BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78948_g1_i1 len=2026 path=[2004:0-2025]

Length=2026
                                                                      Score     E

ref|XP_009608181.1|  PREDICTED: zinc transporter 1-like                 402   1e-130   
ref|XP_009772024.1|  PREDICTED: zinc transporter 1-like                 402   2e-130   
ref|XP_007022739.1|  Zinc transporter 1 precursor                       390   5e-126   
ref|XP_006422259.1|  hypothetical protein CICLE_v10005306mg             387   5e-125   
ref|XP_002315075.2|  metal transport family protein                     387   6e-125   Populus trichocarpa [western balsam poplar]
ref|XP_008447078.1|  PREDICTED: zinc transporter 1                      387   7e-125   
ref|XP_011014118.1|  PREDICTED: zinc transporter 1-like                 386   1e-124   
ref|XP_004139841.1|  PREDICTED: zinc transporter 1-like                 384   6e-124   
ref|XP_006422260.1|  hypothetical protein CICLE_v10005248mg             383   2e-123   
ref|XP_008226052.1|  PREDICTED: zinc transporter 1-like                 382   5e-123   
emb|CAN72264.1|  hypothetical protein VITISV_008114                     380   4e-122   Vitis vinifera
ref|XP_007149187.1|  hypothetical protein PHAVU_005G048900g             378   1e-121   
ref|XP_002264603.2|  PREDICTED: zinc transporter 1                      378   2e-121   Vitis vinifera
ref|XP_006493801.1|  PREDICTED: zinc transporter 1-like                 381   2e-121   
gb|AAR08412.1|  metal transport protein                                 378   2e-121   Medicago truncatula
ref|XP_003546826.1|  PREDICTED: zinc transporter 1-like                 377   6e-121   
gb|AFK42181.1|  unknown                                                 376   9e-121   
gb|EYU27582.1|  hypothetical protein MIMGU_mgv1a008839mg                376   1e-120   
ref|XP_011095751.1|  PREDICTED: zinc transporter 1-like                 376   1e-120   
gb|KHN48870.1|  Zinc transporter 1                                      374   3e-120   
gb|KHN21378.1|  Zinc transporter 1                                      374   3e-120   
ref|XP_007212798.1|  hypothetical protein PRUPE_ppa020164mg             374   4e-120   
emb|CAN72265.1|  hypothetical protein VITISV_008115                     374   4e-120   Vitis vinifera
ref|XP_003531480.1|  PREDICTED: zinc transporter 1-like                 373   1e-119   
ref|XP_002312231.1|  metal transport family protein                     370   1e-118   Populus trichocarpa [western balsam poplar]
gb|ACU24645.1|  unknown                                                 368   1e-117   Glycine max [soybeans]
ref|XP_004293836.1|  PREDICTED: zinc transporter 1-like                 368   1e-117   
ref|XP_004306552.1|  PREDICTED: zinc transporter 1-like                 368   1e-117   
ref|XP_008229645.1|  PREDICTED: zinc transporter 8-like                 367   3e-117   
ref|XP_010036079.1|  PREDICTED: zinc transporter 8-like                 365   7e-117   
ref|XP_010109875.1|  Zinc transporter 1                                 365   1e-116   
ref|XP_011014627.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    365   2e-116   
ref|XP_007217784.1|  hypothetical protein PRUPE_ppa020051mg             364   2e-116   
ref|XP_008229644.1|  PREDICTED: zinc transporter 8-like                 365   2e-116   
gb|EYU33801.1|  hypothetical protein MIMGU_mgv1a008434mg                365   3e-116   
ref|XP_002307860.2|  zinc transporter protein ZIP1                      364   4e-116   Populus trichocarpa [western balsam poplar]
ref|XP_007215607.1|  hypothetical protein PRUPE_ppa007779mg             364   5e-116   
ref|XP_002527722.1|  zinc/iron transporter, putative                    363   1e-115   Ricinus communis
ref|XP_004488546.1|  PREDICTED: zinc transporter 1-like                 363   1e-115   
ref|XP_007049130.1|  Zinc transporter 5 precursor                       363   1e-115   
ref|XP_002532140.1|  zinc/iron transporter, putative                    362   3e-115   Ricinus communis
ref|XP_007213802.1|  hypothetical protein PRUPE_ppa007253mg             363   3e-115   
ref|XP_006353723.1|  PREDICTED: zinc transporter 5-like                 361   3e-115   
ref|XP_011002389.1|  PREDICTED: zinc transporter 8-like                 361   5e-115   
ref|XP_009363255.1|  PREDICTED: zinc transporter 1-like                 361   6e-115   
gb|KHG11077.1|  Zinc transporter 5 -like protein                        360   2e-114   
ref|XP_006429781.1|  hypothetical protein CICLE_v10012062mg             360   2e-114   
gb|KCW47600.1|  hypothetical protein EUGRSUZ_K01344                     360   2e-114   
ref|XP_010260702.1|  PREDICTED: zinc transporter 8-like                 360   2e-114   
ref|XP_008225897.1|  PREDICTED: zinc transporter 8-like                 359   4e-114   
ref|XP_002307858.2|  hypothetical protein POPTR_0006s00840g             358   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_006429779.1|  hypothetical protein CICLE_v10011940mg             360   4e-114   
ref|XP_006481378.1|  PREDICTED: zinc transporter 8-like                 358   7e-114   
gb|KDO77256.1|  hypothetical protein CISIN_1g018362mg                   358   8e-114   
gb|EYU42857.1|  hypothetical protein MIMGU_mgv1a025410mg                358   9e-114   
ref|XP_008371921.1|  PREDICTED: zinc transporter 1-like                 358   1e-113   
ref|XP_010036084.1|  PREDICTED: zinc transporter 1-like                 357   1e-113   
ref|XP_010036080.1|  PREDICTED: zinc transporter 8-like                 356   3e-113   
ref|XP_006468555.1|  PREDICTED: zinc transporter 5-like                 356   5e-113   
ref|XP_006481377.1|  PREDICTED: zinc transporter 8-like                 355   1e-112   
ref|XP_010036078.1|  PREDICTED: zinc transporter 8-like                 354   2e-112   
ref|XP_010093125.1|  Zinc transporter 5                                 353   7e-112   
dbj|BAH66920.1|  metal transporter                                      352   7e-112   Nicotiana tabacum [American tobacco]
gb|KCW47598.1|  hypothetical protein EUGRSUZ_K01343                     354   1e-111   
ref|XP_011100402.1|  PREDICTED: zinc transporter 8-like                 352   3e-111   
ref|XP_009794548.1|  PREDICTED: zinc transporter 8-like                 351   4e-111   
gb|KDP23905.1|  hypothetical protein JCGZ_27105                         351   4e-111   
gb|EYU42826.1|  hypothetical protein MIMGU_mgv1a009106mg                350   7e-111   
emb|CDP16373.1|  unnamed protein product                                350   8e-111   
gb|AFK48496.1|  unknown                                                 349   1e-110   
ref|XP_004243896.1|  PREDICTED: zinc transporter 5-like                 349   2e-110   
ref|XP_008378335.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    348   4e-110   
ref|XP_004303952.1|  PREDICTED: zinc transporter 1-like                 348   5e-110   
ref|XP_008357510.1|  PREDICTED: zinc transporter 8-like                 348   5e-110   
ref|XP_009610335.1|  PREDICTED: zinc transporter 5                      347   6e-110   
ref|XP_008383275.1|  PREDICTED: zinc transporter 1-like                 348   1e-109   
emb|CAN83128.1|  hypothetical protein VITISV_029536                     347   1e-109   Vitis vinifera
ref|XP_004231600.1|  PREDICTED: zinc transporter 8-like                 347   1e-109   
gb|AES71719.2|  ZIP zinc/iron transport family protein                  347   1e-109   
ref|XP_009340286.1|  PREDICTED: zinc transporter 1-like                 347   2e-109   
ref|XP_003601469.1|  Zinc transporter                                   348   2e-109   
ref|XP_011100401.1|  PREDICTED: zinc transporter 8-like                 347   2e-109   
ref|XP_003601470.1|  Zinc transporter                                   348   2e-109   
ref|XP_009775150.1|  PREDICTED: zinc transporter 5-like                 346   2e-109   
ref|XP_010275878.1|  PREDICTED: zinc transporter 5-like                 346   3e-109   
ref|XP_009769157.1|  PREDICTED: zinc transporter 5-like                 345   4e-109   
gb|ADF43066.1|  zinc transporter protein                                346   4e-109   
gb|AAX28838.1|  zinc transporter protein ZIP2                           345   1e-108   Fragaria x ananassa
ref|XP_009379338.1|  PREDICTED: zinc transporter 8-like                 344   1e-108   
ref|XP_009363337.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    343   2e-108   
ref|XP_010676218.1|  PREDICTED: zinc transporter 1-like                 345   2e-108   
ref|XP_003601468.1|  Zinc transporter                                   347   2e-108   
ref|XP_008812441.1|  PREDICTED: zinc transporter 3-like                 346   3e-108   
gb|ABH01187.1|  zinc transporter protein                                343   4e-108   Ammopiptanthus mongolicus
ref|XP_006363493.1|  PREDICTED: zinc transporter 8-like                 343   4e-108   
ref|XP_009625957.1|  PREDICTED: zinc transporter 8-like                 343   5e-108   
gb|KEH35205.1|  ZIP zinc/iron transport family protein                  343   7e-108   
gb|AAR08414.1|  metal transport protein                                 343   8e-108   Medicago truncatula
ref|XP_006353722.1|  PREDICTED: zinc transporter 5-like                 342   1e-107   
ref|XP_008371976.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    342   2e-107   
ref|XP_008799797.1|  PREDICTED: zinc transporter 8-like                 341   2e-107   
ref|XP_009354003.1|  PREDICTED: zinc transporter 1-like                 341   3e-107   
gb|AAX28837.1|  zinc transporter protein ZIP1                           340   9e-107   Fragaria x ananassa
ref|XP_004146060.1|  PREDICTED: zinc transporter 1-like                 340   1e-106   
ref|XP_009393263.1|  PREDICTED: zinc transporter 4-like                 340   1e-106   
ref|XP_010941688.1|  PREDICTED: zinc transporter 4                      339   2e-106   
gb|EYU42823.1|  hypothetical protein MIMGU_mgv1a019299mg                338   2e-106   
ref|XP_009397090.1|  PREDICTED: zinc transporter 8-like                 338   3e-106   
ref|XP_002264621.1|  PREDICTED: zinc transporter 8                      338   4e-106   Vitis vinifera
ref|XP_010044860.1|  PREDICTED: zinc transporter 5-like                 338   7e-106   
ref|XP_004167569.1|  PREDICTED: zinc transporter 1-like                 338   9e-106   
gb|EPS63182.1|  hypothetical protein M569_11603                         336   2e-105   
ref|XP_008464645.1|  PREDICTED: zinc transporter 5-like                 337   3e-105   
ref|XP_007145957.1|  hypothetical protein PHAVU_006G001000g             336   3e-105   
ref|XP_010044870.1|  PREDICTED: zinc transporter 1-like                 335   6e-105   
ref|XP_008378330.1|  PREDICTED: zinc transporter 8-like                 335   7e-105   
ref|XP_007041017.1|  Zinc transporter 1 precursor                       343   8e-105   
ref|XP_006858211.1|  hypothetical protein AMTR_s00062p00183460          334   2e-104   
emb|CAN67594.1|  hypothetical protein VITISV_000700                     333   2e-104   Vitis vinifera
ref|XP_010922623.1|  PREDICTED: zinc transporter 8-like isoform X2      333   3e-104   
gb|ABF55689.1|  putative zinc transporter                               333   3e-104   Triticum aestivum [Canadian hard winter wheat]
emb|CAN83129.1|  hypothetical protein VITISV_029537                     335   3e-104   Vitis vinifera
ref|XP_010922622.1|  PREDICTED: zinc transporter 8-like isoform X1      333   3e-104   
ref|XP_009396993.1|  PREDICTED: zinc transporter 8-like                 333   4e-104   
gb|ACN38063.1|  zinc transporter protein                                333   5e-104   Sedum alfredii
ref|XP_006468557.1|  PREDICTED: zinc transporter 8-like isoform X2      333   6e-104   
gb|AFK49414.1|  unknown                                                 332   7e-104   
ref|XP_004243649.1|  PREDICTED: zinc transporter 5-like                 332   8e-104   
emb|CAN74488.1|  hypothetical protein VITISV_029272                     332   9e-104   Vitis vinifera
ref|XP_002265102.1|  PREDICTED: zinc transporter 8                      332   9e-104   Vitis vinifera
ref|XP_010931295.1|  PREDICTED: zinc transporter 8-like                 332   1e-103   
ref|XP_003568257.1|  PREDICTED: zinc transporter 9-like                 332   1e-103   
ref|XP_008792254.1|  PREDICTED: zinc transporter 8-like                 331   2e-103   
ref|XP_006448619.1|  hypothetical protein CICLE_v10015713mg             331   3e-103   
gb|KDP35622.1|  hypothetical protein JCGZ_09060                         330   3e-103   
ref|XP_010691362.1|  PREDICTED: zinc transporter 1-like                 330   4e-103   
gb|AFN88220.1|  zinc transporter protein                                330   5e-103   
ref|XP_004502089.1|  PREDICTED: zinc transporter 5-like                 330   6e-103   
gb|KCW88546.1|  hypothetical protein EUGRSUZ_A00918                     330   7e-103   
ref|XP_009400783.1|  PREDICTED: zinc transporter 8-like                 329   7e-103   
ref|NP_001149008.1|  zinc transporter 1 precursor                       330   8e-103   Zea mays [maize]
ref|XP_009419521.1|  PREDICTED: zinc transporter 3-like                 330   3e-102   
ref|XP_003581657.2|  PREDICTED: zinc transporter 3-like isoform X1      328   3e-102   
ref|XP_003557360.1|  PREDICTED: zinc transporter 8-like                 328   3e-102   
ref|XP_004976785.1|  PREDICTED: zinc transporter 3-like                 328   6e-102   
ref|XP_010693319.1|  PREDICTED: zinc transporter 1-like                 328   6e-102   
gb|ACN93834.1|  metal ion transporter ZIP8                              327   1e-101   Hordeum vulgare [barley]
ref|XP_002448514.1|  hypothetical protein SORBIDRAFT_06g028270          327   1e-101   Sorghum bicolor [broomcorn]
dbj|BAJ87579.1|  predicted protein                                      327   1e-101   
ref|XP_006468556.1|  PREDICTED: zinc transporter 8-like isoform X1      327   1e-101   
gb|ACN93832.1|  metal ion transporter ZIP3                              327   1e-101   Hordeum vulgare [barley]
ref|XP_007145986.1|  hypothetical protein PHAVU_006G003300g             326   1e-101   
gb|ADE87884.1|  zinc transporter ZIP1                                   325   4e-101   
gb|ADE87887.1|  zinc transporter ZIP1                                   325   5e-101   
gb|AAW68439.1|  zinc transporter ZIP                                    325   5e-101   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007049047.1|  Zinc transporter 5 precursor                       325   6e-101   
ref|XP_002274548.2|  PREDICTED: zinc transporter 5                      334   7e-101   Vitis vinifera
ref|XP_009384788.1|  PREDICTED: zinc transporter 5-like                 327   7e-101   
ref|XP_004961773.1|  PREDICTED: zinc transporter 9-like                 324   8e-101   
ref|XP_010499439.1|  PREDICTED: zinc transporter 1                      324   1e-100   
ref|XP_010487001.1|  PREDICTED: zinc transporter 1-like                 324   1e-100   
emb|CDP18202.1|  unnamed protein product                                323   2e-100   
ref|XP_010538635.1|  PREDICTED: probable zinc transporter 12            323   3e-100   
emb|CBI27217.3|  unnamed protein product                                328   3e-100   
gb|KHG04713.1|  Zinc transporter 1 -like protein                        323   3e-100   
ref|XP_011085461.1|  PREDICTED: zinc transporter 5-like                 322   4e-100   
ref|NP_187881.1|  zinc transporter 1                                    322   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884924.1|  hypothetical protein ARALYDRAFT_897485             322   5e-100   
ref|XP_004976446.1|  PREDICTED: zinc transporter 9-like                 322   5e-100   
gb|EAY95519.1|  hypothetical protein OsI_17365                          322   5e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_010260697.1|  PREDICTED: zinc transporter 8-like                 332   6e-100   
emb|CDP03480.1|  unnamed protein product                                322   6e-100   
gb|ACJ84426.1|  unknown                                                 322   7e-100   Medicago truncatula
ref|XP_010465054.1|  PREDICTED: zinc transporter 1-like                 321   1e-99    
ref|XP_010557015.1|  PREDICTED: zinc transporter 5-like                 320   3e-99    
ref|XP_010051825.1|  PREDICTED: zinc transporter 1-like                 321   3e-99    
gb|AAR08413.1|  metal transport protein                                 320   3e-99    Medicago truncatula
ref|XP_009402753.1|  PREDICTED: zinc transporter 8-like                 320   4e-99    
ref|XP_009363363.1|  PREDICTED: zinc transporter 8-like                 320   4e-99    
dbj|BAJ34313.1|  unnamed protein product                                319   5e-99    
ref|XP_006407300.1|  hypothetical protein EUTSA_v10021018mg             319   7e-99    
ref|XP_006299048.1|  hypothetical protein CARUB_v10015186mg             318   2e-98    
gb|KFK38622.1|  hypothetical protein AALP_AA3G138000                    317   3e-98    
ref|NP_001053851.1|  Os04g0613000                                       318   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652807.1|  PREDICTED: zinc transporter 3-like                 318   3e-98    
gb|KEH35212.1|  ZIP zinc/iron transport family protein                  317   3e-98    
gb|KEH35211.1|  ZIP zinc/iron transport family protein                  318   3e-98    
ref|XP_011035492.1|  PREDICTED: zinc transporter 1-like                 317   7e-98    
ref|XP_009412061.1|  PREDICTED: zinc transporter 3-like                 317   2e-97    
ref|XP_008225896.1|  PREDICTED: zinc transporter 5-like                 315   3e-97    
gb|AAP92123.1|  iron transporter Fe2                                    315   3e-97    Oryza sativa Japonica Group [Japonica rice]
gb|ACN93833.1|  metal ion transporter ZIP5                              315   3e-97    Hordeum vulgare [barley]
ref|NP_001059239.1|  Os07g0232800                                       315   4e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010484879.1|  PREDICTED: zinc transporter 5                      314   8e-97    
emb|CDY42175.1|  BnaC05g40440D                                          313   2e-96    
ref|XP_007212363.1|  hypothetical protein PRUPE_ppa014732mg             313   2e-96    
ref|XP_008799796.1|  PREDICTED: LOW QUALITY PROTEIN: zinc transpo...    313   2e-96    
ref|XP_006305175.1|  hypothetical protein CARUB_v10009542mg             313   3e-96    
gb|EPS66222.1|  zinc transporter protein                                311   3e-96    
ref|XP_010557016.1|  PREDICTED: zinc transporter 3-like                 312   5e-96    
gb|EMS45894.1|  Zinc transporter 5                                      310   1e-95    
ref|XP_003566152.1|  PREDICTED: zinc transporter 5-like                 311   1e-95    
emb|CDY66215.1|  BnaC05g49110D                                          311   1e-95    
ref|XP_010922621.1|  PREDICTED: zinc transporter 8-like                 310   2e-95    
gb|KFK42876.1|  hypothetical protein AALP_AA1G050300                    310   3e-95    
ref|XP_009146590.1|  PREDICTED: zinc transporter 1                      309   4e-95    
ref|XP_009119168.1|  PREDICTED: zinc transporter 5                      308   9e-95    
emb|CDY46862.1|  BnaA10g03460D                                          308   1e-94    
ref|XP_010457615.1|  PREDICTED: zinc transporter 5-like                 308   1e-94    
ref|NP_001055818.1|  Os05g0472700                                       308   2e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011087053.1|  PREDICTED: zinc transporter 1-like                 305   2e-94    
ref|NP_172022.1|  zinc transporter 5                                    308   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892281.1|  hypothetical protein ARALYDRAFT_470527             307   3e-94    
ref|NP_001148241.1|  ZIP zinc/iron transport family protein precu...    308   6e-94    Zea mays [maize]
dbj|BAJ85179.1|  predicted protein                                      306   1e-93    
ref|XP_006363198.1|  PREDICTED: zinc transporter 5-like                 305   2e-93    
ref|XP_002282425.1|  PREDICTED: fe(2+) transport protein 1              305   2e-93    Vitis vinifera
ref|XP_002273179.1|  PREDICTED: probable zinc transporter 10            305   3e-93    Vitis vinifera
ref|XP_006369054.1|  zinc transporter protein ZIP1                      303   3e-93    
ref|NP_001236499.1|  zinc transporter protein ZIP1 precursor            305   3e-93    
ref|XP_006418042.1|  hypothetical protein EUTSA_v10008057mg             304   4e-93    
ref|XP_009759352.1|  PREDICTED: zinc transporter 1-like                 304   4e-93    
gb|KDP31427.1|  hypothetical protein JCGZ_11803                         304   5e-93    
ref|XP_004232649.1|  PREDICTED: zinc transporter 3-like                 304   5e-93    
ref|XP_010475216.1|  PREDICTED: zinc transporter 5-like                 304   7e-93    
ref|XP_004145454.1|  PREDICTED: probable zinc transporter 10-like       303   9e-93    
ref|XP_009141213.1|  PREDICTED: zinc transporter 3-like                 303   1e-92    
ref|XP_009143963.1|  PREDICTED: zinc transporter 3                      302   1e-92    
ref|XP_008678193.1|  PREDICTED: zinc transporter 4-like                 304   2e-92    
ref|XP_002514554.1|  zinc/iron transporter, putative                    302   2e-92    Ricinus communis
ref|XP_004157744.1|  PREDICTED: probable zinc transporter 10-like       302   2e-92    
ref|XP_003571530.1|  PREDICTED: zinc transporter 4-like                 305   2e-92    
gb|ADI24871.1|  zinc transporter                                        303   5e-92    
ref|XP_009377533.1|  PREDICTED: fe(2+) transport protein 1-like         301   6e-92    
emb|CDY48278.1|  BnaA05g10760D                                          301   6e-92    
ref|XP_006658416.1|  PREDICTED: zinc transporter 8-like                 300   6e-92    
ref|XP_006295925.1|  hypothetical protein CARUB_v10025062mg             300   7e-92    
emb|CDP08261.1|  unnamed protein product                                302   8e-92    
emb|CAI77926.2|  hypothetical protein                                   301   9e-92    Noccaea caerulescens
ref|XP_006303204.1|  hypothetical protein CARUB_v10011177mg             300   1e-91    
ref|XP_004293827.1|  PREDICTED: zinc transporter 8-like isoform 1       300   2e-91    
gb|AAT01414.1|  iron regulated transporter                              300   2e-91    Cucumis sativus [cucumbers]
ref|NP_001240277.1|  uncharacterized protein LOC100795511 precursor     300   3e-91    
emb|CAI77925.2|  putative Zn transporter                                299   3e-91    Noccaea caerulescens
ref|XP_009622108.1|  PREDICTED: fe(2+) transport protein 1-like         299   5e-91    
ref|XP_010510059.1|  PREDICTED: zinc transporter 3-like                 298   5e-91    
ref|XP_003542170.1|  PREDICTED: zinc transporter 8-like isoform X1      298   5e-91    
ref|XP_007163951.1|  hypothetical protein PHAVU_L002700g                299   6e-91    
gb|ACU22900.1|  unknown                                                 298   7e-91    Glycine max [soybeans]
ref|XP_010922625.1|  PREDICTED: zinc transporter 8-like                 298   9e-91    
ref|XP_010414019.1|  PREDICTED: zinc transporter 3-like                 298   9e-91    
ref|XP_009795595.1|  PREDICTED: fe(2+) transport protein 1-like         299   1e-90    
ref|XP_010691361.1|  PREDICTED: zinc transporter 3-like                 298   1e-90    
ref|XP_008439828.1|  PREDICTED: fe(2+) transport protein 1-like         298   1e-90    
ref|XP_008459065.1|  PREDICTED: fe(2+) transport protein 1              298   1e-90    
ref|XP_006410360.1|  hypothetical protein EUTSA_v10016884mg             297   1e-90    
ref|XP_002445166.1|  hypothetical protein SORBIDRAFT_07g005140          298   2e-90    Sorghum bicolor [broomcorn]
emb|CDP03484.1|  unnamed protein product                                296   3e-90    
ref|XP_006437816.1|  hypothetical protein CICLE_v10033475mg             296   3e-90    
ref|XP_006654534.1|  PREDICTED: zinc transporter 5-like                 296   3e-90    
ref|XP_006484359.1|  PREDICTED: fe(2+) transport protein 1-like         296   3e-90    
gb|EMT15077.1|  Zinc transporter 1                                      300   4e-90    
ref|XP_009597526.1|  PREDICTED: zinc transporter 5-like                 296   4e-90    
gb|AAG44949.1|AF292029_1  putative Zn transport protein                 296   4e-90    Noccaea caerulescens
ref|XP_007024894.1|  Zinc transporter 10 precursor                      298   4e-90    
ref|XP_009796658.1|  PREDICTED: fe(2+) transport protein 1-like         296   5e-90    
ref|XP_010469621.1|  PREDICTED: zinc transporter 3                      295   6e-90    
ref|XP_006448755.1|  hypothetical protein CICLE_v10015769mg             296   6e-90    
ref|XP_010544345.1|  PREDICTED: zinc transporter 1                      295   6e-90    
ref|XP_002879377.1|  hypothetical protein ARALYDRAFT_320968             295   7e-90    
ref|XP_010091672.1|  Fe(2+) transport protein 1                         295   1e-89    
ref|XP_008390030.1|  PREDICTED: fe(2+) transport protein 1-like         295   1e-89    
ref|XP_002864774.1|  predicted protein                                  295   1e-89    
gb|AAY29147.1|  Zrt- and Irt-related protein 3                          294   1e-89    Arabidopsis halleri subsp. gemmifera
ref|XP_006468430.1|  PREDICTED: probable zinc transporter 10-like       295   2e-89    
gb|ACD71460.1|  metal ion transporter-like protein                      295   2e-89    Hordeum vulgare [barley]
ref|NP_180786.1|  zinc transporter 3                                    294   2e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAY29150.1|  Zrt- and Irt-related protein 12                         294   2e-89    Arabidopsis halleri subsp. gemmifera
ref|XP_011085164.1|  PREDICTED: probable zinc transporter 10            294   3e-89    
gb|AID21515.1|  ZIP transporter                                         293   3e-89    
gb|EYU43694.1|  hypothetical protein MIMGU_mgv1a008730mg                294   3e-89    
ref|XP_004961772.1|  PREDICTED: zinc transporter 5-like                 294   3e-89    
emb|CDY46195.1|  BnaA01g23170D                                          294   4e-89    
gb|AAC24199.1|  putative zinc transporter                               293   4e-89    
ref|XP_010242080.1|  PREDICTED: fe(2+) transport protein 1-like         294   5e-89    
ref|XP_004972589.1|  PREDICTED: zinc transporter 4-like                 295   6e-89    
ref|XP_009398318.1|  PREDICTED: fe(2+) transport protein 1-like         293   7e-89    
ref|XP_009757202.1|  PREDICTED: fe(2+) transport protein 1-like         293   7e-89    
gb|KHG00478.1|  putative zinc transporter 10 -like protein              293   7e-89    
ref|XP_007157804.1|  hypothetical protein PHAVU_002G099700g             293   9e-89    
ref|XP_010458321.1|  PREDICTED: probable zinc transporter 12            293   1e-88    
ref|XP_010476366.1|  PREDICTED: zinc transporter 7-like                 292   1e-88    
emb|CDP17625.1|  unnamed protein product                                292   1e-88    
ref|XP_007225019.1|  hypothetical protein PRUPE_ppa020099mg             293   1e-88    
ref|XP_010483928.1|  PREDICTED: probable zinc transporter 12            292   2e-88    
ref|XP_010495426.1|  PREDICTED: zinc transporter 7-like                 292   2e-88    
ref|XP_008787315.1|  PREDICTED: fe(2+) transport protein 1              292   2e-88    
ref|XP_010242082.1|  PREDICTED: fe(2+) transport protein 1-like         292   3e-88    
ref|XP_002439944.1|  hypothetical protein SORBIDRAFT_09g023160          292   3e-88    
ref|XP_011009052.1|  PREDICTED: fe(2+) transport protein 1-like         292   3e-88    
ref|XP_006417109.1|  hypothetical protein EUTSA_v10009476mg             291   4e-88    
ref|XP_002510959.1|  zinc/iron transporter, putative                    291   4e-88    
ref|XP_008243768.1|  PREDICTED: fe(2+) transport protein 1-like         291   5e-88    
ref|XP_003630921.1|  Iron regulated transporter                         295   6e-88    
ref|XP_010522316.1|  PREDICTED: zinc transporter 5                      289   1e-87    
ref|XP_006853448.1|  hypothetical protein AMTR_s00032p00184330          289   2e-87    
ref|XP_002315981.2|  zinc transporter 7 precursor family protein        290   2e-87    
ref|XP_011040375.1|  PREDICTED: fe(2+) transport protein 1-like         290   2e-87    
gb|EMT27861.1|  Putative zinc transporter 10                            290   2e-87    
ref|XP_010908608.1|  PREDICTED: LOW QUALITY PROTEIN: fe(2+) trans...    290   2e-87    
ref|XP_002322355.2|  root iron transporter family protein               288   3e-87    
ref|XP_008225789.1|  PREDICTED: fe(2+) transport protein 1-like         289   3e-87    
ref|XP_010478570.1|  PREDICTED: probable zinc transporter 10            289   4e-87    
emb|CDY19126.1|  BnaA04g18660D                                          289   5e-87    
ref|XP_010908609.1|  PREDICTED: fe(2+) transport protein 1-like         288   5e-87    
ref|XP_010554256.1|  PREDICTED: zinc transporter 7 isoform X1           288   5e-87    
gb|AAP92124.1|  iron transporter Fe3                                    289   6e-87    
emb|CDY15345.1|  BnaC04g42780D                                          289   6e-87    
ref|XP_010458812.1|  PREDICTED: zinc transporter 7-like                 288   7e-87    
ref|XP_007214341.1|  hypothetical protein PRUPE_ppa027114mg             288   8e-87    
ref|NP_001050853.1|  Os03g0667500                                       288   9e-87    
ref|NP_001274385.1|  probable zinc transporter 10-like precursor        288   1e-86    
ref|XP_009802160.1|  PREDICTED: probable zinc transporter 10            287   1e-86    
gb|KHG00477.1|  putative zinc transporter 8 -like protein               287   1e-86    
emb|CDY12221.1|  BnaC04g12510D                                          288   1e-86    
ref|XP_006853446.1|  hypothetical protein AMTR_s00032p00182850          287   1e-86    
ref|XP_007045694.1|  Zinc transporter 7 precursor, putative             287   2e-86    
ref|XP_011096784.1|  PREDICTED: fe(2+) transport protein 2              287   2e-86    
ref|NP_001234248.1|  iron-regulated transporter 1 precursor             286   2e-86    
sp|Q8S3W4.1|ZIP8_ARATH  RecName: Full=Probable zinc transporter 8...    286   3e-86    
ref|XP_004233216.1|  PREDICTED: fe(2+) transport protein 1-like         286   3e-86    
ref|XP_010444067.1|  PREDICTED: probable zinc transporter 12            286   3e-86    
ref|XP_006362610.1|  PREDICTED: probable zinc transporter 10-like       286   3e-86    
ref|XP_006282196.1|  hypothetical protein CARUB_v10028462mg             286   3e-86    
gb|EYU17732.1|  hypothetical protein MIMGU_mgv1a009083mg                286   3e-86    
gb|EYU25669.1|  hypothetical protein MIMGU_mgv1a009036mg                286   4e-86    
emb|CDY02372.1|  BnaA09g25300D                                          286   4e-86    
ref|XP_002875245.1|  hypothetical protein ARALYDRAFT_484307             286   5e-86    
ref|XP_004245100.1|  PREDICTED: zinc transporter 4, chloroplastic       287   5e-86    
ref|XP_006362613.1|  PREDICTED: fe(2+) transport protein 1-like         285   6e-86    
ref|XP_009604609.1|  PREDICTED: fe(2+) transport protein 1-like         285   6e-86    
emb|CBI20663.3|  unnamed protein product                                285   6e-86    
gb|KFK28622.1|  hypothetical protein AALP_AA7G023400                    285   6e-86    
ref|XP_004134951.1|  PREDICTED: zinc transporter 7-like                 285   7e-86    
ref|NP_001152110.1|  zinc transporter 10 precursor                      286   9e-86    
ref|XP_009772860.1|  PREDICTED: probable zinc transporter 10            285   1e-85    
gb|KCW47601.1|  hypothetical protein EUGRSUZ_K01345                     283   1e-85    
ref|XP_010481654.1|  PREDICTED: fe(2+) transport protein 1-like         285   1e-85    
ref|XP_002273397.1|  PREDICTED: fe(2+) transport protein 1              284   1e-85    
ref|XP_004490323.1|  PREDICTED: fe(2+) transport protein 1-like         285   1e-85    
ref|XP_004298331.1|  PREDICTED: fe(2+) transport protein 1-like         284   1e-85    
ref|XP_010460952.1|  PREDICTED: probable zinc transporter 10 isof...    285   2e-85    
ref|XP_010092655.1|  putative zinc transporter 10                       284   2e-85    
gb|EYU24106.1|  hypothetical protein MIMGU_mgv1a023920mg                284   2e-85    
ref|XP_003520144.1|  PREDICTED: fe(2+) transport protein 1-like         284   2e-85    
ref|XP_009130197.1|  PREDICTED: probable zinc transporter 12            283   3e-85    
ref|XP_010499676.1|  PREDICTED: probable zinc transporter 10            284   3e-85    
ref|XP_010494576.1|  PREDICTED: probable zinc transporter 8             283   3e-85    
emb|CDY30699.1|  BnaA02g33210D                                          283   4e-85    
gb|AET05397.2|  ZIP zinc/iron transport family protein                  285   4e-85    
ref|XP_010441786.1|  PREDICTED: probable zinc transporter 8 isofo...    283   5e-85    
ref|XP_002322353.2|  hypothetical protein POPTR_0015s15750g             282   6e-85    
ref|XP_004986332.1|  PREDICTED: fe(2+) transport protein 2-like         284   6e-85    
ref|XP_010229515.1|  PREDICTED: fe(2+) transport protein 1-like         283   6e-85    
ref|XP_004293828.1|  PREDICTED: zinc transporter 8-like isoform 2       281   8e-85    
emb|CDY03774.1|  BnaC01g28910D                                          283   1e-84    
ref|XP_004982221.1|  PREDICTED: fe(2+) transport protein 1-like         283   1e-84    
ref|XP_004489301.1|  PREDICTED: zinc transporter 3-like                 281   2e-84    
ref|XP_010056627.1|  PREDICTED: fe(2+) transport protein 1-like         282   2e-84    
gb|ACJ85162.1|  unknown                                                 281   2e-84    
ref|XP_006306526.1|  hypothetical protein CARUB_v10012540mg             282   2e-84    
ref|NP_001234252.1|  iron-regulated transporter 2 precursor             281   2e-84    
ref|XP_007161014.1|  hypothetical protein PHAVU_001G035800g             282   2e-84    
ref|XP_008371846.1|  PREDICTED: probable zinc transporter 10            281   2e-84    
gb|AAU89149.1|  iron-regulated transporter, putative                    281   3e-84    
ref|XP_010481652.1|  PREDICTED: probable zinc transporter 8 isofo...    281   3e-84    
ref|NP_001050851.2|  Os03g0667300                                       281   4e-84    
gb|AAO17059.1|  root iron transporter protein IRT1                      281   4e-84    
ref|XP_003607852.1|  Zinc transporter                                   280   4e-84    
emb|CDY44832.1|  BnaCnng11880D                                          280   6e-84    
gb|AFK47100.1|  unknown                                                 280   6e-84    
ref|XP_010494574.1|  PREDICTED: fe(2+) transport protein 1-like i...    280   6e-84    
emb|CDY65203.1|  BnaCnng46010D                                          279   9e-84    
ref|XP_009357272.1|  PREDICTED: fe(2+) transport protein 1-like         280   9e-84    
ref|XP_010058645.1|  PREDICTED: fe(2+) transport protein 1-like         280   1e-83    
ref|XP_004301422.1|  PREDICTED: fe(2+) transport protein 1-like         279   1e-83    
gb|EYU40848.1|  hypothetical protein MIMGU_mgv1a019253mg                280   1e-83    
emb|CDY51626.1|  BnaCnng21180D                                          280   1e-83    
ref|XP_006415352.1|  hypothetical protein EUTSA_v10007930mg             280   1e-83    
ref|XP_002464109.1|  hypothetical protein SORBIDRAFT_01g012440          280   1e-83    
ref|XP_004498889.1|  PREDICTED: zinc transporter 4, chloroplastic...    280   2e-83    
ref|XP_002466763.1|  hypothetical protein SORBIDRAFT_01g013660          280   2e-83    
ref|XP_002891116.1|  hypothetical protein ARALYDRAFT_313960             279   2e-83    
ref|XP_010494573.1|  PREDICTED: fe(2+) transport protein 1-like i...    279   2e-83    
ref|XP_009133184.1|  PREDICTED: fe(2+) transport protein 1              278   2e-83    
ref|XP_006651668.1|  PREDICTED: fe(2+) transport protein 2-like         280   3e-83    
emb|CDY01612.1|  BnaC07g36020D                                          278   3e-83    
gb|AAC17441.1|  root iron transporter protein                           278   5e-83    
ref|XP_002464108.1|  hypothetical protein SORBIDRAFT_01g012430          279   5e-83    
ref|XP_004293739.1|  PREDICTED: probable zinc transporter 10-like       278   5e-83    
ref|XP_009388364.1|  PREDICTED: fe(2+) transport protein 1-like         277   8e-83    
ref|XP_008649739.1|  PREDICTED: zinc transporter 5-like                 277   8e-83    
ref|XP_002863526.1|  hypothetical protein ARALYDRAFT_330887             276   9e-83    
gb|ACR14982.1|  iron-regulated transporter 1                            276   1e-82    
ref|XP_008806707.1|  PREDICTED: fe(2+) transport protein 1-like         277   1e-82    
ref|XP_008665793.1|  PREDICTED: fe(2+) transport protein 2-like         277   1e-82    
ref|XP_010538316.1|  PREDICTED: probable zinc transporter 10            277   1e-82    
gb|AAR08416.1|  metal transport protein                                 277   1e-82    
ref|XP_006285709.1|  hypothetical protein CARUB_v10007180mg             276   1e-82    
ref|XP_006398156.1|  hypothetical protein EUTSA_v10000941mg             276   2e-82    
emb|CDP17626.1|  unnamed protein product                                276   2e-82    
ref|XP_010673172.1|  PREDICTED: zinc transporter 7-like                 276   3e-82    
ref|XP_009133175.1|  PREDICTED: fe(2+) transport protein 1-like         275   3e-82    
ref|XP_006601231.1|  PREDICTED: zinc transporter 4, chloroplastic...    276   3e-82    
ref|NP_567590.3|  Fe(2+) transport protein 1                            275   4e-82    
gb|EYU31714.1|  hypothetical protein MIMGU_mgv1a024137mg                275   4e-82    
ref|XP_009128761.1|  PREDICTED: probable zinc transporter 8 isofo...    275   5e-82    
ref|XP_006394427.1|  hypothetical protein EUTSA_v10005485mg             275   5e-82    
gb|AAB01678.1|  Fe(II) transport protein                                275   6e-82    
gb|AFK33510.1|  unknown                                                 275   6e-82    
gb|KFK44912.1|  hypothetical protein AALP_AA1G318900                    275   8e-82    
ref|NP_174411.2|  putative zinc transporter 10                          275   9e-82    
ref|XP_006282128.1|  hypothetical protein CARUB_v10028380mg             274   1e-81    
gb|ADC35581.2|  iron-regulated transporter                              273   1e-81    
ref|XP_010686669.1|  PREDICTED: zinc transporter 7-like                 275   1e-81    
ref|NP_201022.1|  putative zinc transporter 12                          274   1e-81    
ref|XP_010943751.1|  PREDICTED: fe(2+) transport protein 1-like         274   2e-81    
gb|KFK41852.1|  hypothetical protein AALP_AA2G179200                    273   2e-81    
ref|XP_002863525.1|  hypothetical protein ARALYDRAFT_330886             272   4e-81    
ref|NP_178488.1|  zinc transporter 7                                    273   4e-81    
ref|XP_007049049.1|  Zinc transporter 5 precursor                       272   4e-81    
dbj|BAD94060.1|  putative root iron transporter protein                 273   4e-81    
ref|XP_006398157.1|  hypothetical protein EUTSA_v10000942mg             272   6e-81    
ref|XP_007156150.1|  hypothetical protein PHAVU_003G262400g             272   8e-81    
ref|XP_006413939.1|  hypothetical protein EUTSA_v10025627mg             271   9e-81    
ref|XP_009108125.1|  PREDICTED: probable zinc transporter 10            272   1e-80    
ref|XP_004169249.1|  PREDICTED: zinc transporter 1-like                 268   1e-80    
ref|XP_010056628.1|  PREDICTED: fe(2+) transport protein 1-like         271   2e-80    
ref|XP_009133165.1|  PREDICTED: fe(2+) transport protein 1-like         270   3e-80    
gb|KFK27947.1|  hypothetical protein AALP_AA8G451900                    270   4e-80    
ref|XP_010538610.1|  PREDICTED: fe(2+) transport protein 1              270   5e-80    
ref|XP_006362611.1|  PREDICTED: fe(2+) transport protein 1-like i...    268   1e-79    
ref|XP_010252544.1|  PREDICTED: fe(2+) transport protein 1-like         268   2e-79    
gb|AAR87185.1|  putative metal transporter (with alternative spli...    269   2e-79    
ref|XP_010686504.1|  PREDICTED: fe(2+) transport protein 1-like         268   3e-79    
emb|CDY27157.1|  BnaA08g07950D                                          268   4e-79    
emb|CAL25151.1|  putative Fe(II) transporter 1                          267   6e-79    
ref|XP_010439662.1|  PREDICTED: fe(2+) transport protein 1              266   7e-79    
emb|CDY65204.1|  BnaCnng46020D                                          266   8e-79    
ref|XP_010434368.1|  PREDICTED: fe(2+) transport protein 1-like         266   9e-79    
ref|XP_006395658.1|  hypothetical protein EUTSA_v10005271mg             266   2e-78    
gb|EMS62352.1|  Fe(2+) transport protein 1                              272   2e-78    
ref|XP_010449308.1|  PREDICTED: fe(2+) transport protein 1-like         265   3e-78    
emb|CAN77100.1|  hypothetical protein VITISV_033551                     272   3e-78    
ref|XP_002869968.1|  Fe(II) transport protein IRT1                      265   3e-78    
ref|XP_010480798.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...    265   3e-78    
gb|KFK44913.1|  hypothetical protein AALP_AA1G319000                    264   1e-77    
emb|CAL25150.1|  putative Fe (II) transporter 1                         263   2e-77    
gb|EAZ28054.1|  hypothetical protein OsJ_12020                          263   2e-77    
gb|KHN37034.1|  Zinc transporter 4, chloroplastic                       273   2e-77    
emb|CAE30485.1|  Fe(II) transport protein IRT1                          262   3e-77    
ref|XP_001754592.1|  ZIP family transporter                             263   4e-77    
gb|KHG29259.1|  Zinc transporter 4, chloroplastic -like protein         260   2e-76    
ref|XP_009400959.1|  PREDICTED: zinc transporter 8-like                 258   8e-76    
ref|XP_001771931.1|  ZIP family transporter                             258   1e-75    
ref|XP_003568766.1|  PREDICTED: zinc transporter 7-like                 259   1e-75    
gb|EPS73311.1|  hypothetical protein M569_01444                         258   1e-75    
gb|AFJ05595.1|  iron-regulated transporter 1                            257   2e-75    
gb|AAL38436.1|AF369913_1  putative metal transporter ZIP10              257   3e-75    
emb|CDX98631.1|  BnaA03g44160D                                          256   4e-75    
ref|XP_002439422.1|  hypothetical protein SORBIDRAFT_09g006150          258   5e-75    
ref|XP_008647922.1|  PREDICTED: zinc transporter 4 isoform X1           258   6e-75    
emb|CAC86382.1|  putative Fe(II) transporter                            256   6e-75    
ref|XP_007156151.1|  hypothetical protein PHAVU_003G262500g             255   9e-75    
ref|XP_002969259.1|  hypothetical protein SELMODRAFT_91749              255   9e-75    
ref|XP_009137017.1|  PREDICTED: fe(2+) transport protein 1-like         255   1e-74    
emb|CAJ57719.1|  zinc transporter protein ZIP7                          256   2e-74    
gb|ABF55692.1|  putative zinc transporter                               255   4e-74    
ref|XP_002986851.1|  hypothetical protein SELMODRAFT_182680             253   4e-74    
ref|XP_010915264.1|  PREDICTED: zinc transporter 4, chloroplastic...    253   7e-74    
ref|XP_008782534.1|  PREDICTED: zinc transporter 10-like                251   3e-73    
ref|XP_002869970.1|  iron-responsive transporter 2                      251   3e-73    
gb|KCW88549.1|  hypothetical protein EUGRSUZ_A00921                     250   3e-73    
ref|XP_004960920.1|  PREDICTED: zinc transporter 7-like                 253   5e-73    
ref|XP_006413940.1|  hypothetical protein EUTSA_v10025555mg             251   8e-73    
ref|XP_001772949.1|  ZIP family transporter                             250   3e-72    
gb|KCW47603.1|  hypothetical protein EUGRSUZ_K01349                     246   4e-72    
emb|CDY01611.1|  BnaC07g36010D                                          248   4e-72    
ref|XP_009137130.1|  PREDICTED: fe(2+) transport protein 2-like         248   5e-72    
emb|CDX98630.1|  BnaA03g44150D                                          248   6e-72    
ref|XP_010434369.1|  PREDICTED: fe(2+) transport protein 2-like         248   1e-71    
ref|NP_001031670.1|  Fe(2+) transport protein 2                         247   2e-71    
emb|CDX68931.1|  BnaC01g05220D                                          244   3e-71    
ref|NP_001054875.1|  Os05g0198400                                       248   3e-71    
emb|CBI24156.3|  unnamed protein product                                241   4e-71    
gb|EMT12208.1|  Zinc transporter 4, chloroplastic                       248   4e-71    
ref|XP_010449310.1|  PREDICTED: fe(2+) transport protein 2-like i...    246   4e-71    
gb|ADE77858.1|  unknown                                                 246   5e-71    
ref|XP_009133155.1|  PREDICTED: fe(2+) transport protein 2              246   5e-71    
ref|XP_002988069.1|  hypothetical protein SELMODRAFT_127216             245   5e-71    



