT PRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSSVTAEDLVDALREVDWSTPPRPVSEFFSRFTAPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+F+LGMGFLR+P+AI+AAL T LSIAFLNDSFA  FNEK+TR+VRQFSPHLAAKMRPP
Sbjct  61   LIIFLLGMGFLRKPVAILAALATGLSIAFLNDSFAVTFNEKITRSVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPVIRGRPS +R+I+ICGRPRW+FVL+FS VS +LW  SC LLTV WAL +GLLATL+H
Sbjct  121  ITPVIRGRPSKRRSIHICGRPRWIFVLLFSAVSCVLWLTSCSLLTVLWALLIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010044003.1| PREDICTED: PRA1 family protein A1-like [Eucalyptus grandis]
 ref|XP_010044004.1| PREDICTED: PRA1 family protein A1-like [Eucalyptus grandis]
 gb|KCW86013.1| hypothetical protein EUGRSUZ_B02720 [Eucalyptus grandis]
 gb|KCW86014.1| hypothetical protein EUGRSUZ_B02720 [Eucalyptus grandis]
Length=209

 Score =   350 bits (898),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 191/209 (91%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VTAEDL  ALREV+WSSPPRP +EFFSRFT+PRSYAKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGAVTAEDLAGALREVEWSSPPRPPAEFFSRFTIPRSYAKWSSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+ ILG+GFLRRPLAIVAALLTALS A LNDSFAG F+EK+TRTVRQFSPH AAK+RP 
Sbjct  61   MIMVILGLGFLRRPLAIVAALLTALSTACLNDSFAGTFSEKITRTVRQFSPHFAAKLRPS  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAKR+I+ICG+PR VFV +F++ S +LW+VSCG+LT+ WA ++GLLAT++H
Sbjct  121  HIPVIRGRPSAKRSIHICGQPRRVFVSIFASASLVLWYVSCGILTLLWAFAIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYS+L
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSDL  209



>gb|EAY98283.1| hypothetical protein OsI_20191 [Oryza sativa Indica Group]
 gb|EEE63955.1| hypothetical protein OsJ_18780 [Oryza sativa Japonica Group]
Length=235

 Score =   350 bits (897),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILG+GF+ +P+AI+AA +T +SIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGIGFIWKPVAILAAFMTGISIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRW+FVL+FS VS +LW  SC LLTV WAL + + ATL+H
Sbjct  121  ITPVLRGRPSSKRSIHICGRPRWLFVLLFSAVSCMLWLTSCSLLTVLWALLIAIFATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYS  354
            ASFRTPNLKARLNTFREEFRAVWRNYS
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYS  207



>ref|XP_004970571.1| PREDICTED: PRA1 family protein A1-like isoform X1 [Setaria italica]
 ref|XP_004970572.1| PREDICTED: PRA1 family protein A1-like isoform X2 [Setaria italica]
Length=209

 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 192/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +VTAEDL++ALREVDWS+PPRP+SEFFSRFT PRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSSVTAEDLVDALREVDWSTPPRPVSEFFSRFTAPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++FILGMGFLR+P+AI+AAL T LSIAFLNDSFA  FNEKVTR+VRQFSPHLAAKMRPP
Sbjct  61   LVMFILGMGFLRKPVAILAALATGLSIAFLNDSFAVTFNEKVTRSVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
             TPVIRGRPS +R+I+ICGRPRWV VL+FS VS +LW  SC LLTV WAL +GLLATL+H
Sbjct  121  TTPVIRGRPSKRRSIHICGRPRWVLVLLFSAVSCMLWLTSCSLLTVLWALLIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|NP_001044801.2| Os01g0847900 [Oryza sativa Japonica Group]
 dbj|BAD82667.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG93568.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87133.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71801.1| hypothetical protein OsI_04430 [Oryza sativa Indica Group]
 gb|EEE55669.1| hypothetical protein OsJ_04073 [Oryza sativa Japonica Group]
 dbj|BAF06715.2| Os01g0847900 [Oryza sativa Japonica Group]
Length=209

 Score =   345 bits (886),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +VTAEDL++ALREVDWS+PPRP+SEFFSRFT PRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSSVTAEDLVDALREVDWSTPPRPVSEFFSRFTAPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFLR+P++I+AA  T LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGMGFLRKPVSILAAFSTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PVIRGRPS+KR+I+ICGRPRWVFV++FS VS  LW  SC LLTV WAL VGLLATL+H
Sbjct  121  LRPVIRGRPSSKRSIHICGRPRWVFVVLFSVVSCFLWMTSCSLLTVLWALIVGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSE  351
            ASFRTPNLKARLNTFREEFRAVWRNYSE
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSE  208



>ref|XP_003568326.1| PREDICTED: PRA1 family protein A1-like [Brachypodium distachyon]
Length=209

 Score =   341 bits (875),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFL +P+AI+AA +T +SIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  61   LIMFILGMGFLWKPVAILAAFMTGISIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRW+FVL+FS VS ILW  SC LLTVSWAL + LLATL+H
Sbjct  121  ITPVLRGRPSSKRSIHICGRPRWLFVLLFSAVSCILWLTSCSLLTVSWALLIALLATLLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010452037.1| PREDICTED: PRA1 family protein A1-like [Camelina sativa]
Length=209

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL++ALREVDWSSPPRP SEFFSRFTVP+S++KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVDALREVDWSSPPRPPSEFFSRFTVPKSFSKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+ ILG+GFL RPLAI +ALLTALS+AFLNDSFAG+F+EK TRT R FSP LAAKMRPP
Sbjct  61   MILVILGLGFLTRPLAIFSALLTALSVAFLNDSFAGSFSEKATRTTRNFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PV RGRPSAKRAI+ICG+PRWVFVL  S VS  LW++SCGL T+S AL +GLLAT++H
Sbjct  121  LKPVTRGRPSAKRAIHICGQPRWVFVLACSLVSLALWYISCGLFTLSLALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_010490619.1| PREDICTED: PRA1 family protein A1-like [Camelina sativa]
Length=209

 Score =   337 bits (864),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL+ ALREVDWSSPPRP SEFFSRFTVP+S++KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVHALREVDWSSPPRPPSEFFSRFTVPKSFSKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+ ILG+GFL RPLAI +ALLTALS+AFLNDSFAG+F+EK TRT R FSP LAAKMRPP
Sbjct  61   MILVILGLGFLTRPLAIFSALLTALSVAFLNDSFAGSFSEKATRTTRNFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PV RGRPSAKRAI++CG+PRWVFVL  S VS  LW++SCGL T+S AL +GLLAT++H
Sbjct  121  LKPVTRGRPSAKRAIHVCGQPRWVFVLTCSLVSLALWYISCGLFTLSLALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_010423906.1| PREDICTED: PRA1 family protein A1 [Camelina sativa]
Length=209

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL++ALREVDWSSPPRP SEFFSRFTVP+S++KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVDALREVDWSSPPRPPSEFFSRFTVPKSFSKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+GF  RPLAI +A LTALS+AFLNDSFAG+F+EK TRT R FSP LAAKMRPP
Sbjct  61   MIVVILGLGFFTRPLAIFSAFLTALSVAFLNDSFAGSFSEKATRTTRNFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            L PV RGRPSAKRAI++CG+PRWVFVL  S VS  LW++SCGL T+S AL +GLLAT++H
Sbjct  121  LKPVTRGRPSAKRAIHVCGQPRWVFVLTCSLVSLALWYISCGLFTLSLALLIGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_008363886.1| PREDICTED: PRA1 family protein A1-like, partial [Malus domestica]
Length=185

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 177/185 (96%), Gaps = 0/185 (0%)
 Frame = -1

Query  902  RPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAIVAALLTA  723
            RPLSEFFSRFTVPRS +KWNSRLKCNLYYYRTNYFL+IV +LG+ FLRRPLA++AA+LTA
Sbjct  1    RPLSEFFSRFTVPRSSSKWNSRLKCNLYYYRTNYFLLIVLVLGLAFLRRPLALIAAVLTA  60

Query  722  LSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWV  543
            LSIAFLNDSFAG F+EKV+RTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI+ICGRPRWV
Sbjct  61   LSIAFLNDSFAGTFSEKVSRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIFICGRPRWV  120

Query  542  FVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWR  363
            FV++FS+VS ILWFVSCGLLTV WA+  GLLATL+HASFRTPNLKARLNT+REEFRAVWR
Sbjct  121  FVMIFSSVSFILWFVSCGLLTVLWAVXFGLLATLLHASFRTPNLKARLNTYREEFRAVWR  180

Query  362  NYSEL  348
            NYSEL
Sbjct  181  NYSEL  185



>gb|AAU90214.1| unknow protein [Oryza sativa Japonica Group]
Length=204

 Score =   333 bits (855),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 185/209 (89%), Gaps = 5/209 (2%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPRP+ EFFSRFTVPRSY+KW SRL      YRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRPVPEFFSRFTVPRSYSKWTSRLN-----YRTNYFI  55

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILG+GF+ +P+AI+AA +T +SIAFLNDSFA  FNEKVTRTVRQFSPHLAAKMRPP
Sbjct  56   LIMFILGIGFIWKPVAILAAFMTGISIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKMRPP  115

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPS+KR+I+ICGRPRW+FVL+FS VS +LW  SC LLTV WAL + + ATL+H
Sbjct  116  ITPVLRGRPSSKRSIHICGRPRWLFVLLFSAVSCMLWLTSCSLLTVLWALLIAIFATLLH  175

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  176  ASFRTPNLKARLNTFREEFRAVWRNYSEL  204



>ref|XP_008803140.1| PREDICTED: PRA1 family protein A1-like [Phoenix dactylifera]
Length=199

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDLI+ALREVDWSSPPRP+SEFFSRFTVPRSY+KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTTEDLIDALREVDWSSPPRPVSEFFSRFTVPRSYSKWSSRLKCNLYYYRTNYFV  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILGMGFL RPLAI+A +LT LSIA LNDSFA  FNEKVTRTVRQFSPHLA K+RPP
Sbjct  61   MIIFILGMGFLLRPLAILATILTGLSIAILNDSFAVTFNEKVTRTVRQFSPHLAVKLRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +TPV+RGRPSAKRAI+ICG PRWVFVLVFS  S ILW  SC LLTV WAL +GLLATL+H
Sbjct  121  ITPVLRGRPSAKRAIHICGWPRWVFVLVFSAASCILWLTSCRLLTVLWALLIGLLATLLH  180

Query  434  ASFRTPNLKARLNTFREEF  378
            ASFRTPNLKARLNTFREEF
Sbjct  181  ASFRTPNLKARLNTFREEF  199



>ref|XP_002315199.1| prenylated rab acceptor family protein [Populus trichocarpa]
 gb|EEF01370.1| prenylated rab acceptor family protein [Populus trichocarpa]
Length=209

 Score =   331 bits (848),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI AL+E+DW+SPPRPL+EF S+FT+PRSY+KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIGALKEIDWTSPPRPLNEFLSKFTIPRSYSKWSSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+ ILG+  + RPLAI+A  L+AL+IAF NDSFA +F+EKVTRTVR+FSPHLAAKMRPP
Sbjct  61   LILLILGVACILRPLAILATALSALAIAFFNDSFAASFSEKVTRTVRKFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAK+++YICG+PR +FVL+FS  S +LW+ S  LL VSWA ++ +  T++H
Sbjct  121  HMPVIRGRPSAKKSVYICGQPRLLFVLLFSAASFLLWYSSGSLLYVSWAYAISIFVTVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_011035742.1| PREDICTED: PRA1 family protein A3-like [Populus euphratica]
Length=209

 Score =   331 bits (848),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI AL+EVDW+SPPRPL+EFFSRFT+PRSY+KW+SRLKCN YYYRTNYF+
Sbjct  1    MDWGNVTAEDLIGALKEVDWTSPPRPLNEFFSRFTIPRSYSKWSSRLKCNAYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+ ILG+  + RPLAI+A  L+ALSIAFLNDSFA  F+E+VTRTVR+FSPHLAAKMRP 
Sbjct  61   LILLILGVACILRPLAILATALSALSIAFLNDSFAATFSERVTRTVRKFSPHLAAKMRPR  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAK+++YI G+PR +FVL+FS VS +LW+ S  LL +SWAL  GLLAT++H
Sbjct  121  HMPVIRGRPSAKKSVYILGQPRLLFVLLFSAVSFVLWYASGSLLYISWALISGLLATVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASF+TPNLKARLNTFREEFRAVWRNYS+L
Sbjct  181  ASFKTPNLKARLNTFREEFRAVWRNYSDL  209



>ref|XP_011036056.1| PREDICTED: PRA1 family protein A2-like [Populus euphratica]
Length=209

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI AL+E+DW+SPPRPL+EF S+FT+PRSY+KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIGALKEIDWTSPPRPLNEFLSKFTIPRSYSKWSSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+ ILG+  + RPLAI+A  L+AL+IAF NDSFA +F+EKVTRTVR+FSPHLAAKMRPP
Sbjct  61   LILLILGVACILRPLAILATALSALAIAFFNDSFAASFSEKVTRTVRKFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAK+++YICG+PR +FVL+FS  S +LW+ S  LL VSWA  + +  T++H
Sbjct  121  HMPVIRGRPSAKKSVYICGQPRLLFVLLFSAASFLLWYSSGSLLYVSWAYVISIFVTVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASFRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_002312119.1| prenylated rab acceptor family protein [Populus trichocarpa]
 gb|EEE89486.1| prenylated rab acceptor family protein [Populus trichocarpa]
Length=209

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI AL+EVDW+SPPRPL+EFFSRFT+PRSY+KW+SRLKCN YYYRTNYF+
Sbjct  1    MDWGNVTAEDLIGALKEVDWTSPPRPLNEFFSRFTIPRSYSKWSSRLKCNSYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+ ILG+  + RPLAI+A  L+ALSIAFLNDSFA  F+E+VTRTVR+FSPHLAAKMRP 
Sbjct  61   LILLILGVACILRPLAILATALSALSIAFLNDSFAATFSERVTRTVRKFSPHLAAKMRPR  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAK+++YI G+PR +FVL+FS VS +LW+ S  LL +SWAL  GLL  ++H
Sbjct  121  HMPVIRGRPSAKKSVYILGQPRLLFVLLFSAVSFVLWYASGSLLYISWALISGLLVIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASF+TPNLKARLNTFREEFRAVWRNYS+L
Sbjct  181  ASFKTPNLKARLNTFREEFRAVWRNYSDL  209