>ref|XP_009608181.1| PREDICTED: zinc transporter 1-like [Nicotiana tomentosiformis]
Length=367

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 222/375 (59%), Positives = 270/375 (72%), Gaps = 18/375 (5%)
 Frame = +1

Query  727   YSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLV  906
             Y    +V +  +I++F P  ISG      ECTCN  V+       + T  + DSL+YRL+
Sbjct  11    YCYKAVVLTCLVILVFAP-GISG------ECTCNIKVD-----QPRNTKNSSDSLRYRLI  58

Query  907   AIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLT  1086
             +I SIL+AGA GVS+PLLARK E L PE DIFFMIKAFAAGVIL+TGF+HILPDAFQTLT
Sbjct  59    SIVSILIAGAIGVSLPLLARKIEALRPENDIFFMIKAFAAGVILATGFIHILPDAFQTLT  118

Query  1087  SPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeea  1266
             SP L+  +PW KFPF+G  A+ ASI  LM+DT A SF++ +  H  K    QV+  +EEA
Sbjct  119   SPCLQGMDPWGKFPFTGFFAMIASIGCLMIDTFATSFYQNRHFHIAK----QVNIVDEEA  174

Query  1267  kdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLC  1446
                            A         S+ EL+ LS+ IR R++SQVLELGI+VHS+IIG+ 
Sbjct  175   ARDDIQHSHSHASHVAHGA-THSIGSDQELI-LSENIRNRIISQVLELGILVHSIIIGVS  232

Query  1447  LGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATG  1626
             LG SQ  E I+PLLVALSFHQFFEGMGLGGCI+QAKFKS STA+M+V FSLTTP GI  G
Sbjct  233   LGASQNTEMIKPLLVALSFHQFFEGMGLGGCISQAKFKSTSTAIMSVLFSLTTPAGIGIG  292

Query  1627  IGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVS  1806
             IGIS VYN HSS +LI +G+LNSAS+GILIYMALVD+LA+DFM P++QNNVRL  G H+S
Sbjct  293   IGISRVYNAHSSISLIVEGILNSASSGILIYMALVDILASDFMNPRMQNNVRLLCGAHIS  352

Query  1807  LVLGAGSMSVLAMWA  1851
             L+LGAG MSV+A WA
Sbjct  353   LLLGAGCMSVMAKWA  367



>ref|XP_009772024.1| PREDICTED: zinc transporter 1-like [Nicotiana sylvestris]
Length=370

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 223/375 (59%), Positives = 271/375 (72%), Gaps = 15/375 (4%)
 Frame = +1

Query  727   YSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLV  906
             Y    +V +  +I++F P  ISG      ECTCN  V+       + T  +  SL+YRL+
Sbjct  11    YCYKAVVLTCLVIVVFAP-GISG------ECTCNIKVD-----QPRNTKNSSVSLRYRLI  58

Query  907   AIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLT  1086
             +I SIL+AGA GVS+PLLARK E L PE DIFFMIKAFAAGVIL+TGF+HILPDAFQTLT
Sbjct  59    SIVSILLAGAIGVSLPLLARKIEALRPENDIFFMIKAFAAGVILATGFIHILPDAFQTLT  118

Query  1087  SPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeea  1266
             SP L+  NPW KFPF+G  A+ ASI  LM+DT A S ++K+  HF   K   ++ +E   
Sbjct  119   SPCLQGMNPWGKFPFTGFFAMVASIGCLMIDTFATSIYQKR--HFHIAKQVNIADEEAAR  176

Query  1267  kdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLC  1446
              D   +     H    A        S+ EL+ LS+ IR R++SQVLELGI+VHS+IIG+ 
Sbjct  177   DDIQHSHSHTSHVHGHAHGATYSIGSDQELI-LSENIRNRIISQVLELGILVHSIIIGVS  235

Query  1447  LGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATG  1626
             LG SQ  + I+PLLVALSFHQFFEGMGLGGCI+QAKFKSVSTA+MAV FSLTTP GI  G
Sbjct  236   LGASQNTQMIKPLLVALSFHQFFEGMGLGGCISQAKFKSVSTAIMAVLFSLTTPAGIGIG  295

Query  1627  IGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVS  1806
             IGIS VYN HSS +LI +G+LNSAS+GILIYMALVD+LA+DFM PK+QNNVRL  G H+S
Sbjct  296   IGISRVYNAHSSISLIVEGILNSASSGILIYMALVDILASDFMNPKMQNNVRLLCGAHIS  355

Query  1807  LVLGAGSMSVLAMWA  1851
             L+LGAG MSV+A WA
Sbjct  356   LLLGAGCMSVMAKWA  370



>ref|XP_007022739.1| Zinc transporter 1 precursor [Theobroma cacao]
 gb|EOY14264.1| Zinc transporter 1 precursor [Theobroma cacao]
Length=363

 Score =   390 bits (1001),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 269/359 (75%), Gaps = 23/359 (6%)
 Frame = +1

Query  775   FPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIP  954
             FP  +S      SECTC   VE  L  +  E      +LKY+L AIA+ILVAGA GVS+P
Sbjct  28    FPATVS------SECTCE--VE-DLAQNKGE------ALKYKLGAIAAILVAGAVGVSLP  72

Query  955   LLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFS  1134
             LL R+   L PE DIFFMIKAFAAGVIL+TGFVHILPDAF+ LTSP LK++ PW  FPFS
Sbjct  73    LLGRRIPALRPENDIFFMIKAFAAGVILATGFVHILPDAFKNLTSPCLKES-PWGNFPFS  131

Query  1135  GLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaa  1314
             G +A+ ++I TLM+DT A  +++++  HF+K K  QV+ADEE+A + A   H+H H    
Sbjct  132   GFVAMMSAIGTLMIDTFATGYYKRQ--HFNKNK--QVNADEEKAAEHAGHVHVHTHATHG  187

Query  1315  aaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVA  1494
              A     P   +E   LS+ IRQR++SQVLE+GIVVHSVIIG+ LG S++ +TIRPLL A
Sbjct  188   HAHGSASP---SEEFGLSELIRQRIISQVLEVGIVVHSVIIGISLGASESPDTIRPLLAA  244

Query  1495  LSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALI  1674
             LSFHQFFEGMGLGGCI+QA+FKS+S A+M  FFSLTTP+GIA GIGIS  YN +S TALI
Sbjct  245   LSFHQFFEGMGLGGCISQAQFKSLSVAIMGTFFSLTTPLGIAVGIGISCFYNDNSPTALI  304

Query  1675  TQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
               GV NSASAGILIYM+LVDLLAADFM P++Q+NVRLQ+G +VSL+LGA  MSVLA WA
Sbjct  305   VGGVFNSASAGILIYMSLVDLLAADFMNPRLQSNVRLQVGANVSLLLGAACMSVLAKWA  363



>ref|XP_006422259.1| hypothetical protein CICLE_v10005306mg [Citrus clementina]
 ref|XP_006493777.1| PREDICTED: zinc transporter 1-like [Citrus sinensis]
 gb|ESR35499.1| hypothetical protein CICLE_v10005306mg [Citrus clementina]
 gb|KDO61586.1| hypothetical protein CISIN_1g018732mg [Citrus sinensis]
Length=351

 Score =   387 bits (993),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 208/363 (57%), Positives = 262/363 (72%), Gaps = 23/363 (6%)
 Frame = +1

Query  763   IIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAG  942
             +++++P  + G      ECTC+  VE     +        ++LK++L AIA+ILVAGA G
Sbjct  12    VLLYYPSTVRG------ECTCD--VEDTEQNNG-------EALKFKLAAIATILVAGALG  56

Query  943   VSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAK  1122
             VS+PLL +K   L PE D+FFM+KAFAAGVIL+TGFVHILP+AF +LTSP L + NPW  
Sbjct  57    VSLPLLGKKIPALRPENDVFFMVKAFAAGVILATGFVHILPEAFDSLTSPCLGE-NPWGN  115

Query  1123  FPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrh  1302
             FPF+GL+A+ ++I TLM+D+ A  +++++  HFDK++ PQ+  +E     +         
Sbjct  116   FPFTGLVAMMSAIGTLMIDSFATGYYKRQ--HFDKSR-PQLVDEEMADDHSGHVHVHTHA  172

Query  1303  gaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRP  1482
                 A    D P    EL  L + IR+RVVSQVLE+GIVVHSVIIG+ LG S+  + I+P
Sbjct  173   THGHAHGSADSP---QELA-LPELIRKRVVSQVLEIGIVVHSVIIGISLGASEDLDIIKP  228

Query  1483  LLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSS  1662
             LL ALSFHQFFEGMGLGGCI+QAKFKS S A+MA FFSLTTPVGIA GIGISSVY  +S 
Sbjct  229   LLAALSFHQFFEGMGLGGCISQAKFKSRSMAIMATFFSLTTPVGIAIGIGISSVYEENSP  288

Query  1663  TALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLA  1842
             TALI +G+ NSASAGILIYMALVDLLAADFM P +Q+N RLQLG + SL+LGAG MSVLA
Sbjct  289   TALIVEGIFNSASAGILIYMALVDLLAADFMNPILQSNSRLQLGANASLLLGAGCMSVLA  348

Query  1843  MWA  1851
              WA
Sbjct  349   KWA  351



>ref|XP_002315075.2| metal transport family protein [Populus trichocarpa]
 gb|EEF01246.2| metal transport family protein [Populus trichocarpa]
Length=361

 Score =   387 bits (994),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 205/375 (55%), Positives = 263/375 (70%), Gaps = 22/375 (6%)
 Frame = +1

Query  727   YSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLV  906
             +++  I++   +I++F+P  +S       ECTC   VE   H          ++LKY+L 
Sbjct  9     FNVRKIISCVLMILLFYPTIVS------CECTCE--VEDSKHDKG-------EALKYKLG  53

Query  907   AIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLT  1086
             +I SILVAGA GV +PLL +K + L PE DIFFMIKAFAAGVIL+TGF+HILPDAF +LT
Sbjct  54    SILSILVAGAIGVGLPLLGKKIKALSPENDIFFMIKAFAAGVILATGFIHILPDAFDSLT  113

Query  1087  SPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeea  1266
             SP L   NPW  FPF+G +A+  +I TLMVDT A  F+++  MHF+K+K    + +E   
Sbjct  114   SPCLAQ-NPWGDFPFTGFVAMMTAIGTLMVDTFATGFYKR--MHFNKSKPVNTTDEETAE  170

Query  1267  kdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLC  1446
             +               A     P     E + LS+ IR+R++SQ LELGIVVHS+IIG+ 
Sbjct  171   EHEGHVHVHTHATHGHAHGSASP----EEDLALSELIRRRIISQALELGIVVHSIIIGIS  226

Query  1447  LGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATG  1626
             LG S + +TI+PL+VALSFHQFFEGMGLGGCI  A+FKS S A+MA FFSLTTPVGIA G
Sbjct  227   LGASGSPKTIKPLMVALSFHQFFEGMGLGGCITLAQFKSTSMAIMATFFSLTTPVGIAVG  286

Query  1627  IGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVS  1806
             IGISS+YN +S TA + +G+ N+ASAGILIYMALVDLLAADFM P++Q+N+R+QLG +VS
Sbjct  287   IGISSIYNENSPTAQVVEGIFNAASAGILIYMALVDLLAADFMSPRMQSNLRIQLGANVS  346

Query  1807  LVLGAGSMSVLAMWA  1851
             L+LGAG MS LA WA
Sbjct  347   LLLGAGCMSFLAKWA  361



>ref|XP_008447078.1| PREDICTED: zinc transporter 1 [Cucumis melo]
Length=354

 Score =   387 bits (993),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 216/346 (62%), Positives = 258/346 (75%), Gaps = 14/346 (4%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
              C+C+   +G    S+KE      ++KY++ +I S+LVAGAAGVS+PL+ +K   L PE 
Sbjct  23    SCSCD-ESDGGAAVSAKE------AMKYKVGSIGSVLVAGAAGVSLPLVGKKIRCLRPEN  75

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFFMIKAFAAGVILSTGF+HILPDAFQ LTSP L   NPW  FPF+G IA+ ASIATLM
Sbjct  76    DIFFMIKAFAAGVILSTGFIHILPDAFQDLTSPCLGQ-NPWGDFPFAGFIAMAASIATLM  134

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT A SF++++  HF KTK  QV AD+E   D A   H+H H     A    P P+   
Sbjct  135   VDTFATSFYQRR--HFSKTK--QVIADQETGNDHAGHVHVHTHATHGHAHGSAPTPTGE-  189

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
              + L+D IR R++SQVLELGIVVHSVIIG+ LG S +  TI+PLLVALSFHQFFEGMGLG
Sbjct  190   -LSLADLIRYRIISQVLELGIVVHSVIIGISLGASLSPATIKPLLVALSFHQFFEGMGLG  248

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI+QA+F+  S A MA FFSLT PVGIA GIGIS VY  +S TALI +G +NSASAGIL
Sbjct  249   GCISQAQFRWQSAAAMATFFSLTAPVGIAVGIGISGVYRDNSRTALIVEGSMNSASAGIL  308

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM P++QNN+ LQLG ++SL+LGA  MSVLA WA
Sbjct  309   IYMALVDLLAADFMNPRMQNNLGLQLGANISLLLGAACMSVLAKWA  354



>ref|XP_011014118.1| PREDICTED: zinc transporter 1-like [Populus euphratica]
Length=360

 Score =   386 bits (991),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/369 (56%), Positives = 260/369 (70%), Gaps = 22/369 (6%)
 Frame = +1

Query  745   VASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASIL  924
             + S  + ++F+P  +S       ECTC   VE   H          ++LKY+L +I SIL
Sbjct  14    IISSVLFLLFYPTIVS------CECTCE--VEDLKHDKG-------EALKYKLGSILSIL  58

Query  925   VAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKD  1104
             VAGA GV +PLL +K + L PE DIFFMIKAFAAGVIL+TGF+HILPDAF +LTSP L  
Sbjct  59    VAGAIGVGLPLLGKKIKALSPENDIFFMIKAFAAGVILATGFIHILPDAFDSLTSPCLAQ  118

Query  1105  TNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaa  1284
              NPW  FPF+G +A+  +I TLMVDT A  F+++  MHF+K+K    + +E         
Sbjct  119   -NPWGDFPFTGFVAMMTAIGTLMVDTYATGFYKR--MHFNKSKPVNTTDEETAGAHEGHV  175

Query  1285  dhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQT  1464
                       A     P     E + LS+ IR+R++SQVLELGIVVHS+IIG+ LG S++
Sbjct  176   HVHTHATHGHAHGSASP----EEDLALSELIRRRIISQVLELGIVVHSIIIGISLGASES  231

Query  1465  RETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSV  1644
              +TI+PL+VALSFHQFFEGMGLGGCI  A+FKS S A+MA FFSLTTPVGIA GIGISS+
Sbjct  232   PKTIKPLMVALSFHQFFEGMGLGGCITLAQFKSTSMAIMATFFSLTTPVGIAVGIGISSI  291

Query  1645  YNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAG  1824
             YN +S TA + +G+LN+ASAGILIYMALVDLLAADFM P++Q+N+R+QLG +VSL+LGAG
Sbjct  292   YNENSPTAQVIEGILNAASAGILIYMALVDLLAADFMSPRMQSNLRIQLGANVSLLLGAG  351

Query  1825  SMSVLAMWA  1851
              MS LA WA
Sbjct  352   CMSFLAKWA  360



>ref|XP_004139841.1| PREDICTED: zinc transporter 1-like [Cucumis sativus]
 gb|KGN44299.1| hypothetical protein Csa_7G239610 [Cucumis sativus]
Length=354

 Score =   384 bits (987),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 216/355 (61%), Positives = 261/355 (74%), Gaps = 17/355 (5%)
 Frame = +1

Query  787   ISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLAR  966
             +SG  A+   C+C+ +  G         + T +++KY++ +I S+LVAGAAGVS+PL+ +
Sbjct  17    VSGVGAS---CSCDKSDGGG-------AVATKEAMKYKVGSIGSVLVAGAAGVSLPLVGK  66

Query  967   KYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIA  1146
             K   L PE DIFFMIKAFAAGVILSTGF+HILPDAFQ LTSP L   NPW  FPF+G IA
Sbjct  67    KIRCLRPENDIFFMIKAFAAGVILSTGFIHILPDAFQDLTSPCLGQ-NPWGDFPFAGFIA  125

Query  1147  LTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVY  1326
             + ASIATLMVDT A SF++++  HF KTK  QV AD+E   D A   H+H H     A  
Sbjct  126   MAASIATLMVDTFATSFYQRR--HFSKTK--QVIADQETGNDHAGHVHVHTHATHGHAHG  181

Query  1327  LDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFH  1506
               P P+    + L+D IR R++SQVLELGIVVHSVIIG+ LG S +  TI+PLLVALSFH
Sbjct  182   SAPTPTGE--LSLADLIRYRIISQVLELGIVVHSVIIGISLGASVSPATIKPLLVALSFH  239

Query  1507  QFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGV  1686
             QFFEGMGLGGCI+QA+F+  S A MA FFSLT PVGIA GIGIS  Y  +S TALI +G 
Sbjct  240   QFFEGMGLGGCISQAQFRWRSAAAMATFFSLTAPVGIAVGIGISGAYRDNSRTALIVEGS  299

Query  1687  LNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +NSASAGILIYMALVDLLAADFM P++QNN+ LQLG ++SL+LGA  MSVLA WA
Sbjct  300   MNSASAGILIYMALVDLLAADFMNPRMQNNLGLQLGANISLLLGAACMSVLAKWA  354



>ref|XP_006422260.1| hypothetical protein CICLE_v10005248mg [Citrus clementina]
 gb|ESR35500.1| hypothetical protein CICLE_v10005248mg [Citrus clementina]
 gb|KDO61585.1| hypothetical protein CISIN_1g018182mg [Citrus sinensis]
Length=359

 Score =   383 bits (984),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/362 (57%), Positives = 261/362 (72%), Gaps = 19/362 (5%)
 Frame = +1

Query  766   IIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGV  945
             I+ +P  + G      EC C+  VE     ++++     ++LKY+++AIASILVAGA GV
Sbjct  17    ILLYPTLVFG------ECVCD--VEAMSQDNNQQ-----EALKYKVIAIASILVAGAFGV  63

Query  946   SIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKF  1125
             S+PLL +K   L PE D FFMIKAFAAGVIL+TGFVHILPDAF  LTSP L + NPW  F
Sbjct  64    SLPLLGKKVPALRPENDTFFMIKAFAAGVILATGFVHILPDAFDNLTSPCLVE-NPWGDF  122

Query  1126  PFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhg  1305
             PFSG +A+ ++I TLM+DT A  +++++  HF+     Q+  +E   + A          
Sbjct  123   PFSGFVAMMSAIGTLMIDTFATGYYKRQ--HFNCKPNKQLVDEEMANEHAGHVHVHTHAT  180

Query  1306  aaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPL  1485
                A    D   S+ + + LS+ IR+RV+SQVLELGIVVHS+IIG+ LG S++ +TI+PL
Sbjct  181   HGHAHGSTD---SSYQELALSEIIRKRVISQVLELGIVVHSIIIGISLGASESLDTIKPL  237

Query  1486  LVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSST  1665
             L ALSFHQFFEGMGLGGCI+QA++KS S A+MA FFSLTTPVGIA G+GISSVY  +  T
Sbjct  238   LAALSFHQFFEGMGLGGCISQAEYKSRSMAIMAAFFSLTTPVGIAIGVGISSVYKENGPT  297

Query  1666  ALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAM  1845
             ALI QGV NSASAGILIYMALVDLLAADFM P +Q+N RLQLG ++SL+LGAG MSVLA 
Sbjct  298   ALIVQGVFNSASAGILIYMALVDLLAADFMNPILQSNRRLQLGANISLLLGAGCMSVLAK  357

Query  1846  WA  1851
             WA
Sbjct  358   WA  359



>ref|XP_008226052.1| PREDICTED: zinc transporter 1-like [Prunus mume]
Length=347

 Score =   382 bits (980),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 207/364 (57%), Positives = 264/364 (73%), Gaps = 23/364 (6%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             I+I  FP  + G      +CTC    E +    +KE      +LKY+L +IASILVAGA 
Sbjct  7     ILIFLFPTMVFG------DCTC----ESEDTEHNKEA-----ALKYKLGSIASILVAGAV  51

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GVS+PLL +K   L PE DIFFMIKAFAAGVIL+TGF+HILPDAF  LTSP LK+ NPW 
Sbjct  52    GVSLPLLGKKIPTLRPENDIFFMIKAFAAGVILATGFIHILPDAFDNLTSPCLKE-NPWG  110

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+G +A+ ++I TLMVD+LA  ++++  +  ++  + ++   +     AA   H H 
Sbjct  111   KFPFTGFVAMLSAIGTLMVDSLATGYYQRSNIKSNQVTVHELETGDHVHGHAADHVHGHT  170

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
             H   + A         +E +  S+ IR RV+SQVLELGI+VHSVIIG+ LG SQ+ ETI+
Sbjct  171   HATQSHA-------HGSEELMSSELIRHRVISQVLELGILVHSVIIGISLGASQSPETIK  223

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHS  1659
             PL+VALSFHQFFEG+GLGGCI+QAKFKS S A+MA FFSLTTPVGIA GIGIS+VYN  S
Sbjct  224   PLMVALSFHQFFEGVGLGGCISQAKFKSRSAAIMAAFFSLTTPVGIAIGIGISTVYNESS  283

Query  1660  STALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVL  1839
              TALI +G  N+A+AGILIYMALVDLLAADFM P++Q+N+++QLG ++SL+LG G MSV+
Sbjct  284   PTALIVEGTFNAAAAGILIYMALVDLLAADFMNPRLQSNLKIQLGAYISLLLGTGCMSVI  343

Query  1840  AMWA  1851
             A WA
Sbjct  344   AKWA  347



>emb|CAN72264.1| hypothetical protein VITISV_008114 [Vitis vinifera]
Length=360

 Score =   380 bits (975),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 263/347 (76%), Gaps = 14/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             S+C+C+   E   H S+       +SLKY+L AIASILVAGAAGVSIPLL +K   L PE
Sbjct  28    SDCSCD-EAEHSDHPSNGG-----ESLKYKLAAIASILVAGAAGVSIPLLGKKVPALNPE  81

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
               IFFMIKAFAAGVIL+TGF+HILP+AF+ LTSP L + NPW KFPF+GL+A+ ++I TL
Sbjct  82    NHIFFMIKAFAAGVILATGFIHILPEAFERLTSPCLGE-NPWGKFPFTGLVAMMSAIGTL  140

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A  +++++  HF K K  QV+ADEE  ++ A   H+H H       +    PS+ 
Sbjct  141   MVDTFATGYYKRQ--HFSKPK--QVTADEERGQEHAGHVHVHTHATHGH-AHGSASPSDE  195

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             E   LSD IR+R+VSQVLELGIVVHSVIIG+ LG SQ  ETI+PLL ALSFHQFFEG+GL
Sbjct  196   E--SLSDLIRRRIVSQVLELGIVVHSVIIGVSLGASQRPETIKPLLAALSFHQFFEGLGL  253

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKF+  + A+M +FFS+TTPVGI  GIGIS +Y+ +  TALI +GV ++ASAGI
Sbjct  254   GGCISQAKFRFSTMAMMVLFFSVTTPVGIVLGIGISRIYHENGPTALIVEGVFDAASAGI  313

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++QN++RLQLG ++SL+LG G MS LA WA
Sbjct  314   LIYMALVDLLAADFMNPRLQNSLRLQLGANISLLLGTGCMSFLAKWA  360



>ref|XP_007149187.1| hypothetical protein PHAVU_005G048900g [Phaseolus vulgaris]
 gb|ESW21181.1| hypothetical protein PHAVU_005G048900g [Phaseolus vulgaris]
Length=359

 Score =   378 bits (971),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 206/346 (60%), Positives = 264/346 (76%), Gaps = 16/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+ + E +   SS       + L Y+L +IAS+LVAGA GVS+PLL+R+   L P+ 
Sbjct  30    DCTCDTD-EAKRSDSS-------EMLHYKLGSIASVLVAGALGVSLPLLSRRIPTLNPKN  81

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFFM+KAFAAGVIL+TGFVHILPDA+++LTSP LKD NPW KFPF+G +A+ +SI TLM
Sbjct  82    DIFFMVKAFAAGVILATGFVHILPDAYESLTSPCLKD-NPWGKFPFTGFVAMMSSIGTLM  140

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD+ A  F+ ++  HF+ +K  QV ADEE   + A   H+H H     A        ++E
Sbjct  141   VDSFATGFYHRQ--HFNPSK--QVPADEEIGDEHAGHIHVHTHATHGHAHG---SAVSSE  193

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                 S+ IRQR++SQVLE+GIVVHSVIIG+ LGT+ + +TI+PLLVALSFHQFFEGMGLG
Sbjct  194   DAETSELIRQRIISQVLEIGIVVHSVIIGISLGTAGSIDTIKPLLVALSFHQFFEGMGLG  253

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI+QA+F+S STA+MA FFSLTTP+GIA G+G+SS Y  +S TAL  +GV NSASAGIL
Sbjct  254   GCISQAEFESKSTAIMATFFSLTTPIGIAIGMGVSSAYKENSPTALTVEGVFNSASAGIL  313

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM P++Q N++LQLG ++SL+LG+G MS+LA WA
Sbjct  314   IYMALVDLLAADFMNPRLQKNLKLQLGANISLLLGSGCMSLLAKWA  359



>ref|XP_002264603.2| PREDICTED: zinc transporter 1 [Vitis vinifera]
Length=360

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 210/347 (61%), Positives = 263/347 (76%), Gaps = 14/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             S+C+C+   E +    S   +   +SLKY+L AIASILVAGAAGVSIPLL +K   L PE
Sbjct  28    SDCSCD---EAE---HSDHPINGGESLKYKLAAIASILVAGAAGVSIPLLGKKVPALNPE  81

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
               IFFMIKAFAAGVIL+TGF+HILP+AF+ LTSP L + NPW KFPF+GL+A+ ++I TL
Sbjct  82    NHIFFMIKAFAAGVILATGFIHILPEAFERLTSPCLGE-NPWGKFPFTGLVAMMSAIGTL  140

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A  +++++  HF K K  QV+ADEE  ++ A   H+H H       +    PS+ 
Sbjct  141   MVDTFATGYYKRQ--HFSKPK--QVTADEERGQEHAGHVHVHTHATHGH-AHGSASPSDE  195

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             E   LSD IR+R+VSQVLELGIVVHSVIIG+ LG SQ  ETI+PLL ALSFHQFFEG+GL
Sbjct  196   E--SLSDLIRRRIVSQVLELGIVVHSVIIGVSLGASQRPETIKPLLAALSFHQFFEGLGL  253

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKF+  + A+M +FFS+TTPVGI  GIGIS +Y+ +  TALI +GV ++ASAGI
Sbjct  254   GGCISQAKFRFSTMAMMVLFFSVTTPVGIVLGIGISRIYHENGPTALIVEGVFDAASAGI  313

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++QN++RLQLG ++SL+LG G MS LA WA
Sbjct  314   LIYMALVDLLAADFMNPRLQNSLRLQLGANISLLLGTGCMSFLAKWA  360



>ref|XP_006493801.1| PREDICTED: zinc transporter 1-like [Citrus sinensis]
Length=451

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 207/362 (57%), Positives = 261/362 (72%), Gaps = 19/362 (5%)
 Frame = +1

Query  766   IIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGV  945
             I+ +P  + G      EC C+  VE     ++++     ++LKY+++AIASILVAGA GV
Sbjct  109   ILLYPTLVFG------ECVCD--VEAMSQDNNQQ-----EALKYKVIAIASILVAGAFGV  155

Query  946   SIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKF  1125
             S+PLL +K   L PE D FFMIKAFAAGVIL+TGFVHILPDAF  LTSP L + NPW  F
Sbjct  156   SLPLLGKKVPALRPENDTFFMIKAFAAGVILATGFVHILPDAFDNLTSPCLVE-NPWGDF  214

Query  1126  PFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhg  1305
             PFSG +A+ ++I TLM+DT A  +++++  HF+     Q+  +E   + A          
Sbjct  215   PFSGFVAMMSAIGTLMIDTFATGYYKRQ--HFNCKPNKQLVDEEMANEHAGHVHVHTHAT  272

Query  1306  aaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPL  1485
                A    D   S+ + + LS+ IR+RV+SQVLELGIVVHS+IIG+ LG S++ +TI+PL
Sbjct  273   HGHAHGSTD---SSYQELALSEIIRKRVISQVLELGIVVHSIIIGISLGASESLDTIKPL  329

Query  1486  LVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSST  1665
             L ALSFHQFFEGMGLGGCI+QA++KS S A+MA FFSLTTPVGIA G+GISSVY  +  T
Sbjct  330   LAALSFHQFFEGMGLGGCISQAEYKSRSMAIMAAFFSLTTPVGIAIGVGISSVYKENGPT  389

Query  1666  ALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAM  1845
             ALI QGV NSASAGILIYMALVDLLAADFM P +Q+N RLQLG ++SL+LGAG MSVLA 
Sbjct  390   ALIVQGVFNSASAGILIYMALVDLLAADFMNPILQSNRRLQLGANISLLLGAGCMSVLAK  449

Query  1846  WA  1851
             WA
Sbjct  450   WA  451



>gb|AAR08412.1| metal transport protein [Medicago truncatula]
 gb|KEH38228.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=358

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 263/367 (72%), Gaps = 22/367 (6%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ +I   P  +S  +     C C           +KE     ++L Y+L +IAS+LV G
Sbjct  13    FFYVIFILPILVSCDS-----CKCETE-------QTKENSEKNEALHYKLGSIASVLVCG  60

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GVS+PLL+++   L P+ DIFFMIKAFAAGVIL+TGF+HILPDAF++L SP LK+  P
Sbjct  61    ALGVSLPLLSKRIPILSPKNDIFFMIKAFAAGVILATGFIHILPDAFESLNSPCLKE-KP  119

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadh  1290
             W  FP +GL+A+ +SIATLMVD+ A S+++K+  HF+ +K +P      +E         
Sbjct  120   WGDFPLAGLVAMLSSIATLMVDSFASSYYQKR--HFNPSKQVPADEEKGDEHVGHVHVHT  177

Query  1291  mhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRE  1470
                HG A  +        + EL      IRQR++SQVLELGIVVHSVIIG+ LGT+Q+ +
Sbjct  178   HATHGHAHGSATSSQDSISPEL------IRQRIISQVLELGIVVHSVIIGISLGTAQSID  231

Query  1471  TIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYN  1650
             TI+PLLVALSFHQFFEGMGLGGCI+QAKF+S STA+MA FFSLTTP+GIA G+G+SSVY 
Sbjct  232   TIKPLLVALSFHQFFEGMGLGGCISQAKFESRSTAIMATFFSLTTPIGIAIGMGVSSVYK  291

Query  1651  PHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSM  1830
              +S T+LI +GV NSASAGILIYMALVDLLAADFM P++QNN ++Q+G ++SL+LG+G M
Sbjct  292   DNSPTSLIVEGVFNSASAGILIYMALVDLLAADFMSPRMQNNFKIQIGANISLLLGSGCM  351

Query  1831  SVLAMWA  1851
             S+LA WA
Sbjct  352   SLLAKWA  358



>ref|XP_003546826.1| PREDICTED: zinc transporter 1-like [Glycine max]
Length=359

 Score =   377 bits (967),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 204/366 (56%), Positives = 266/366 (73%), Gaps = 21/366 (6%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             FY+  +  P        A  +CTC+  +E     S       ++ L Y++ +IAS+LVAG
Sbjct  15    FYVCFVLLP------TMALGDCTCD-TIEATKSDS-------IEVLHYKIGSIASVLVAG  60

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GVS+PLL+++   L P+ DIFFM+KAFAAGVIL+TGFVHILP+A+++LTSP LK+ NP
Sbjct  61    ALGVSLPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKE-NP  119

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W KFPF+G +A+ +SI TLMVD+ A  F+ ++  HF+ +K  QV AD+EE  D  A    
Sbjct  120   WGKFPFTGFVAMLSSIGTLMVDSFATGFYHRQ--HFNPSK--QVPADDEEMGDEHAGHIH  175

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                 A     +     S   +   SD IRQR++SQVLE+GIV+HSVIIG+ LGT+ + +T
Sbjct  176   VHTHATHGHAHGSAVSSEGSIT--SDVIRQRIISQVLEIGIVIHSVIIGISLGTAGSIDT  233

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PLLVALSFHQFFEGMGLGGCI+QAKF+S S A+MA FFSLTTP+GIA G+G+SSVY  
Sbjct  234   IKPLLVALSFHQFFEGMGLGGCISQAKFESKSMAIMATFFSLTTPIGIAIGMGVSSVYKE  293

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TAL  +G+ NSASAGILIYMALVDLLAADFM P++Q N++LQLG ++SL+LGAG MS
Sbjct  294   NSPTALTVEGIFNSASAGILIYMALVDLLAADFMSPRLQKNLKLQLGANISLLLGAGCMS  353

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  354   LLAKWA  359



>gb|AFK42181.1| unknown [Medicago truncatula]
Length=358

 Score =   376 bits (966),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 263/367 (72%), Gaps = 22/367 (6%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ +I   P  +S  +     C C           +KE     ++L Y+L +IAS+LV G
Sbjct  13    FFYVIFILPILVSCDS-----CKCETE-------QTKENSEKNEALHYKLGSIASVLVCG  60

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GVS+PLL+++   L P+ DIFFMIKAFAAGVIL+TGF+HILPDAF++L SP LK+  P
Sbjct  61    ALGVSLPLLSKRIPILSPKNDIFFMIKAFAAGVILATGFIHILPDAFESLNSPCLKE-KP  119

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadh  1290
             W  FP +GL+A+ +SIATLMVD+ A S+++K+  HF+ +K +P      +E         
Sbjct  120   WGDFPLAGLVAMLSSIATLMVDSFASSYYQKR--HFNPSKQVPADEEKGDEHVGHVHVHT  177

Query  1291  mhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRE  1470
                HG A  +        + EL      IRQR++SQVLELGIVVHSVIIG+ LGT+Q+ +
Sbjct  178   RATHGHAHGSATSSQDSISPEL------IRQRIISQVLELGIVVHSVIIGISLGTAQSID  231

Query  1471  TIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYN  1650
             TI+PLLVALSFHQFFEGMGLGGCI+QAKF+S STA+MA FFSLTTP+GIA G+G+SSVY 
Sbjct  232   TIKPLLVALSFHQFFEGMGLGGCISQAKFESRSTAIMATFFSLTTPIGIAIGMGVSSVYK  291

Query  1651  PHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSM  1830
              +S T+LI +GV NSASAGILIYMALVDLLAADFM P++QNN ++Q+G ++SL+LG+G M
Sbjct  292   DNSPTSLIVEGVFNSASAGILIYMALVDLLAADFMSPRMQNNFKIQIGANISLLLGSGCM  351

Query  1831  SVLAMWA  1851
             S+LA WA
Sbjct  352   SLLAKWA  358



>gb|EYU27582.1| hypothetical protein MIMGU_mgv1a008839mg [Erythranthe guttata]
Length=360

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 209/363 (58%), Positives = 267/363 (74%), Gaps = 14/363 (4%)
 Frame = +1

Query  763   IIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAG  942
             I++  P  +SG ++  S CTC    E Q    S       ++LK++L AIAS+L AG  G
Sbjct  12    ILVLIPPTVSGESS--SSCTCPEENEDQTQNYS-------EALKFKLAAIASVLTAGGIG  62

Query  943   VSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAK  1122
             VSIPLL R+++FL PE D FFMIKAFAAGVIL+TGFVHILPDA++TLTSP L  + PW +
Sbjct  63    VSIPLLGRRFQFLRPENDAFFMIKAFAAGVILATGFVHILPDAYRTLTSPCLSKS-PWRE  121

Query  1123  FPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrh  1302
             FPF+G  A+ A+I TL VDT+A +F++   MHF K+K    + DEE+ +           
Sbjct  122   FPFTGFFAMVAAIGTLAVDTVATAFYKN--MHFSKSKPLNYAVDEEDQQPPHDGHVHVHT  179

Query  1303  gaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRP  1482
              A     +    PS+   ++LSD +RQR++SQVLELGIVVHSVIIG+ LG SQ+ +T++P
Sbjct  180   HATHGHAHGAVVPSHE--INLSDLVRQRIISQVLELGIVVHSVIIGISLGASQSVDTVKP  237

Query  1483  LLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSS  1662
             L+ ALSFHQFFEGMGLGGCI+QAKFKS++T VM +FFSLTTP+GI  GIGISSVY  +S 
Sbjct  238   LMAALSFHQFFEGMGLGGCISQAKFKSLTTTVMMIFFSLTTPIGIGVGIGISSVYKENSP  297

Query  1663  TALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLA  1842
              ALI +G+LNSAS+GILIYM+LVDLLAADF  P++Q+NVRLQLG HVSL+LGAG MS++A
Sbjct  298   IALIVEGILNSASSGILIYMSLVDLLAADFTNPRMQSNVRLQLGAHVSLLLGAGCMSLMA  357

Query  1843  MWA  1851
              WA
Sbjct  358   KWA  360



>ref|XP_011095751.1| PREDICTED: zinc transporter 1-like [Sesamum indicum]
Length=361

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 213/363 (59%), Positives = 265/363 (73%), Gaps = 21/363 (6%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             +I+   P  +SG      +CTC  +   Q + S        ++LK++L AIAS+L AG  
Sbjct  19    LILFLVPATVSG------DCTCQDDQTEQHNKS--------EALKFKLAAIASVLGAGGI  64

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GVS+PLL R++    PE DIFFMIKAFAAGVIL+TGF+HILPDAF+TLTSP L + NPW 
Sbjct  65    GVSLPLLGRRFHVFRPENDIFFMIKAFAAGVILATGFIHILPDAFRTLTSPCLGE-NPWG  123

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+G + + A+IATLMVDT+A SF++   MHF K+K  QV+ DEE   D  A      
Sbjct  124   KFPFAGFVGMMAAIATLMVDTVATSFYKN--MHFSKSK--QVNVDEEAGDDEHAGHVHIH  179

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
               A     +    PSN   + LSD +RQR++SQVLELGIVVHSVIIG+ LG S + +TI+
Sbjct  180   THATHGHAHGAAAPSNE--MSLSDLVRQRIISQVLELGIVVHSVIIGISLGASVSVDTIK  237

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHS  1659
             PLL ALSFHQFFEGMGLGGCI+QA+FKS++T +M +FFSLTTP+GI  GIGISSVY  +S
Sbjct  238   PLLAALSFHQFFEGMGLGGCISQAEFKSLTTTIMMLFFSLTTPIGIGVGIGISSVYKENS  297

Query  1660  STALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVL  1839
               ALI +G+ NSAS+GILIYMALVDLLAADFM P++Q+NVRLQLG H+SL+LGAG MS L
Sbjct  298   PKALIVEGIFNSASSGILIYMALVDLLAADFMNPRMQSNVRLQLGAHISLLLGAGCMSFL  357

Query  1840  AMW  1848
             A W
Sbjct  358   AKW  360



>gb|KHN48870.1| Zinc transporter 1 [Glycine soja]
Length=335

 Score =   374 bits (961),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 200/349 (57%), Positives = 261/349 (75%), Gaps = 15/349 (4%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A  +CTC+  +E     S       ++ L Y++ +IAS+LVAGA GVS+PLL+++   L 
Sbjct  2     ALGDCTCD-TIEATKSDS-------IEVLHYKIGSIASVLVAGALGVSLPLLSKRIPTLN  53

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             P+ DIFFM+KAFAAGVIL+TGFVHILP+A+++LTSP LK+ NPW KFPF+G +A+ +SI 
Sbjct  54    PKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKE-NPWGKFPFTGFVAMLSSIG  112

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLMVD+ A  F+ ++  HF+ +K  QV AD+EE  D  +        A     +     S
Sbjct  113   TLMVDSFATGFYHRQ--HFNPSK--QVPADDEEMGDEHSGHIHVHTHATHGHAHGSAVSS  168

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                +   SD IRQR++SQVLE+GIV+HSVIIG+ LGT+ + +TI+PLLVALSFHQFFEGM
Sbjct  169   EGSIT--SDVIRQRIISQVLEIGIVIHSVIIGISLGTAGSIDTIKPLLVALSFHQFFEGM  226

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKF+S S A+MA FFSLTTP+GIA G+G+SSVY  +S TAL  +G+ NSASA
Sbjct  227   GLGGCISQAKFESKSMAIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEGIFNSASA  286

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM P++Q N++LQLG ++SL+LGAG MS+LA WA
Sbjct  287   GILIYMALVDLLAADFMSPRLQKNLKLQLGANISLLLGAGCMSLLAKWA  335



>gb|KHN21378.1| Zinc transporter 1 [Glycine soja]
Length=335

 Score =   374 bits (960),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 258/349 (74%), Gaps = 21/349 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVT--VDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
             +CTC+          +KE   +  ++ L Y++ +IAS+LVAGA GVS+PLL+++   L P
Sbjct  5     DCTCD----------TKEATKSDSIEVLHYKIGSIASVLVAGALGVSLPLLSKRIPTLNP  54