>ref|XP_002524234.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38158.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 178/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VTAEDLI ALREVDWS+PPRP++EFFS+FT+PRSY KW+SR KCNLYYYR+NYF+
Sbjct  1    MDWGTVTAEDLIGALREVDWSTPPRPVNEFFSKFTIPRSYPKWDSRFKCNLYYYRSNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+  LG+  + RP+AIVA  LTALSIAFLNDSFA  F+EKVTRTVR+ SPH AAKMRPP
Sbjct  61   LIMLALGVACITRPMAIVATALTALSIAFLNDSFAATFSEKVTRTVRKVSPHWAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAK+++YICG+PR VFV +FS  S ILWF S  L TV WAL +GLL T++H
Sbjct  121  HMPVIRGRPSAKKSVYICGQPRGVFVFLFSAASFILWFTSSSLWTVLWALGIGLLVTVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFR VWRNYSEL
Sbjct  181  ASARTPNLKARLNTFREEFRQVWRNYSEL  209



>ref|XP_002871193.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47452.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV+AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVSAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV   LTALSIAFLNDSFA +FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LVIFVLGIALVTRPLAIVGTALTALSIAFLNDSFAASFNEKFIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +YICG+PRWVFV+ F T S ++WF SCGLL V +AL   L  T+VH
Sbjct  121  HMPVIRGRSAARKTVYICGKPRWVFVVTFLTASIVMWFSSCGLLWVLYALLTSLAVTIVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASMRTPNLKARLNTFREEFRAVWRNYSEL  209



>emb|CDY04974.1| BnaAnng01560D [Brassica napus]
Length=209

 Score =   322 bits (824),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR L EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSLGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV A  TALSIAFLNDSFA  FNEK+ RT+R FSPH+AAKMRPP
Sbjct  61   LVIFVLGLALITRPLAIVGAAFTALSIAFLNDSFAATFNEKLIRTIRLFSPHVAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV++F T S ++WF SCGLL V +AL   L   +VH
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVIFLTASLVMWFSSCGLLWVLYALLTSLTLVIVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|NP_850778.1| PRA1 family protein A2 [Arabidopsis thaliana]
 sp|Q8GWC3.1|PR1A2_ARATH RecName: Full=PRA1 family protein A2; Short=AtPRA1.A2 [Arabidopsis 
thaliana]
 dbj|BAC43523.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64001.1| unknown protein [Arabidopsis thaliana]
 gb|AED90951.1| PRA1 family protein A2 [Arabidopsis thaliana]
Length=209

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLA+V A LTALSIAFLNDSFA +FNEK  RT+R FSPH+AAKMRPP
Sbjct  61   LVIFVLGLALVTRPLALVGAALTALSIAFLNDSFAASFNEKFIRTIRHFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV+ F T S ++WF SCGLL V +AL   L   +VH
Sbjct  121  HMPVIRGRSTARKTVYVCGKPRWVFVITFLTASLVMWFSSCGLLWVLYALLTSLAVIIVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASIRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_006399062.1| hypothetical protein EUTSA_v10014679mg [Eutrema salsugineum]
 gb|ESQ40515.1| hypothetical protein EUTSA_v10014679mg [Eutrema salsugineum]
Length=209

 Score =   320 bits (821),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV A  TALSIAFLNDSFA  FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LMIFVLGLALITRPLAIVGAAFTALSIAFLNDSFAATFNEKFIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV++F T S ++WF SCGLL V +AL   L+  ++H
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVIFLTASLVMWFSSCGLLWVLYALLTSLVVIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010452511.1| PREDICTED: PRA1 family protein A2 [Camelina sativa]
Length=209

 Score =   320 bits (820),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV A LTALSIAFLNDSFA +FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LVIFLLGLALITRPLAIVGAALTALSIAFLNDSFAASFNEKFIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV+V  T S ++WF SCGLL V +AL   L+  ++H
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVVLLTASLVMWFSSCGLLWVLYALLTSLVVIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEI  209



>emb|CDY14095.1| BnaC02g02120D [Brassica napus]
Length=209

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV A  TALSIAFLNDSFA  FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LVIFVLGLALITRPLAIVGAAFTALSIAFLNDSFAATFNEKFIRTIRLFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV++F T S ++WF SCGLL V +AL   L   +VH
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVIFLTASLVMWFSSCGLLWVLYALLTSLTLVVVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_009125625.1| PREDICTED: PRA1 family protein A2-like [Brassica rapa]
Length=209

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR L EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSLGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV  + TALSIAFLNDSFA  FNEK  RT+R FSPH+AAKMRPP
Sbjct  61   LVIFVLGLALITRPLAIVGTVFTALSIAFLNDSFAATFNEKFIRTIRLFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV++F T S ++WF SCGLL V +A    L   +VH
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVIFLTASLVMWFSSCGLLWVLYAFLTSLFVVIVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010558103.1| PREDICTED: PRA1 family protein A2 isoform X1 [Tarenaya hassleriana]
Length=209

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV  ED+IEALREV+WS+PPRPL EFFSRF  PRS++K  SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAGEDVIEALREVEWSTPPRPLGEFFSRFAFPRSFSKLTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RP+AI+ A LTAL IAFLNDSFA +FNEKV RTVR+FSPHLAAKMRPP
Sbjct  61   LVIFVLGLALITRPVAIIGAALTALGIAFLNDSFAASFNEKVIRTVRRFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR SA++ IYICG+PR+V V +   VS +LWF SCGLL V +AL  G+LA ++H
Sbjct  121  HMPVIRGRSSARKTIYICGQPRFVSVFICLAVSLVLWFSSCGLLWVLYALLAGILAIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010423396.1| PREDICTED: PRA1 family protein A2-like [Camelina sativa]
Length=209

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV A LTALSIAFLNDSFA +FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LVIFLLGLALITRPLAIVGAALTALSIAFLNDSFAASFNEKFIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWV V+V  T S ++WF SCGLL V +A    L+  ++H
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVLVVVLLTASLVMWFSSCGLLWVLYAFLTSLVVIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|NP_195824.1| prenylated RAB acceptor 1.A1 [Arabidopsis thaliana]
 ref|NP_850753.1| prenylated RAB acceptor 1.A1 [Arabidopsis thaliana]
 sp|Q9LZM7.1|PR1A1_ARATH RecName: Full=PRA1 family protein A1; Short=AtPRA1.A1 [Arabidopsis 
thaliana]
 emb|CAB82977.1| putative protein [Arabidopsis thaliana]
 gb|AAK76649.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85056.1| unknown protein [Arabidopsis thaliana]
 gb|AED90424.1| prenylated RAB acceptor 1.A1 [Arabidopsis thaliana]
 gb|AED90425.1| prenylated RAB acceptor 1.A1 [Arabidopsis thaliana]
Length=209

 Score =   316 bits (810),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT +DL +ALREVDWSSPPRP SEFFSRFTVP+S  KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVDDLFDALREVDWSSPPRPPSEFFSRFTVPKSVPKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+G L RPLAI AALLTALS+AFLNDSFAG+F+EK TRTVR+FSP LAAKMRPP
Sbjct  61   MIVVILGLGVLTRPLAIFAALLTALSLAFLNDSFAGSFSEKATRTVRRFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPV RGRPS+KRAI++CG+PRWVFVL  S VS  LW++S GLL VS AL +  LAT++H
Sbjct  121  LTPVTRGRPSSKRAIHVCGQPRWVFVLTCSLVSFALWYISSGLLRVSVALLIAHLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKAR NTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARFNTFREEFRAVWRNYSEI  209



>ref|XP_006381216.1| hypothetical protein POPTR_0006s09220g [Populus trichocarpa]
 gb|ERP59013.1| hypothetical protein POPTR_0006s09220g [Populus trichocarpa]
Length=180

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 170/209 (81%), Gaps = 29/209 (14%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLI+ALREVDWSSPPRPLSEFFSRFT+P+S +KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIDALREVDWSSPPRPLSEFFSRFTLPKSSSKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            M+V I+G                              F+EKV RTVRQFSPHLAAKMRPP
Sbjct  61   MMVLIMG-----------------------------TFSEKVMRTVRQFSPHLAAKMRPP  91

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTP IRGRPSAKRAIYICGRPRW FV++FS VS  LW+VSCGLLTV WAL++GLLAT++H
Sbjct  92   LTPGIRGRPSAKRAIYICGRPRWFFVMIFSFVSFTLWYVSCGLLTVLWALAIGLLATILH  151

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  152  ASFRTPNLKARLNTFREEFRAVWRNYSEL  180



>ref|NP_974282.1| prenylated RAB acceptor 1.A3 [Arabidopsis thaliana]
 sp|Q8W115.1|PR1A3_ARATH RecName: Full=PRA1 family protein A3; Short=AtPRA1.A3 [Arabidopsis 
thaliana]
 gb|AAL58894.1|AF462798_1 At3g11395 [Arabidopsis thaliana]
 gb|AAM47329.1| At3g11395/At3g11395 [Arabidopsis thaliana]
 dbj|BAE99089.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75040.1| prenylated RAB acceptor 1.A3 [Arabidopsis thaliana]
Length=209

 Score =   315 bits (806),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAEDVIEALREVEWSASPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            + VF+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  61   LFVFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR + ++ +YICG+PR VFVL+  T S +LWF SCGLL V +AL+  LL  L+H
Sbjct  121  HMPVIRGRSATRKTVYICGQPRLVFVLLGLTASFVLWFTSCGLLWVLYALTTALLMILLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|EPS58479.1| hypothetical protein M569_16335, partial [Genlisea aurea]
Length=187

 Score =   313 bits (802),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 168/189 (89%), Gaps = 3/189 (2%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDLIEALREVDWSSPPRP+SEFFSRFT PRS+AKW SRLKCNLYYYR NYF+
Sbjct  1    MDWSTVTAEDLIEALREVDWSSPPRPVSEFFSRFTFPRSFAKWTSRLKCNLYYYRANYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILGMGFLRRPLAIVAAL+TALSIAFLNDSFAG F+EKVTRTVRQFSP LAAKMRPP
Sbjct  61   MIIFILGMGFLRRPLAIVAALMTALSIAFLNDSFAGTFSEKVTRTVRQFSPRLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATL-V  438
            LTPVIRGRPSAKR+I++CG+PRWVFVL+FS VS ILW VSCGL+ + WALS GLL    +
Sbjct  121  LTPVIRGRPSAKRSIHVCGKPRWVFVLIFSAVSFILWLVSCGLVVLLWALSFGLLGNFPI  180

Query  437  HASFRTPNL  411
            H  FR P L
Sbjct  181  H--FRIPML  187



>ref|XP_010495295.1| PREDICTED: PRA1 family protein A3 [Camelina sativa]
Length=209

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAEDVIEALREVEWSTSPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEKV RT+R FSPHLAAKMRPP
Sbjct  61   LLIFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKVIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR + ++ +Y+CG+PR VFVL+  T S +LWF SCGLL V +A +  LL  L+H
Sbjct  121  HMPVIRGRSATRKTVYVCGQPRLVFVLIGLTASFVLWFTSCGLLWVLYAFTTALLMILLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            A+ RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ATLRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|AAM63057.1| unknown [Arabidopsis thaliana]
Length=209

 Score =   313 bits (802),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT +DL +ALREVDWSSPPRP SEFFSRFTVP+S  KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVDDLFDALREVDWSSPPRPPSEFFSRFTVPKSVPKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+G L RPLAI AALLTALS+AFLNDSFAG+F+EK TRTV +FSP LAAKMRPP
Sbjct  61   MIVVILGLGVLTRPLAIFAALLTALSLAFLNDSFAGSFSEKATRTVIRFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            LTPV RGRPS+KRAI++CG+PRWVFVL  S VS  LW++S GLL VS AL +  LAT++H
Sbjct  121  LTPVTRGRPSSKRAIHVCGQPRWVFVLTCSLVSFALWYISSGLLRVSVALLIAHLATILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKAR NTFREEFRAVWRNYSE+
Sbjct  181  ASLRTPNLKARFNTFREEFRAVWRNYSEI  209



>emb|CDX80980.1| BnaC03g02340D [Brassica napus]
Length=209

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWENVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++ +LG+  + RPLAI+ A  TALS+AFLNDSFA +FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LVILVLGLALITRPLAILGAAFTALSLAFLNDSFAASFNEKFIRTIRFFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV+ F T S ++WF SCGLL V +A    L   +VH
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVTFLTTSLVMWFSSCGLLWVLYAFLTSLAVIIVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_009130905.1| PREDICTED: PRA1 family protein A2 [Brassica rapa]
 emb|CDY11345.1| BnaA03g01810D [Brassica napus]
Length=209

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWENVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++ +LG+  + RPLAI+ A  TALS+AFLNDSFA +FNEK  RT+R FSPHLAAKMRPP
Sbjct  61   LVILVLGLALITRPLAILGAAFTALSLAFLNDSFAASFNEKFIRTIRLFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV+ F T S ++WF SCGLL V +A    L   +VH
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWVFVVTFLTASLVMWFSSCGLLWVLYAFLTSLALIIVH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>emb|CDY08532.1| BnaA05g27680D [Brassica napus]
Length=209

 Score =   312 bits (800),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V A D++EALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAGDVVEALREVEWSTSPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK  RT+RQFSPHLAAKMRPP
Sbjct  61   LLIFVLGLALITRPLAIIGAALTALSLAFLNDSFAATFNEKAIRTIRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR ++++ +Y+CG+PR VFVL+  T S +LWF SCGLL + +AL+  LL  ++H
Sbjct  121  HMPVIRGRSASRKTVYVCGQPRLVFVLLGLTASFVLWFASCGLLWILYALATALLMIMLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|ABK27091.1| unknown [Picea sitchensis]
 gb|ACN40621.1| unknown [Picea sitchensis]
Length=210

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 189/210 (90%), Gaps = 1/210 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT EDL++AL+EV+W++PPRPL+EFFSRFTVPRSY+KWNSR KCNLYYYRTNYF+
Sbjct  1    MDWGNVTVEDLVDALQEVEWTAPPRPLNEFFSRFTVPRSYSKWNSRAKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I  +LG+ FL  PLA+ AA+L   S+A LNDSFA  FNE++TRTVR+ SPHLAAKMRPP
Sbjct  61   IITLVLGLAFLTNPLALFAAILAGFSLAILNDSFAITFNERLTRTVRKVSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAK-RAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLV  438
            +TPVIRGRP  + RAI+ICG+PRW+FVL+FS+ S+++WFVSCGLLTV WAL +GLL+TL+
Sbjct  121  VTPVIRGRPVKRTRAIHICGQPRWMFVLLFSSASALVWFVSCGLLTVLWALLLGLLSTLL  180

Query  437  HASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            HASFRTPNLKARLNTFREEFRAVWRNYS+L
Sbjct  181  HASFRTPNLKARLNTFREEFRAVWRNYSDL  210



>ref|XP_010486790.1| PREDICTED: PRA1 family protein A3-like [Camelina sativa]
Length=209