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             + DIFFM+KAFAAGVIL+TGFVHILP+A+++LTSP LK+ NPW KFPF+G +A+ +SI T
Sbjct  55    KNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKE-NPWGKFPFTGFVAMLSSIGT  113

Query  1168  LMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             LMVD+ A  F+ ++  HF+ +K +P    +  +        H H     A    + P  S
Sbjct  114   LMVDSFATGFYHRQ--HFNPSKQVPADDEEMGDEHAGHMHVHTHATHGHAHGSAVSPEGS  171

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                    S+ IRQR++SQVLE+GIVVHSVIIG+ LGT+ + +TI+PLLVALSFHQFFEGM
Sbjct  172   IT-----SEVIRQRIISQVLEIGIVVHSVIIGISLGTAGSIDTIKPLLVALSFHQFFEGM  226

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKF+S ST +MA FFSLTTP+GIA G+G+SSVY  +S TAL  +G+ NSASA
Sbjct  227   GLGGCISQAKFESKSTVIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEGIFNSASA  286

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM PK+Q N++LQLG ++SL+LGAG MS+LA WA
Sbjct  287   GILIYMALVDLLAADFMSPKLQKNLKLQLGANISLLLGAGCMSLLAKWA  335



>ref|XP_007212798.1| hypothetical protein PRUPE_ppa020164mg [Prunus persica]
 gb|EMJ13997.1| hypothetical protein PRUPE_ppa020164mg [Prunus persica]
Length=331

 Score =   374 bits (959),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 202/346 (58%), Positives = 249/346 (72%), Gaps = 19/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC    E +    +KE      +LKY+L +IASILVAGA GVS+PLL +K   L PE 
Sbjct  5     DCTC----ESEDTEHNKEA-----ALKYKLGSIASILVAGAVGVSLPLLGKKIPTLRPEN  55

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFFMIKAFAAGVIL+T F+HILPDAF  LTSP LK+ NPW KFPF+G +A+ ++I TLM
Sbjct  56    DIFFMIKAFAAGVILATAFIHILPDAFDNLTSPCLKE-NPWGKFPFTGFVAMLSAIGTLM  114

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD+LA  ++++        K  QV   E   +    A         A   +       +E
Sbjct  115   VDSLATGYYQRS-----NIKSNQVHELETGDRVHGHAADHVHGHTHATQSH----AHGSE  165

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
              +  S+ IR RV+SQVLELGI+VHSVIIG+ LG SQ+ ETI+PL+VALSFHQFFEG+GLG
Sbjct  166   ELMSSELIRNRVISQVLELGILVHSVIIGISLGASQSPETIKPLMVALSFHQFFEGVGLG  225

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI+QAKFKS S A+MA FFSLTTPVGIA GIGIS+VYN  S TALI +G  N+A+AGIL
Sbjct  226   GCISQAKFKSRSAAIMAAFFSLTTPVGIAIGIGISTVYNESSPTALIVEGTFNAAAAGIL  285

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM P++Q+N+ +QLG ++SL+LG G MSVLA WA
Sbjct  286   IYMALVDLLAADFMNPRLQSNLGIQLGAYISLLLGTGCMSVLAKWA  331



>emb|CAN72265.1| hypothetical protein VITISV_008115 [Vitis vinifera]
Length=360

 Score =   374 bits (961),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 209/347 (60%), Positives = 261/347 (75%), Gaps = 14/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             S+C+C+   E   H  +       +SLKY+L AIASILVAGAAGVSIPLL +K   L PE
Sbjct  28    SDCSCD-EAEHSDHPXNGG-----ESLKYKLAAIASILVAGAAGVSIPLLGKKVPALNPE  81

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
               IFFMIKAFAAGVIL+TGF+HILP+AF+ LTSP L + NPW KFPF+GL+A+ ++I TL
Sbjct  82    NHIFFMIKAFAAGVILATGFIHILPEAFERLTSPCLGE-NPWGKFPFTGLVAMMSAIGTL  140

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A  +++++  HF K K  QV+ADEE  ++ A   H+H H       +    PS+ 
Sbjct  141   MVDTFATGYYKRQ--HFSKPK--QVTADEERGQEHAGHVHVHTHATHGH-AHGSASPSDE  195

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             E   LSD IR+R+VSQVLELGIVVHSVIIG+ LG SQ  ETI+PLL ALSFHQFFEG+GL
Sbjct  196   E--SLSDLIRRRIVSQVLELGIVVHSVIIGVSLGASQRPETIKPLLAALSFHQFFEGLGL  253

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKF+  + A+M +FFS+TTPVGI  GIGIS +Y+ +  TALI +GV ++ASAGI
Sbjct  254   GGCISQAKFRFSTMAMMVLFFSVTTPVGIVLGIGISRIYHENGPTALIVEGVFDAASAGI  313

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++Q ++RLQLG ++SL+LG G MS LA WA
Sbjct  314   LIYMALVDLLAADFMNPRLQXSLRLQLGANISLLLGTGCMSFLAKWA  360



>ref|XP_003531480.1| PREDICTED: zinc transporter 1-like [Glycine max]
Length=361

 Score =   373 bits (958),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 259/352 (74%), Gaps = 21/352 (6%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVT--VDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             A  +CTC+          +KE   +  ++ L Y++ +IAS+LVAGA GVS+PLL+++   
Sbjct  28    ALGDCTCD----------TKEATKSDSIEVLHYKIGSIASVLVAGALGVSLPLLSKRIPT  77

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L P+ DIFFM+KAFAAGVIL+TGFVHILP+A+++LTSP LK+ NPW KFPF+G +A+ +S
Sbjct  78    LNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKE-NPWGKFPFTGFVAMLSS  136

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             I TLMVD+ A  F+ ++  HF+ +K +P    +  +        H H     A    + P
Sbjct  137   IGTLMVDSFATGFYHRQ--HFNPSKQVPADDEEMGDEHAGHMHVHTHATHGHAHGSAVSP  194

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
               S       S+ IRQR++SQVLE+GIVVHSVIIG+ LGT+ + +TI+PLLVALSFHQFF
Sbjct  195   EGSIT-----SEVIRQRIISQVLEIGIVVHSVIIGISLGTAGSIDTIKPLLVALSFHQFF  249

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EGMGLGGCI+QAKF+S ST +MA FFSLTTP+GIA G+G+SSVY  +S TAL  +G+ NS
Sbjct  250   EGMGLGGCISQAKFESKSTVIMATFFSLTTPIGIAIGMGVSSVYKENSPTALTVEGIFNS  309

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYMALVDLLAADFM PK+Q N++LQLG ++SL+LGAG MS+LA WA
Sbjct  310   ASAGILIYMALVDLLAADFMSPKLQKNLKLQLGANISLLLGAGCMSLLAKWA  361



>ref|XP_002312231.1| metal transport family protein [Populus trichocarpa]
 gb|EEE89598.1| metal transport family protein [Populus trichocarpa]
Length=360

 Score =   370 bits (951),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 200/368 (54%), Positives = 263/368 (71%), Gaps = 21/368 (6%)
 Frame = +1

Query  748   ASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILV  927
             AS  +I++++P  ++       ECTC     G L +S  E      +LK++L +I SILV
Sbjct  14    ASSLLILLYYPTIVT------CECTCE---VGDLEHSKGE------ALKFKLGSILSILV  58

Query  928   AGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDT  1107
             AGA GVS+PLL +K +   PE D+FFMIKAFAAGVIL+TGF+HILPDAF++LTSP L + 
Sbjct  59    AGAIGVSLPLLGKKIKAFRPENDVFFMIKAFAAGVILATGFIHILPDAFESLTSPCL-NQ  117

Query  1108  NPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaad  1287
             + W  FPF+G +A+ ++I TLMVD+ A  F+++  MHF+K K  QV   +EE        
Sbjct  118   DLWGHFPFTGFVAMMSAIGTLMVDSFATGFYKR--MHFNKNK--QVDTTDEETAGQEHEG  173

Query  1288  hmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTR  1467
             H+H H  A           N +L  LS+ +R+RV+SQVLELGIVVHS+IIG+ LG S + 
Sbjct  174   HVHVHTHATHGHAHGSASLNEDLA-LSEMVRRRVISQVLELGIVVHSIIIGISLGASGSP  232

Query  1468  ETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVY  1647
             ETI+PL+ ALSFHQFFEG+GLGGCI QA+FKS S A+MA  FSLTTP+GIA GIGIS++Y
Sbjct  233   ETIKPLMAALSFHQFFEGLGLGGCITQAQFKSASMAIMATLFSLTTPLGIAIGIGISNIY  292

Query  1648  NPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGS  1827
             +  S TAL  +G+ N+ASAGILIYMALVDLLA+DFM P++Q N+R+QLG +VSL+LGAG 
Sbjct  293   DERSPTALTVEGIFNAASAGILIYMALVDLLASDFMSPRMQGNLRIQLGANVSLLLGAGC  352

Query  1828  MSVLAMWA  1851
             M+ +  WA
Sbjct  353   MTFMVKWA  360



>gb|ACU24645.1| unknown [Glycine max]
Length=359

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/361 (56%), Positives = 265/361 (73%), Gaps = 15/361 (4%)
 Frame = +1

Query  769   IFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVS  948
             +F+ C +     A  +CTC+  +E     ++K    +++ L Y++ +IAS+LVAGA GVS
Sbjct  14    LFYVCFVLLPTMALGDCTCD-TIE-----ATKSD--SIEVLHYKIGSIASVLVAGALGVS  65

Query  949   IPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFP  1128
             +PLL+++   L P+ DIFFM+KAFAAGVIL+TGFVHILP+A+++LTSP LK+ NPW KFP
Sbjct  66    LPLLSKRIPTLNPKNDIFFMVKAFAAGVILATGFVHILPEAYESLTSPCLKE-NPWGKFP  124

Query  1129  FSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhga  1308
             F+G +A+ +SI TLMVD+ A  F+ ++  HF+ +K  QV AD+EE  D  A        A
Sbjct  125   FTGFVAMLSSIGTLMVDSFATGFYHRQ--HFNPSK--QVPADDEEMGDEHAGHIHVHTHA  180

Query  1309  aaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLL  1488
                  +     S   +   SD IRQR++SQVLE+GIV+HSVIIG+ LGT+ + +TI+PLL
Sbjct  181   THGHAHGSAVSSEGSIT--SDVIRQRIISQVLEIGIVIHSVIIGISLGTAGSIDTIKPLL  238

Query  1489  VALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTA  1668
             VALSFHQFFEGMGLGGCI QAKF+S   A+MA FFSLTTP+GIA G+G+SSVY  +S TA
Sbjct  239   VALSFHQFFEGMGLGGCIFQAKFESKFMAIMATFFSLTTPIGIAIGMGVSSVYKENSPTA  298

Query  1669  LITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMW  1848
             L  +G+ NSA AGILIYMALVDLLAADFM P++Q N++LQLG ++SL LGAG MS+LA W
Sbjct  299   LTVEGIFNSAFAGILIYMALVDLLAADFMSPRLQKNLKLQLGANISLFLGAGCMSLLAKW  358

Query  1849  A  1851
             A
Sbjct  359   A  359



>ref|XP_004293836.1| PREDICTED: zinc transporter 1-like [Fragaria vesca subsp. vesca]
Length=355

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 197/350 (56%), Positives = 253/350 (72%), Gaps = 21/350 (6%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E Q    +K       +LK++LVAI+SIL+A A GVS+P+L +K   L PE
Sbjct  24    AECTCSD--ESQDRDKAK-------ALKFKLVAISSILIASAIGVSLPMLGKKIPTLRPE  74

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              DIFFMIKAFAAGVIL+TGF+H+LPDAF++LTSP L    PW  FPF+G IA+ ++I T+
Sbjct  75    NDIFFMIKAFAAGVILATGFIHVLPDAFESLTSPCLSQM-PWGDFPFTGFIAMVSAIGTM  133

Query  1171  MVDTLAMSFFRKKMMHFDKT---KLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             M+DT A S++R+   HF+K    K  Q      E          H H   + A+ L+   
Sbjct  134   MIDTFATSYYRRS--HFNKALPVKDDQEMNGVHEGHVHVHTHATHGHAHGSDAMALEDSA  191

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S+ ELV      R+R++SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ AL+FHQFFEG
Sbjct  192   SSFELV------RRRIISQVLELGIVVHSVIIGVSLGASESPKTIKPLVAALTFHQFFEG  245

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI QAKFKS + A M +FFSLTTP+GI  G+G+SS Y  +SSTALI +GV NSAS
Sbjct  246   MGLGGCICQAKFKSKAIATMVLFFSLTTPIGIVVGMGVSSFYKENSSTALIVEGVFNSAS  305

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYMALVDLLAADFM P++Q N+R+QLG ++SL+LG+G MS+LA WA
Sbjct  306   AGILIYMALVDLLAADFMNPRMQGNLRIQLGANLSLLLGSGCMSLLAKWA  355



>ref|XP_004306552.1| PREDICTED: zinc transporter 1-like [Fragaria vesca subsp. vesca]
Length=361

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 203/375 (54%), Positives = 260/375 (69%), Gaps = 24/375 (6%)
 Frame = +1

Query  730   SLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVA  909
             ++  IVAS  ++I+ FP  + G    ESE T + N E               +LKY+L +
Sbjct  10    NMLKIVAS--VLILLFPTVVFGECTCESEDTQDHNNE---------------ALKYKLGS  52

Query  910   IASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTS  1089
             IASILV+GA GVS+PLL +K   L PE +IFF++KAFAAGVIL+T F+HILPDAF+TLTS
Sbjct  53    IASILVSGALGVSLPLLGKKIPALRPENNIFFIVKAFAAGVILATAFIHILPDAFETLTS  112

Query  1090  PLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeak  1269
             P LK+ NPW KFPF+G + + ++I TLMVD +A  +++   +     K  QV+ D+EE++
Sbjct  113   PCLKE-NPWGKFPFTGFVCMMSAIGTLMVDAMATGYYKSSSL-----KRTQVTDDDEESR  166

Query  1270  daaaadhmhrhgaaaaaVYLDPPPSN-NELVHLSDRIRQRVVSQVLELGIVVHSVIIGLC  1446
                   H                 ++ +E +  S+ IR RV+SQVLELGI+VHSVIIG+ 
Sbjct  167   VGHDHGHAGHAHGHTHGATQQASNAHGSEELKSSELIRHRVISQVLELGILVHSVIIGIT  226

Query  1447  LGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATG  1626
             LG SQ  +TI+PLLVALSFHQFFEG+GLGGCI+QA+FKS S A+MA FFSLTTP+GIA G
Sbjct  227   LGVSQNPDTIKPLLVALSFHQFFEGIGLGGCISQAQFKSRSAAIMAAFFSLTTPIGIAVG  286

Query  1627  IGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVS  1806
               IS VY+  S TALI QG L SA+AGILIYMALVDLLAADFM P++Q N R+QLG ++S
Sbjct  287   TAISRVYSETSPTALIVQGTLESAAAGILIYMALVDLLAADFMSPRMQGNRRIQLGSYIS  346

Query  1807  LVLGAGSMSVLAMWA  1851
             L+LG G MS LA WA
Sbjct  347   LLLGTGCMSFLAKWA  361



>ref|XP_008229645.1| PREDICTED: zinc transporter 8-like [Prunus mume]
Length=356

 Score =   367 bits (942),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 249/349 (71%), Gaps = 21/349 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   +G  + +        ++LKY+L AIASILVA A GV IP+L +    L P++
Sbjct  26    ECTCDEEEDGDRNKT--------EALKYKLAAIASILVASAIGVCIPILGKSIPALHPDR  77

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             +IFF+IKAFAAGVIL+TGF+H+LPDAF  LTSP LK+ NPW KFPF+G +A+ A+I TLM
Sbjct  78    NIFFLIKAFAAGVILATGFIHVLPDAFHNLTSPCLKE-NPWGKFPFTGFVAMVAAIGTLM  136

Query  1174  VDTLAMSFFRKKMMHFDKTKL-PQ--VSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             VD  A S++ +   HF   +  P+  V  +E+  +               A   +D  P+
Sbjct  137   VDASATSYYSRS--HFKNNRAQPEESVGDEEKAGEHEDHLHVHTHATHGHAHGSVDTSPT  194

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                L       R RV+SQVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGM
Sbjct  195   TQLL-------RHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFHQFFEGM  247

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKFK+   A+MA+FFSLTTPVGIA GIGIS+VY  +S TALI +GV N+ASA
Sbjct  248   GLGGCISQAKFKARGVAIMALFFSLTTPVGIAIGIGISNVYKENSPTALIVEGVFNAASA  307

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYM+LVDLLAADFM PK+Q+N RLQ G +++L+LGAG MS+LA WA
Sbjct  308   GILIYMSLVDLLAADFMNPKMQSNGRLQAGANIALLLGAGCMSLLAKWA  356



>ref|XP_010036079.1| PREDICTED: zinc transporter 8-like [Eucalyptus grandis]
Length=342

 Score =   365 bits (938),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 248/347 (71%), Gaps = 19/347 (5%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC          S  E      +LKY+L AIASILVAGA GV +P++ +    L PE
Sbjct  15    AECTCE---------SDPEERNRTRALKYKLAAIASILVAGAVGVCLPIVGKTVPALHPE  65

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             + IFF+IKAFAAGVILSTGF+H+LPDAF+ LTSP L +T PW  FPF+G +A+  ++ TL
Sbjct  66    RSIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLSET-PWGDFPFAGFVAMLGALGTL  124

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT+A S+F+K+  H DKT    VS    + + A            A   +   P S +
Sbjct  125   MVDTVATSYFKKR--HADKT----VSDKSGDEEKARENQGEVHVHTHATHGHSHGPISTD  178

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  SD +R RV+SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGL
Sbjct  179   SE---SDLLRHRVISQVLELGIVVHSVIIGVSLGASESPQTIKPLVAALSFHQFFEGMGL  235

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKFK+ +T VMA+FFSLTTPVGI  G+G+S+VY+ +S TALI +G+ N+AS+GI
Sbjct  236   GGCISQAKFKTRATVVMALFFSLTTPVGIVIGLGVSNVYDENSPTALIVEGIFNAASSGI  295

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             L+YM+LVDLLAADFM  K+QNN RL  G +V+L+LGAG MS+LA WA
Sbjct  296   LVYMSLVDLLAADFMSSKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  342



>ref|XP_010109875.1| Zinc transporter 1 [Morus notabilis]
 gb|EXC24818.1| Zinc transporter 1 [Morus notabilis]
Length=351

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 256/368 (70%), Gaps = 27/368 (7%)
 Frame = +1

Query  757   YIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGA  936
             Y  +I  P  +S      +EC C G  E Q    +K       +L+ +LVAI SILVA A
Sbjct  8     YFFLIVLPFLVS------AECGC-GETEAQDRDKTK-------ALQLKLVAITSILVASA  53

Query  937   AGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPW  1116
              GVS+P+L +K   L PE DIFFMIKAFAAGVIL+TGF+HILP+AF++LTSP L   NPW
Sbjct  54    IGVSLPILGKKIPTLRPENDIFFMIKAFAAGVILATGFIHILPEAFESLTSPCL-GRNPW  112

Query  1117  AKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLP---QVSadeeeakdaaaad  1287
               FPF+G +A+ +++AT+M+DT A SF+ +   HF+K  LP            +      
Sbjct  113   GDFPFAGFVAMLSALATMMIDTFATSFYERA--HFNKA-LPVKDDSHVQGAAHEGHVHVH  169

Query  1288  hmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTR  1467
                 HG A  + ++    S+ ELV      R RV+SQVLELGIVVHSVIIG+ LG S + 
Sbjct  170   THATHGHAHGSAFVSEDISSVELV------RHRVISQVLELGIVVHSVIIGISLGASYSP  223

Query  1468  ETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVY  1647
              TI+PL+ AL+FHQFFEGMGLGGCI+QAKFKS S   M +FFSLTTPVGI  G+GISSVY
Sbjct  224   TTIKPLVAALTFHQFFEGMGLGGCISQAKFKSKSIVTMVLFFSLTTPVGIGIGMGISSVY  283

Query  1648  NPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGS  1827
             N ++ TALI +G+ NSASAGILIYMALVDLLAADFM P++Q+N+RLQLG ++SL+LG+GS
Sbjct  284   NENNPTALIVEGIFNSASAGILIYMALVDLLAADFMNPRMQSNLRLQLGANISLLLGSGS  343

Query  1828  MSVLAMWA  1851
             MS+LA WA
Sbjct  344   MSLLAKWA  351



>ref|XP_011014627.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 1 [Populus euphratica]
Length=359

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 259/368 (70%), Gaps = 22/368 (6%)
 Frame = +1

Query  748   ASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILV  927
             AS  +I++++P  ++       ECTC   VE  L +S  E      +LK++L +I SILV
Sbjct  14    ASSLLILLYYPTIVT------CECTCE--VE-DLEHSKGE------ALKFKLGSILSILV  58

Query  928   AGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDT  1107
             AGA GVS+PLL +K +   PE D+FFMIKAFAAGVIL+TGF+HILPDAF++LTSP L + 
Sbjct  59    AGAIGVSLPLLGKKIKAFRPENDVFFMIKAFAAGVILATGFIHILPDAFESLTSPCL-NQ  117

Query  1108  NPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaad  1287
             + W  FPF+G +A+ ++I TLMVD+ A  F+++  MHF+K K    + +E  A+      
Sbjct  118   DLWGHFPFTGFVAMMSAIGTLMVDSFATGFYKR--MHFNKNKPADTTDEETAAEHEGHVH  175

Query  1288  hmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTR  1467
                      A        S  E + LS+ +R+RV+SQVLELGIVVHS+IIG+ LG S + 
Sbjct  176   VHTHATHGHAHG----SASLKEDLALSELVRRRVISQVLELGIVVHSIIIGISLGASGSP  231

Query  1468  ETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVY  1647
             ETI+PL+ ALSFHQFFEG+GLGGCI QA+FKS S A+MA  FSLTTP+GIA GIGIS++Y
Sbjct  232   ETIKPLMAALSFHQFFEGLGLGGCITQAQFKSASMAIMATLFSLTTPLGIAIGIGISNIY  291

Query  1648  NPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGS  1827
             +  S TAL  +G+ N+ASAGILIYMALVDLLA+DFM P++Q N R+QLG +VSL+LGAG 
Sbjct  292   DERSPTALTVEGIFNAASAGILIYMALVDLLASDFMSPRMQGNFRIQLGANVSLLLGAGC  351

Query  1828  MSVLAMWA  1851
             M+ +  WA
Sbjct  352   MTFMVKWA  359



>ref|XP_007217784.1| hypothetical protein PRUPE_ppa020051mg, partial [Prunus persica]
 gb|EMJ18983.1| hypothetical protein PRUPE_ppa020051mg, partial [Prunus persica]
Length=333

 Score =   364 bits (934),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 190/347 (55%), Positives = 246/347 (71%), Gaps = 17/347 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   +G  + +        ++LKY+L AIASILVA A GV IP+L +    L P++
Sbjct  3     ECTCDEEEDGDRNKT--------EALKYKLAAIASILVASAIGVGIPILGKTIPALHPDR  54

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             +IFF+IKAFAAGVIL+TGF+H+LPDAF  LTSP LK+ NPW KFPF+G +A+ A+I TLM
Sbjct  55    NIFFLIKAFAAGVILATGFIHVLPDAFDNLTSPCLKE-NPWGKFPFTGFVAMVAAIGTLM  113

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQ-VSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             VD  A S++ +     +K +  +     E+  +               A   +D  P+  
Sbjct  114   VDASATSYYSRSHFKNNKARPAESCGDQEKAGEHEGHVHVHTHATHGHAHGAVDTSPTTQ  173

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
              L       R RV+SQVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGL
Sbjct  174   LL-------RHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFHQFFEGMGL  226

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKF +   A+MA+FFSLTTPVGIA GIGIS+VY  +S TALI +GV N+ASAGI
Sbjct  227   GGCISQAKFTARGVAIMALFFSLTTPVGIAIGIGISNVYKENSPTALIVEGVFNAASAGI  286

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYM+LVDLLAADFM PK+Q+N RLQ+G +++L+LGAG MS+LA WA
Sbjct  287   LIYMSLVDLLAADFMNPKLQSNGRLQVGANIALLLGAGFMSLLAKWA  333



>ref|XP_008229644.1| PREDICTED: zinc transporter 8-like [Prunus mume]
Length=356

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 245/349 (70%), Gaps = 21/349 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   +G  + +        ++LKY+L AIASILVA A GV IP+L +    L P++
Sbjct  26    ECTCDEEEDGDRNKA--------EALKYKLAAIASILVASAIGVCIPILGKTIPALHPDR  77

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             +IFF+IKAFAAGVIL+TGF+H+LPDAF  LTSP LK+ NPW KFPF+G +A+ A+I TLM
Sbjct  78    NIFFLIKAFAAGVILATGFIHVLPDAFDNLTSPCLKE-NPWGKFPFTGFVAMVAAIGTLM  136

Query  1174  VDTLAMSFFRKKMMHFDKTKL---PQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             VD  A S++ +   HF   K          E+  +               A   +D  P+
Sbjct  137   VDASATSYYSRS--HFKNNKAQPAESCGDQEKAGEHEGHVHVHTHATHGHAHGSVDTSPT  194

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                L       R RV+SQVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGM
Sbjct  195   TQLL-------RHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFHQFFEGM  247

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKFK+   A+MA+FFSLTTPVGIA GIGIS+VY  +S TALI +GV N+ASA
Sbjct  248   GLGGCISQAKFKARGVAIMALFFSLTTPVGIAIGIGISNVYKENSPTALIVEGVFNAASA  307

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYM+LVDLLAADFM PK+Q+N RLQ G +++L+LGAG MS+LA WA
Sbjct  308   GILIYMSLVDLLAADFMNPKLQSNGRLQAGANIALLLGAGFMSLLAKWA  356



>gb|EYU33801.1| hypothetical protein MIMGU_mgv1a008434mg [Erythranthe guttata]
Length=374

 Score =   365 bits (937),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 252/330 (76%), Gaps = 12/330 (4%)
 Frame = +1

Query  883   DSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHIL  1062
             ++LKY+L AI ++L AGA GVS+PLL R+ E L PE D+FFMIKAFAAGVIL+TGF+HIL
Sbjct  50    EALKYKLGAIVAVLAAGAVGVSLPLLGRRVEALRPENDVFFMIKAFAAGVILATGFIHIL  109

Query  1063  PDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQ  1242
             PDAF+TLTSP L + +PW +FPF+G IA+ ASI TLMVDTLA +F+  K MHFD  K  Q
Sbjct  110   PDAFRTLTSPCLAE-DPWRRFPFAGFIAMVASIGTLMVDTLATAFY--KNMHFDTAK--Q  164

Query  1243  VSadeeeakdaa-------aadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQV  1401
             V+   +E + +        A   +H H     A        + +   +SD +RQR++SQV
Sbjct  165   VNDVGDEEEGSIHPEDGHDARVDIHAHATHGHAHGASAALPSRKSGSVSDIVRQRIISQV  224

Query  1402  LELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVM  1581
             LELGIVVHSVIIG+ LG SQ+  TI+PLLVALSFHQFFEGMGLGGCI+QA+FKSV+T +M
Sbjct  225   LELGIVVHSVIIGISLGASQSSYTIKPLLVALSFHQFFEGMGLGGCISQARFKSVTTMIM  284

Query  1582  AVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKP  1761
              +FFSLTTP+GI  GIGISSVY  +SST LI +GV+NSASAGILIYMALVDLLAADFM P
Sbjct  285   TLFFSLTTPIGIGVGIGISSVYKENSSTGLIVEGVMNSASAGILIYMALVDLLAADFMNP  344

Query  1762  KIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +++ N+RLQLG H SL+LGAG MS LA WA
Sbjct  345   RMEGNLRLQLGAHTSLLLGAGCMSFLAKWA  374



>ref|XP_002307860.2| zinc transporter protein ZIP1 [Populus trichocarpa]
 gb|EEE91383.2| zinc transporter protein ZIP1 [Populus trichocarpa]
Length=354

 Score =   364 bits (934),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 250/348 (72%), Gaps = 18/348 (5%)
 Frame = +1

Query  811   SECTCN-GNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
             +ECTC+ G  EG+    +K      ++LKY+ VAIASIL  GA GV +P+L +    L P
Sbjct  24    AECTCDVGGGEGK----NKS-----EALKYKAVAIASILFGGAVGVCLPILGKTIPVLSP  74

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             EK+IFF+IKAFAAGVILSTGF+H+LPDAF +LTSP L + NPW KFPF+G +A+ ++I T
Sbjct  75    EKNIFFIIKAFAAGVILSTGFIHVLPDAFDSLTSPCLGE-NPWGKFPFTGFVAMVSAIGT  133

Query  1168  LMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSN  1347
             LMVD LA S++ +  +H +K +  +   +E+ A +A             +   +D   S 
Sbjct  134   LMVDCLASSYYTR--LHLNKAQPEESGDEEKAAVEAHEGHVHTHATHGHSHGIVDSSGSG  191

Query  1348  NELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMG  1527
                   S  IR RV++QVLELGIVVHSVIIG+ LG S++  TIRPL+ ALSFHQFFEGMG
Sbjct  192   P-----SQLIRHRVITQVLELGIVVHSVIIGVSLGASESPNTIRPLVAALSFHQFFEGMG  246

Query  1528  LGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAG  1707
             LGGCI QAKFK+ +  +MA+FFSLTTPVGIA G+GIS+VYN  S  ALI +G+ N+ASAG
Sbjct  247   LGGCITQAKFKTKTIVIMALFFSLTTPVGIAIGLGISNVYNESSPNALIVEGIFNAASAG  306

Query  1708  ILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ILIYMALVDLLAADFM PK+Q+N  LQ G +VSL+LGAG MS+LA WA
Sbjct  307   ILIYMALVDLLAADFMHPKVQSNGALQFGVNVSLLLGAGCMSLLAKWA  354



>ref|XP_007215607.1| hypothetical protein PRUPE_ppa007779mg [Prunus persica]
 gb|EMJ16806.1| hypothetical protein PRUPE_ppa007779mg [Prunus persica]
Length=356

 Score =   364 bits (934),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 243/349 (70%), Gaps = 21/349 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+            E     ++LKY+L AIASILVA A GV IP L +    L P++
Sbjct  26    KCTCD--------KEEDEDRNKTEALKYKLAAIASILVASAIGVGIPTLGKNIPALHPDR  77

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             +IFF+IKAFAAGVIL+TGF+H+LPDAF  LTSP LK+ NPW KFPF+G +A+ A+I TLM
Sbjct  78    NIFFLIKAFAAGVILATGFIHVLPDAFDKLTSPCLKE-NPWGKFPFTGFVAMVAAIGTLM  136

Query  1174  VDTLAMSFFRKKMMHFDKTKL---PQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             VD  A S++ +   HF   +      V  +E+  +               A   +D  PS
Sbjct  137   VDASATSYYSRS--HFKNNRAQPAESVGDEEKAGEHEDHMHVHTHATHGHAHGSVDTSPS  194

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                L       R RV+SQVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGM
Sbjct  195   TQLL-------RHRVISQVLELGIIVHSVIIGISLGASESPDTIRPLVAALTFHQFFEGM  247

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKFK+   A+MA+FFSLTTPVGIA GIGIS+VY  +S TALI +GV N+ASA
Sbjct  248   GLGGCISQAKFKARGVAIMALFFSLTTPVGIAIGIGISNVYEENSPTALIVEGVFNAASA  307

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYM+LVDLLAADFM PK+Q+N RLQ G +++L+LGAG MS+LA WA
Sbjct  308   GILIYMSLVDLLAADFMNPKMQSNGRLQAGANIALLLGAGCMSLLANWA  356



>ref|XP_002527722.1| zinc/iron transporter, putative [Ricinus communis]
 gb|EEF34635.1| zinc/iron transporter, putative [Ricinus communis]
Length=355

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 199/350 (57%), Positives = 249/350 (71%), Gaps = 20/350 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   E      S       ++LKY+L AIA+ILVA A GV +PLL++    L PEK
Sbjct  22    ECTCDAEEEEGDRNKS-------EALKYKLGAIAAILVASAIGVCLPLLSKFIPALSPEK  74

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             ++FFMIK+FAAGVILSTGF+HILPDAF++LTSP L D NPW KFPF+G IA+ ++I TLM
Sbjct  75    NVFFMIKSFAAGVILSTGFIHILPDAFESLTSPCL-DENPWGKFPFTGFIAMVSAIGTLM  133

Query  1174  VDTLAMSFFRKKMMHFDKTKL---PQVSadeeeakdaaaadhmhrhgaaaaaVYL-DPPP  1341
             VDT A S+F K  +   ++ +    + S D   A +         HG +   V + D  P
Sbjct  134   VDTYATSYFNKSNLRKAQSAVTGDEEKSVDNGGAHEHMHVHTHATHGHSHGRVTVQDSVP  193

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S        D +R RV+SQVLELGIVVHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEG
Sbjct  194   S--------DLLRHRVISQVLELGIVVHSVIIGISLGASESPKTIRPLVAALTFHQFFEG  245

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI+QA FK+ +   M +FF+LTTP GIA GIGIS+VYN +S TALI +GV NSAS
Sbjct  246   MGLGGCISQANFKTRAVTTMVLFFALTTPAGIAIGIGISNVYNENSPTALIVEGVFNSAS  305

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYMALVDLLAADFM PK+Q + +LQ G +VSL+LGAG M++LA WA
Sbjct  306   AGILIYMALVDLLAADFMNPKVQASAKLQFGVNVSLLLGAGCMALLAKWA  355



>ref|XP_004488546.1| PREDICTED: zinc transporter 1-like [Cicer arietinum]
Length=369

 Score =   363 bits (932),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 198/368 (54%), Positives = 258/368 (70%), Gaps = 16/368 (4%)
 Frame = +1

Query  751   SFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVA  930
             SF+ +I F P  +S T     +              +K+      +L Y+L +IASIL+ 
Sbjct  17    SFFYVIFFLPTLVSCTTTCTCDTE-----------QTKQNDENNKTLHYKLGSIASILIC  65

Query  931   GAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTN  1110
             GA GVS+PLL+++   L P  D+FFMIKAFAAGVILSTGF+HILP+AF+ L SP LK+ N
Sbjct  66    GAVGVSLPLLSKRVPILSPNNDLFFMIKAFAAGVILSTGFIHILPEAFEKLNSPCLKE-N  124

Query  1111  PWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKL-PQVSadeeeakdaaaad  1287
              W  FPF+G +A+ +SIATLMVD+ A  ++ ++  HF+   L  QV  D+ E        
Sbjct  125   IWGNFPFAGFVAMLSSIATLMVDSFASGYYHRQ--HFNNNNLSKQVPHDDVEIGGNEHVG  182

Query  1288  hmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTR  1467
             H+H H  A          S+++ +  S+ IRQR++SQVLELGIVVHSVIIG+ LGT+Q+ 
Sbjct  183   HIHVHTHATHGHAHGSTNSSHDSIS-SELIRQRIISQVLELGIVVHSVIIGISLGTAQSI  241

Query  1468  ETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVY  1647
             +TI+PLLVALSFHQFFEGMGLGGCI+QAKF+S ST +MA FFSLTTP+GIA GI +SSVY
Sbjct  242   DTIKPLLVALSFHQFFEGMGLGGCISQAKFESRSTTIMATFFSLTTPIGIAIGIAVSSVY  301

Query  1648  NPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGS  1827
               +  T+LI +GV  SASAGILIYMALVDLLAADFM P++QNN+++    ++SL+LGAG 
Sbjct  302   KENDPTSLIVEGVFTSASAGILIYMALVDLLAADFMSPRLQNNLKMHFAANISLLLGAGC  361

Query  1828  MSVLAMWA  1851
             MS+LA WA
Sbjct  362   MSLLAKWA  369



>ref|XP_007049130.1| Zinc transporter 5 precursor [Theobroma cacao]
 gb|EOX93287.1| Zinc transporter 5 precursor [Theobroma cacao]
Length=355

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 197/349 (56%), Positives = 249/349 (71%), Gaps = 17/349 (5%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A  ECTC    E +      + L    +LKY++ AIASILVAGA GV  PLL +    L 
Sbjct  24    ARGECTCEPEDEDR-----NKPL----ALKYKMAAIASILVAGAIGVCFPLLGKTINALR  74

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PEK++FF IKAFAAGVILSTGF+H+LPDA ++LTSP L D NPW KFPF+GL+A+T++IA
Sbjct  75    PEKNLFFTIKAFAAGVILSTGFIHVLPDATESLTSPCL-DENPWGKFPFAGLVAMTSAIA  133

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLMVD  A S + K   HF+KT+         + +     ++       A   +     S
Sbjct  134   TLMVDVFATSHYTKS--HFNKTQ-----HINGDEEKTGEHENHVHVHTHATHGHAHGSVS  186

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             + +    S+ +R RVVSQVLELGIVVHS I+G  LG S++ +TI+PL+ AL+FHQFFEGM
Sbjct  187   SVDRSGSSELLRHRVVSQVLELGIVVHSAIVGTSLGASESPKTIKPLVAALTFHQFFEGM  246

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QA+FKS + A+MA+FFSLTTPVGIA GIGIS++Y+  S TALI +G+ N+ASA
Sbjct  247   GLGGCISQAQFKSRAVAIMALFFSLTTPVGIAIGIGISNIYDESSPTALIVEGIFNAASA  306

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM PK+QNN  LQ G  V+L+LGAG MS+LA+WA
Sbjct  307   GILIYMALVDLLAADFMNPKLQNNGILQAGASVALLLGAGLMSLLAVWA  355



>ref|XP_002532140.1| zinc/iron transporter, putative [Ricinus communis]
 gb|EEF30239.1| zinc/iron transporter, putative [Ricinus communis]
Length=359

 Score =   362 bits (929),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 250/362 (69%), Gaps = 40/362 (11%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVT-----VDSLKYRLVAIASILVAGAAGVSIPLLARK  969
             A ++CTC+           +ET VT       +LKY+LVA++SIL+A A GV++P+  +K
Sbjct  25    ASADCTCD----------QEETAVTQSDDRTKTLKYKLVAVSSILIASALGVTLPIFGKK  74

Query  970   YEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIAL  1149
                L PE +IFF+IKAFAAGVIL+TGFVHILPDAF +LTSP LK   PW +FPFSG +A+
Sbjct  75    IPSLNPENNIFFLIKAFAAGVILATGFVHILPDAFDSLTSPCLKK-KPWGQFPFSGFVAM  133

Query  1150  TASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYL  1329
              ++I T+MVDT A S+F++   HF+K  LP              +      G     V++
Sbjct  134   VSAIMTMMVDTFATSYFKRS--HFNKA-LP-------------LSGDEELQGKHEGHVHV  177

Query  1330  DPPPSNNE-------LVHLSDRI-RQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPL  1485
                 S+         L H    I R R+VSQVLELGIVVHSVIIG+ LG SQ+ +TI+PL
Sbjct  178   HTHASHGHAHGSAAFLSHDDSGIFRHRIVSQVLELGIVVHSVIIGISLGASQSIDTIKPL  237

Query  1486  LVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSST  1665
             + AL+FHQFFEGMGLGGCI+QAKFKS + A M +FFSLTTP+GIA GIGIS  YN ++ T
Sbjct  238   VAALTFHQFFEGMGLGGCISQAKFKSRAVAAMVLFFSLTTPIGIAVGIGISHSYNGNAQT  297

Query  1666  ALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAM  1845
             ALI +GV NSASAGILIYMALVDLLA DFM PK+Q+N+RLQLG ++SL+LG   MS+LA 
Sbjct  298   ALIVEGVFNSASAGILIYMALVDLLAEDFMNPKLQSNLRLQLGANLSLLLGTACMSLLAK  357

Query  1846  WA  1851
             WA
Sbjct  358   WA  359



>ref|XP_007213802.1| hypothetical protein PRUPE_ppa007253mg [Prunus persica]
 gb|EMJ15001.1| hypothetical protein PRUPE_ppa007253mg [Prunus persica]
Length=376

 Score =   363 bits (931),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 248/349 (71%), Gaps = 21/349 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+   +   H+        V  LK++LVAI+SIL+A   GVS+P+L +K   L PE 
Sbjct  46    KCTCSKETQ---HHDK------VKVLKFKLVAISSILIASVLGVSLPMLGKKIPTLRPEN  96

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFFMIKAFAAGVIL+TGF+HILP+AF++LTSP L  T PW  FPF+G IA+ ++I T+M
Sbjct  97    DIFFMIKAFAAGVILATGFIHILPEAFESLTSPCLSQT-PWGNFPFTGFIAMLSAIGTMM  155

Query  1174  VDTLAMSFFRKKMMHFDKT---KLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             +DT A S++R+   HF K    K  +      E          H H   + A+  +   S
Sbjct  156   IDTFATSYYRRS--HFTKALPVKEDEEMHGVHEGHVHVHTHATHGHAHGSGAILPEDSAS  213

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             + EL      IR RV+SQVLELGIVVHSVIIG+ LG SQ+  TI+PL+ AL+FHQFFEGM
Sbjct  214   SFEL------IRHRVISQVLELGIVVHSVIIGISLGASQSPRTIKPLVAALTFHQFFEGM  267

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKFKS + A M +FFSLTTP+GI  G+GIS++YN  S TALI +GV NSASA
Sbjct  268   GLGGCISQAKFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNESSPTALIVEGVFNSASA  327

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM P++Q N+R+QLG ++SL+LG+G MS+LA WA
Sbjct  328   GILIYMALVDLLAADFMNPRMQGNLRIQLGANISLLLGSGCMSLLAKWA  376



>ref|XP_006353723.1| PREDICTED: zinc transporter 5-like [Solanum tuberosum]
Length=343

 Score =   361 bits (927),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 197/366 (54%), Positives = 257/366 (70%), Gaps = 31/366 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      ECTC+         S  E     ++LKY++ A+ASILVA 
Sbjct  9     FWYILLLLPAIVLG------ECTCD---------SEDEERNKSEALKYKMAALASILVAS  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PE++ FF+IKAFAAGVILSTGF+H+LPDAF++LTSP LK+ NP
Sbjct  54    AIGVCIPVLGKVIPALSPERNFFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLKE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPF G +A+ +++ATLMVDT A S++ KK +         V   E   ++     H 
Sbjct  113   WGNFPFCGFVAMVSAMATLMVDTYATSYYNKKNLK------NGVVTTEGGDEERVIHTHS  166

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
             H H   +  +  D   SN+EL      +R RV++QVLELGI+VHSVIIG+ LG S++ +T
Sbjct  167   HAHAHGSTTMMAD---SNSEL------LRYRVIAQVLELGIIVHSVIIGIALGASESPKT  217

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PL+ AL+FHQFFEGMGLGGCIAQAK KS + A+MA+FFSLTTPVGIA G+ I++VY+ 
Sbjct  218   IKPLVAALTFHQFFEGMGLGGCIAQAKLKSRAIAIMALFFSLTTPVGIAVGLAITNVYDE  277

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +G+ NSASAGILIYMALVD LAADFM P++Q N +LQLG +VSL+LGAG MS
Sbjct  278   NSPTALIVEGIFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANVSLLLGAGLMS  337

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  338   MLAKWA  343



>ref|XP_011002389.1| PREDICTED: zinc transporter 8-like [Populus euphratica]
Length=354

 Score =   361 bits (927),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 196/346 (57%), Positives = 245/346 (71%), Gaps = 16/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   EG    +  E      +LKY+ VAIASIL AGA GV +P+L +    L PEK
Sbjct  25    ECTCD--AEGGEGKNKSE------ALKYKAVAIASILFAGAVGVCLPILGKTIPVLSPEK  76

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             +IFF+IKAFAAGVILSTGF+H+LPDAF +LTSP L + NPW KFPF+G + + ++I TLM
Sbjct  77    NIFFIIKAFAAGVILSTGFIHVLPDAFDSLTSPCLSE-NPWGKFPFTGFVTMMSAIGTLM  135

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD LA S+F +  +H +K +  +   +E+ A +A             +   +D   S   
Sbjct  136   VDCLASSYFTR--LHLNKAQPEESRDEEKAAVEAHEGHVHTHATHGHSHGLVDSSGSGP-  192

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                 S  IR RV++QVLELGIVVHSVIIG+ LG S++ +TIRPL+ ALSFHQFFEGMGLG
Sbjct  193   ----SQLIRHRVITQVLELGIVVHSVIIGVSLGASESPKTIRPLVAALSFHQFFEGMGLG  248

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKFK+ +  +MA+FFSLTTPVGIA GIGI++VYN  S  ALI +G+ N+ASAGIL
Sbjct  249   GCITQAKFKTKTIVIMALFFSLTTPVGIAIGIGITNVYNESSPNALIVEGIFNAASAGIL  308

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM PK+Q N  LQ G +VSL+LG G MS+LA WA
Sbjct  309   IYMALVDLLAADFMHPKVQANGALQFGVNVSLLLGVGCMSLLAKWA  354



>ref|XP_009363255.1| PREDICTED: zinc transporter 1-like [Pyrus x bretschneideri]
Length=356

 Score =   361 bits (927),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 190/324 (59%), Positives = 239/324 (74%), Gaps = 12/324 (4%)
 Frame = +1

Query  889   LKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPD  1068
             LK++LVAI+SIL+A   GVS+P+L +K   L PE DIFFMIKAFAAGVIL+TGF+H+LPD
Sbjct  42    LKFKLVAISSILIASFLGVSLPMLGKKIPALNPENDIFFMIKAFAAGVILATGFIHVLPD  101

Query  1069  AFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKL---P  1239
             AF++LTSP L +T PW  FPF+G IA+ ++I T+M+DT A S++R+   HF K  L    
Sbjct  102   AFESLTSPCLSET-PWGNFPFTGFIAMLSAIGTMMIDTFATSYYRRS--HFTKPLLVNED  158

Query  1240  QVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIV  1419
             +      E          H H   +  +  +   S+ ELV      R RV+SQVLELGI+
Sbjct  159   EEMNGVHEGHVHVHTHATHGHAHGSGVIAAEDSISSFELV------RHRVISQVLELGIL  212

Query  1420  VHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSL  1599
             VHSVIIG+ LG SQ+ +TI+PL+ AL+FHQFFEGMGLGGCI QAKFKS + A M +FFSL
Sbjct  213   VHSVIIGISLGASQSPKTIKPLVAALTFHQFFEGMGLGGCITQAKFKSRAIATMVLFFSL  272

Query  1600  TTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNV  1779
             TTP+GI  G+GIS++YN  S TALI +GV NSASAGILIYMALVDLLAADFM P++QNN+
Sbjct  273   TTPIGIGVGMGISNIYNDTSPTALIVEGVFNSASAGILIYMALVDLLAADFMNPRMQNNL  332

Query  1780  RLQLGGHVSLVLGAGSMSVLAMWA  1851
             R+QLG +VSL+LG G MS+LA WA
Sbjct  333   RIQLGANVSLLLGCGCMSLLAKWA  356



>gb|KHG11077.1| Zinc transporter 5 -like protein [Gossypium arboreum]
Length=356

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 257/366 (70%), Gaps = 22/366 (6%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F   +I  P  + G      ECTC    E +      ++L    +LKY++ AIASILVAG
Sbjct  13    FCCFLILIPSLVQG------ECTCEPEDEDR-----NKSL----ALKYKIAAIASILVAG  57

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV  PLL +  E L P+K++FF+IKAFAAGVILSTGF+H+LPDA ++LTSP L + NP
Sbjct  58    AIGVCFPLLGKVIEALRPDKNLFFLIKAFAAGVILSTGFIHVLPDATESLTSPCLNE-NP  116

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W KFPF+GL+A+TA+I TLMVD  A S + K  +H  +          E+ ++       
Sbjct  117   WGKFPFAGLLAMTAAIGTLMVDVFATSHYTKSHLHKTQQNHEGDEEKTEQTENHLHVHTH  176

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
               HG +  +V +     + +L      +R RVVSQVLELGIVVHSVIIG+ LG S++ +T
Sbjct  177   ATHGHSHGSVSMLERADSAQL------LRHRVVSQVLELGIVVHSVIIGISLGASESPKT  230

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PL+ AL+FHQFFEGMGLGGCI+QAKFK  S A+M++FFSLTTPVGIA GI I++ Y+ 
Sbjct  231   IKPLVAALTFHQFFEGMGLGGCISQAKFKGRSVAIMSLFFSLTTPVGIAIGIAITNAYDE  290

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +G+LN+AS+GILIYMALVDLLAADFM PK+Q+N  LQ+G  VSL+LGAG MS
Sbjct  291   NSPTALIVEGLLNAASSGILIYMALVDLLAADFMNPKLQSNGILQVGASVSLLLGAGLMS  350

Query  1834  VLAMWA  1851
             +LA+WA
Sbjct  351   LLAIWA  356



>ref|XP_006429781.1| hypothetical protein CICLE_v10012062mg [Citrus clementina]
 gb|ESR43021.1| hypothetical protein CICLE_v10012062mg [Citrus clementina]
Length=355

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 199/370 (54%), Positives = 255/370 (69%), Gaps = 30/370 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F I++I  P  + G      ECTC+            +      +LKY+L AIASILVAG
Sbjct  12    FCILLILLPNVVRG------ECTCD---------PEDDDRDKTQALKYKLAAIASILVAG  56

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV +P+L +  + L PE++IFF+IKAFAAGVILSTGF+H+LPDAF+ LTSP L D +P
Sbjct  57    AIGVLLPVLGKTIKALSPERNIFFLIKAFAAGVILSTGFIHVLPDAFENLTSPCL-DEHP  115

Query  1114  WAKFPFSGLIALTASIATLMVD----TLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaa  1281
             W  FPF+G  A+ A+I TLM+D    + A S++RK   HF + +   VS +E+  + A  
Sbjct  116   WGDFPFTGFAAMVAAIGTLMIDAFATSYATSYYRKS--HFGEAE-NNVSDEEKVGEHAGH  172

Query  1282  adhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQ  1461
                        A  +L       E    S+ +R RV+S VLELGI+VHSVIIG+ LG S+
Sbjct  173   VHVHTHATDGHAHGFL-------EYSGESELLRHRVISLVLELGILVHSVIIGISLGASE  225

Query  1462  TRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS  1641
             + +TI+PL+ AL+FHQFFEGMGLGGCI QAKFKS   A++A+FFSLTTPVGIA GIGISS
Sbjct  226   SPKTIKPLVAALTFHQFFEGMGLGGCITQAKFKSRGVAILALFFSLTTPVGIAIGIGISS  285

Query  1642  VYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGA  1821
             VY+ +S TALI +G+ N+A+AGILIYM+LVDLLAADFM PK+Q N RLQ G +VSL+LGA
Sbjct  286   VYDENSPTALIVEGIFNAAAAGILIYMSLVDLLAADFMNPKMQTNKRLQFGANVSLLLGA  345

Query  1822  GSMSVLAMWA  1851
             G MS+LA WA
Sbjct  346   GCMSLLAKWA  355



>gb|KCW47600.1| hypothetical protein EUGRSUZ_K01344 [Eucalyptus grandis]
Length=374

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 241/322 (75%), Gaps = 10/322 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +LKY+L AIASILVAGA GV +P++ +    L PE+ IFF+IKAFAAGVILSTGF+H+LP
Sbjct  63    ALKYKLAAIASILVAGAVGVCLPIVGKTVPALHPERSIFFIIKAFAAGVILSTGFIHVLP  122

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L +T PW  FPF+G +A+  ++ TLMVDT+A S+F+K+  H DKT    V
Sbjct  123   DAFENLTSPCLSET-PWGDFPFAGFVAMLGALGTLMVDTVATSYFKKR--HADKT----V  175

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
             S    + + A            A   +   P S +     SD +R RV+SQVLELGIVVH
Sbjct  176   SDKSGDEEKARENQGEVHVHTHATHGHSHGPISTDSE---SDLLRHRVISQVLELGIVVH  232

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGLGGCI+QAKFK+ +T VMA+FFSLTT
Sbjct  233   SVIIGVSLGASESPQTIKPLVAALSFHQFFEGMGLGGCISQAKFKTRATVVMALFFSLTT  292

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+G+S+VY+ +S TALI +G+ N+AS+GIL+YM+LVDLLAADFM  K+QNN RL
Sbjct  293   PVGIVIGLGVSNVYDENSPTALIVEGIFNAASSGILVYMSLVDLLAADFMSSKLQNNGRL  352

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
               G +V+L+LGAG MS+LA WA
Sbjct  353   LFGTNVALLLGAGCMSLLAKWA  374



>ref|XP_010260702.1| PREDICTED: zinc transporter 8-like [Nelumbo nucifera]
Length=354

 Score =   360 bits (923),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 200/379 (53%), Positives = 261/379 (69%), Gaps = 31/379 (8%)
 Frame = +1

Query  718   PFRYSLFNIVASFYIIIIFF-PCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLK  894
             PF    F++   F ++++F  P   SG      ECTC+   E   H  SK       +LK
Sbjct  6     PFSSQFFSV---FTLLLLFLAPIVASG------ECTCDPE-ENTGHDKSK-------ALK  48

Query  895   YRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAF  1074
             Y++ AIASIL A A GV IP+L +    L PEK+IFF+IKAFAAGVIL+TGF+HILPDAF
Sbjct  49    YKIAAIASILTASAIGVCIPVLGKTIPALHPEKNIFFIIKAFAAGVILATGFIHILPDAF  108

Query  1075  QTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSad  1254
             + LTSP LK    W KFPF+G +A+ ++I TLM+DT A S++ +   HF+K++L      
Sbjct  109   EQLTSPCLKG-KAWEKFPFTGFVAMMSAIGTLMIDTTATSYYNRS--HFNKSQL------  159

Query  1255  eeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVI  1434
                  +    + +        A Y     S++     S+ +R RV+SQVLELGIVVHSVI
Sbjct  160   -MNGDEERTDEQVSHVHVHTHATYGHAHGSDSTS---SELLRHRVISQVLELGIVVHSVI  215

Query  1435  IGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVG  1614
             IG+ +GTS+   TIRPL+ AL+FHQFFEGMGLGGCI QAKFK+ +TA+M +FFSLTTPVG
Sbjct  216   IGISVGTSEDPSTIRPLVAALTFHQFFEGMGLGGCITQAKFKNRATAIMILFFSLTTPVG  275

Query  1615  IATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLG  1794
             IA G+GI++VYN +S TALI +G+ +SA+AGILIYMALVDLLAADFM P++Q+N +LQ+ 
Sbjct  276   IAIGMGITNVYNENSPTALIVEGIFDSAAAGILIYMALVDLLAADFMNPRMQSNGKLQIL  335

Query  1795  GHVSLVLGAGSMSVLAMWA  1851
              + SL+LGAG MSVLA WA
Sbjct  336   ANASLLLGAGCMSVLAKWA  354



>ref|XP_008225897.1| PREDICTED: zinc transporter 8-like [Prunus mume]
Length=356

 Score =   359 bits (921),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 249/349 (71%), Gaps = 19/349 (5%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   +   H+        V  LK++LVAI+SIL+A   GVS+P+L +K   L PE
Sbjct  25    AECTCSKETQ---HHDK------VKVLKFKLVAISSILIASVLGVSLPMLGKKIPTLRPE  75

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              DIFF+IKAFAAGVIL+TGF+H+LP+AF++LTSP L  T PW  FPFSG IA+ ++I T+
Sbjct  76    NDIFFLIKAFAAGVILATGFIHVLPEAFESLTSPCLSQT-PWGNFPFSGFIAMLSAIGTM  134

Query  1171  MVDTLAMSFFRKKMMHFDKTKLP--QVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             M+DT A S++R+   HF K  LP  +        +          HG A  +  + P  S
Sbjct  135   MIDTFATSYYRRS--HFTKA-LPVKEDEEMHGVHEGHVHVHTHATHGHAHGSGAILPEDS  191

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
              + L    + IR +V+SQVLELGIVVHSVIIG+ LG SQ+  TI+PL+ AL+FHQFFEGM
Sbjct  192   ASSL----ELIRHQVISQVLELGIVVHSVIIGISLGASQSPRTIKPLVAALTFHQFFEGM  247

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKFK  + A M +FFSLTTP+GI  G+GIS++YN  S TALI +GV NSASA
Sbjct  248   GLGGCISQAKFKFRAIATMVLFFSLTTPIGIGVGMGISNIYNESSPTALIVEGVFNSASA  307

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM P++Q N+R+QLG ++SL+LG+G MS+LA WA
Sbjct  308   GILIYMALVDLLAADFMNPRMQGNLRIQLGANISLLLGSGCMSLLAKWA  356



>ref|XP_002307858.2| hypothetical protein POPTR_0006s00840g, partial [Populus trichocarpa]
 gb|EEE91381.2| hypothetical protein POPTR_0006s00840g, partial [Populus trichocarpa]
Length=332

 Score =   358 bits (919),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 245/347 (71%), Gaps = 16/347 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLAR-KYEFLGPE  990
             ECTC+    G     S       ++LKY+ VAIASIL AGA GV +P+L +     L PE
Sbjct  1     ECTCDAGGGGGDRNKS-------EALKYKAVAIASILFAGAVGVCLPILGKTSIPALSPE  53

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             K+IFF+IKAFAAGVILSTGF+H+LPDAF +LTSP L + NPW  FPF+G +A+ ++I TL
Sbjct  54    KNIFFIIKAFAAGVILSTGFIHVLPDAFDSLTSPCLGE-NPWGNFPFTGFVAMVSAIGTL  112

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVD LA ++F +   H  K +  +   +E+ A +A             +   +D   S  
Sbjct  113   MVDCLATTYFTR--FHLIKAQSEESGDEEKAAVEAHEGHVHTHASHGHSHGIVDSSGSGP  170

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  S  IR RV++QVLELGIVVHSVIIG+ LG S++ +TIRPL+ ALSFHQFFEGMGL
Sbjct  171   -----SQLIRHRVITQVLELGIVVHSVIIGVSLGASESPKTIRPLVAALSFHQFFEGMGL  225

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI QAKFK+ ST +MA+FFSLTTPVGIA GIGI++VYN  S  +LI +G+ N+ASAGI
Sbjct  226   GGCITQAKFKTKSTVIMALFFSLTTPVGIAIGIGITNVYNESSPNSLIVEGIFNAASAGI  285

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM PK+Q+N  LQ G +VSL+LGAG MS++A WA
Sbjct  286   LIYMALVDLLAADFMHPKVQSNGALQFGVNVSLLLGAGCMSLVAKWA  332