 Score =   311 bits (797),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  V AED+IEALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDIVAAEDVIEALREVEWSTSPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  61   LLIFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR + ++ +Y+CG+PR VFVL+  T S +LWF SCGLL V +A +  LL  L+H
Sbjct  121  HMPVIRGRSATRKTVYVCGQPRLVFVLIGLTASFVLWFTSCGLLWVLYAFTTALLMILLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            A+ RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ATLRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_010543766.1| PREDICTED: PRA1 family protein A2 [Tarenaya hassleriana]
Length=209

 Score =   310 bits (795),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR + EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSVGEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            + + +L +  + RP++I+ A LTALSIAFLNDSFA +FNEKV RTVR FSPHLAAKMRPP
Sbjct  61   LEILVLSLALITRPVSILGAALTALSIAFLNDSFAASFNEKVIRTVRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR  A++ IYICG+PRWV V +   VS +LWF SCGLL + + +  GLLA ++H
Sbjct  121  HMPVIRGRSLARKTIYICGQPRWVLVFICLAVSFVLWFSSCGLLWILYTILAGLLAIILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYS+L
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSDL  209



>gb|KDP44875.1| hypothetical protein JCGZ_01375 [Jatropha curcas]
Length=208

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 177/209 (85%), Gaps = 1/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWG VTAEDL+ ALREVDWS+PPRPL EFFSRFT+PRSY KWNSR KCNLYYYRTNYF+
Sbjct  1    MDWGTVTAEDLMGALREVDWSTPPRPLHEFFSRFTIPRSYPKWNSRFKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +IV  LG+  L RP+AI AA LTALSIAFLNDSFA  F+EKVTRTVR+FSPHLAAKMRPP
Sbjct  61   VIVLALGVACLTRPIAITAAALTALSIAFLNDSFAATFSEKVTRTVRKFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR SAK+++YICG+PR V V +FS  S ILWF S  LL V WA  +GLL T++H
Sbjct  121  HMPVIRGR-SAKKSVYICGQPRGVCVFLFSAASIILWFTSGSLLYVLWAFGIGLLVTIIH  179

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  180  ASVRTPNLKARLNTFREEFRAVWRNYSEL  208



>ref|XP_002882727.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58986.1| prenylated rab acceptor family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAEDVIEALREVEWSASPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++ +LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  61   LLICVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR + ++ +YICG+PR VFVL+  T S +LWF+SCGLL V +A +  +L  L+H
Sbjct  121  HMPVIRGRSATRKTVYICGQPRLVFVLIGLTASFVLWFMSCGLLWVLYAFTTAILMILLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|KCW49533.1| hypothetical protein EUGRSUZ_K03055 [Eucalyptus grandis]
Length=180

 Score =   307 bits (786),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWS PPRPL EFFSRFTVPRSYAKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLMDALREVDWSLPPRPLPEFFSRFTVPRSYAKWSSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLRRPLAI+AALLT LSIAFLNDSFAG F+EKVTR+VRQFSPHLAAKMRP 
Sbjct  61   MIVVILALGFLRRPLAIIAALLTTLSIAFLNDSFAGTFSEKVTRSVRQFSPHLAAKMRPS  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGL  453
            LTPVIRGRPSAKR +++CG+PRWVFVL+FS+ S +LW++SCGLLTV WAL +GL
Sbjct  121  LTPVIRGRPSAKRTVHVCGQPRWVFVLIFSSASLVLWYLSCGLLTVLWALLIGL  174



>gb|KCW49530.1| hypothetical protein EUGRSUZ_K03055 [Eucalyptus grandis]
Length=181

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWS PPRPL EFFSRFTVPRSYAKW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLMDALREVDWSLPPRPLPEFFSRFTVPRSYAKWSSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLRRPLAI+AALLT LSIAFLNDSFAG F+EKVTR+VRQFSPHLAAKMRP 
Sbjct  61   MIVVILALGFLRRPLAIIAALLTTLSIAFLNDSFAGTFSEKVTRSVRQFSPHLAAKMRPS  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGL  453
            LTPVIRGRPSAKR +++CG+PRWVFVL+FS+ S +LW++SCGLLTV WAL +GL
Sbjct  121  LTPVIRGRPSAKRTVHVCGQPRWVFVLIFSSASLVLWYLSCGLLTVLWALLIGL  174



>ref|XP_009792776.1| PREDICTED: PRA1 family protein A1-like isoform X2 [Nicotiana 
sylvestris]
Length=179

 Score =   305 bits (781),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNV+ +DLIEALREV+WSSPPRP SEFFSRFT PRSY KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVSTQDLIEALREVEWSSPPRPPSEFFSRFTFPRSYTKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLR PLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVVILALGFLRGPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWA  468
            LTPVIRGRPSAKRAI+ICGRPRWVFV VFS VS  LWFVSCGLLTV WA
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRWVFVFVFSIVSFFLWFVSCGLLTVLWA  169



>gb|KFK38504.1| hypothetical protein AALP_AA3G121600 [Arabis alpina]
Length=209

 Score =   306 bits (783),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR  +EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAEDVIEALREVEWSTSPRSFAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  61   LLIFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR + ++ +YICG+PR VFVL+    S +LWF SCGLL V +AL+  +   ++H
Sbjct  121  HMPVIRGRSATRKTVYICGQPRLVFVLLGLIASLVLWFTSCGLLWVLYALTTAIFMIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            A+ RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  181  ATLRTPNLKARLNTFREEFRAVWRNYSEI  209



>ref|XP_009621147.1| PREDICTED: PRA1 family protein A1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=179

 Score =   301 bits (770),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNV+ +DLIEALREV+WSSPPRP SEFFSRFT PRSY KWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVSTQDLIEALREVEWSSPPRPPSEFFSRFTFPRSYTKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV IL +GFLR PLAIVAALLTALSIAFLNDSFAG F+EKVTRTVRQFSPHLAAKMRPP
Sbjct  61   MIVVILALGFLRGPLAIVAALLTALSIAFLNDSFAGTFSEKVTRTVRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWA  468
            LTPVIRGRPSAKRAI+ICGRPR VFV VFS VS  LWFVSCGLLTV WA
Sbjct  121  LTPVIRGRPSAKRAIFICGRPRSVFVFVFSIVSFFLWFVSCGLLTVLWA  169



>ref|NP_001189860.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE75039.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis 
thaliana]
Length=910

 Score =   321 bits (823),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 181/228 (79%), Gaps = 2/228 (1%)
 Frame = -1

Query  1031  WFAPDTFCFSRVSRCPIGGMDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYA  852
             W    TFC S VS      MDW +V AED+IEALREV+WS+ PR L+EFFSRF  PRS++
Sbjct  685   WLGTSTFCVSIVSE--ERRMDWDSVAAEDVIEALREVEWSASPRSLAEFFSRFAFPRSFS  742

Query  851   KWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEK  672
             KW SRLKCNLYYYRTNYF++ VF+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK
Sbjct  743   KWMSRLKCNLYYYRTNYFILFVFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEK  802

Query  671   VTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSC  492
             + RT+R FSPHLAAKMRPP  PVIRGR + ++ +YICG+PR VFVL+  T S +LWF SC
Sbjct  803   MIRTIRHFSPHLAAKMRPPHMPVIRGRSATRKTVYICGQPRLVFVLLGLTASFVLWFTSC  862

Query  491   GLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
             GLL V +AL+  LL  L+HAS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  863   GLLWVLYALTTALLMILLHASLRTPNLKARLNTFREEFRAVWRNYSEL  910



>ref|XP_006407452.1| hypothetical protein EUTSA_v10021519mg [Eutrema salsugineum]
 gb|ESQ48905.1| hypothetical protein EUTSA_v10021519mg [Eutrema salsugineum]
Length=209

 Score =   300 bits (769),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 176/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR ++EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWESVAAEDVIEALREVEWSTRPRSMAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + +PLAI+ A LTALSIAFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  61   LLIFVLGLALITQPLAILGAALTALSIAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PR VFVL+  T S +LWF SCGLL V +AL+  LL  ++H
Sbjct  121  HMPVIRGRSAARKTVYVCGQPRLVFVLLGLTASFVLWFTSCGLLWVLYALATALLLIILH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASMRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_009146733.1| PREDICTED: PRA1 family protein A3 [Brassica rapa]
Length=209

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V A D++EALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAGDVVEALREVEWSTSPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK  RT+RQFSPHLAAKMRPP
Sbjct  61   LLIFVLGLALITRPLAIIGAALTALSLAFLNDSFAATFNEKAIRTIRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR ++++ +Y+CG+PR VFVL+  T S +LWF SCGLL V +AL+  LL  ++H
Sbjct  121  HMPVIRGRSASRKTVYVCGQPRLVFVLLGLTASFVLWFASCGLLWVLYALATALLLIMLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASLRTPNLKARLNTFREEFRAVWRNYSEL  209



>ref|XP_002529863.1| hypothetical protein RCOM_1157320 [Ricinus communis]
 gb|EEF32513.1| hypothetical protein RCOM_1157320 [Ricinus communis]
Length=376

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 171/201 (85%), Gaps = 16/201 (8%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDL++ALREVDWSSPPRPLSEFFSRFT P+S +KWNSRL      YRTNYF+
Sbjct  1    MDWGNVTAEDLMDALREVDWSSPPRPLSEFFSRFTFPKSSSKWNSRLN-----YRTNYFI  55

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+FILG+GFLRRPLAIVAALLTAL+IAFLNDSFAG F+EK TRTVRQFSPHLAAKMRPP
Sbjct  56   MIIFILGIGFLRRPLAIVAALLTALTIAFLNDSFAGTFSEKATRTVRQFSPHLAAKMRPP  115

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATL--  441
            LTPVIRGRPSAKRAI+ICGRPRWVFVL+FS VS ILW+ SCGLLTV WAL++GLL +   
Sbjct  116  LTPVIRGRPSAKRAIHICGRPRWVFVLIFSIVSFILWYASCGLLTVLWALAIGLLVSCSF  175

Query  440  -----VHA----SFRTPNLKA  405
                 +HA     F+  +LKA
Sbjct  176  DGTYSIHALGSKCFKVLDLKA  196



>ref|XP_010468120.1| PREDICTED: uncharacterized protein LOC104748136 [Camelina sativa]
Length=956

 Score =   314 bits (804),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  748  MDWDSVAAEDVIEALREVEWSTSPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  807

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  808  LLIFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  867

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR + ++ +Y+CG+PR VFVL+  T S +LWF SCGLL V +A +  LL  L+H
Sbjct  868  HMPVIRGRSATRKTVYVCGQPRLVFVLIGLTASFVLWFTSCGLLWVLYAFTTALLMILLH  927

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            A+ RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  928  ATLRTPNLKARLNTFREEFRAVWRNYSEL  956



>ref|XP_006286388.1| hypothetical protein CARUB_v10001963mg [Capsella rubella]
 gb|EOA19286.1| hypothetical protein CARUB_v10001963mg [Capsella rubella]
Length=209

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            ++V +LG+  + RPLAIV A LTAL IAFLNDSFA +FNEK  RT+R FSPH+AAKMRPP
Sbjct  61   LVVLLLGLALVTRPLAIVGAALTALGIAFLNDSFAASFNEKFIRTIRHFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRW +V+V  T S  +WF SCGLL V +AL   L+  ++H
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWAYVVVLLTASLAMWFSSCGLLLVLYALLTSLVVIVLH  180

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  181  ASVRTPNLKARLNTFREEFRAVWRNYSEL  209



>gb|KDO36511.1| hypothetical protein CISIN_1g031200mg [Citrus sinensis]
Length=164

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -1

Query  815  YRTNYFLMIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHL  636
            YRTNYF+MI  ILG+GFLRRP+AI+AALLTALSIAFLNDSFAG FNEKVTRTVRQFSPHL
Sbjct  9    YRTNYFIMITVILGLGFLRRPVAIIAALLTALSIAFLNDSFAGTFNEKVTRTVRQFSPHL  68

Query  635  AAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVG  456
            AAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVL+FS VS ILW+VSCGLLTV WAL+VG
Sbjct  69   AAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLIFSCVSFILWYVSCGLLTVLWALAVG  128

Query  455  LLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            LLAT++HASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  129  LLATILHASFRTPNLKARLNTFREEFRAVWRNYSEL  164



>ref|XP_006299182.1| hypothetical protein CARUB_v10015327mg [Capsella rubella]
 gb|EOA32080.1| hypothetical protein CARUB_v10015327mg [Capsella rubella]
Length=900

 Score =   310 bits (794),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V AED+IEALREV+WS+ PR L+EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  692  MDWDSVAAEDVIEALREVEWSTRPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  751

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP
Sbjct  752  LLIFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP  811

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR ++++A+Y+CG+PR VFVL+  T S +LWF+SCGLL V +A +  LL  L+H
Sbjct  812  HMPVIRGRSASRKAVYVCGQPRLVFVLIGLTASFVLWFMSCGLLWVLYAFTTALLLILLH  871

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  872  ASLRTPNLKARLNTFREEFRAVWRNYSEL  900



>ref|XP_001785203.1| predicted protein [Physcomitrella patens]
 gb|EDQ49982.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVT ++L++AL+EV+WS PPRPL+EFF++FTVP++ +KW+ R+KCN+YYYR+NYF+
Sbjct  1    MDWSNVTIDELVDALKEVEWSQPPRPLAEFFAKFTVPKTQSKWDGRVKCNMYYYRSNYFV  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +   +L + F+R P A+VA  LTAL IA LNDSFA + +EK+TRTVR+FSP LA K+R P
Sbjct  61   LFSLVLVIAFIRNPFALVAVFLTALDIACLNDSFAVSLSEKLTRTVRRFSPPLAHKLRAP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            ++   RGRP  K  +YICGR R +FV     V+++LW+ S  ++T+  AL +G+    +H
Sbjct  121  VSTGTRGRP-LKGTVYICGRDRRIFVGALGLVTALLWWYSSAVITILGALIIGITLPFLH  179

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSE  351
            ASFRTPNLKARLN+FREEFRAVWR YS+
Sbjct  180  ASFRTPNLKARLNSFREEFRAVWRGYSD  207



>ref|XP_001777603.1| predicted protein [Physcomitrella patens]
 gb|EDQ57646.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVT ++L +AL+EV+WS PPRPL+EFF++F VP++ +KW+ R KCN+YYYRTNYF 
Sbjct  1    MDWSNVTIDELADALKEVEWSQPPRPLTEFFAKFAVPKTQSKWDGRFKCNIYYYRTNYFC  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++ +L + F+R PLA++A  LTAL++A LNDSFA A +EK+TRTVR+FSP LA K+R P
Sbjct  61   LLILVLVIAFMRNPLALLAVFLTALTLACLNDSFAVALSEKLTRTVRRFSPPLAHKLRAP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            ++   RGRP  K  +YICGR R +FV     V++++W+ S  +LTV  +L +G+    +H
Sbjct  121  VSTGTRGRP-LKGNVYICGRDRRLFVAGLGFVTTLVWWYSAAVLTVFGSLLIGIAVPFLH  179