>ref|XP_006429779.1| hypothetical protein CICLE_v10011940mg [Citrus clementina]
 gb|ESR43019.1| hypothetical protein CICLE_v10011940mg [Citrus clementina]
Length=388

 Score =   360 bits (924),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 201/386 (52%), Positives = 257/386 (67%), Gaps = 38/386 (10%)
 Frame = +1

Query  730   SLFNIVAS--------FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVD  885
               FN++ S        F I+++  P  + G      ECTC+            +      
Sbjct  29    KFFNMITSSRSLCIIFFCILLVLLPNIVRG------ECTCD---------PEDDDRDKTQ  73

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +LKY+L AIASILVAGA GV +P+L +    L PE+ IFF+IKAFAAGVILSTGFVH+LP
Sbjct  74    ALKYKLAAIASILVAGAIGVYLPVLGKTIPALSPERKIFFLIKAFAAGVILSTGFVHVLP  133

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVD----TLAMSFFRKKMMHFDKTK  1233
             DAF+ LTSP L D +PWA FPF+G  A+ A+I TLM+D    + A S++RK   HF + +
Sbjct  134   DAFENLTSPCL-DEHPWADFPFTGFAAMVAAIGTLMIDAFATSYATSYYRKS--HFGEAE  190

Query  1234  LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELG  1413
                VS +E+  + A             A   +       E    S+ +R RV+S VLELG
Sbjct  191   -DNVSDEEKVGEHAGHVHVHTHATHGHAHGSI-------EYAGESELLRHRVISLVLELG  242

Query  1414  IVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFF  1593
             I+VHSVIIG+ LGTS++ +TI+PL+ AL+FHQFFEGMGLGGCI QAKFKS   A++A+FF
Sbjct  243   ILVHSVIIGISLGTSESPKTIKPLVAALTFHQFFEGMGLGGCITQAKFKSRGVAILALFF  302

Query  1594  SLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQN  1773
             SLTTP GIA GIGISS Y+ +  TALI +G+ N+A+AGILIYM+LVDLLAADFM PK+Q+
Sbjct  303   SLTTPAGIAIGIGISSFYDENDPTALIVEGIFNAAAAGILIYMSLVDLLAADFMNPKMQD  362

Query  1774  NVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             N RLQ G HVSL+LGAG MS+LA WA
Sbjct  363   NKRLQFGAHVSLLLGAGCMSLLAKWA  388



>ref|XP_006481378.1| PREDICTED: zinc transporter 8-like [Citrus sinensis]
Length=355

 Score =   358 bits (919),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 197/370 (53%), Positives = 248/370 (67%), Gaps = 30/370 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F I++I  P  + G      ECTC+            E      +LKY+L AIASILVAG
Sbjct  12    FCILLILLPNVVRG------ECTCD---------PEDEDRDKTQALKYKLAAIASILVAG  56

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV +P+L +    L PE++IFF+IKAFAAGVILSTGF+H+LPDAF+ LTSP L D +P
Sbjct  57    AIGVLLPVLGKTIRALSPERNIFFLIKAFAAGVILSTGFIHVLPDAFENLTSPCL-DEHP  115

Query  1114  WAKFPFSGLIALTASIATLMVD----TLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaa  1281
             W  FPF+G  A+ A+I TLM+D    + A S++RK      +   P      E A     
Sbjct  116   WGDFPFTGFAAMVAAIGTLMIDAFATSYATSYYRKSHFGEAENNAPDEEKVGEHAGHVHV  175

Query  1282  adhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQ  1461
               H     A     Y      + E    S+ +R RV+S VLELGI+VHSVIIG+ LG S+
Sbjct  176   HTHATDGHAHGFLEY------SGE----SELLRHRVISLVLELGILVHSVIIGISLGASE  225

Query  1462  TRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS  1641
             + +TI+PL+ AL+FHQFFEGMGLGGCI QA+FKS   A++A+FFSLTTPVGIA GIGISS
Sbjct  226   SPKTIKPLVAALTFHQFFEGMGLGGCITQARFKSRGVAILALFFSLTTPVGIAIGIGISS  285

Query  1642  VYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGA  1821
             VY+ +S TALI +G+ N+A+AGILIYM+LVDLLAADFM PK+Q N RLQ G +VSL+LGA
Sbjct  286   VYDENSPTALIVEGIFNAAAAGILIYMSLVDLLAADFMNPKMQTNKRLQFGANVSLLLGA  345

Query  1822  GSMSVLAMWA  1851
             G MS+LA WA
Sbjct  346   GCMSLLAKWA  355



>gb|KDO77256.1| hypothetical protein CISIN_1g018362mg [Citrus sinensis]
Length=357

 Score =   358 bits (919),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 245/349 (70%), Gaps = 21/349 (6%)
 Frame = +1

Query  796   TAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE  975
             +AAA S CTC+   E Q H        T ++LKY+LVAI SIL+A AAGVS+P L +K  
Sbjct  25    SAAASSTCTCD-EAEAQEHK-------TTEALKYKLVAIVSILIASAAGVSLPFLVKKVS  76

Query  976   FLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTA  1155
             +L P+KD+FF+IKAFAAGVIL+TGF+HILPDAF++LTSP L + NPW KFPF+G IA+ +
Sbjct  77    YLSPDKDVFFLIKAFAAGVILATGFIHILPDAFESLTSPCLCE-NPWHKFPFAGFIAMMS  135

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             SI TLM++  A  + ++       T+L +    + + +     D    H          P
Sbjct  136   SIGTLMMEAYATGYHKR-------TELRKAQPFDGDEESDHDHDQQGVHAGHVHGSSFVP  188

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
              P+N+     SD IR R++SQ+LELGIV+HSVIIG+ LG S+   TI+PL+ ALSFHQFF
Sbjct  189   EPTNS-----SDLIRNRIISQILELGIVIHSVIIGISLGASERASTIKPLVAALSFHQFF  243

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EG GLGGCI+QAKF   + ++M +FFSLTTP GIA GIGIS +Y+  S TALI QG+LNS
Sbjct  244   EGTGLGGCISQAKFNYTAISIMVLFFSLTTPAGIAVGIGISKIYDQSSPTALIVQGLLNS  303

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLA  1842
             ASAGIL YMALVDLLAADFM PK+ +N+RLQ+G + +++LGA  M  LA
Sbjct  304   ASAGILTYMALVDLLAADFMNPKMLSNIRLQIGANFTVLLGASCMCFLA  352



>gb|EYU42857.1| hypothetical protein MIMGU_mgv1a025410mg [Erythranthe guttata]
Length=345

 Score =   358 bits (918),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 254/362 (70%), Gaps = 30/362 (8%)
 Frame = +1

Query  766   IIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGV  945
             ++  P A+ G      ECTC    EG     SK       +LKY++ AIA+ILVA A GV
Sbjct  14    VVLLPAAVLG------ECTCEPEEEGD---ESKSL-----ALKYKVGAIAAILVASAVGV  59

Query  946   SIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKF  1125
              +P++ R+   L PE++ FF+IKAFAAGVILSTGF+H+LPDAF++LTSP +   +PW  F
Sbjct  60    MLPVVGRRVPALSPERNFFFVIKAFAAGVILSTGFIHVLPDAFESLTSPCIP-ASPWGDF  118

Query  1126  PFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhg  1305
             PF+G IA+ ++I TLMVDT A S++R++           V A E    +   A  +  H 
Sbjct  119   PFTGFIAMLSAIGTLMVDTYATSYYRRR---------SGVKAVEGGGDEEGGAAVVPVHA  169

Query  1306  aaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPL  1485
              A  +V L+P     +L      +R RV+SQVLELGI+VHSVIIG+ LG SQ+ +TIRPL
Sbjct  170   HAHGSVSLEPDSGETDL------LRHRVISQVLELGIIVHSVIIGIALGASQSPKTIRPL  223

Query  1486  LVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSST  1665
             + ALSFHQFFEG+GLGGCI QA+FK+ +  +MA+FFS+TTPVGIA GIGI+++Y+  SST
Sbjct  224   IAALSFHQFFEGIGLGGCITQARFKARAVTIMALFFSITTPVGIAIGIGITNIYSETSST  283

Query  1666  ALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAM  1845
             ALI QGV N+ASAGIL+YMALVDLLAADFM PK+Q+N +LQLG ++SL++G G MS +A 
Sbjct  284   ALIVQGVFNAASAGILVYMALVDLLAADFMSPKLQSNGKLQLGANLSLLIGTGCMSFIAK  343

Query  1846  WA  1851
             WA
Sbjct  344   WA  345



>ref|XP_008371921.1| PREDICTED: zinc transporter 1-like [Malus domestica]
Length=356

 Score =   358 bits (918),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/326 (58%), Positives = 239/326 (73%), Gaps = 16/326 (5%)
 Frame = +1

Query  889   LKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPD  1068
             LK++LVAI+SIL+A   GVS+P+L +K   L PE DIFFMIKAFAAGVIL+TGF+H+LPD
Sbjct  42    LKFKLVAISSILIASFLGVSLPMLGKKIPALNPENDIFFMIKAFAAGVILATGFIHVLPD  101

Query  1069  AFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLP---  1239
             AF++LTSP L +T PW  FPF+G IA+ ++I T+M+DTLA S++R+   HF K  LP   
Sbjct  102   AFESLTSPCLSET-PWGNFPFTGFIAMLSAIGTMMIDTLATSYYRRS--HFTK-PLPVNE  157

Query  1240  --QVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELG  1413
               +++   E            R   +      D  PS        + +R RV+SQVLELG
Sbjct  158   DEEMNRVPEGHVHGHTHATHGRAHGSGVIAAEDSIPS-------FELVRHRVISQVLELG  210

Query  1414  IVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFF  1593
             I+VHSVIIG+ LG SQ+ +TI+PL+ AL+FHQFFEGMGLGGCI QA FKS + A M +FF
Sbjct  211   ILVHSVIIGISLGASQSPKTIKPLVAALTFHQFFEGMGLGGCITQANFKSRAIATMVLFF  270

Query  1594  SLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQN  1773
             SLTTP+GI  G+GIS++YN  S TALI +GV NSASAGILIYMALVDLLAADFM P++Q+
Sbjct  271   SLTTPIGIGVGMGISNIYNDTSPTALIVEGVFNSASAGILIYMALVDLLAADFMNPRMQS  330

Query  1774  NVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             N+R+QLG +VSL+LG G MS+LA WA
Sbjct  331   NLRIQLGANVSLLLGCGCMSLLAKWA  356



>ref|XP_010036084.1| PREDICTED: zinc transporter 1-like [Eucalyptus grandis]
Length=346

 Score =   357 bits (917),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 255/346 (74%), Gaps = 15/346 (4%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C  + E +    +         LKY+L AIASILVAGA GV +P+L +    L PE+
Sbjct  16    DCACETDSEDRNKGQA---------LKYKLAAIASILVAGAIGVCLPILGKTVPALHPER  66

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             +IFF+IKAFAAGVILSTGF+H+LPDAF++LTSP L  T PW +FPF+G +A+ A++ TL+
Sbjct  67    NIFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLGKT-PWGEFPFAGFVAMIAALGTLI  125

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD+LA S+++K   H DK  L     DEE+A++     H+H H +     +   P   + 
Sbjct  126   VDSLATSYYKKS--HIDKAMLDNYVEDEEKARENHGHVHVHAHASNG---HSHGPKLTDS  180

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
              V+ SD +R RVVSQVLELGIVV SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG
Sbjct  181   DVNSSDLLRHRVVSQVLELGIVVRSVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLG  240

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI  AKF++ ++A+MA+FFSLTTPVG+A G+G++SVY+ +S  AL+ +G+ N+ASAGIL
Sbjct  241   GCITLAKFETRASAIMAMFFSLTTPVGVAIGLGLTSVYDENSPKALVVEGIFNAASAGIL  300

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM PK+QNN RL  G +V+L+LGAG MS+LA WA
Sbjct  301   IYMALVDLLAADFMSPKLQNNGRLLFGTYVALLLGAGCMSLLARWA  346



>ref|XP_010036080.1| PREDICTED: zinc transporter 8-like [Eucalyptus grandis]
 gb|KCW47602.1| hypothetical protein EUGRSUZ_K01348 [Eucalyptus grandis]
Length=346

 Score =   356 bits (914),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 193/346 (56%), Positives = 248/346 (72%), Gaps = 15/346 (4%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC          S  E     ++LKY++VAI SILVA A GV +P++ ++   L PE+
Sbjct  16    DCTCE---------SDSEDRNKSEALKYKIVAIVSILVASAIGVCLPIVGKRVPALHPER  66

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
              IFF++KAFAAGVILSTGF+H+LPDAF+ LTSP L +T PW +FPF+G +A+ A++ TLM
Sbjct  67    SIFFIVKAFAAGVILSTGFIHVLPDAFENLTSPCLSET-PWGEFPFAGFVAMMAALGTLM  125

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDTLA S++RK  +H +K   P  SA++EE              A+    +   P     
Sbjct  126   VDTLATSYYRK--LHANKAG-PDKSAEDEEKGKGNQGHVHVHTHASQGHSH--APMLTKS  180

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                 SD +R RVVSQVLELGIVVHSVIIG+ LG S++ ETI+PL+ AL+FHQFFEGMGLG
Sbjct  181   DGSSSDLLRHRVVSQVLELGIVVHSVIIGISLGASESPETIKPLVAALTFHQFFEGMGLG  240

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QA+F++ ++A+MA+FFSLTTPVGIA GIGIS+VY+  S TALI +G+ NSAS+GIL
Sbjct  241   GCITQAQFETRASAIMALFFSLTTPVGIAIGIGISNVYDESSPTALIVEGIFNSASSGIL  300

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLA DFM PK+QN+ RL  G   +L+LGAG MS+LA WA
Sbjct  301   IYMALVDLLAPDFMSPKLQNSGRLLWGTFAALLLGAGCMSLLAKWA  346



>ref|XP_006468555.1| PREDICTED: zinc transporter 5-like [Citrus sinensis]
Length=357

 Score =   356 bits (914),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 188/349 (54%), Positives = 244/349 (70%), Gaps = 21/349 (6%)
 Frame = +1

Query  796   TAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE  975
             +AAA S CTC+   E Q H        T ++LKY+LVAI SIL+A AAGVS+P L +K  
Sbjct  25    SAAASSTCTCD-EAEAQEHK-------TTEALKYKLVAIVSILIASAAGVSLPFLVKKVS  76

Query  976   FLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTA  1155
             +L P+KD+FF+IKAFAAGVIL+TGF+HILPDAF++LTSP L + NPW KFPF+G IA+ +
Sbjct  77    YLSPDKDVFFLIKAFAAGVILATGFIHILPDAFESLTSPCLCE-NPWHKFPFAGFIAMMS  135

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             SI TLM++  A  + ++       T+L +    + + +     D    H          P
Sbjct  136   SIGTLMMEAYATGYHKR-------TELRKAQPFDGDEESDHDHDQQGVHAGHVHGSSFVP  188

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
              P+N+     SD IR R++SQ+LELGIV+HSVIIG+ LG S+   TI+PL+ ALSFHQFF
Sbjct  189   EPTNS-----SDLIRNRIISQILELGIVIHSVIIGISLGASERASTIKPLVAALSFHQFF  243

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EG GLGGCI+QAKF   + ++M +FFSL TP GIA GIGIS +Y+  S TALI QG+LNS
Sbjct  244   EGTGLGGCISQAKFNYTAISIMVLFFSLITPAGIAVGIGISKIYDQSSPTALIVQGLLNS  303

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLA  1842
             ASAGIL YMALVDLLAADFM PK+ +N+RLQ+G + +++LGA  M  LA
Sbjct  304   ASAGILTYMALVDLLAADFMNPKMLSNIRLQIGANFTVLLGASCMCFLA  352



>ref|XP_006481377.1| PREDICTED: zinc transporter 8-like [Citrus sinensis]
Length=358

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 242/352 (69%), Gaps = 24/352 (7%)
 Frame = +1

Query  808   ESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
               ECTC+            E      +LKY+L AIASILVAGA GV +P+L +    L P
Sbjct  27    RGECTCD---------PEDEDRDKTQALKYKLAAIASILVAGAIGVYLPVLGKTIPALSP  77

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             E+ IFF+IKAFAAGVILSTGFVH+LPDAF+ LTSP L D +PW  FPF+G  A+ A+I T
Sbjct  78    ERKIFFLIKAFAAGVILSTGFVHVLPDAFENLTSPCL-DEHPWGDFPFTGFAAMVAAIGT  136

Query  1168  LMVD----TLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             LM+D    + A S++RK   HF + +   VS +E+  + A             A   +  
Sbjct  137   LMIDAFATSYATSYYRKS--HFGEAE-DNVSDEEKVGEHAGHVHVHTHATHGHAHGSI--  191

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
                  E    S+ +R RV+S VLELGI+VHSVIIG+ LGTS++ +TI+PL+ AL+FHQFF
Sbjct  192   -----EYAGESELLRHRVISLVLELGILVHSVIIGISLGTSESPKTIKPLVAALTFHQFF  246

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EGMGLGGCI QAKFKS   A++A FFSLTTP GIA GIGISS Y+ +  TALI +G+ N+
Sbjct  247   EGMGLGGCITQAKFKSRGVAILAFFFSLTTPAGIAIGIGISSFYDENDPTALIVEGIFNA  306

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             A+AGILIYM+LVDLLAADFM PK+Q+N RLQ G HVSL+LGAG MS+LA WA
Sbjct  307   AAAGILIYMSLVDLLAADFMNPKMQDNKRLQFGAHVSLLLGAGCMSLLAKWA  358



>ref|XP_010036078.1| PREDICTED: zinc transporter 8-like [Eucalyptus grandis]
Length=343

 Score =   354 bits (909),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 247/346 (71%), Gaps = 18/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             EC C+ + EG  H  S+       +LKY+L AIASILVAG  GV +P+L +    L PE+
Sbjct  16    ECKCDSDEEG--HNKSQ-------ALKYKLAAIASILVAGTVGVCLPILGKTVPALHPER  66

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
              IFF+IKAFAAGVILSTG +H+LPDAF+ LTSP L +  PW +FPF+G +A+  ++ TLM
Sbjct  67    SIFFIIKAFAAGVILSTGLIHVLPDAFENLTSPCLSE-RPWGEFPFAGFVAMLGALGTLM  125

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT+A S+F+K  +H D     + S  +EE              A     +  P  ++ E
Sbjct  126   VDTVATSYFKK--LHADNAGSDK-SVGDEERARENRGQVPVHTHATHGHSH-GPISTDAE  181

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                 SD +R RV+SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGLG
Sbjct  182   ----SDLLRHRVISQVLELGIVVHSVIIGVSLGASESPKTIKPLVAALSFHQFFEGMGLG  237

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKFK+ +T VMA+FFSLTTP+GI  G+G+++ Y+ +S TALI +G+ N+AS+GIL
Sbjct  238   GCITQAKFKTRATVVMALFFSLTTPIGICIGLGVTTKYDENSPTALIVEGIFNAASSGIL  297

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +YM+LVDLLAADFM PK+QNN RL  G +V+L+LGAG MS+LA WA
Sbjct  298   VYMSLVDLLAADFMSPKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  343



>ref|XP_010093125.1| Zinc transporter 5 [Morus notabilis]
 gb|EXB53577.1| Zinc transporter 5 [Morus notabilis]
Length=358

 Score =   353 bits (906),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 195/349 (56%), Positives = 251/349 (72%), Gaps = 22/349 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   +G    S         +LKY+L AIASILVA   GV +P+L +    L PE+
Sbjct  29    ECTCDPE-DGDRDKSK--------ALKYKLAAIASILVASGIGVCLPMLGKTIHALSPER  79

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             ++FFMIKAFAAGVIL+TGF+H+LPDAF+ LTSP L +T PW +FPF+G +A+ ++I TLM
Sbjct  80    NVFFMIKAFAAGVILATGFIHVLPDAFENLTSPCLSET-PW-EFPFTGFVAMMSAILTLM  137

Query  1174  VDTLAMSFFRKKMMHFD-KTKLP-QVSadeeeakdaaaadhmhrhgaaaaaVYL-DPPPS  1344
             VD  A S+F+K   HF  K+  P  V  +E++ + +             +  ++ D   +
Sbjct  138   VDAFATSYFQKS--HFGGKSPAPASVGDEEKDGEHSEHVHVHTHATHGHSHGFVGDENSA  195

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             ++EL      +R RV+SQVLELGIVVHSVIIG+ LG S++ +TI PL+ AL+FHQFFEGM
Sbjct  196   SSEL------LRHRVISQVLELGIVVHSVIIGISLGASESPKTITPLVAALTFHQFFEGM  249

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCIAQAKFK+ +  +MA+FFSLTTPVGIA GIGIS+VY   S TALI +G+ N+ASA
Sbjct  250   GLGGCIAQAKFKARAVTIMAIFFSLTTPVGIAIGIGISNVYKETSPTALIVEGIFNAASA  309

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM  K+QNN RLQ+G +VSL+LGAG MS+LA WA
Sbjct  310   GILIYMALVDLLAADFMSRKLQNNGRLQIGANVSLLLGAGCMSLLAKWA  358



>dbj|BAH66920.1| metal transporter [Nicotiana tabacum]
Length=339

 Score =   352 bits (904),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 256/366 (70%), Gaps = 35/366 (10%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      ECTC+         S  E     ++LKY++VAIASIL+A 
Sbjct  9     FWYILLLLPAIVLG------ECTCD---------SEDEERNKTEALKYKMVAIASILIAS  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PEK+ FF+IKAFAAGVIL+TGF+H+LPDAF++LTSP LK+ NP
Sbjct  54    AIGVCIPVLGKAIPALSPEKNFFFIIKAFAAGVILATGFIHVLPDAFESLTSPCLKE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPFSG IA+ +++ TLMVDT A S+F  K    + TK   V+   +E        H 
Sbjct  113   WGNFPFSGFIAMVSAMGTLMVDTYATSYFSNK----NDTKNGLVAQSGDEGGAIHVHSHG  168

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                             S++EL      +R RVVSQVLE+GI+VHSVIIG+ LG S++ +T
Sbjct  169   SASLMG---------DSSSEL------LRYRVVSQVLEMGIIVHSVIIGIALGASESPKT  213

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQFFEGMGLGGCIAQAKFK+ + A+MA+FFSLTTPVGIA G+GI++VY+ 
Sbjct  214   IRPLVAALTFHQFFEGMGLGGCIAQAKFKTRAVAIMALFFSLTTPVGIAIGLGITNVYDE  273

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +GV NSASAGILIYMALVD LAADFM P++Q N +LQLG ++SL+LGAG M+
Sbjct  274   NSPTALIVEGVFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMA  333

Query  1834  VLAMWA  1851
             ++A WA
Sbjct  334   LIAKWA  339



>gb|KCW47598.1| hypothetical protein EUGRSUZ_K01343 [Eucalyptus grandis]
Length=406

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 248/346 (72%), Gaps = 18/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             EC C+ + EG  H  S+       +LKY+L AIASILVAG  GV +P+L +    L PE+
Sbjct  79    ECKCDSDEEG--HNKSQ-------ALKYKLAAIASILVAGTVGVCLPILGKTVPALHPER  129

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
              IFF+IKAFAAGVILSTG +H+LPDAF+ LTSP L +  PW +FPF+G +A+  ++ TLM
Sbjct  130   SIFFIIKAFAAGVILSTGLIHVLPDAFENLTSPCLSE-RPWGEFPFAGFVAMLGALGTLM  188

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT+A S+F+K  +H D     +  +  +E +       +  H  A       P  ++ E
Sbjct  189   VDTVATSYFKK--LHADNAGSDK--SVGDEERARENRGQVPVHTHATHGHSHGPISTDAE  244

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                 SD +R RV+SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGLG
Sbjct  245   ----SDLLRHRVISQVLELGIVVHSVIIGVSLGASESPKTIKPLVAALSFHQFFEGMGLG  300

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKFK+ +T VMA+FFSLTTP+GI  G+G+++ Y+ +S TALI +G+ N+AS+GIL
Sbjct  301   GCITQAKFKTRATVVMALFFSLTTPIGICIGLGVTTKYDENSPTALIVEGIFNAASSGIL  360

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +YM+LVDLLAADFM PK+QNN RL  G +V+L+LGAG MS+LA WA
Sbjct  361   VYMSLVDLLAADFMSPKLQNNGRLLFGTNVALLLGAGCMSLLAKWA  406



>ref|XP_011100402.1| PREDICTED: zinc transporter 8-like [Sesamum indicum]
Length=357

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 259/366 (71%), Gaps = 25/366 (7%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
              ++++I  P ++ G      ECTC    E +      +TL    +LKY+L AIASIL A 
Sbjct  17    LWVVLILLPASVVG------ECTCEPEEEDR-----NKTL----ALKYKLAAIASILTAS  61

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
               GV +P+L ++   L PE+  FF++KAFAAGVILSTGF+H+LPDAF++LTSP L + +P
Sbjct  62    GIGVCLPVLGKRVPALSPERSFFFIVKAFAAGVILSTGFIHVLPDAFESLTSPCLSE-HP  120

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPF+G +A+ ++I TLMVDT A S++R++        +     DEE A         
Sbjct  121   WGDFPFTGFVAMVSAIGTLMVDTYATSYYRRRAGAKAAATV-VAGDDEEGAVVPVHTHAT  179

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
             H H   + ++ LD    + E    +DR+R RV+SQVLELGI+VHSVIIG+ LG S++ +T
Sbjct  180   HGHAHGSVSLELD----SGE----TDRLRHRVISQVLELGIIVHSVIIGIALGASESPKT  231

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQFFEG+GLGGCI QAKF + + A+MA+FFS+TTP+GIA GIGIS++Y+ 
Sbjct  232   IRPLIAALTFHQFFEGIGLGGCITQAKFNTRAVAIMALFFSITTPMGIAVGIGISNIYSE  291

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
              S TALI +GV N+ASAGILIYMALVDLL+ADFM PK+Q+N +LQLG +VSL++GAG MS
Sbjct  292   TSPTALIVEGVFNAASAGILIYMALVDLLSADFMSPKLQSNGKLQLGANVSLLIGAGCMS  351

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  352   LLAKWA  357



>ref|XP_009794548.1| PREDICTED: zinc transporter 8-like [Nicotiana sylvestris]
Length=354

 Score =   351 bits (901),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 254/351 (72%), Gaps = 21/351 (6%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             SECTC+ + E    Y +K      ++LKY+LVA+ASIL+AGA G+SIP+L + +  L PE
Sbjct  21    SECTCDEDSE----YRNK-----TEALKYKLVAVASILLAGAIGISIPILGKIFPALHPE  71

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              +IFF +KAFAAGVIL+TGFVHILPDAF++L+SP L +  PW  FPF+G IA+ A+I T+
Sbjct  72    NNIFFFVKAFAAGVILATGFVHILPDAFESLSSPCLSE-KPWGDFPFAGFIAMVAAIGTM  130

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLD----PP  1338
             MVD +AMS+FR+   H  K K P  S +E+E       ++       +   +      P 
Sbjct  131   MVDLVAMSYFRRS--HLKKQK-PVNSDEEKEGGGIINQNNHVHVHTHSTHGHAHGSVVPL  187

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
                +EL    D  R+RV+SQVLELGI+VHSVIIG+ LG S++ +TI+PL+ AL+FHQ FE
Sbjct  188   EEGSEL----DLSRRRVISQVLELGILVHSVIIGISLGASESPKTIKPLVAALTFHQLFE  243

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             GMGLGGCI++A+FK   TA+MA+FFSLTTP+GIA G GIS+VY+  S TAL+ +G+ NS 
Sbjct  244   GMGLGGCISEARFKVRKTAIMAIFFSLTTPMGIAIGFGISTVYSETSPTALMVEGIFNSI  303

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +AGIL+YMALVDLLAADFM  ++Q++ +LQ+G +V L+LGAG MS+LA WA
Sbjct  304   AAGILVYMALVDLLAADFMSNRMQDSPKLQIGANVFLLLGAGCMSLLAKWA  354



>gb|KDP23905.1| hypothetical protein JCGZ_27105 [Jatropha curcas]
Length=359

 Score =   351 bits (901),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 188/350 (54%), Positives = 247/350 (71%), Gaps = 19/350 (5%)
 Frame = +1

Query  817   CTCNGNVEGQLHYSSKETLVTVD---SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
             C+C+           +ET+   D   +LKY+L+AI+SIL+A   GV++P+  +K + L P
Sbjct  24    CSCD-----------QETVEIDDRTTTLKYKLIAISSILIASGIGVTLPIFGKKIQSLNP  72

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             E +IFF+IKAFAAGVIL+TGFVHILPDAF+ LTSP L++  PW  FPF+G +A+ A+I T
Sbjct  73    ENNIFFLIKAFAAGVILATGFVHILPDAFENLTSPCLEEI-PWGDFPFAGFVAMVAAILT  131

Query  1168  LMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP--  1341
             +MVD+ A S++++  +HF+   LP      E         H+H H  A+           
Sbjct  132   MMVDSFATSYYKR--LHFNDKALPVTGDIVEMQGGKQHEGHVHVHTHASHGHAHGSSAVI  189

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S++ ++      R RVVSQVLELGI+VHSVIIG+ LG S++ +TI+PL+ AL+FHQFFEG
Sbjct  190   SDDSVLKSDGLFRHRVVSQVLELGILVHSVIIGISLGASESTDTIKPLVAALTFHQFFEG  249

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI+QAKFKS +  +M +FFSLTTP+GIA GIGIS  Y+ ++ TALI +GV NSAS
Sbjct  250   MGLGGCISQAKFKSGTITMMVLFFSLTTPMGIAIGIGISHSYSDNTPTALIVEGVFNSAS  309

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYMALVDLLA DFM PK+Q N RLQ+G +VSL+LG G MS LA WA
Sbjct  310   AGILIYMALVDLLAEDFMNPKMQANFRLQIGANVSLLLGMGCMSALAKWA  359



>gb|EYU42826.1| hypothetical protein MIMGU_mgv1a009106mg [Erythranthe guttata]
Length=353

 Score =   350 bits (899),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 248/346 (72%), Gaps = 17/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC    +G       ++L    +LKY++ AIA+ILVA A GV +P++ R+   L PE+
Sbjct  25    DCTCEAEEDG----GESKSL----ALKYKVGAIAAILVASAVGVMLPVVGRRVPALSPER  76

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             + FF+IKAFAAGVILSTGF+H+LPDAF++LTSP +   +PW  FPF+G IA+ ++I TLM
Sbjct  77    NFFFVIKAFAAGVILSTGFIHVLPDAFESLTSPCIP-ASPWGDFPFTGFIAMVSAIGTLM  135

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT A S++R++     K      + DEE             HG A  +V L       E
Sbjct  136   VDTYATSYYRRR--SGVKAVEGGGARDEEGGAAVVPVHTHATHGHAHGSVSLQSDSGETE  193

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
             L      +R RV+SQVLELGI+VHSVIIG+ LG SQ+ +TIRPL+ ALSFHQFFEG+GLG
Sbjct  194   L------LRHRVISQVLELGIIVHSVIIGIALGASQSPKTIRPLIAALSFHQFFEGIGLG  247

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QA+FK  +  +MAVFFS+TTPVGIA GIGI+++Y+  SSTALI QGV N+ASAGIL
Sbjct  248   GCITQARFKVRAVTIMAVFFSITTPVGIAIGIGITNIYSETSSTALIVQGVFNAASAGIL  307

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLL+ADFM PK+Q+N +LQLG ++SL++GAG MS++A WA
Sbjct  308   IYMALVDLLSADFMSPKMQSNGKLQLGANLSLLIGAGCMSLIAKWA  353



>emb|CDP16373.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   350 bits (899),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 249/392 (64%), Gaps = 63/392 (16%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F +++   P  + G      +CTC+   E      +  +L    +LKY+L AIASI VA 
Sbjct  10    FAVLVTVLPSLVLG------DCTCDAEEE-----ENDRSL----ALKYKLGAIASIFVAS  54

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV  P+L +K   L PE + FF+IKAFAAGVIL+TGF+H+LPDAF++LTSP L ++ P
Sbjct  55    AVGVYFPVLGKKIRALSPENNFFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLPES-P  113

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPF+G +A+ A+I TLMVD  A S + KK    + T L     D+            
Sbjct  114   WGDFPFTGFVAMVAAIGTLMVDVQATSHYNKKSSGNNGTVLALGEGDDHGE---------  164

Query  1294  hrhgaaaaaVYLDPPPSNNELVH--------------------------LSDRIRQRVVS  1395
                         +  PSN E+                            +S ++R RV++
Sbjct  165   ------------NGKPSNGEIAKSSAGLPLHTHATHGHAHGAISMEGDSISTQLRYRVIT  212

Query  1396  QVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTA  1575
             QVLELGI+VHSVIIGL LG S + +TIRPLL ALSFHQ FEG+GLGGCI QAKFK+ + A
Sbjct  213   QVLELGIIVHSVIIGLALGASDSPKTIRPLLAALSFHQLFEGLGLGGCITQAKFKAPAIA  272

Query  1576  VMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFM  1755
             VMA+FFSLTTPVGIA GIG+++VYN +S  ALI QGVLN+ASAGILIYMALVDLLA DFM
Sbjct  273   VMALFFSLTTPVGIAIGIGVANVYNENSPKALIVQGVLNAASAGILIYMALVDLLATDFM  332

Query  1756  KPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              PK+QNN  LQ+G +VSL+LGAG MS+LA WA
Sbjct  333   NPKMQNNGWLQIGANVSLLLGAGCMSLLAKWA  364



>gb|AFK48496.1| unknown [Lotus japonicus]
Length=338

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 183/356 (51%), Positives = 241/356 (68%), Gaps = 49/356 (14%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC  + +     S  ++L      KY++ A+ SIL+AGA GV+IP+L R +  L P+ 
Sbjct  22    ECTCEKDDD-----SGDKSLAQ----KYKVAALVSILIAGAIGVNIPVLGRHFSILRPDN  72

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D FFM+KAFAAGVILSTGF+H+LPDAF  LTSP L D +PW  FPF+G +A+ ++I TLM
Sbjct  73    DFFFMVKAFAAGVILSTGFIHVLPDAFDKLTSPCLND-HPWGDFPFTGFVAMVSAIGTLM  131

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP---PS  1344
             +D+ A ++F K   H    K  +V                           +D P    +
Sbjct  132   IDSTATAYFNKS--HSSNEKEEKV---------------------------VDLPVHTHA  162

Query  1345  NNELVHLS-------DRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSF  1503
             +N   H S         +R R +SQVLELGIVVHSVIIG+ LG S++ ETIRPL+ AL+F
Sbjct  163   SNGHAHGSTASSASTQLLRHRAISQVLELGIVVHSVIIGISLGASESPETIRPLIAALTF  222

Query  1504  HQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQG  1683
             HQFFEGMGLGGCI+QAKF++ +  VMA+FFSLTTPVGIA G+GI++ Y+ +S TALI +G
Sbjct  223   HQFFEGMGLGGCISQAKFETKAVIVMALFFSLTTPVGIAIGMGITNAYDENSQTALIVEG  282

Query  1684  VLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ++N+ASAGILIYM+LVDLLAADFM P+ Q + +LQLG ++ L+LGAG MS+LA WA
Sbjct  283   IMNAASAGILIYMSLVDLLAADFMNPRFQQSSKLQLGANLCLLLGAGCMSLLAKWA  338



>ref|XP_004243896.1| PREDICTED: zinc transporter 5-like [Solanum lycopersicum]
Length=342

 Score =   349 bits (895),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 251/366 (69%), Gaps = 29/366 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      ECTC+            E     ++ KY++ A+ASILVA 
Sbjct  6     FWYILLVLPTIVLG------ECTCD---------PEDEDRNKSEAFKYKMAALASILVAS  50

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PE++ FF+IKAFAAGVILSTGF+H+LPDAF++LTSP L + +P
Sbjct  51    AVGVCIPVLGKVIPALSPERNFFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLPE-HP  109

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPF G +A+ +++ATLMVDT A S++ KK +          +   +E        H 
Sbjct  110   WGDFPFCGFVAMVSAMATLMVDTYATSYYNKKNLKNGVVG----TEVGDEGGVGHTHSHA  165

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
             H H   +  + +D   SN+EL      +R RV+SQVLELGI+VHSVIIG+ LG S++ +T
Sbjct  166   HAHAHGSTTMMVD---SNSEL------LRYRVISQVLELGIIVHSVIIGIALGASESPKT  216

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PL+ AL+FHQFFEGMGLGGCIAQAK K     +MA+FFSLTTPVGI  G+GI++VY+ 
Sbjct  217   IKPLVAALTFHQFFEGMGLGGCIAQAKLKCREITIMALFFSLTTPVGIGIGLGITNVYDE  276

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI QG+ +SASAGILIYMALVD LAADFM P++Q N +LQLG +VSL+LGAG MS
Sbjct  277   NSPTALIVQGIFDSASAGILIYMALVDFLAADFMNPRMQGNGKLQLGANVSLLLGAGLMS  336

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  337   MLAKWA  342



>ref|XP_008378335.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 8-like [Malus 
domestica]
Length=351

 Score =   348 bits (894),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 196/371 (53%), Positives = 254/371 (68%), Gaps = 34/371 (9%)
 Frame = +1

Query  751   SFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVA  930
             +F+ ++   P  + G      ECTC    EG    +  E      +LKY++ AIASILVA
Sbjct  11    AFFCLLFILPTLVFG------ECTCEKG-EGDGBRNKXE------ALKYKIGAIASILVA  57

Query  931   GAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTN  1110
             GA GV IP+L +    L P+++IFF+IKAFAAGVIL+TGF+H+LPDAF++LT P LK+ N
Sbjct  58    GAVGVGIPILGKTIPALHPDRNIFFIIKAFAAGVILATGFIHVLPDAFESLTDPALKE-N  116

Query  1111  PWAKFPFSGLIALTASIATLMVDTLAMSFFR----KKMMHFDKTKLPQVSadeeeakdaa  1278
             PW KFPF+G +A+ A+I TLMVD+ A S++     K  ++ D+ K  +            
Sbjct  117   PWGKFPFTGFVAMMAAIGTLMVDSYATSYYSRSHFKNNINADEEKAQE---------HEG  167

Query  1279  aadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTS  1458
                         A   +D  PS       ++ +R RV+SQVLELGIVVHSVIIG+ LG S
Sbjct  168   HVHVHTHATHGHAHGAVDTSPS-------AELLRHRVISQVLELGIVVHSVIIGISLGAS  220

Query  1459  QTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGIS  1638
             ++ +TI+PL+ ALSFHQFFEGMGLGGCI QAKFK+ + A+M++FFSLTTPVGI  GIGIS
Sbjct  221   ESPKTIKPLVAALSFHQFFEGMGLGGCITQAKFKNRAVAIMSLFFSLTTPVGIGIGIGIS  280

Query  1639  SVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLG  1818
             +VY+  S TALI +GV N+ASAGILIYM+LVDLLAADFM PK+Q N RLQ G ++SL+LG
Sbjct  281   NVYDESSPTALIMEGVFNAASAGILIYMSLVDLLAADFMNPKMQRNGRLQAGANLSLLLG  340

Query  1819  AGSMSVLAMWA  1851
             AG MS+LA WA
Sbjct  341   AGCMSLLAKWA  351



>ref|XP_004303952.1| PREDICTED: zinc transporter 1-like [Fragaria vesca subsp. vesca]
Length=353

 Score =   348 bits (893),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 246/346 (71%), Gaps = 18/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   EG             ++LKY+L AIASILVAGA GV IP++ +    L PEK
Sbjct  26    ECTCDAEEEGGNRS---------EALKYKLGAIASILVAGAIGVCIPIIGKTIPSLQPEK  76

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
              IFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK+ NPWA FPF+G +A+ A+I TLM
Sbjct  77    PIFFIIKAFAAGVILATGFIHVLPDAFERLTSPCLKE-NPWANFPFTGFVAMMAAIGTLM  135

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD++A S+F +   HF K +      +E+  +               +   LD   + ++
Sbjct  136   VDSIATSYFNRS--HFKKAQNHVNGDEEKVGEHEGHVHVHTHGTHGHSHGSLDTNSAESQ  193

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
             L      +R RV+S+VLELGIVVHSVIIG+ LG S++  T+RPL+ AL+FHQFFEGMGLG
Sbjct  194   L------LRHRVISKVLELGIVVHSVIIGISLGASESPATVRPLVAALTFHQFFEGMGLG  247

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCIAQA+   ++T +M +FFSLTTPVGI  GIGISS Y  +SSTALI +G+ ++ASAGIL
Sbjct  248   GCIAQARESRLTTIIMVLFFSLTTPVGIGIGIGISSRYKENSSTALILEGLFDAASAGIL  307

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM PK+Q NV+LQ+G +VSL+ GAG MS++A WA
Sbjct  308   IYMALVDLLAADFMNPKMQKNVKLQVGANVSLLFGAGCMSLIAKWA  353



>ref|XP_008357510.1| PREDICTED: zinc transporter 8-like, partial [Malus domestica]
Length=338

 Score =   348 bits (892),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 248/351 (71%), Gaps = 30/351 (9%)
 Frame = +1

Query  814   ECTCN-GNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ECTC  G  +G  + S        ++LKY++ AIASILVAGA GV IP+L +    L P+
Sbjct  13    ECTCEKGEGDGDRNKS--------EALKYKIGAIASILVAGAVGVGIPILGKTIPALHPD  64

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             ++IFF+IKAFAAGVIL+TGF+H+LPDAF++LT P LK+ NPW KFPF+G +A+ A+I TL
Sbjct  65    RNIFFIIKAFAAGVILATGFIHVLPDAFESLTDPALKE-NPWGKFPFTGFVAMMAAIGTL  123

Query  1171  MVDTLAMSFFR----KKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             MVD+ A S++     K  ++ D+ K  +                        A   +D  
Sbjct  124   MVDSYATSYYSRSHFKNNINADEEKAQE---------HEGHVHVHTHATHGHAHGAVDTS  174

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
             PS       ++ +R RV+SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFE
Sbjct  175   PS-------AELLRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFFE  227

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             GMGLGGCI QAKFK+ + A+M++FFSLTTPVGI  GIGIS+VY+  S TALI +GV N+A
Sbjct  228   GMGLGGCITQAKFKNRAVAIMSLFFSLTTPVGIGIGIGISNVYDESSPTALIMEGVFNAA  287

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVDLLAADFM PK+Q N RLQ G ++SL+LGAG MS+LA WA
Sbjct  288   SAGILIYMSLVDLLAADFMNPKMQRNGRLQAGANLSLLLGAGCMSLLAKWA  338



>ref|XP_009610335.1| PREDICTED: zinc transporter 5 [Nicotiana tomentosiformis]
Length=341

 Score =   347 bits (891),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 256/366 (70%), Gaps = 33/366 (9%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      ECTC+         S +E     ++LKY++VA+ASILVA 
Sbjct  9     FWYILVLLPAIVLG------ECTCD---------SDEEERNKTEALKYKMVAVASILVAS  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PEK++FF+IKAFAAGVIL+TGF+H+LPDA+++LTSP LK+ NP
Sbjct  54    ALGVCIPVLGKAIPALSPEKNLFFIIKAFAAGVILATGFIHVLPDAYKSLTSPYLKE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPFSG IA+ +++ATLMVDT A S+++ K       K   V+   +E      +   
Sbjct  113   WGDFPFSGFIAMVSAMATLMVDTYATSYYKNK-----SAKNGVVAQSGDEELVNVHSHGH  167

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                  +          S++EL      +R RV+SQVLE+GI+VHSVIIG+ LG S++ +T
Sbjct  168   VHGSTSMIG------DSDSEL------LRYRVISQVLEVGIIVHSVIIGIALGASESPKT  215

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQFFEGMGLGGCIAQAKFK+ + A+M +FFSLTTP+GI  G+GI++ Y+ 
Sbjct  216   IRPLVAALTFHQFFEGMGLGGCIAQAKFKTRAVAIMTLFFSLTTPIGIGIGLGITNSYDE  275

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +GV NSASAGILIYMALVD LAADFM P++Q N +LQLG ++SL+LGAG MS
Sbjct  276   NSPTALIVEGVFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMS  335

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  336   LLAKWA  341



>ref|XP_008383275.1| PREDICTED: zinc transporter 1-like [Malus domestica]
Length=358

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 246/361 (68%), Gaps = 23/361 (6%)
 Frame = +1

Query  772   FFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSI  951
             F P ++S      +EC CN        +           LK++L+AI+SIL+A   GVS+
Sbjct  20    FVPISVS------AECECNSETLDHDKF---------KVLKFKLLAISSILIASFLGVSL  64

Query  952   PLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPF  1131
             P+L +K   L PE DIFF+IKAFAAGVIL+TGF+H+LPDAF++L SP L +T PW  FPF
Sbjct  65    PMLGKKIPALNPENDIFFVIKAFAAGVILATGFIHVLPDAFESLRSPCLSET-PWGSFPF  123

Query  1132  SGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadhmhrhga  1308
             +G IA+ ++I T+M+DT A S++R+     D TK LP    +E                 
Sbjct  124   TGFIAMLSAIGTMMIDTFATSYYRRS----DFTKALPVKEDEEMNGLHEGHVHVHTHATH  179

Query  1309  aaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLL  1488
               A       P ++  +   + +R RV+SQVLELGI+VHSVIIG+ LG SQ+ +TI+PL+
Sbjct  180   GHAHGSGAIAPEDS--ISSFEIVRHRVISQVLELGILVHSVIIGISLGASQSPKTIKPLV  237

Query  1489  VALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTA  1668
              AL+FHQFFEGMGLGGCI QA FKS + A M +FFS TTP+GI  G+GIS++YN  S +A
Sbjct  238   AALTFHQFFEGMGLGGCITQANFKSRAIAAMVLFFSFTTPIGIGVGMGISNIYNETSPSA  297

Query  1669  LITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMW  1848
             LI +GV NSASAGILIYMALVDLLAADFM P++Q+N+R+Q+G ++SL+LG+G MS+LA W
Sbjct  298   LIVEGVFNSASAGILIYMALVDLLAADFMNPRMQSNLRIQVGANISLLLGSGCMSLLAKW  357

Query  1849  A  1851
             A
Sbjct  358   A  358



>emb|CAN83128.1| hypothetical protein VITISV_029536 [Vitis vinifera]
 gb|AFG19376.1| zinc transporter protein [Vitis vinifera]
Length=348

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 206/380 (54%), Positives = 255/380 (67%), Gaps = 38/380 (10%)
 Frame = +1

Query  709   LQFPFRYSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDS  888
             LQF + Y +  I +   ++I+F P  +S      S CTC    E Q    +    VT   
Sbjct  4     LQF-YPYRILTISS---LLILFQPLLVS------SLCTC----ETQHKDQNASQAVT---  46

Query  889   LKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPD  1068
               Y+LVAIASILV+ A GV +PLL +    L PEK I+F+IKAFAAGVIL+TGF+HILPD
Sbjct  47    --YKLVAIASILVSSAIGVCLPLLLKNVPSLRPEKAIYFLIKAFAAGVILATGFLHILPD  104

Query  1069  AFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVS  1248
             A+ +L SP L + NPW  FPF+G IA+ A+I TLM++  A  + R+  +     K   V+
Sbjct  105   AYDSLKSPCLSE-NPWGGFPFTGFIAMMAAILTLMMEAFATGYHRRSELR----KAQPVN  159

Query  1249  adeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHS  1428
              DEE   D A   H                    E  + SD IR RVVSQVLELGIVVHS
Sbjct  160   GDEESDGDHAGHVHGSAFVL--------------ERSNSSDLIRHRVVSQVLELGIVVHS  205

Query  1429  VIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTP  1608
             VIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGLGGCI+QAK+K  +T +M +FFSLTTP
Sbjct  206   VIIGISLGASESPKTIKPLVAALSFHQFFEGMGLGGCISQAKYKIKATIIMVLFFSLTTP  265

Query  1609  VGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQ  1788
              GIA G+GIS +Y+ +S TALI QGVLNSASAGILIYMALVDLLA DFM PK+Q+NVRLQ
Sbjct  266   TGIAVGLGISKIYDENSPTALIVQGVLNSASAGILIYMALVDLLATDFMNPKMQSNVRLQ  325

Query  1789  LGGHVSLVLGAGSMSVLAMW  1848
             LG + +L+LGA SMSVLA W
Sbjct  326   LGAYATLLLGAASMSVLAKW  345



>ref|XP_004231600.1| PREDICTED: zinc transporter 8-like [Solanum lycopersicum]
Length=347

 Score =   347 bits (889),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 246/357 (69%), Gaps = 33/357 (9%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             A   SECTC+ + + +           +++LKY+LVA+ASIL+AGA GVSIP+L +    
Sbjct  18    ALVSSECTCDEDADDR---------DKIEALKYKLVAVASILIAGAIGVSIPILGKVIPA  68

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
               PE ++FF+IKAFAAGVIL TGFVHILPDAF++L+SP L +  PW  FPF+G IA+ +S
Sbjct  69    FRPENNVFFLIKAFAAGVILGTGFVHILPDAFESLSSPCLPE-KPWGDFPFAGFIAMISS  127

Query  1159  IATLMVDTLAMSFFR------KKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaa  1320
             I T+MVD LA SF++      +K ++ D+ K   V           +             
Sbjct  128   IGTMMVDLLATSFYKNSNLTKQKPVNSDEEKEVHVHTHSTHGHAHGS-------------  174

Query  1321  VYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALS  1500
             V L     N+EL    D  R+RV+SQVLELGI+VHSVIIG+ LG S++ +TI+PL+ AL+
Sbjct  175   VMLTSSEGNDEL----DLSRRRVISQVLELGILVHSVIIGVSLGASESPKTIKPLVAALT  230

Query  1501  FHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQ  1680
             FHQ FEGMGLGGCIA+AKFK    A+MA+FFSLTTP+GIA G GIS+VY+  S TAL+ +
Sbjct  231   FHQLFEGMGLGGCIAEAKFKIKKAALMAIFFSLTTPIGIAIGFGISTVYSETSPTALMVE  290

Query  1681  GVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             G+ NSA+AGILIYMALVDLLAADFM  ++Q++ +L +G ++ L+ GAG MS+LA WA
Sbjct  291   GIFNSAAAGILIYMALVDLLAADFMSSRMQDSPKLLMGANIFLLFGAGCMSLLAKWA  347



>gb|AES71719.2| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=349

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 237/322 (74%), Gaps = 10/322 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+LP
Sbjct  38    ALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLP  97

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    QV
Sbjct  98    DAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQV  153

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
              +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+VH
Sbjct  154   ESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIVH  207

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LTT
Sbjct  208   SVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTT  267

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+GIS+VY+ +S TALI +G+ N+ASAGILIYMALVDLLAADFM P++Q N RL
Sbjct  268   PVGIGIGLGISNVYDENSPTALIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNGRL  327

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QLG ++SL+LGAG MS++A WA
Sbjct  328   QLGSNISLLLGAGCMSLIAKWA  349



>ref|XP_009340286.1| PREDICTED: zinc transporter 1-like [Pyrus x bretschneideri]
Length=359

 Score =   347 bits (890),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/350 (53%), Positives = 241/350 (69%), Gaps = 15/350 (4%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             +A  EC CN        +           LK++LVAI+SIL+A   GVS+P+L +K   L
Sbjct  25    SASVECECNSETLDHDKF---------KVLKFKLVAISSILMASFLGVSLPMLGKKIPAL  75

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
               E DIFF+IKAFAAGVIL+TGF+H+LPDAF++L SP L +T  W  FPF+G IA+ ++I
Sbjct  76    NTENDIFFLIKAFAAGVILATGFIHVLPDAFESLRSPCLSET-LWDSFPFTGFIAMLSAI  134

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
              T+M+DT A S++R+   HF K  LP    +E                   A       P
Sbjct  135   GTMMIDTFATSYYRRS--HFTKA-LPVKEDEEMNGVHQGHVHVHAHATHGHAHGSGAIAP  191

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
              ++  +   + +R RV+SQVLELGI+VHSVIIG+ LG SQ+ +TI+PL+ AL+FHQFFEG
Sbjct  192   EDS--ISSFEIVRNRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFHQFFEG  249

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI QA FKS + A M +FFSLTTP+GI  G+GIS++YN  S +ALI +GV NSAS
Sbjct  250   MGLGGCITQANFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNKTSPSALIVEGVFNSAS  309

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYMALVDLLAADFM P++Q+N+R+QLG +VSL+LG+G MS+LA WA
Sbjct  310   AGILIYMALVDLLAADFMNPRMQSNLRIQLGANVSLLLGSGCMSLLAKWA  359



>ref|XP_003601469.1| Zinc transporter [Medicago truncatula]
 gb|AES71720.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=372

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 237/322 (74%), Gaps = 10/322 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+LP
Sbjct  61    ALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLP  120

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    QV
Sbjct  121   DAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQV  176

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
              +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+VH
Sbjct  177   ESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIVH  230

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LTT
Sbjct  231   SVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTT  290

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+GIS+VY+ +S TALI +G+ N+ASAGILIYMALVDLLAADFM P++Q N RL
Sbjct  291   PVGIGIGLGISNVYDENSPTALIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNGRL  350

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QLG ++SL+LGAG MS++A WA
Sbjct  351   QLGSNISLLLGAGCMSLIAKWA  372



>ref|XP_011100401.1| PREDICTED: zinc transporter 8-like [Sesamum indicum]
Length=342

 Score =   347 bits (889),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 190/346 (55%), Positives = 249/346 (72%), Gaps = 22/346 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC    E +      + L    +LKY+L AIASILVA A GV +P+  ++   L PE+
Sbjct  19    DCTCEPEDEDR-----NKAL----ALKYKLAAIASILVASAIGVCLPVAGKRVPALSPER  69

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
               FF++KAFAAGVILSTGF+H+LPDAF++LTSP L D +PW  FPF+G IA+ +++ TLM
Sbjct  70    SFFFIVKAFAAGVILSTGFIHVLPDAFESLTSPCLSD-HPWGDFPFAGFIAMLSAVGTLM  128

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT A S+++++       K     ADEEEA         H H   + ++ LD      E
Sbjct  129   VDTYATSYYQRRA----GAKAEMGGADEEEAVVPFHTHATHGHAHGSLSLELDS--GETE  182

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
             L      +R RV+SQVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEG+GLG
Sbjct  183   L------LRHRVISQVLELGIIVHSVIIGIALGASESPKTIRPLIAALTFHQFFEGIGLG  236

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKF + + A+MA+FFS+TTP+GIA GIGIS++Y+  S TALI +GV N+ASAGIL
Sbjct  237   GCITQAKFNTRAVAIMALFFSITTPMGIAVGIGISNIYSETSPTALIVEGVFNAASAGIL  296

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLL+ADFM PK+Q+N +LQLG +VSL++GAG MS+LA WA
Sbjct  297   IYMALVDLLSADFMSPKLQSNGKLQLGANVSLLIGAGCMSLLAKWA  342



>ref|XP_003601470.1| Zinc transporter [Medicago truncatula]
 gb|AES71721.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=377

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 237/322 (74%), Gaps = 10/322 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+LP
Sbjct  66    ALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLP  125

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    QV
Sbjct  126   DAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQV  181

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
              +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+VH
Sbjct  182   ESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIVH  235

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LTT
Sbjct  236   SVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTT  295

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+GIS+VY+ +S TALI +G+ N+ASAGILIYMALVDLLAADFM P++Q N RL
Sbjct  296   PVGIGIGLGISNVYDENSPTALIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNGRL  355

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QLG ++SL+LGAG MS++A WA
Sbjct  356   QLGSNISLLLGAGCMSLIAKWA  377



>ref|XP_009775150.1| PREDICTED: zinc transporter 5-like [Nicotiana sylvestris]
Length=342

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 197/366 (54%), Positives = 258/366 (70%), Gaps = 32/366 (9%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      ECTC+         S  E     ++LKY++VA+ASILVA 
Sbjct  9     FWYILVLLPAIVLG------ECTCD---------SEDEERNKAEALKYKMVAVASILVAS  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PEK++FF+IKAFAAGVILSTGF+H+LPDA+++LTSP LK+ NP
Sbjct  54    ALGVCIPVLGKAIPALSPEKNLFFIIKAFAAGVILSTGFIHVLPDAYESLTSPCLKE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPFSG IA+ +++ATLMVDT A S+++ K +   K  +   S DEE      +  H 
Sbjct  113   WGDFPFSGFIAMVSAMATLMVDTYATSYYKNKSV---KNGVVAQSGDEEGVIHVHSHGHA  169

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
             H   +           S++EL      +R RV+SQVLELGI+VHSVIIG+ LG S++ +T
Sbjct  170   HGSTSMIG-------DSDSEL------LRYRVISQVLELGIIVHSVIIGIALGASESPKT  216

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQFFEGMGLGGCIAQAKFK+ +  +M +FFSLTTP+GI  G+GI++ Y+ 
Sbjct  217   IRPLVGALTFHQFFEGMGLGGCIAQAKFKNRAVVIMTLFFSLTTPIGIGIGLGITNSYDE  276

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +GV NSASAGILIYMALVD LAADFM P++Q N +LQLG ++SL+LGAG MS
Sbjct  277   NSPTALIVEGVFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMS  336

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  337   LLAKWA  342



>ref|XP_010275878.1| PREDICTED: zinc transporter 5-like [Nelumbo nucifera]
Length=357

 Score =   346 bits (888),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 242/349 (69%), Gaps = 22/349 (6%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A  ECTC+          ++E      SLKY++  + +IL A A GV IP+L + +  L 
Sbjct  31    ASGECTCD---------PTEEEHDKATSLKYKIAGMVAILSASAIGVCIPVLGKSFPPLR  81

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             P+ DIFFMIKAFAAGVIL+TGF+HILPDAF+ LTSP LK    W  FPF+G +A+ + I 
Sbjct  82    PDNDIFFMIKAFAAGVILATGFIHILPDAFEKLTSPCLKG-KVWENFPFTGFVAMMSGII  140

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLMVDT+A S+F++  +HF+K++   V  +           H H     +          
Sbjct  141   TLMVDTIATSYFQR--LHFNKSQPLSVDQETGGEHAGHLHVHTHATHGHSHGSDSS----  194

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                    S+ +R R++SQVLELGIVVHSVIIG+ LG S++  TIRPL+ AL+FHQFFEG+
Sbjct  195   ------SSELLRHRIISQVLELGIVVHSVIIGISLGASESPSTIRPLVAALTFHQFFEGI  248