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSE  351
            A+FRTPNLKARLN+FREEFRAVWR YS+
Sbjct  180  ATFRTPNLKARLNSFREEFRAVWRGYSD  207



>emb|CDY53323.1| BnaCnng24850D [Brassica napus]
Length=186

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -1

Query  893  SEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAIVAALLTALSI  714
            S FFSR   PRS++KW SRLKCNLYYYRTNYF +++ +LG+  + RPLAI+ A LTALS+
Sbjct  5    SSFFSRLAFPRSFSKWMSRLKCNLYYYRTNYFTLLILVLGLALITRPLAILGAALTALSL  64

Query  713  AFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVL  534
            AFLNDSFA  FNEK+ RT+R FSPHLAAKMRPP  PVIRGR +A++ +Y+CG+PR VFVL
Sbjct  65   AFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPPHMPVIRGRSAARKKVYVCGQPRLVFVL  124

Query  533  VFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYS  354
            +  T S +LWF SCGLL V +A +  L+  L+HAS RTPNLKARLNT+REEFRAVWRNYS
Sbjct  125  LGLTASFVLWFASCGLLWVLYAFATALIMILLHASLRTPNLKARLNTYREEFRAVWRNYS  184

Query  353  EL  348
            EL
Sbjct  185  EL  186



>ref|XP_002962538.1| hypothetical protein SELMODRAFT_141259 [Selaginella moellendorffii]
 gb|EFJ36001.1| hypothetical protein SELMODRAFT_141259 [Selaginella moellendorffii]
Length=209

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNV   +L+ AL+EV+W++PPRPL+EFF++F +P++ AKW SR+KCNLYYYRTNYFL
Sbjct  1    MDWGNVKLAELVNALKEVEWTTPPRPLAEFFAKFAIPKTRAKWESRVKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
             I FIL +GF+R PLA +A L++++  A LNDSFA + NE++TR +R+ SP LA+KMRPP
Sbjct  61   SIAFILCIGFIRNPLAFIAVLISSIGTACLNDSFALSVNERLTRAIRRLSPPLASKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
             +  +RGRP  K  +YICG  R + VL   ++S++ W++S    TV +AL++G + TL+H
Sbjct  121  TSVGVRGRP-LKGNVYICGTDRRIVVLSILSLSALFWYISSAFKTVLYALALGFILTLLH  179

Query  434  ASFRTPNLKARLNTFREEFRAVWRN  360
             S RTPNLKARLN +REEFRA WR 
Sbjct  180  MSLRTPNLKARLNAYREEFRAGWRG  204



>ref|XP_002962756.1| hypothetical protein SELMODRAFT_78966 [Selaginella moellendorffii]
 gb|EFJ36219.1| hypothetical protein SELMODRAFT_78966 [Selaginella moellendorffii]
Length=209

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNV   +L++AL+EV+W++PPRPL+EFF++F +P++ AKW SR+KCNLYYYRTNYFL
Sbjct  1    MDWGNVKLGELVDALKEVEWTTPPRPLAEFFAKFAIPKTRAKWESRVKCNLYYYRTNYFL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
             I FIL +GF+R PLA +A L++++  A LNDSFA + NE++TR +R+ SP LA+KMRPP
Sbjct  61   SIAFILCIGFIRNPLAFIAVLISSIGTACLNDSFALSVNERLTRAIRRLSPPLASKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
             +  +RGRP  K  +YICG  R + VL   ++S++ W++S    TV +AL++G + +L+H
Sbjct  121  TSVGVRGRP-LKGNVYICGTDRRIVVLSILSLSALFWYISSAFKTVLYALALGFILSLLH  179

Query  434  ASFRTPNLKARLNTFREEFRAVWRN  360
             S RTPNLKARLN +REEFRA WR 
Sbjct  180  MSLRTPNLKARLNAYREEFRAGWRG  204



>ref|XP_010495083.1| PREDICTED: PRA1 family protein A2-like [Camelina sativa]
Length=176

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 148/209 (71%), Gaps = 33/209 (16%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+                             C    YRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVE-----------------------------C----YRTNYFI  27

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RPLAIV A LTALSIAFLNDSFA +FNEK  RT+R FSPHLAAKMRPP
Sbjct  28   LVIFLLGLALITRPLAIVGAALTALSIAFLNDSFAASFNEKFIRTIRHFSPHLAAKMRPP  87

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR +A++ +Y+CG+PRWVFV+V  T S ++WF SCGLL V +AL   L+  ++H
Sbjct  88   HMPVIRGRSAARKTVYVCGKPRWVFVVVLLTASLVMWFSSCGLLWVLYALLTSLVVIVLH  147

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            AS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  148  ASVRTPNLKARLNTFREEFRAVWRNYSEL  176



>gb|KCW86015.1| hypothetical protein EUGRSUZ_B02720 [Eucalyptus grandis]
Length=149

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MI+ ILG+GFLRRPLAIVAALLTALS A LNDSFAG F+EK+TRTVRQFSPH AAK+RP 
Sbjct  1    MIMVILGLGFLRRPLAIVAALLTALSTACLNDSFAGTFSEKITRTVRQFSPHFAAKLRPS  60

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGRPSAKR+I+ICG+PR VFV +F++ S +LW+VSCG+LT+ WA ++GLLAT++H
Sbjct  61   HIPVIRGRPSAKRSIHICGQPRRVFVSIFASASLVLWYVSCGILTLLWAFAIGLLATVLH  120

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPNLKARLNTFREEFRAVWRNYS+L
Sbjct  121  ASFRTPNLKARLNTFREEFRAVWRNYSDL  149



>emb|CDY01015.1| BnaC05g41850D [Brassica napus]
Length=292

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 138/166 (83%), Gaps = 0/166 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +V A D++EALREV+WS+ PR ++EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDSVAAGDVVEALREVEWSTSPRSVAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            ++VF+LG+  + RPLAI+ A LTALS+AFLNDSFA  FNEK  RT+RQFSPHLAAKMRPP
Sbjct  61   LLVFVLGLALITRPLAIIGAALTALSLAFLNDSFAATFNEKAIRTIRQFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTV  477
              PVIRGR ++++ +Y+CG+PR VFVL+  T S +LWF SCGLL V
Sbjct  121  HMPVIRGRSASRKTVYVCGQPRLVFVLLGLTASFVLWFTSCGLLWV  166


 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -1

Query  608  PVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHAS  429
            PVIRGR ++++ +Y+CG+PR VFVL+  T S +LWF SCGLL V +AL+  LL  ++HAS
Sbjct  206  PVIRGRSASRKTVYVCGQPRLVFVLLGLTASFVLWFTSCGLLWVLYALATALLLIMLHAS  265

Query  428  FRTPNLKARLNTFREEFRAVWRNYSEL  348
             RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  266  LRTPNLKARLNTFREEFRAVWRNYSEL  292



>gb|ACU24194.1| unknown [Glycine max]
Length=167

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/146 (82%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  785  FILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTP  606
            F   +GF  +  + +AALLTALSIAFLN SFAG F+EKVTRTVRQFSPHLAAKMRPPLTP
Sbjct  22   FCSHIGFSSKTASYLAALLTALSIAFLNYSFAGTFSEKVTRTVRQFSPHLAAKMRPPLTP  81

Query  605  VIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASF  426
            VIRGRPS+KRAIYICGRPRWVFVL+FS+ S  LWFVS GLLTV WAL++GLLAT++HASF
Sbjct  82   VIRGRPSSKRAIYICGRPRWVFVLIFSSASFFLWFVSAGLLTVLWALAIGLLATILHASF  141

Query  425  RTPNLKARLNTFREEFRAVWRNYSEL  348
            RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  142  RTPNLKARLNTFREEFRAVWRNYSEL  167



>ref|XP_010558105.1| PREDICTED: PRA1 family protein A2 isoform X2 [Tarenaya hassleriana]
Length=186

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 140/185 (76%), Gaps = 6/185 (3%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV  ED+IEALREV+WS+PPRPL EFFSRF  PRS++K  SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAGEDVIEALREVEWSTPPRPLGEFFSRFAFPRSFSKLTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +++F+LG+  + RP+AI+ A LTAL IAFLNDSFA +FNEKV RTVR+FSPHLAAKMRPP
Sbjct  61   LVIFVLGLALITRPVAIIGAALTALGIAFLNDSFAASFNEKVIRTVRRFSPHLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
              PVIRGR SA++ IYICG+PR+V V +       L  +SCG L V    S  L + +  
Sbjct  121  HMPVIRGRSSARKTIYICGQPRFVSVFI------CLAALSCGFLLVDCCGSSMLFSLVFS  174

Query  434  ASFRT  420
             SF T
Sbjct  175  LSFFT  179



>gb|AAL06948.1| AT5g02040/T7H20_90 [Arabidopsis thaliana]
Length=191

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 4/164 (2%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVT +DL +ALREVDWSSPPRP SEFFSRFTVP+S  KW+SRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTVDDLFDALREVDWSSPPRPPSEFFSRFTVPKSVPKWDSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            MIV ILG+G L RPLAI AALLTALS+AFLNDSFAG+F+EK TRTVR+FSP LAAKMRPP
Sbjct  61   MIVVILGLGVLTRPLAIFAALLTALSLAFLNDSFAGSFSEKATRTVRRFSPQLAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLV----FSTVSSILWFVS  495
            LTPV RGRPS+KRAI++CG+PRWVFVL     F ++   LWF  
Sbjct  121  LTPVTRGRPSSKRAIHVCGQPRWVFVLTCSLEFCSLVYFLWFAQ  164



>gb|EMS47117.1| hypothetical protein TRIUR3_07819 [Triticum urartu]
Length=204

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 143/205 (70%), Gaps = 3/205 (1%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MD    TA+D++EA+RE  W  PPRP SEFFSRF+ PRS +KW SRL+CNLYYY TNYF+
Sbjct  1    MDGSPATADDVVEAMREFVWFPPPRPASEFFSRFSAPRSCSKWISRLECNLYYYGTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+ I GM FL++P+AI+ A  T LSIAF +DSFA     KV   VR+FSP LAA+MRP 
Sbjct  61   LILLI-GMSFLQKPVAILTAFATGLSIAFFSDSFAVTSTNKVISIVRKFSPDLAAQMRPY  119

Query  614  LTPVIRGRPSAKRAIYICGRP--RWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATL  441
            +  V  GRPS K + +ICGRP   WVF L    VS I W  SC  L V WAL VGLL TL
Sbjct  120  INSVRHGRPSMKGSTHICGRPLSMWVFALFLFEVSCIFWASSCNFLIVPWALYVGLLVTL  179

Query  440  VHASFRTPNLKARLNTFREEFRAVW  366
            +HASFR  NLK RLN FR+EFR  W
Sbjct  180  IHASFRERNLKGRLNRFRKEFREAW  204



>emb|CDM85014.1| unnamed protein product [Triticum aestivum]
Length=204

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MD   VTA+D++EA+RE  W  PPRP SEFFSRF+ PRS +KW SRL+CNLYYY TNYF+
Sbjct  1    MDGRPVTADDVVEAMREFVWLRPPRPSSEFFSRFSAPRSCSKWISRLECNLYYYGTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+ I GM FL++P+ I+ A  T LSIAF++DSFA    +KV   VR+FSP LAAKMRP 
Sbjct  61   LIILI-GMSFLQKPVTIITAFATGLSIAFISDSFAVTSTDKVISIVRKFSPDLAAKMRPY  119

Query  614  LTPVIRGRPSAKRAIYICGRP--RWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATL  441
            + P + GRPS K + +ICGRP   WV  L    VS I W  SC  L V WAL VG+L TL
Sbjct  120  MNPFLHGRPSIKGSTHICGRPLSMWVIALFLFEVSCIFWASSCNFLIVPWALYVGVLVTL  179

Query  440  VHASFRTPNLKARLNTFREEFRAVW  366
            +HASFR  NLK R N  R+E R  W
Sbjct  180  IHASFRERNLKGRFNRSRKECREAW  204



>ref|XP_006286386.1| hypothetical protein CARUB_v10001963mg [Capsella rubella]
 ref|XP_006286387.1| hypothetical protein CARUB_v10001963mg [Capsella rubella]
 gb|EOA19284.1| hypothetical protein CARUB_v10001963mg [Capsella rubella]
 gb|EOA19285.1| hypothetical protein CARUB_v10001963mg [Capsella rubella]
Length=153

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NV AED+IEALREV+WS+PPR   EFFSRF  PRS++KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            ++V +LG+  + RPLAIV A LTAL IAFLNDSFA +FNEK  RT+R FSPH+AAKMRPP
Sbjct  61   LVVLLLGLALVTRPLAIVGAALTALGIAFLNDSFAASFNEKFIRTIRHFSPHMAAKMRPP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFST  522
              PVIRGR +A++ +Y+CG+PRW +V+V  T
Sbjct  121  HMPVIRGRSAARKTVYVCGKPRWAYVVVLLT  151



>ref|NP_001131465.1| hypothetical protein [Zea mays]
 gb|ACF79887.1| unknown [Zea mays]
 gb|AFW81695.1| hypothetical protein ZEAMMB73_930527 [Zea mays]
Length=125

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS PPRP+ EFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSMPPRPVPEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+FILGMGFL +P+AIVAA +T LSIAFLNDSFA  FNEKVTRTVRQFSPHLAAK+RPP
Sbjct  61   LIMFILGMGFLWKPVAIVAAFMTGLSIAFLNDSFAVTFNEKVTRTVRQFSPHLAAKLRPP  120

Query  614  LT  609
            +T
Sbjct  121  IT  122



>ref|XP_001761322.1| predicted protein [Physcomitrella patens]
 gb|EDQ74044.1| predicted protein [Physcomitrella patens]
Length=208

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/209 (48%), Positives = 141/209 (67%), Gaps = 1/209 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW +VT EDL++AL+EVDWS PPRPL EFF  F+ P++ +KW  RL+CNLYYYRTNY L
Sbjct  1    MDWNDVTFEDLVDALKEVDWSIPPRPLGEFFGNFSAPKNDSKWEGRLRCNLYYYRTNYVL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +   +  + F+R PLA+ A  LT LS+A  NDSFA   +EK+TR + Q SP +  K+R P
Sbjct  61   LAGSVFVLAFVRNPLALGAVTLTGLSVACFNDSFAITLSEKLTRGISQVSPTIGRKLRAP  120

Query  614  LTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVH  435
            +    RG+ S  R IYICG+ R +   + ++  ++LW+ S  ++T+  A  + L   ++H
Sbjct  121  VNDKPRGQ-SRNRTIYICGQDRRICATILASAGALLWWKSSAVVTICGASILALSLPILH  179

Query  434  ASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            ASFRTPN+K+RLN  REE R V + Y E+
Sbjct  180  ASFRTPNVKSRLNRIREEIRDVLKGYKEM  208



>ref|XP_010532359.1| PREDICTED: PRA1 family protein A3-like, partial [Tarenaya hassleriana]
Length=147

 Score =   207 bits (528),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -1

Query  776  GMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIR  597
            G+  + RP+AI+ A LTAL IAFLNDSFA +FNEKV RTVR+FSPHLAAKMRPP  PVIR
Sbjct  5    GLALITRPVAIIGAALTALGIAFLNDSFAASFNEKVIRTVRRFSPHLAAKMRPPHMPVIR  64

Query  596  GRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTP  417
            GR SA++ IYICG+PR+V V +   VS +LWF SCGLL V +AL  G+LA ++HAS RTP
Sbjct  65   GRSSARKTIYICGQPRFVSVFICLAVSLVLWFSSCGLLWVLYALLAGILAIVLHASLRTP  124

Query  416  NLKARLNTFREEFRAVWRNYSEL  348
            NLKARLNTFREEFRAVWRNYSEL
Sbjct  125  NLKARLNTFREEFRAVWRNYSEL  147



>ref|XP_002500004.1| hypothetical protein MICPUN_104760 [Micromonas sp. RCC299]
 gb|ACO61262.1| hypothetical protein MICPUN_104760 [Micromonas sp. RCC299]
Length=211

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/210 (50%), Positives = 138/210 (66%), Gaps = 2/210 (1%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVT  +L++ALREVDW+  PRPL+EFF+RFT P+S  K  SRLKCN+YYYR NYF 
Sbjct  1    MDWANVTPGELMDALREVDWNMRPRPLTEFFARFTPPKSQGKLTSRLKCNIYYYRANYFA  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            ++V    + F R P A+ A  ++ LS+   NDSFA + +EK+TRTVR++ P  AA MR  
Sbjct  61   LLVLSFVVAFFRNPFALFACAMSCLSLLCANDSFAQSMSEKITRTVRKYHPPTAAWMRRN  120

Query  614  LT-PVIRGRPSAK-RAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATL  441
                    RP +K + ++ICG  R   V     +S  +   S  + TV WAL +  + TL
Sbjct  121  ANVAAAPSRPYSKSKVVHICGFQRLHVVAFLCVLSFFMLRSSRAVSTVLWALGMFAVGTL  180

Query  440  VHASFRTPNLKARLNTFREEFRAVWRNYSE  351
             HAS R+PNLKARL+++REEFRAVWR YSE
Sbjct  181  AHASLRSPNLKARLSSYREEFRAVWRGYSE  210



>ref|XP_008674824.1| PREDICTED: LOW QUALITY PROTEIN: PRA1 family protein A1 [Zea mays]
Length=124

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 107/124 (86%), Gaps = 2/124 (2%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MD  +VTAEDL++ LREVDWS+P  P+SEFFSRFT PRSY KW   LKCNLYYYRTNY++
Sbjct  1    MDXSSVTAEDLMDTLREVDWSTPSCPISEFFSRFTTPRSYTKWTRHLKCNLYYYRTNYYI  60

Query  794  MIVFILGMGFLRRPLAIVAAL--LTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMR  621
            +++F+LGMGFLR+P+AI+AAL   T LSI FLNDSFA  FNEK+TR+VRQFSPHLAAKM+
Sbjct  61   LVIFVLGMGFLRKPVAILAALQVATGLSIVFLNDSFAVTFNEKMTRSVRQFSPHLAAKMK  120

Query  620  PPLT  609
            PP+T
Sbjct  121  PPIT  124



>emb|CDY16186.1| BnaA09g29200D [Brassica napus]
Length=230

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  698  SFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTV  519
            SFAG+F+EK TRT+R+FSP LAAKMRPPL PVIRGRPSAKRAIYICG+PRWVFVL+ S V
Sbjct  114  SFAGSFSEKATRTIRRFSPQLAAKMRPPLAPVIRGRPSAKRAIYICGQPRWVFVLISSLV  173

Query  518  SSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            S  LW++SCGL TVS AL +GLLAT++HA+ RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  174  SFALWYISCGLFTVSLALLIGLLATILHATLRTPNLKARLNTFREEFRAVWRNYSEI  230



>gb|AFW78233.1| hypothetical protein ZEAMMB73_090719 [Zea mays]
Length=116

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = -1

Query  683  FNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILW  504
            FNEKVTRTVRQFSPHLAAKMRPP+TPV+RGRP++KR+I+ICGRPR VFV+ FS VS ILW
Sbjct  5    FNEKVTRTVRQFSPHLAAKMRPPITPVLRGRPNSKRSIHICGRPRRVFVIFFSAVSCILW  64

Query  503  FVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
              SC LLTV WAL + L AT++HASFRTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  65   LTSCSLLTVLWALLIALFATVLHASFRTPNLKARLNTFREEFRAVWRNYSEL  116



>gb|KHG11674.1| PRA1 family protein A2 [Gossypium arboreum]
Length=93

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRS AKWNSRLKCNLYYYRTNYF+
Sbjct  1    MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSSAKWNSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLND  699
            +IV I+G+GFLRRP+A++AA+LTALSIAFLND
Sbjct  61   LIVLIVGLGFLRRPVAVLAAILTALSIAFLND  92



>emb|CDX73879.1| BnaA03g31680D [Brassica napus]
Length=125

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -1

Query  698  SFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTV  519
            SFA  FNEK+ RT+R FSPHLAAKMRPP  PVIRGR +A++ +Y+CG+PR VFV +  T 
Sbjct  9    SFAATFNEKMIRTIRHFSPHLAAKMRPPHMPVIRGRSAARKKVYVCGQPRLVFVFLGLTA  68

Query  518  SSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            S +LWF SCGLL V +A +  LL  ++HAS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  69   SFVLWFTSCGLLWVFYAFATALLMIILHASLRTPNLKARLNTFREEFRAVWRNYSEL  125



>gb|AFW78232.1| hypothetical protein ZEAMMB73_090719 [Zea mays]
Length=93

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VTAEDL++ALREVDWS+PPR +SEFFSRFTVPRSY+KW SRLKCNLYYYRTNYF+
Sbjct  1    MDWSAVTAEDLVDALREVDWSTPPRTVSEFFSRFTVPRSYSKWTSRLKCNLYYYRTNYFI  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLND  699
            +I+FILGMGFL +P+AI+AA +T LSIAFLND
Sbjct  61   LIMFILGMGFLWKPVAILAAFMTGLSIAFLND  92



>ref|XP_005642700.1| hypothetical protein COCSUDRAFT_31816 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18156.1| hypothetical protein COCSUDRAFT_31816 [Coccomyxa subellipsoidea 
C-169]
Length=217

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 119/208 (57%), Gaps = 1/208 (0%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW NVT E+L+ +L+EVDW+SPPR   EFF +FT      K   R+KCNLYYYRTNY L
Sbjct  1    MDWANVTFEELLSSLQEVDWNSPPRSPKEFFGKFTGLPDQDKLLPRIKCNLYYYRTNYVL  60

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            +I+      FLR   A+VA  +  L    LND+FA   +++  R +R+  P LA K+R  
Sbjct  61   LILLAFCGAFLRNIGALVALGICVLGCLCLNDTFAITLSDRTLRMIRRIHPPLAQKLRAQ  120

Query  614  LTP-VIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLV  438
                   G P   R + I G  R   V +   +  IL + +  LLT++ A+ +G    L+
Sbjct  121  SGGHAGLGAPGKAREVKIVGIKRNTVVFMLLALGIILLWRTRALLTLAIAVILGDGGVLL  180

Query  437  HASFRTPNLKARLNTFREEFRAVWRNYS  354
            H   R PNLK+R+ + R+EFRAVWR Y 
Sbjct  181  HVVLRAPNLKSRMASARQEFRAVWRGYQ  208



>ref|XP_001696250.1| hypothetical protein CHLREDRAFT_187088 [Chlamydomonas reinhardtii]
 gb|EDP08227.1| predicted protein [Chlamydomonas reinhardtii]
Length=216

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 126/208 (61%), Gaps = 4/208 (2%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MDW  VT E+L  AL+EV WS+P RP+ EFF  F+ P   A    RLK NLYYYRTNY +
Sbjct  1    MDWNQVTLEELASALKEVTWSAP-RPVEEFFRSFSPPSQRALM-GRLKNNLYYYRTNYLV  58

Query  794  MIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPP  615
            ++V    + F+R P+A+ + +L  L  A  ND FA + N+ +   +R+++P L AK R  
Sbjct  59   ILVLAFLVCFIRNPVALGSLVLVGLGTALCNDPFATSLNDNLLHALRKYAPRLVAKSRAK  118

Query  614  L-TPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLV  438
              +  + G    KR +Y+   PR + V     V  +L + S  +LT+ WA+ +G+   L+
Sbjct  119  AGSDGVVGLHKRKR-LYVLVLPRGLVVAALLLVGGLLVYWSHAVLTLCWAILLGVGLPLM  177

Query  437  HASFRTPNLKARLNTFREEFRAVWRNYS  354
            HA+FR PNLKA++ + REEFRAVWR Y 
Sbjct  178  HATFRLPNLKAKIASAREEFRAVWRGYQ  205



>gb|EMT22695.1| hypothetical protein F775_11037 [Aegilops tauschii]
Length=134

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 83/131 (63%), Gaps = 12/131 (9%)
 Frame = -1

Query  974  MDWGNVTAEDLIEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFL  795
            MD    TA+D++EA+RE  W  PPRP SEFFSRF+ PRS +KW SRL+CNLYY     FL
Sbjct  1    MDGRPATADDVVEAMREFVWFPPPRPSSEFFSRFSAPRSCSKWISRLECNLYYLFQKMFL  60

Query  794  M------------IVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQ  651
                         +    GM FL++P+AI+ A  T LSIAF +DSFA    +KV   VR+
Sbjct  61   KFEPKPEQIPESWLNNYSGMSFLQKPVAILTAFATGLSIAFFSDSFAVTSTDKVISIVRK  120

Query  650  FSPHLAAKMRP  618
            FSP LAAKMRP
Sbjct  121  FSPDLAAKMRP  131



>gb|EMS58313.1| hypothetical protein TRIUR3_22546 [Triticum urartu]
Length=96

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -1

Query  815  YRTNYFLMIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHL  636
            YRTNYF++I+FILG+GFL +P+AI+AA +T  SIAFLNDSFA  FNEKVTRTVRQFSPHL
Sbjct  28   YRTNYFILIMFILGLGFLWKPVAILAAFMTGFSIAFLNDSFAVTFNEKVTRTVRQFSPHL  87

Query  635  AAKMRPPLT  609
            AAKMRPP+T
Sbjct  88   AAKMRPPIT  96



>tpg|DAA56838.1| TPA: hypothetical protein ZEAMMB73_451006 [Zea mays]
Length=82

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -1

Query  941  IEALREVDWSSPPRPLSEFFSRFTVPRSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFL  762
            ++ LREVDWS+P  P+SEFFSRFT P SY KW   LKCNLYYYRTNY+++++F+LGMGFL
Sbjct  1    MDTLREVDWSTPSCPISEFFSRFTTPESYTKWTRHLKCNLYYYRTNYYILVIFVLGMGFL  60

Query  761  RRPLAIVAALLTA  723
            R+P+AI+AAL ++
Sbjct  61   RKPVAILAALASS  73



>ref|XP_002323524.2| hypothetical protein POPTR_0016s10360g [Populus trichocarpa]
 gb|EEF05285.2| hypothetical protein POPTR_0016s10360g [Populus trichocarpa]
Length=92

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 71/100 (71%), Gaps = 15/100 (15%)
 Frame = -1

Query  626  MRPPLT----PVIRGRPSAKRAIYICGRPRWVFVLVFSTVS--SILWFVSCGLL-TVSWA  468
            MRPPLT    PVIR RPS KRAIYIC    WVFV+ F T +  S  W+ SC LL TV WA
Sbjct  1    MRPPLTQVLLPVIRERPSTKRAIYIC----WVFVMQFQTQTLFSSFWYASCDLLSTVLWA  56

Query  467  LSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            L+ GLLAT++HASFR PNLKARL T    FRAVW NYSEL
Sbjct  57   LATGLLATILHASFRRPNLKARLKT----FRAVWCNYSEL  92



>emb|CDX69570.1| BnaA10g19190D [Brassica napus]
Length=71

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  524  TVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            TVS  LW++SCGL TVS AL +GLLAT++HA+ RTPNLKARLNTFREEFRAVWRNYSE+
Sbjct  13   TVSFALWYISCGLFTVSLALLIGLLATILHATLRTPNLKARLNTFREEFRAVWRNYSEI  71



>ref|XP_002945943.1| hypothetical protein VOLCADRAFT_115862 [Volvox carteri f. nagariensis]
 gb|EFJ52938.1| hypothetical protein VOLCADRAFT_115862 [Volvox carteri f. nagariensis]
Length=272

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 82/147 (56%), Gaps = 0/147 (0%)
 Frame = -1

Query  806  NYFLMIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAK  627
            NY +++V    + FLR P A+ +  L  L ++  ND FA   N+ +  ++R+ +P L A+
Sbjct  1    NYLVILVLSFIVCFLRNPSALASLALVVLGVSCCNDPFATGLNDTLLHSLRKVAPRLVAR  60

Query  626  MRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLA  447
             R             +R +YI   PR +  +   +   +  + S  LLT+SWA+ +GL  
Sbjct  61   ARAKAGSDGVVGLHKRRRVYIVLLPRSLVAVGLVSGGLVAVYWSHALLTLSWAILLGLGL  120

Query  446  TLVHASFRTPNLKARLNTFREEFRAVW  366
             L+HASFR PNLKA++ + REEFRAVW
Sbjct  121  PLLHASFRLPNLKAKIASAREEFRAVW  147



>emb|CDY04976.1| BnaAnng01580D [Brassica napus]
Length=37

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  443  LVHASFRTPNLKARLNTFREEFRAVWRNYSEL  348
            +VHAS RTPNLKARLNTFREEFRAVWRNYSEL
Sbjct  6    IVHASVRTPNLKARLNTFREEFRAVWRNYSEL  37



>ref|XP_005188407.1| PREDICTED: PRA1 family protein 3-like [Musca domestica]
Length=191

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 84/179 (47%), Gaps = 34/179 (19%)
 Frame = -1

Query  908  PPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAI  744
            P R L +F    +RF +P  + + KW +R+  NL YY+TNYFL+ + I G+  +  P+ I
Sbjct  13   PLRSLDDFVLGSARFQIPNIKDFDKWGNRVVKNLLYYQTNYFLLFLAIYGLMMIVNPVKI  72

Query  743  VAAL-LTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
            +  L + A+ IA +   F+G      TR VR         +R P         S  +  Y
Sbjct  73   ICGLTVQAMIIAIILHFFSGQ-----TRFVR---------LRVP------AAGSDTQKWY  112

Query  566  ICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
            I G    V  L+     +IL  +SC  L + ++L      T +HAS R  NLK ++   
Sbjct  113  ILGGALLVGYLLLHWFDAIL--LSCFTLLLPFSL------TFIHASLRLRNLKNKVTNL  163



>ref|NP_001158615.1| PRA1 family protein 3 [Oncorhynchus mykiss]
 gb|ACO08481.1| PRA1 family protein 3 [Oncorhynchus mykiss]
 emb|CDQ64715.1| unnamed protein product [Oncorhynchus mykiss]
Length=191

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 40/182 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFI-LGMGFLRRPL  750
            +P RP  +FF    RF  P  R   KWN+R+  NL YY+TNY  M V + L +GFL  P+
Sbjct  7    TPLRPWDDFFPGSDRFAKPDVRDLPKWNNRVVNNLLYYQTNYLAMAVMVFLIVGFL-NPM  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +    +  +S+ FL   +AG  N+ + +  ++ +P L                      
Sbjct  66   EMFMG-MAVVSLVFLGSVWAGE-NKAMIKDFKRQNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                     FV+     S  L  +  G++   + ++  LL    HASFR  N+K +L   
Sbjct  102  ---------FVMAVMLASYFLMSLFDGVMVFIFGITFPLLLIFAHASFRLRNMKNKLENK  152

Query  389  RE  384
             E
Sbjct  153  ME  154



>emb|CDQ61672.1| unnamed protein product [Oncorhynchus mykiss]
Length=191

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 79/179 (44%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLM-IVFILGMGFLRRPL  750
            +P +P  +FF    RF  P  R   +WN+R+  NL YY+TNYF M I+  L +GFL  P+
Sbjct  7    TPLKPWDDFFPGSDRFAKPDARDLPRWNNRVVNNLLYYQTNYFAMAIIVFLIVGFL-NPM  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +    +  +S+ FL   +AG  N+ + +  ++ +P L                      
Sbjct  66   GMFMG-MAVVSLVFLGSVWAGE-NKAMIKDFKRQNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV+     S  L  +  G++   + ++  +L   VHAS R  N+K +L  
Sbjct  102  ---------FVMAVMVASYFLMSLFDGVMVFMFGITFPILLIFVHASLRLRNMKNKLEN  151



>ref|XP_008277450.1| PREDICTED: PRA1 family protein 3-like [Stegastes partitus]
Length=190

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 82/179 (46%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFI-LGMGFLRRPL  750
            +P RP  +FF    RF  P  +  AKWN+R+  NL YY+TNY  M V + L +GFL  PL
Sbjct  7    TPLRPWDDFFPGSERFAKPDVKDLAKWNNRVVSNLLYYQTNYLAMAVAVFLIVGFL-NPL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +  A +  +S  FL   + G                   + R  L    R  P+A   I
Sbjct  66   GMFTA-MAVVSGVFLGSVWTG-------------------ENRAALNNFKRQNPTAFIII  105

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
             +       +VL+ S + S++ F+S        A+++ L   L HASFR  N+K +L  
Sbjct  106  IMVAS----YVLI-SMLGSVMVFMS--------AITLPLALILAHASFRLRNMKNKLEN  151



>ref|XP_010745648.1| PREDICTED: PRA1 family protein 3 [Larimichthys crocea]
Length=191

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 79/180 (44%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF--LMIVFILGMGFLRRP  753
            +P RP  +FF    RFT P      KWN+R+  NL YY+TNYF   ++VF++ +GFL   
Sbjct  8    APLRPWDDFFPGADRFTKPEFGDLTKWNNRVISNLMYYQTNYFAAALLVFLI-VGFLNPF  66

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
               +   + AL   F+   +AG  N+ + +  ++ +P L                     
Sbjct  67   GMFLGGAVVAL--VFMGSVWAGE-NQAIVKNFKKKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  L  +  G+L   + ++  LL  L+HAS R  N+K RL  
Sbjct  103  ----------FVVGVMLTSYFLLSLCGGVLVFIFGITFPLLLILIHASLRLRNMKNRLEN  152



>ref|NP_001290772.1| PRA1 family protein 3 [Esox lucius]
 gb|ACO13849.1| PRA1 family protein 3 [Esox lucius]
Length=190

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFI-LGMGFLRRPL  750
            +P RP  +FF    RF  P  R   KWN R+  NL YY+TNY ++ V + L +GFL  P+
Sbjct  7    TPIRPWDDFFPGSDRFAKPDVRDLPKWNKRVVNNLLYYQTNYLVLAVMVFLIVGFL-NPI  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +    +  +S+ FL   +AG  N+ + +  ++ +P L                      
Sbjct  66   GMFMG-MAVVSLVFLGSVWAGE-NKAMIKDFKKQNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV+     S  L  +  G++   + ++  LL   +HAS R  N+K +L  
Sbjct  102  ---------FVMAVMVASYFLMSLFNGVMVFIFGITFPLLLIFMHASLRLRNMKNKLEN  151



>ref|XP_007560833.1| PREDICTED: PRA1 family protein 3 [Poecilia formosa]
Length=190

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 84/184 (46%), Gaps = 42/184 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFL--MIVFILGMGFLRRP  753
            +P RP  +FF    RF+ P  R   KWN+++  NL YY+TNYF+  ++VF++ +GFL  P
Sbjct  8    APLRPWDDFFPGADRFSKPEFRDLTKWNNKVISNLMYYQTNYFVVALVVFLI-VGFLN-P  65

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
              +       L  A ++  FAG+                A + +P +    R  P+    
Sbjct  66   FGMF------LGGAVVSLVFAGSV--------------WAGENKPTIKNFKRKNPT----  101

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     +FV+     S  +  +  G+L   + ++  LL  L+HAS R  N+K RL  
Sbjct  102  ---------LFVIGVMATSYFVLSLFGGVLVFIFGITFPLLLILIHASLRQRNMKNRLEN  152

Query  392  FREE  381
              E+
Sbjct  153  KIED  156



>ref|XP_003136756.1| PRA1 family protein [Loa loa]
Length=197

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 92/211 (44%), Gaps = 51/211 (24%)
 Frame = -1

Query  998  VSRCPIGGMDWGNVTAED---LIEALREVDWSSPPRPLSEFF---SRFTVP--RSYAKWN  843
            V+ C  G M    V  E+   LI A++      P R + EFF   SRF +P  R  AKWN
Sbjct  2    VTDC--GAMTQEAVGKEENWKLINAVQ----VPPLRNVREFFFDRSRFEIPPFRDLAKWN  55

Query  842  SRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAIVAALLTALSIAFLNDSFAGAFNEKVTR  663
            +R+  NL YY+TNYF          F+   + I A++        L+D F G        
Sbjct  56   NRMLSNLLYYQTNYF---------AFMSLIILICASVQ-------LHDVFIGLVAIVCVA  99

Query  662  TVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYICGRPRWVFVLVFSTVSSILWFVSC--G  489
            TV  FS                  P+     ++  R    F+ + + + +  +FV     
Sbjct  100  TVLAFS--------------FSSNPT-----FVQARHEHTFITLGAILLAFYFFVYAIVP  140

Query  488  LLTVSWALSVGLLATLVHASFRTPNLKARLN  396
            ++TV +  S+ LL  LVHAS R  +LK ++N
Sbjct  141  VVTVLFTFSLPLLLVLVHASTRLRSLKVKVN  171



>emb|CAG04015.1| unnamed protein product [Tetraodon nigroviridis]
Length=191

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (46%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYFL--MIVFILGMGFLRRP  753
            +P R   +FF    RF+ P     AKWN+R+  NL YY+TNYF+  ++VF++ +GFL  P
Sbjct  8    APLRQWDDFFPGTDRFSKPEFGDLAKWNNRVISNLMYYQTNYFVVALVVFLI-VGFL-SP  65

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
             ++       +S+ F+   +AG  N+ + +  ++ +P L                     
Sbjct  66   FSMFLG-GAVVSLVFMGSVWAGE-NKAIIKNFKKKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  L  +  G++   + ++  LL  L+HAS R  N+K RL  
Sbjct  103  ----------FVIGVMVTSYFLLSLCGGVMVFIFGITFPLLLILIHASLRLRNMKNRLEN  152



>gb|ACI69213.1| PRA1 family protein 3 [Salmo salar]
Length=190

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLM-IVFILGMGFLRRPL  750
            +P +P  +FF    RF  P  R   +WN+R+  NL YY+TNYF M I+  L +GFL  P+
Sbjct  7    TPLKPWDDFFPGSDRFAKPDARDLPRWNNRVVNNLLYYQTNYFAMAIIVFLIVGFL-NPV  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +    +  +S+ FL   +AG  N+ + +  ++ +P L                      
Sbjct  66   GMFMG-MAVVSLVFLGSVWAGE-NKAMIKDFKRQNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV+     S  L  +  G++   + ++  +L    HAS R  N+K +L  
Sbjct  102  ---------FVMAVMVASYFLMSLFDGVMVFMFGITFPILLIFAHASLRLRNMKNKLEN  151



>gb|ACI33741.1| PRA1 family protein 3 [Salmo salar]
Length=191

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLM-IVFILGMGFLRRPL  750
            +P +P  +FF    RF  P  R   +WN+R+  NL YY+TNYF M I+  L +GFL  P+
Sbjct  7    TPLKPWDDFFPGSDRFAKPDARDLPRWNNRVVNNLLYYQTNYFAMAIIVFLIVGFL-NPV  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +    +  +S+ FL   +AG  N+ + +  ++ +P L                      
Sbjct  66   GMFMG-MAVVSLVFLGSVWAGE-NKAMIKDFKRQNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV+     S  L  +  G++   + ++  +L    HAS R  N+K +L  
Sbjct  102  ---------FVMAVMVASYFLMSLFDGVMVFMFGITFPILLIFAHASLRLRNMKNKLEN  151



>emb|CBN80979.1| PRA1 family protein 3 [Dicentrarchus labrax]
Length=190

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 82/179 (46%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLM-IVFILGMGFLRRPL  750
            +P RP  +FF    RF  P  +  AKWN+R+  NL YY+TNY  M IV  L +GFL  PL
Sbjct  7    TPFRPWDDFFPGAERFAKPDTKDLAKWNNRVVSNLLYYQTNYLAMAIVVFLIVGFLN-PL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +  A+   +S  F+   +AG  N  V   +  F  H       P   VI        A+
Sbjct  66   GMFTAM-AVVSGVFMGSVWAGE-NRAV---ISNFKKH------NPTAFVI--------AV  106

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
             +         +V S + S++ F++        A+++ L     HASFR  N+K +L  
Sbjct  107  MVAS------YVVISMLGSVMVFMT--------AITLPLALIFAHASFRLRNMKNKLEN  151



>gb|EFO27323.2| PRA1 family protein [Loa loa]
Length=190

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 79/178 (44%), Gaps = 42/178 (24%)
 Frame = -1

Query  908  PPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAI  744
            P R + EFF   SRF +P  R  AKWN+R+  NL YY+TNYF          F+   + I
Sbjct  22   PLRNVREFFFDRSRFEIPPFRDLAKWNNRMLSNLLYYQTNYF---------AFMSLIILI  72

Query  743  VAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIYI  564
             A++        L+D F G        TV  FS                  P+     ++
Sbjct  73   CASVQ-------LHDVFIGLVAIVCVATVLAFS--------------FSSNPT-----FV  106

Query  563  CGRPRWVFVLVFSTVSSILWFVSC--GLLTVSWALSVGLLATLVHASFRTPNLKARLN  396
              R    F+ + + + +  +FV     ++TV +  S+ LL  LVHAS R  +LK ++N
Sbjct  107  QARHEHTFITLGAILLAFYFFVYAIVPVVTVLFTFSLPLLLVLVHASTRLRSLKVKVN  164



>ref|XP_005926317.1| PREDICTED: PRA1 family protein 3-like [Haplochromis burtoni]
Length=191

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 77/180 (43%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF--LMIVFILGMGFLRRP  753
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF   M+VF++ +GF+   
Sbjct  8    APLRPWDDFFPGTDRFGKPDFGDLAKWNNRVISNLMYYQTNYFAVAMVVFLI-VGFMNPF  66

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
               +   + AL   F    +AG  N+   +  ++ +P L                     
Sbjct  67   GMFLGGAVVAL--VFAGSVWAGE-NKATIKNFKRKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  L  +  G++   + L+  LL  L+HAS R  N+K RL  
Sbjct  103  ----------FVIGVMVTSYFLLSLCGGVMVFIFGLTFPLLLILIHASLRLRNMKNRLEN  152



>ref|XP_005801778.1| PREDICTED: PRA1 family protein 3-like [Xiphophorus maculatus]
Length=190

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 81/184 (44%), Gaps = 42/184 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYFL--MIVFILGMGFLRRP  753
            +P RP  +FF    RF+ P      KWN+R+  NL YY+TNYF+  ++VF++ +GFL  P
Sbjct  8    APLRPWDDFFPGAERFSKPEFGDLTKWNNRVISNLMYYQTNYFVVALVVFLI-VGFLN-P  65

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
              +       +S+ F    +AG  N+   +  ++ +P L                     
Sbjct  66   FGMFLGG-AVVSLVFAGSVWAGE-NKPTIKNFKKKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  +  +  G++   + ++  LL  L+HAS R  N+K RL  
Sbjct  103  ----------FVIGVMATSYFVLSLFGGVMVFIFGITFPLLLILIHASLRQRNMKNRLEN  152

Query  392  FREE  381
              EE
Sbjct  153  KIEE  156



>ref|XP_003442836.1| PREDICTED: PRA1 family protein 3-like [Oreochromis niloticus]
Length=181

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 38/176 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            +P RP ++FF    RF  P  + + KWN+R+  NL YY+TNY  ++ F+  +  + +PL 
Sbjct  8    APLRPWTDFFPGSDRFAKPDTKDFTKWNNRVVSNLLYYQTNYLALVTFVFLLVGILKPLE  67

Query  746  IVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
             + A++    +  +   + G     +    +Q                   +PSA     
Sbjct  68   TLVAIVVVSVVFVV-SVWVGENGAAINNFKKQ-------------------KPSA-----  102

Query  566  ICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARL  399
                    F+++    S IL  V   ++   WA+++ L+    HASFR  N+K +L
Sbjct  103  --------FIILIMVASCILISVLGSIVVFMWAITLPLILIFAHASFRKRNMKNKL  150



>ref|XP_006794277.1| PREDICTED: PRA1 family protein 3-like [Neolamprologus brichardi]
Length=191

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 77/180 (43%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF--LMIVFILGMGFLRRP  753
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF   M+VF++ +GF+   
Sbjct  8    APLRPWDDFFPGTDRFGKPDFGDLAKWNNRVISNLMYYQTNYFAVAMVVFLI-VGFMNPF  66

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
               +   + AL   F    +AG  N+   +  ++ +P L                     
Sbjct  67   GMFLGGAVVAL--VFAGSVWAGE-NKATIKNFKRKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  L  +  G++   + ++  LL  L+HAS R  N+K RL  
Sbjct  103  ----------FVIGVMVTSYFLLSLCGGVMVFIFGITFPLLLILIHASLRLRNMKNRLEN  152



>ref|XP_004546348.1| PREDICTED: PRA1 family protein 3-like [Maylandia zebra]
 ref|XP_005731758.1| PREDICTED: PRA1 family protein 3-like [Pundamilia nyererei]
Length=191

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 77/180 (43%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF--LMIVFILGMGFLRRP  753
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF   M+VF++ +GF+   
Sbjct  8    APLRPWDDFFPGTDRFGKPDFGDLAKWNNRVISNLMYYQTNYFAVAMVVFLI-VGFMNPF  66

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
               +   + AL   F    +AG  N+   +  ++ +P L                     
Sbjct  67   GMFLGGAVVAL--VFAGSVWAGE-NKATIKNFKRKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  L  +  G++   + ++  LL  L+HAS R  N+K RL  
Sbjct  103  ----------FVIGVMVTSYFLLSLCGGVMVFIFGITFPLLLILIHASLRLRNMKNRLEN  152



>ref|XP_008412473.1| PREDICTED: PRA1 family protein 3 [Poecilia reticulata]
Length=190

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 77/183 (42%), Gaps = 40/183 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            +P RP  +FF    RF+ P      KWN+++  NL YY+TNYF                 
Sbjct  8    APLRPWDDFFPGADRFSKPEFGDLTKWNNKVISNLMYYQTNYF-----------------  50

Query  746  IVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHL-AAKMRPPLTPVIRGRPSAKRAI  570
             V AL+  L + FLN  F       V   V  F+  + A + +P +    R  P+     
Sbjct  51   -VVALMVFLIVGFLN-PFGMFLGGAVVSLV--FAGSVWAGENKPTIKNFKRKYPT-----  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                    +FV+     S  +  +  G++   + ++  LL  L+HAS R  N+K RL   
Sbjct  102  --------LFVIGVMATSYFVLSLFGGVMVFIFGITFPLLLILIHASLRQRNMKNRLENK  153

Query  389  REE  381
             E+
Sbjct  154  IED  156



>ref|XP_010732963.1| PREDICTED: LOW QUALITY PROTEIN: PRA1 family protein 3-like [Larimichthys 
crocea]
Length=190

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 73/178 (41%), Gaps = 38/178 (21%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            +P RP  +FF    RF  P  +  AKWN+R+  NL YY+TNY  + + +  +     PL 
Sbjct  7    TPLRPWDDFFPGSERFGKPDGKDLAKWNNRVVSNLLYYQTNYLALAIVVFLIVGXENPLG  66

Query  746  IVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
            +  A +  +S  FL   +AG                   + R  +    R  P+A     
Sbjct  67   MFTA-MAVVSGVFLGSVWAG-------------------ENRAVINNFKRQNPTA-----  101

Query  566  ICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                    FV+     S IL  +   ++    A+++ L     HASFR  N+K +L  
Sbjct  102  --------FVIAIMVASYILISMLGSVMVFMTAITLPLALIFAHASFRLRNMKNKLEN  151



>ref|XP_001862330.1| PRA1 family protein 2 [Culex quinquefasciatus]
 gb|EDS36935.1| PRA1 family protein 2 [Culex quinquefasciatus]
Length=188

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 81/181 (45%), Gaps = 33/181 (18%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            +P R +++F    +RF +P  + + KW +R+  NL YY+TNYFLM   + G+  L  P  
Sbjct  13   APLRTVNDFLLESARFQLPNFQDFEKWGNRVVKNLLYYQTNYFLMGAAVFGLIGLIHPYK  72

Query  746  IVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
            +V  +   L++A++   F   F  +  R++   S H               +P+      
Sbjct  73   VVLGVAILLALAYV---FIKFFAAEARRSISVTSGH--------------QQPN------  109

Query  566  ICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFR  387
                 +W  +      S ++ F+   +L V +A+ +      VHAS R  N+K ++    
Sbjct  110  -----KWAVLGGVVGCSYLVLFLFDAVLIVMFAMLLPFCLAFVHASLRLRNMKNKITNAI  164

Query  386  E  384
            E
Sbjct  165  E  165



>ref|NP_001187580.1| pra1 family protein 3 [Ictalurus punctatus]
 gb|ADO28844.1| pra1 family protein 3 [Ictalurus punctatus]
Length=191

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 81/182 (45%), Gaps = 40/182 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYF-LMIVFILGMGFLRRPL  750
            +P R   +FF    RF  P  +   KWN+R+  NL Y++TNYF ++IV  L +GF+  PL
Sbjct  8    APFRQWGDFFPGADRFAKPDMKDLTKWNNRVISNLLYFQTNYFAVVIVVFLLVGFM-NPL  66

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             ++   +  +S+ F+   +AG  N+ V +  ++  P L                      
Sbjct  67   GMILGSVV-VSLVFMGSVWAGE-NKAVIKNFKKNHPSL----------------------  102

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                     FV+     S  L  +  G++   + ++  LL  L+HAS R  ++K +L   
Sbjct  103  ---------FVIAVLGASYFLLSLCGGVMVFIFGITFPLLLILIHASLRLRSMKNKLENK  153

Query  389  RE  384
             E
Sbjct  154  VE  155



>gb|KEH23866.1| PRA1 family protein [Medicago truncatula]
Length=201

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = -1

Query  914  SSPPRPLSEFFS--RFTVPRSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAIV  741
            S+  RP  E F+   FT P S  +  SR+KCN+ ++R NY ++I+F+L +  L  P++I+
Sbjct  35   SATRRPWEEVFALYSFTRPYSLTEATSRVKCNINHFRVNYIILILFVLFLSLLWHPISII  94

Query  740  AALLTALSIAFL  705
              L+T ++  FL
Sbjct  95   VFLITLIAWFFL  106



>ref|XP_008318681.1| PREDICTED: PRA1 family protein 3-like [Cynoglossus semilaevis]
Length=190

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYF-LMIVFILGMGFLRRPL  750
            +P RP  +FF    R   P  +  AKWN+R+  NL YY+TNY  L +V  L +GFL  P+
Sbjct  7    TPLRPWDDFFPGSERVAKPDFKDLAKWNNRVISNLLYYQTNYLVLAVVVFLIVGFLN-PV  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +  A+   +S  F+   +AG  N+ V    +                  R  P+A    
Sbjct  66   GMFTAM-AVVSAVFMGSLWAGE-NKAVINNFK------------------RQNPTA----  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV++    S +L  +   ++    A+++ L     HASFR  N+K +L  
Sbjct  102  ---------FVIIIMVASYMLITLLGSVMVFMTAVTLPLALIFAHASFRLRNMKNKLEN  151



>ref|XP_002001647.1| GI16873 [Drosophila mojavensis]
 gb|EDW11089.1| GI16873 [Drosophila mojavensis]
Length=208

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 81/188 (43%), Gaps = 34/188 (18%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            +P R L +F    +RF +P  + + KW +R+  NL YY+TNYFL+ + I  +     P+ 
Sbjct  23   APLRTLDDFVLGSARFQLPNLKDFDKWGNRVVKNLLYYQTNYFLVFLAIYVIMIACNPMK  82

Query  746  IVA-----ALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSA  582
            I++     ALL A+   F N      F   +   +   +P LA             + +A
Sbjct  83   IISGLIVQALLIAIIWQFFNSKSKANF---IASRLTGGNPILA-------------QQNA  126

Query  581  KRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKAR  402
            ++  YI         L    +S++L      LL VS         T +HAS R  N+K +
Sbjct  127  QQKWYILAGALLASYLFLHMISAVLLTAFTLLLPVS--------VTFIHASLRLRNMKNK  178

Query  401  LNTFREEF  378
            L    E F
Sbjct  179  LANTIESF  186



>ref|XP_001961664.1| GF19689 [Drosophila ananassae]
 gb|EDV30885.1| GF19689 [Drosophila ananassae]
Length=208

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 89/185 (48%), Gaps = 30/185 (16%)
 Frame = -1

Query  908  PPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAI  744
            P R L +F    +RF +P  + + KW +R+  NL YY+TNYFL+ + I  +  +  P  I
Sbjct  24   PLRTLDDFILGSARFQLPNLKDFDKWGNRVVKNLLYYQTNYFLLFLTIYVLMIVCNPAKI  83

Query  743  VAALLT-ALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
            ++ L+  AL IA +   F+G          +  S  +A+++         G  +A     
Sbjct  84   ISGLIVQALIIAVIWQFFSG----------KSKSNFIASRLTG-------GNANAAEQ--  124

Query  566  ICGRPRWVFVLVFSTVSSILW--FVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
               + +W ++L  + +   L+   +S  LLT ++ L + +  T +HAS R  N+K +L  
Sbjct  125  -NAQQKW-YILAGALLGGYLFLHLISAVLLT-AFTLLLPISVTFIHASLRLRNMKNKLAN  181

Query  392  FREEF  378
              E F
Sbjct  182  TIESF  186



>emb|CAF96929.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=190

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 79/179 (44%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFI-LGMGFLRRPL  750
            +P R   +FF    RF  P  +  A+W++R+  NL YY+TNY ++ V I L +GFL  PL
Sbjct  7    TPLRAWDDFFPGWERFAKPDAKDLARWSNRVVSNLLYYQTNYLVLAVAIFLVVGFL-NPL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +  A L  +S  FL   +                   AA+ R  +    R +P+A    
Sbjct  66   GMFTA-LAVVSAIFLGSVW-------------------AAENRAVINHFKRQKPTA----  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FVL+    S IL  +   ++    A++  L+    HASFR  N+K +L  
Sbjct  102  ---------FVLLVLVASYILLSLLGSVMVFMSAITFPLVCVFAHASFRLRNMKNKLEN  151



>ref|XP_004018384.1| PREDICTED: PRA1 family protein 3 [Ovis aries]
Length=188

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 78/184 (42%), Gaps = 42/184 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILG-MGFLRRPL  750
            +P R   +FF    RF  P  R  +KWN+R+  NL YY+TNY ++   ++  +GFL  P 
Sbjct  6    APLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFL-SPF  64

Query  749  AIVAALLTALSIAFLNDSFA-GAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
             ++   L  + +  +   F   A N+ + R +++  P                       
Sbjct  65   NMI---LGGIVVVLVFTGFVWAAHNKDILRRMKKQYPT----------------------  99

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     VFV+V    S  L  +  G++   + ++  LL   +HAS R  NLK +L  
Sbjct  100  ---------VFVMVVMLASYFLISLFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLEN  150

Query  392  FREE  381
              EE
Sbjct  151  KMEE  154



>ref|XP_006630680.1| PREDICTED: PRA1 family protein 3-like [Lepisosteus oculatus]
Length=190

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 77/182 (42%), Gaps = 40/182 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYFLM-IVFILGMGFLRRPL  750
            +P RP  +F     RF  P   + AKWN+R+  NL YY+TNYF M IV  L +GFL    
Sbjct  7    APLRPWDDFLPGSDRFAKPDVGNLAKWNNRVVSNLLYYQTNYFAMAIVVFLIVGFLNPVS  66

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             I+   + AL   F+   +A A +  V +  ++ +P L                      
Sbjct  67   MILGGAVVAL--VFVGSVWA-ADDRAVIKNFKKQNPSL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                     FV+     S  L  +  G++   + ++  LL   VHAS R  N+K +L   
Sbjct  102  ---------FVIGVLGASYFLISLFGGVMVFIFGITFPLLLMFVHASLRLRNVKNKLENK  152

Query  389  RE  384
             E
Sbjct  153  LE  154



>ref|XP_005695807.1| PREDICTED: PRA1 family protein 3 [Capra hircus]
Length=188

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (43%), Gaps = 42/184 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILG-MGFLRRPL  750
            +P R   +FF    RF  P  R  +KWN+R+  NL YY+TNY ++  +++  +GFL  P 
Sbjct  6    APLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAWMISVVGFL-SPF  64

Query  749  AIVAALLTALSIAFLNDSFA-GAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
             ++   L  + +  +   F   A N+ + R +++  P                       
Sbjct  65   NMI---LGGIVVVLVFTGFVWAAHNKDILRRMKKQYPT----------------------  99

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     VFV+V    S  L  +  G++   + ++  LL   +HAS R  NLK +L  
Sbjct  100  ---------VFVMVVMLASYFLISLFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLEN  150

Query  392  FREE  381
              EE
Sbjct  151  KMEE  154



>ref|XP_005985463.1| PREDICTED: PRA1 family protein 3 [Pantholops hodgsonii]
Length=188

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 78/184 (42%), Gaps = 42/184 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILG-MGFLRRPL  750
            +P R   +FF    RF  P  R  +KWN+R+  NL YY+TNY ++   ++  +GFL  P 
Sbjct  6    APLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFL-SPF  64

Query  749  AIVAALLTALSIAFLNDSFA-GAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
             ++   L  + +  +   F   A N+ + R +++  P                       
Sbjct  65   NMI---LGGIVVVLVFTGFVWAAHNKDILRRMKKQYPT----------------------  99

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     VFV+V    S  L  +  G++   + ++  LL   +HAS R  NLK +L  
Sbjct  100  ---------VFVMVVMLASYFLISLFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLEN  150

Query  392  FREE  381
              EE
Sbjct  151  KMEE  154



>ref|XP_010780797.1| PREDICTED: PRA1 family protein 3 [Notothenia coriiceps]
Length=191

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 78/180 (43%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF--LMIVFILGMGFLRRP  753
            +P R   +F+    RF  P      KWN+R+  NL YY+TNYF   ++VF++ +GFL   
Sbjct  8    APLRQWDDFYPGTDRFAKPEFGDLTKWNNRVISNLMYYQTNYFAAAVVVFLI-VGFLNPF  66

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
               +  ++ AL   F+   +AG  N+ + +  ++ +P                       
Sbjct  67   GMFLGGVVVAL--VFMGSVWAGE-NQAMVKNFKKKNPS----------------------  101

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     VFV+     S  L  +  G+L   + ++  LL  L+HAS R  N+K ++  
Sbjct  102  ---------VFVICVMGTSYFLLSLCGGVLVFMFGITFPLLLILIHASLRLRNMKNKMEN  152



>ref|XP_009019141.1| hypothetical protein HELRODRAFT_81043 [Helobdella robusta]
 gb|ESO02927.1| hypothetical protein HELRODRAFT_81043 [Helobdella robusta]
Length=179

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (45%), Gaps = 43/188 (23%)
 Frame = -1

Query  926  EVDWSSPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFL  762
            +VD++ P +PL EF    SRF  P  R+  KW +R+  NL Y++TNYF+M + I  +  +
Sbjct  4    KVDFA-PFQPLDEFLLDLSRFQAPNFRNIDKWTNRIINNLLYFQTNYFVMALIIFTLIGI  62

Query  761  RRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRP--  588
              P+ ++   LT           AGA    +T           + M+  L    +  P  
Sbjct  63   YHPVDMIVGCLT----------LAGAITIFIT----------ISNMKQELKRFKKNYPIV  102

Query  587  SAKRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLK  408
                 I +C    + F+ V  +V+     V C      + ++  L   L+HASFR  +LK
Sbjct  103  GVLCIIALC----YFFIYVLGSVA-----VFC------FGIAFPLFIILLHASFRLRSLK  147

Query  407  ARLNTFRE  384
             +++   E
Sbjct  148  NKMSNKME  155



>gb|ACN60174.1| PRA1 family protein 3 [Salmo salar]
Length=189

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 78/182 (43%), Gaps = 40/182 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF-LMIVFILGMGFLRRPL  750
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF + IV  L +GFL  PL
Sbjct  5    APLRPWDDFFPGADRFAKPDFGDLAKWNNRVISNLLYYQTNYFAVAIVVFLIVGFL-NPL  63

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +       +S+ F+   +AG   +   +  ++ +P L                      
Sbjct  64   GMFLG-GAVVSLVFMGSVWAGEN-KNFIKNFKKKNPTL----------------------  99

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                     FV+     S  L  +  G++   + ++  L+  LVHAS R  N+K RL   
Sbjct  100  ---------FVIAVMGTSYFLLSLCGGVMVFIFGITFPLMLILVHASLRLRNMKNRLENK  150

Query  389  RE  384
             E
Sbjct  151  ME  152



>ref|XP_010873776.1| PREDICTED: PRA1 family protein 3 [Esox lucius]
 ref|XP_010873777.1| PREDICTED: PRA1 family protein 3 [Esox lucius]
Length=191

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 74/179 (41%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF-LMIVFILGMGFLRRPL  750
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF + IV  L +GFL  PL
Sbjct  7    APLRPWDDFFPGADRFAKPDFGDLAKWNNRVISNLLYYQTNYFAVAIVVFLIVGFL-NPL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +       +S+ F+   +AG           +       K  P L              
Sbjct  66   GMFLG-GAVVSLVFMGSVWAGE---------NKNFIKNFKKKNPTL--------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV+     S  L  +  G++   + ++  LL  LVHAS R  N+K RL  
Sbjct  102  ---------FVIAVMGTSYFLLSLCGGVMVFIFGITFPLLLILVHASLRLRNMKNRLEN  151



>gb|ACI66695.1| PRA1 family protein 3 [Salmo salar]
Length=191

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 78/182 (43%), Gaps = 40/182 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF-LMIVFILGMGFLRRPL  750
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF + IV  L +GFL  PL
Sbjct  7    APLRPWDDFFPGADRFAKPDFGDLAKWNNRVISNLLYYQTNYFAVAIVVFLIVGFL-NPL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +       +S+ F+   +AG   +   +  ++ +P L                      
Sbjct  66   GMFLG-GAVVSLVFMGSVWAGEN-KNFIKNFKKKNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                     FV+     S  L  +  G++   + ++  L+  LVHAS R  N+K RL   
Sbjct  102  ---------FVIAVMGTSYFLLSLCGGVMVFIFGITFPLMLILVHASLRLRNMKNRLENK  152

Query  389  RE  384
             E
Sbjct  153  ME  154



>ref|XP_002732529.1| PREDICTED: PRA1 family protein 3-like [Saccoglossus kowalevskii]
Length=178

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/188 (26%), Positives = 82/188 (44%), Gaps = 41/188 (22%)
 Frame = -1

Query  920  DWSSPP-RPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLM-IVFILGMGFL  762
            D   PP R   +F    +RF  P      +WN+R+  NL YY+TNYFL+ +V  L +G L
Sbjct  3    DIQVPPLRAFKDFLGESARFQTPAFNDLMRWNNRVVNNLLYYQTNYFLVTVVMFLIVGCL  62

Query  761  RRPLAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSA  582
              P+ ++  ++  ++ AF+    A   N++  +  +Q  P                    
Sbjct  63   -HPVKMLIGIVAVIA-AFMGFIMATE-NKRQMKNFKQAHP--------------------  99

Query  581  KRAIYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKAR  402
                 IC       VL    +   + +V  GLL   W +++ L    +HASF+  N+K +
Sbjct  100  ----LIC-------VLAILAIGYFIVYVFGGLLVFIWGIALPLAVIFLHASFKLRNIKNK  148

Query  401  LNTFREEF  378
            ++   + F
Sbjct  149  VSYGAKSF  156



>ref|XP_002892203.1| hypothetical protein ARALYDRAFT_470402 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68462.1| hypothetical protein ARALYDRAFT_470402 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = -1

Query  953  AEDLIEALREVDWS--SPPRPLSEFF--SRFTVPRSYAKWNSRLKCNLYYYRTNYFLMIV  786
            A  +I  ++E   S     RP  +F   S F+VP S A   +R+  NL ++R NY +++ 
Sbjct  2    ANQVITGIKETAQSITGAARPWGDFLDLSAFSVPSSVADATTRVTQNLTHFRINYSIILS  61

Query  785  FILGMGFLRRPLAIVAALLTALSIAFL  705
             +LG+  + RP+AI+A +   L+  FL
Sbjct  62   ILLGLTLITRPIAILAFIAVGLAWFFL  88



>ref|XP_002015306.1| GL18490 [Drosophila persimilis]
 ref|XP_002132824.1| GA25658 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW29302.1| GL18490 [Drosophila persimilis]
 gb|EDY70226.1| GA25658 [Drosophila pseudoobscura pseudoobscura]
Length=208

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 88/188 (47%), Gaps = 34/188 (18%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            +P R L +F    +RF +P  + + KW +R+  NL YY+TNY L+ + I  +  +  P  
Sbjct  23   APLRTLDDFVLGSARFQLPNLKDFDKWGNRVVKNLLYYQTNYILLFLVIYALMIVCNPTK  82

Query  746  IVAALLT-ALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
            I++ L+  AL IA                 + QF    ++K +P     I  R +   AI
Sbjct  83   IISGLIVQALIIA----------------VIWQF---FSSKSKPSF---IASRLTGGNAI  120

Query  569  YI--CGRPRWVFVLVFSTVSSILW--FVSCGLLTVSWALSVGLLATLVHASFRTPNLKAR  402
                  + +W ++L  + +   L+   +S  LLT ++ L + +  T +HAS R  N+K +
Sbjct  121  VAEQNAQQKW-YILAGALLGGYLFLHLISAVLLT-AFTLLLPISVTFIHASLRLRNMKNK  178

Query  401  LNTFREEF  378
            L    E F
Sbjct  179  LANTIESF  186



>ref|XP_002051820.1| GJ17203 [Drosophila virilis]
 gb|EDW63975.1| GJ17203 [Drosophila virilis]
Length=208

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 82/183 (45%), Gaps = 26/183 (14%)
 Frame = -1

Query  908  PPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLAI  744
            P R L +F    +RF +P  + + KW +R+  NL YY+TNYFL+ + I  +     P  I
Sbjct  24   PLRTLDDFVLGSARFQLPNLKDFDKWGNRVVKNLLYYQTNYFLVFLAIYVIMIAFNPTKI  83

Query  743  VAALLT-ALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
            ++ LL  AL IA +   F+           +  +  +A+++       I  + +A++  Y
Sbjct  84   ISGLLVQALIIAIIWQFFSS----------KSKTNFIASRLTGG--NQILAQQNAQQKWY  131

Query  566  ICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFR  387
            I         L    +S++L      LL +S         T +HAS R  N+K +L    
Sbjct  132  ILAGALLAGYLFLHMISAVLLTAFTLLLPIS--------VTFIHASLRLRNIKNKLANTI  183

Query  386  EEF  378
            E F
Sbjct  184  ESF  186



>dbj|BAG51976.1| unnamed protein product [Homo sapiens]
Length=188

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/183 (27%), Positives = 79/183 (43%), Gaps = 42/183 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGM-GFLRRPL  750
            +P R   +FF    RF  P  R  +KWN+R+  NL YY+TNY ++   ++ + GFL  P 
Sbjct  6    APLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLS-PF  64

Query  749  AIVAALLTALSIAFLNDSFA-GAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
             ++   L  + +  ++  F   A N+ V R +++         R P T            
Sbjct  65   NMI---LGGIVVVLVSTGFVWAAHNKDVLRRMKK---------RYPTT------------  100

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+V    S  L  +  G++   + ++  LL   +HAS R  NLK +L  
Sbjct  101  ----------FVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLEN  150

Query  392  FRE  384
              E
Sbjct  151  KME  153



>ref|XP_003973801.1| PREDICTED: PRA1 family protein 3-like [Takifugu rubripes]
Length=190

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 75/179 (42%), Gaps = 40/179 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFI-LGMGFLRRPL  750
            +P R   +FF    RF  P  +  AKWN+R+  NL YY+TNY +  V I L +GFL  PL
Sbjct  7    TPLRAWDDFFPGWERFAKPDTKDVAKWNNRIVNNLLYYQTNYLVSAVAIFLVVGFL-NPL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +  A +  +S  FL   +AG                   + R  +    R  P+A    
Sbjct  66   GMFTA-MAVVSAIFLGSVWAG-------------------ENRAVINNFKRHNPTA----  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                     FV +    S IL  +   ++    A++  L     HASFR  N+K +L  
Sbjct  102  ---------FVFLIMVASYILISLLGSVMVFMSAITFPLACIFAHASFRLRNMKNKLEN  151



>gb|KFK31706.1| hypothetical protein AALP_AA6G148400 [Arabis alpina]
Length=183

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = -1

Query  953  AEDLIEALREVDWS--SPPRPLSEFF--SRFTVPRSYAKWNSRLKCNLYYYRTNYFLMIV  786
            A  +I   +E   S     RP +EF   + F++P S A   +R+  NL ++R NY +++ 
Sbjct  2    ANQVIAGFKETAQSIAGAARPWTEFLDLTAFSIPSSIADATTRITQNLTHFRINYSIILY  61

Query  785  FILGMGFLRRPLAIVAALLTALSIAFL  705
            F+L +  + RP+AI+A +   L+  FL
Sbjct  62   FLLAISLITRPIAILAFIAVGLAWYFL  88



>ref|XP_007447707.1| PREDICTED: PRA1 family protein 3 [Lipotes vexillifer]
Length=188

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 42/183 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGM-GFLRRPL  750
            +P R   +FF    RF  P  R  +KWN+R+  NL YY+TNY ++   ++ + GFL  P 
Sbjct  6    APLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLS-PF  64

Query  749  AIVAALLTALSIAFLNDSFA-GAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
             ++   L  + +  +   F   A N+ + R ++                  + RP+A   
Sbjct  65   NMI---LGGIVVVLVFTGFVWAAHNKDILRRMK------------------KQRPTA---  100

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+V    S  L  +  G++   + ++  LL   +HAS R  NLK +L  
Sbjct  101  ----------FVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLEN  150

Query  392  FRE  384
              E
Sbjct  151  KME  153



>emb|CDQ75843.1| unnamed protein product [Oncorhynchus mykiss]
Length=191

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 78/182 (43%), Gaps = 40/182 (22%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF-LMIVFILGMGFLRRPL  750
            +P RP  +FF    RF  P     AKWN+R+  NL YY+TNYF + IV  L +GFL  PL
Sbjct  7    APLRPWDDFFPGADRFAKPDFGDLAKWNNRVISNLLYYQTNYFAVAIVVFLIVGFL-NPL  65

Query  749  AIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAI  570
             +       +S+ F+   +AG   +   +  ++ +P L                      
Sbjct  66   GMFLG-GAVVSLVFMCSVWAGEN-KNFIKNFKKKNPTL----------------------  101

Query  569  YICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTF  390
                     FV+     S  L  +  G++   + ++  LL  LVHAS R  N+K RL   
Sbjct  102  ---------FVIAVMGTSYFLLSLCGGVMVFIFGITFPLLLILVHASLRLRNMKNRLENK  152

Query  389  RE  384
             E
Sbjct  153  ME  154



>ref|XP_002430606.1| pra1 protein, putative [Pediculus humanus corporis]
 gb|EEB17868.1| pra1 protein, putative [Pediculus humanus corporis]
Length=183

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 78/180 (43%), Gaps = 38/180 (21%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVP--RSYAKWNSRLKCNLYYYRTNYFLMIVFILGMGFLRRPLA  747
            SP R L +F    +RF +P  R   KW +R+  NL YY+TNYFLM + ++ +  +  P+ 
Sbjct  10   SPLRSLDDFLLGSARFQLPNYRDMEKWGNRVVQNLLYYQTNYFLMSIIMILVVTVLHPVK  69

Query  746  IVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRAIY  567
            +    LT L +  L  SF       VTR  + +                   P     + 
Sbjct  70   MACGGLTILLMYAL-FSFLMNSTSSVTRLKKDY-------------------PFLGICLM  109

Query  566  ICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNTFR  387
            I G    V++L      S+L F+   LL +S        AT +HAS R  N+  +L+T  
Sbjct  110  IGGACLMVYML-----GSLLVFLFGILLPIS--------ATFIHASLRLRNIMNKLSTIE  156



>ref|XP_004070879.1| PREDICTED: PRA1 family protein 3-like [Oryzias latipes]
Length=191

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (44%), Gaps = 42/180 (23%)
 Frame = -1

Query  911  SPPRPLSEFF---SRFTVPR--SYAKWNSRLKCNLYYYRTNYF--LMIVFILGMGFLRRP  753
            +P R   +FF    RF  P     AKWN+R+  NL YY+TNYF   ++VF++ +GFL  P
Sbjct  8    APLRQWDDFFPGVDRFAKPDFSDLAKWNNRMISNLMYYQTNYFAAALVVFLI-VGFL-NP  65

Query  752  LAIVAALLTALSIAFLNDSFAGAFNEKVTRTVRQFSPHLAAKMRPPLTPVIRGRPSAKRA  573
              +     T +++ F    +AG  N+   ++ ++ +P L                     
Sbjct  66   FGLFLG-GTVVTLVFAGSVWAGE-NKAFIKSFKRKNPTL---------------------  102

Query  572  IYICGRPRWVFVLVFSTVSSILWFVSCGLLTVSWALSVGLLATLVHASFRTPNLKARLNT  393
                      FV+     S  L  +  G++   + ++  LL  ++HAS R  N+K +L  
Sbjct  103  ----------FVICVMVTSYFLLSLCGGVMIFIFGITFPLLLIMIHASLRLRNIKNKLEN  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3145178720708