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI QA+FK  +  VM +FFSLTTPVGIA G+GI+++Y+ ++STAL  +GVL+SA+A
Sbjct  249   GLGGCITQARFKRRAVVVMTLFFSLTTPVGIAVGLGITNIYDENTSTALSVEGVLDSAAA  308

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM P++Q+N RLQ+G ++SL++GAG MSVLA WA
Sbjct  309   GILIYMALVDLLAADFMNPRMQSNGRLQIGAYISLLIGAGCMSVLAKWA  357



>ref|XP_009769157.1| PREDICTED: zinc transporter 5-like [Nicotiana sylvestris]
Length=343

 Score =   345 bits (886),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 200/366 (55%), Positives = 259/366 (71%), Gaps = 31/366 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      ECTC+         S  E     ++LKY++VAIASIL+A 
Sbjct  9     FWYILLLLPAIVLG------ECTCD---------SEDEERNKPEALKYKMVAIASILIAS  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PEK+ FF+IKAFAAGVIL+TGF+H+LPDAF++LTSP LK+ NP
Sbjct  54    AIGVCIPVLGKAIPALSPEKNFFFIIKAFAAGVILATGFIHVLPDAFESLTSPCLKE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPFSG IA+ +++ TLMVDT A S+F  K    + TK   V+   +E        H 
Sbjct  113   WGNFPFSGFIAMVSAMGTLMVDTYATSYFSNK----NDTKNGLVAQSGDEGGAIHVHSHG  168

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
             H HG+++                 S+ +R RVVSQVLE+GI+VHSVIIG+ LG S++ +T
Sbjct  169   HAHGSSSLLGDS-----------SSELLRYRVVSQVLEMGIIVHSVIIGIALGASESPKT  217

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQFFEGMGLGGCIAQAKFK+ + A+MA+FFSLTTPVGIA G+GI++VY+ 
Sbjct  218   IRPLVGALTFHQFFEGMGLGGCIAQAKFKTRAVAIMALFFSLTTPVGIAIGLGITNVYDE  277

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +GV NSASAGILIYMALVD LAADFM P++Q N +LQLG +VSL+LGAG M+
Sbjct  278   NSPTALIVEGVFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANVSLLLGAGLMA  337

Query  1834  VLAMWA  1851
             ++A WA
Sbjct  338   LIAKWA  343



>gb|ADF43066.1| zinc transporter protein [Ammopiptanthus nanus]
Length=356

 Score =   346 bits (887),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 243/354 (69%), Gaps = 37/354 (10%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC  + E        ++L    ++KY++ A+ASILVA A GVSIP+L + +  L PEK
Sbjct  32    DCTCEEDKE----EPGDKSL----AVKYKVAALASILVASAIGVSIPMLGKTFPALRPEK  83

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D FF+IKAFAAGVILSTGF+H+LPDAF  LTSP L D +PW   PF+G +A+ ++I TLM
Sbjct  84    DFFFIIKAFAAGVILSTGFIHVLPDAFDKLTSPRLSD-HPWGDLPFTGFVAMISAIGTLM  142

Query  1174  VDTLAMSFFRKKMMHF--------DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYL  1329
             VD+LA ++F K   HF        D+ K+ QV  D       A   H H           
Sbjct  143   VDSLATAYFNKS--HFKDKDQVVADEEKVEQVHGDHLHLHTHATHGHAHGSI--------  192

Query  1330  DPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
                PS       +D +R RV+SQVLE+GIVVHSVIIG+ LG S++ +TIRPL+ AL+FHQ
Sbjct  193   ---PS-------TDLLRHRVISQVLEIGIVVHSVIIGISLGASESPKTIRPLIAALTFHQ  242

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
             FFEGMGLGGCI QAKFK  +  +MA+FFSLTTPVGIA G+ I+  Y+ +S TALI +G+L
Sbjct  243   FFEGMGLGGCIYQAKFKIKAVIIMALFFSLTTPVGIAIGLAITGAYDENSPTALIVEGIL  302

Query  1690  NSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             N+ASAGILIYM+LVDLLAADFM  +IQ + RLQ G  VSL+LGAG MS+LA WA
Sbjct  303   NAASAGILIYMSLVDLLAADFMNSRIQGSGRLQFGASVSLLLGAGCMSLLAKWA  356



>gb|AAX28838.1| zinc transporter protein ZIP2 [Fragaria x ananassa]
Length=353

 Score =   345 bits (884),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 189/346 (55%), Positives = 248/346 (72%), Gaps = 18/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+   EG    S++      ++LKY+L AIASILVAGA GV IP++ +    L PEK
Sbjct  26    KCTCDTEEEG----SNRS-----EALKYKLGAIASILVAGAIGVCIPIIGKTIPSLQPEK  76

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
              IFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK+ NPWA FPF+G +A+ A+I TLM
Sbjct  77    PIFFIIKAFAAGVILATGFIHVLPDAFERLTSPCLKE-NPWANFPFTGFVAMMAAIGTLM  135

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD++A S+F +   HF K +      +E+  +               +   LD   + ++
Sbjct  136   VDSIATSYFNRS--HFKKAQNHVNGDEEKVGEHEGHVHVHTHGTHGHSHGSLDTNSAESQ  193

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
             L      +R RV+S+VLELGIVVHSVIIG+ LG S++  T+RPL+ AL+FHQFFEGMGLG
Sbjct  194   L------LRHRVISKVLELGIVVHSVIIGISLGASESPATVRPLVAALTFHQFFEGMGLG  247

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCIAQA+   ++T +M +FFSLTTPVGI  GIGISS Y  +S TALI +G+ ++ASAGIL
Sbjct  248   GCIAQARESQLTTIIMVLFFSLTTPVGIGIGIGISSRYEENSPTALILEGLFDAASAGIL  307

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM PK+Q N++LQ+G +VSL+ GAG MS++A WA
Sbjct  308   IYMALVDLLAADFMNPKMQKNIKLQVGANVSLLFGAGCMSLIAKWA  353



>ref|XP_009379338.1| PREDICTED: zinc transporter 8-like [Pyrus x bretschneideri]
 ref|XP_009379339.1| PREDICTED: zinc transporter 8-like [Pyrus x bretschneideri]
Length=350

 Score =   344 bits (883),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 258/368 (70%), Gaps = 29/368 (8%)
 Frame = +1

Query  751   SFYIIIIFFPCAISGTAAAESECTCN-GNVEGQLHYSSKETLVTVDSLKYRLVAIASILV  927
             +F+ ++   P  + G      ECTC  G  +G  + +        ++LKY++ AIASILV
Sbjct  11    AFFCLLFILPTLVFG------ECTCEKGEGDGDRNKT--------EALKYKIGAIASILV  56

Query  928   AGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDT  1107
             AGA GV IP+L +    L P+++IFF+IKAFAAGVIL+TGF+H+LPDAF++LT P LK+ 
Sbjct  57    AGALGVGIPILGKTIPDLHPDRNIFFIIKAFAAGVILATGFIHVLPDAFESLTDPALKE-  115

Query  1108  NPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaad  1287
             NPW KFPF+G +A+ A+I TLMVD+ A S++ +  +         +  DEE A++    D
Sbjct  116   NPWGKFPFTGFVAMMAAIGTLMVDSCATSYYSRSHLK------NNIDGDEERAQEHEGHD  169

Query  1288  hmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTR  1467
                      A   +D  PS       ++ +R RV+SQVLELGIVVHSVIIG+ LG S++ 
Sbjct  170   VHTHTTHGHAHGAIDTSPS-------TELLRHRVISQVLELGIVVHSVIIGISLGASESP  222

Query  1468  ETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVY  1647
             +TI+PLLVALSFHQFFEGMGLGGCI QAKFK+ +  +M++FFSLTTPVGI  GIGIS  Y
Sbjct  223   KTIKPLLVALSFHQFFEGMGLGGCITQAKFKNRAVVIMSLFFSLTTPVGIGIGIGISKFY  282

Query  1648  NPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGS  1827
             +  S T LI +GV N+ASAGILIYM+LVDLLAADFMKPK+Q+N +LQ G ++SL+LGAG 
Sbjct  283   DGSSQTVLIMEGVFNAASAGILIYMSLVDLLAADFMKPKMQSNGKLQAGANISLLLGAGC  342

Query  1828  MSVLAMWA  1851
             MS+LA WA
Sbjct  343   MSLLAKWA  350



>ref|XP_009363337.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 1-like, partial 
[Pyrus x bretschneideri]
Length=335

 Score =   343 bits (881),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 233/324 (72%), Gaps = 12/324 (4%)
 Frame = +1

Query  883   DSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHIL  1062
             D+L+Y+L +IASILVAG+ GVS+PLL +K   L PEKDIFF+ K FAAGVIL+ GFVHIL
Sbjct  23    DALRYKLGSIASILVAGSVGVSLPLLGKKIPTLTPEKDIFFLNKVFAAGVILAIGFVHIL  82

Query  1063  PDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQ  1242
             PDAF  LTSP +K+ NPW KFPF+G + + ++  TLMVD+LA  ++++  +  ++  + +
Sbjct  83    PDAFDNLTSPCIKE-NPWGKFPFTGFVTMLSATGTLMVDSLAPGYYQRSNVKSNQVTIHE  141

Query  1243  VSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVV  1422
             + + +++             G A  +  L  P          + IR RV SQVLELGI+V
Sbjct  142   LESSDDDHAGHVHGHTHSTQGHAHGSEELKSP----------ELIRHRVFSQVLELGILV  191

Query  1423  HSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLT  1602
             HSVIIG+ LG S + ETI+PL+VALSFHQFFEGMGLGGCI+ AKFKS S  VMA FFSLT
Sbjct  192   HSVIIGISLGASPSPETIKPLIVALSFHQFFEGMGLGGCISMAKFKSRSAMVMATFFSLT  251

Query  1603  TPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKI-QNNV  1779
             TP GIA G+ IS+VYN +S TALI    LN+AS GILIYMALVDLLAADFM P+I Q N+
Sbjct  252   TPAGIAVGVRISTVYNVNSRTALIVXRTLNAASGGILIYMALVDLLAADFMNPRIMQGNL  311

Query  1780  RLQLGGHVSLVLGAGSMSVLAMWA  1851
             ++QLG + SL+LG G MS+LA WA
Sbjct  312   KIQLGAYSSLLLGTGCMSLLAKWA  335



>ref|XP_010676218.1| PREDICTED: zinc transporter 1-like [Beta vulgaris subsp. vulgaris]
Length=363

 Score =   345 bits (884),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 255/366 (70%), Gaps = 17/366 (5%)
 Frame = +1

Query  769   IFFPCA--ISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSL-KYRLVAIASILVAGAA  939
             +FFP    ++ +   +   TCN +      Y +    ++VDSL K ++ AI +ILVA   
Sbjct  10    VFFPLDQILTTSLLTQQNTTCNCD------YVTHN--LSVDSLLKTKIAAIVAILVASGV  61

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GV++P++ +    L PE  +FF+IK+FAAGVILSTGFVHILPDAF+ L+ P L DT PW 
Sbjct  62    GVTLPIVGKNLPILHPESKLFFLIKSFAAGVILSTGFVHILPDAFENLSDPSLSDT-PWG  120

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+GL A+  ++ +LM+D +A   +R+   HF +     + A ++E +   A+     
Sbjct  121   KFPFTGLAAMLGALGSLMIDAVATGHYRRA--HFGQHSASSIGAVDDETRGDHASHVHLH  178

Query  1300  hgaaaaaVYLDPPPSNNELVHLSD--RIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
               A     +  P P +  L  LSD  RIR +V SQVLELGIVVHS+IIG+ LGTSQ+ +T
Sbjct  179   THATHGHAHG-PGPMDANLDGLSDFDRIRYKVTSQVLELGIVVHSIIIGISLGTSQSLDT  237

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PL+VAL FHQFFEG+GLGGCIAQA F+S ST  MA+FFSLTTPVG+A GIGI++VY+ 
Sbjct  238   IKPLIVALCFHQFFEGIGLGGCIAQAAFRSGSTMCMALFFSLTTPVGVAIGIGITNVYDD  297

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
              S TAL+ QG+LNS +AGILIYMALVDLLA DFM PK+Q N RL +G +V+L+LGAG M+
Sbjct  298   SSPTALVVQGLLNSVAAGILIYMALVDLLAQDFMNPKVQTNTRLFVGANVTLLLGAGVMA  357

Query  1834  VLAMWA  1851
             +LA+WA
Sbjct  358   LLAIWA  363



>ref|XP_003601468.1| Zinc transporter [Medicago truncatula]
Length=440

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 237/323 (73%), Gaps = 10/323 (3%)
 Frame = +1

Query  883   DSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHIL  1062
              +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+L
Sbjct  128   KALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVL  187

Query  1063  PDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQ  1242
             PDAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    Q
Sbjct  188   PDAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQ  243

Query  1243  VSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVV  1422
             V +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+V
Sbjct  244   VESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIV  297

Query  1423  HSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLT  1602
             HSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LT
Sbjct  298   HSVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALT  357

Query  1603  TPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVR  1782
             TPVGI  G+GIS+VY+ +S TALI +G+ N+ASAGILIYMALVDLLAADFM P++Q N R
Sbjct  358   TPVGIGIGLGISNVYDENSPTALIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNGR  417

Query  1783  LQLGGHVSLVLGAGSMSVLAMWA  1851
             LQLG ++SL+LGAG MS++A WA
Sbjct  418   LQLGSNISLLLGAGCMSLIAKWA  440



>ref|XP_008812441.1| PREDICTED: zinc transporter 3-like [Phoenix dactylifera]
Length=417

 Score =   346 bits (888),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 247/347 (71%), Gaps = 10/347 (3%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ++C C  N EGQ          T ++LK + +AIASIL AGAAGV IP+L R    L PE
Sbjct  81    ADCECTTNPEGQ---------DTQEALKLKFIAIASILTAGAAGVLIPILGRSVAALRPE  131

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              D+FF+IKAFAAGVIL+TG +HILP AF++LTSP LK+ +PW  FP +G +A+ ++I T+
Sbjct  132   NDVFFVIKAFAAGVILATGLIHILPAAFESLTSPCLKE-DPWHHFPVAGFVAMLSAIGTM  190

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             +VD+ A S++R+  +   +        + +E   A  A+H+H H  A         P + 
Sbjct  191   VVDSFATSYYRRSHISKARPVEEDEGRNGDEEYSADLAEHVHVHTHATHGHAHGSVPVSP  250

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             E   L++RIR R++SQVLELGIVVHS+IIG+ LG S+   TIRPLL ALSFHQFFEG+GL
Sbjct  251   EEASLAERIRHRIISQVLELGIVVHSLIIGISLGASERPSTIRPLLGALSFHQFFEGIGL  310

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI QA F++ +T VMAVFFSLT P+GI+ GI ISS Y  +SS ALI +G+ NSASAGI
Sbjct  311   GGCIVQANFRAKATVVMAVFFSLTAPIGISLGIAISSSYEENSSIALIVEGIFNSASAGI  370

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADF  PK+QNN RLQLG H++L+LGAG MS++A WA
Sbjct  371   LIYMALVDLLAADFTNPKMQNNGRLQLGTHLALLLGAGLMSIIAKWA  417



>gb|ABH01187.1| zinc transporter protein [Ammopiptanthus mongolicus]
Length=356

 Score =   343 bits (881),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 190/354 (54%), Positives = 242/354 (68%), Gaps = 37/354 (10%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC  + E        ++L    ++KY++ A+ASILVA A GVSIP+L + +  L PEK
Sbjct  32    DCTCEEDKE----EPGDKSL----AVKYKVAALASILVASAIGVSIPMLGKTFPALRPEK  83

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D FF++KAFAAGVILS GF+H+LPDAF  LTSP L D +PW  FPF+G +A+ ++I TLM
Sbjct  84    DFFFIVKAFAAGVILSAGFIHVLPDAFDKLTSPRLSD-HPWGDFPFTGFVAMISAIGTLM  142

Query  1174  VDTLAMSFFRKKMMHF--------DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYL  1329
             VD+LA ++F K   HF        D+ K+ QV  D       A   H H           
Sbjct  143   VDSLATAYFNKS--HFKDKDQVVADEEKVEQVHGDHLHLHTHATHGHAHGSI--------  192

Query  1330  DPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
                PS       +D +R RV+SQVLE+GIVVHSVIIG+ LG S++ +TIRPL+ AL+FHQ
Sbjct  193   ---PS-------TDLLRHRVISQVLEIGIVVHSVIIGISLGASESPKTIRPLIAALTFHQ  242

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
             FFEGMGLGGCI QAKFK  +  +MA+FFSLTTPVGIA G+ I+  Y+ +S TALI +G+L
Sbjct  243   FFEGMGLGGCIYQAKFKIKAVIIMALFFSLTTPVGIAIGLAITGAYDENSPTALIVEGIL  302

Query  1690  NSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              +ASAGILIYM+LVDLLAADFM  +IQ + RLQ G  VSL+LGAG MS+LA WA
Sbjct  303   KAASAGILIYMSLVDLLAADFMNSRIQGSGRLQFGASVSLLLGAGCMSLLAKWA  356



>ref|XP_006363493.1| PREDICTED: zinc transporter 8-like [Solanum tuberosum]
Length=348

 Score =   343 bits (880),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 183/351 (52%), Positives = 247/351 (70%), Gaps = 21/351 (6%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             A   SECTC+ + + +           +++LKY+LVA+ASIL+AGA GVSIP+L +    
Sbjct  19    ALVSSECTCDEDADDRNR---------IEALKYKLVAVASILIAGAIGVSIPILGKIIPA  69

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
               PE ++F +IKAFAAGVIL+TGFVHILPDAF++L+SP L +  PW  FPF+GLIA+ ++
Sbjct  70    FRPENNVFVLIKAFAAGVILATGFVHILPDAFESLSSPCLPE-KPWGDFPFAGLIAMISA  128

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I T+MVD LA SF++K       + L +      + +          HG A  +V L   
Sbjct  129   IGTMMVDLLATSFYKK-------SNLTKQKPVNSDEEKEVHVHTHSTHGHAHGSVMLSSS  181

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
                +EL    D  R+RV+SQVLELGI+VHSVIIG+ LG S++ +TI+PL+ AL+FHQ FE
Sbjct  182   EGTDEL----DLSRRRVISQVLELGILVHSVIIGVSLGASESPKTIKPLVAALTFHQLFE  237

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             GMGLGGCIA+AKFK    A+M++FFSLTTP+GIA G GIS+VY+  S TAL+ +G+ NSA
Sbjct  238   GMGLGGCIAEAKFKIKKAALMSIFFSLTTPIGIAIGFGISTVYSETSPTALMVEGIFNSA  297

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +AGILIYMALVDLLAADFM  ++Q++ +L +G ++ L+ GAG MS+LA WA
Sbjct  298   AAGILIYMALVDLLAADFMSTRMQDSPKLLMGANIFLLFGAGCMSLLAKWA  348



>ref|XP_009625957.1| PREDICTED: zinc transporter 8-like [Nicotiana tomentosiformis]
Length=353

 Score =   343 bits (879),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 242/347 (70%), Gaps = 14/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             SECTC+ + E +            ++LKY+LVA+ASIL+AGA G+SIP+L + +  L PE
Sbjct  21    SECTCDEDSEDR---------NKTEALKYKLVAVASILLAGAIGISIPILGKIFPALHPE  71

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              +IFF +KAFAAGVIL+TGFVHILPDAF++L+SP L +  PW  FPF+G IA+ A+I T+
Sbjct  72    NNIFFFVKAFAAGVILATGFVHILPDAFESLSSPCLPE-KPWGDFPFAGFIAMVAAIGTM  130

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVD +AMS+FR+  +   K        +                    A   + P    +
Sbjct  131   MVDLVAMSYFRRSHLKRQKPVNSDEEKEGGMINQNNHVHVHTHSTHGHAHGSVVPLEEGS  190

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             EL    D  R+RV+SQVLELGI+VHSVIIG+ LG S++ +TI+PL+ AL+FHQ FEG+GL
Sbjct  191   EL----DLSRRRVISQVLELGILVHSVIIGISLGASESPKTIKPLVAALTFHQLFEGIGL  246

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI++A+FK   TA+MA+FFSLTTP+GIA G GIS+VY+  S TAL+ +G+ NS + GI
Sbjct  247   GGCISEARFKLRKTAMMAIFFSLTTPMGIAIGFGISTVYSETSPTALMVEGIFNSIATGI  306

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             L+YMALVDLLAADFM  ++Q++ +LQ+  +V L+LGAG MS+LA WA
Sbjct  307   LVYMALVDLLAADFMSSRMQDSPKLQIEANVFLLLGAGCMSLLAKWA  353



>gb|KEH35205.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=361

 Score =   343 bits (879),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 243/357 (68%), Gaps = 31/357 (9%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+            E      +L+Y++ A+ SILV  A GV IPLL +    L PE
Sbjct  26    AECTCD---------EEDEDRDKAKALRYKIAALVSILVVSAIGVFIPLLGKVIPALSPE  76

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KDIFF+IK FAAGVILSTGF+H+LPDAF+ LTSP LK+ +PW  FPF+G +A+  ++ +L
Sbjct  77    KDIFFIIKTFAAGVILSTGFIHVLPDAFENLTSPCLKE-HPWGDFPFTGFVAMCTAMGSL  135

Query  1171  MVDTLAMSFFRKKMMHFDK-TKLPQVSadeeeakdaaaadhmh---------rhgaaaaa  1320
             MVDT A ++F+ +  H  K + L QV + E                       HG A   
Sbjct  136   MVDTYATAYFQNR--HSKKASTLTQVKSHEATLDVEKEVVEQQGHVHVHTHASHGHAHGH  193

Query  1321  VYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALS  1500
             V  DP          S+ +R RV+SQVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+
Sbjct  194   VSSDPS---------SELLRHRVISQVLELGIIVHSVIIGISLGASESPKTIRPLVAALT  244

Query  1501  FHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQ  1680
             FHQFFEGMGLG CI QA FKS+S  +M +FF+LTTPVGIA G+GIS+VY+ ++ TALI +
Sbjct  245   FHQFFEGMGLGSCITQANFKSLSITIMGLFFALTTPVGIAIGLGISNVYDENTPTALIVE  304

Query  1681  GVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             G+ N+ASAGILIYMALVDLLAADFM P++Q + +L+LG ++SL+LGAG MS+LA WA
Sbjct  305   GIFNAASAGILIYMALVDLLAADFMNPRMQKSGKLRLGCNLSLLLGAGCMSLLAKWA  361



>gb|AAR08414.1| metal transport protein [Medicago truncatula]
Length=372

 Score =   343 bits (880),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 235/322 (73%), Gaps = 10/322 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+LP
Sbjct  61    ALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLP  120

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    QV
Sbjct  121   DAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQV  176

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
              +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+ H
Sbjct  177   ESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIGH  230

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LTT
Sbjct  231   SVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTT  290

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+GIS+VY+ +S TA I +G+ N+ASAGILIYMALVDLLAADFM P++Q N RL
Sbjct  291   PVGIGIGLGISNVYDENSPTAFIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNGRL  350

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QLG ++SL+LGAG MS++A WA
Sbjct  351   QLGSNISLLLGAGCMSLIAKWA  372



>ref|XP_006353722.1| PREDICTED: zinc transporter 5-like [Solanum tuberosum]
Length=339

 Score =   342 bits (876),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 195/366 (53%), Positives = 258/366 (70%), Gaps = 35/366 (10%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++ FP      A   SECTC+   E +   + KE      +LKY++ A+ASILVA 
Sbjct  9     FWYILLLFP------AIVLSECTCDPEDEDR---NKKE------ALKYKMAALASILVAS  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV IP+L +    L PE++ FF+IKAFAAGVILSTGF+H+LPDAF++LTSP L + +P
Sbjct  54    AIGVCIPVLGKAIPALSPERNFFFIIKAFAAGVILSTGFIHVLPDAFESLTSPCLAE-HP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPFSG IA+ +++ATLMVDT A S++ KK +   K  +    A  E+    A +   
Sbjct  113   WGDFPFSGFIAMVSALATLMVDTYATSYYSKKNL---KNGVVATEAGYEQGVVHAHSHGH  169

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                             S++E    S+ +R RV+SQVLELGI+VHSVIIG+ LG S++ +T
Sbjct  170   VHGL------------SDSE----SELLRYRVISQVLELGIIVHSVIIGIALGASESPKT  213

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PL+ AL+FHQFFEG+GLGGCIAQAK K+ + A+MA+FFSLTTP+GI  G+GI++VY+ 
Sbjct  214   IKPLVAALTFHQFFEGLGLGGCIAQAKLKTRTIAIMALFFSLTTPIGIGIGLGITNVYDE  273

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TALI +GV NSASAGILIYMALVD LAADFM P++Q N +LQLG ++SL+LGAG MS
Sbjct  274   NSPTALIVEGVFNSASAGILIYMALVDFLAADFMHPRMQGNGKLQLGANISLLLGAGLMS  333

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  334   LLAKWA  339



>ref|XP_008371976.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 1-like [Malus 
domestica]
Length=355

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 231/323 (72%), Gaps = 11/323 (3%)
 Frame = +1

Query  883   DSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHIL  1062
             D L+Y+L +IASILVAG+ GVS+  L +K   L P  DIFF+IKAFAAGVI + GFVHIL
Sbjct  44    DELRYKLGSIASILVAGSVGVSLNWLGKKIPTLMPXNDIFFLIKAFAAGVIJAIGFVHIL  103

Query  1063  PDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQ  1242
             PDAF  LTSP +K+  PW KFP+ G + + ++  TLMVD+LA  ++++  +  ++  + +
Sbjct  104   PDAFDNLTSPCIKEX-PWGKFPYXGFVTMLSATGTLMVDSLATGYYQRSKVKSNQVTIHE  162

Query  1243  VSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVV  1422
             + + +++             G A            +E +  S+ IRQRV+  VLELGI+V
Sbjct  163   LESGDDDHAGHVHGXTHSTQGHA----------HGSEELKSSELIRQRVIXXVLELGILV  212

Query  1423  HSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLT  1602
             HSVIIG  LG S + ETI+PL+VALSFHQFFEGMGLGGCI++A+FKS S A+MA FFSLT
Sbjct  213   HSVIIGXSLGASPSXETIKPLMVALSFHQFFEGMGLGGCISKAQFKSRSAAIMATFFSLT  272

Query  1603  TPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVR  1782
             TPVGIA G+GIS+VYN +S TALI +G  N+A+ GILIYMALVDLLAADFM P++Q N++
Sbjct  273   TPVGIAVGVGISTVYNXNSPTALIXEGTSNAAAGGILIYMALVDLLAADFMNPRMQGNLK  332

Query  1783  LQLGGHVSLVLGAGSMSVLAMWA  1851
             +QLG + SL+LG G MS+L  WA
Sbjct  333   IQLGAYSSLLLGTGCMSLLXXWA  355



>ref|XP_008799797.1| PREDICTED: zinc transporter 8-like [Phoenix dactylifera]
Length=347

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 187/347 (54%), Positives = 238/347 (69%), Gaps = 23/347 (7%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C+ + EG+    ++           ++ A  SIL+ GA GV +P+L++    L PE 
Sbjct  23    DCECSPDDEGRNKSKAR---------PLKIAAFFSILICGAIGVCLPILSKSIPALSPEN  73

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L D +PW KFPF+G  A+  ++ TLM
Sbjct  74    DIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLSD-DPWGKFPFAGFGAMIGALGTLM  132

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDTLA S+F +     +               +   A+  H  G A   V+     ++  
Sbjct  133   VDTLATSYFSRSARAVNDE------------ANKGDAEMNHPVGDAVIHVHATHGHAHGP  180

Query  1354  LVHLSDR-IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
              V  SD+ +R RV+SQVLELGIVVHSVIIG+ LG S +  TIRPL+ ALSFHQFFEGMGL
Sbjct  181   AVDGSDKLVRHRVISQVLELGIVVHSVIIGISLGASDSPSTIRPLVAALSFHQFFEGMGL  240

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCIAQAKFK++S A M +FFSLTTPVGIA G GISSVYN +S TALI +G+LNS +AGI
Sbjct  241   GGCIAQAKFKTMSVATMILFFSLTTPVGIAIGFGISSVYNENSPTALIVEGILNSVAAGI  300

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLA DFM P++Q+  +LQ   +VSL++GAG MS+LA WA
Sbjct  301   LIYMALVDLLAEDFMNPRVQSKGKLQFAINVSLLIGAGLMSLLAKWA  347



>ref|XP_009354003.1| PREDICTED: zinc transporter 1-like [Pyrus x bretschneideri]
Length=359

 Score =   341 bits (875),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 246/353 (70%), Gaps = 21/353 (6%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             +A  EC CN  +E   H   K        LK++LVA++SIL+A   GVS+P+L +K   L
Sbjct  25    SASVECECN--LETLDHDKFK-------VLKFKLVAVSSILMASFLGVSLPILGKKIPAL  75

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
               E DIFF+IKAFAAGVIL+TGF+H+LPDAF++L SP L +T  W  FPF+G IA+ ++I
Sbjct  76    NTENDIFFLIKAFAAGVILATGFIHVLPDAFESLRSPCLSET-LWDSFPFTGFIAMLSAI  134

Query  1162  ATLMVDTLAMSFFRKKMMHFDKT---KLPQVSadeeeakdaaaadhmhrhgaaaaaVYLD  1332
              T+M+DT A S++R+   HF K    K  +      +      A   H H   + A+  +
Sbjct  135   GTMMIDTFATSYYRRS--HFTKALPVKEDEEMNGVHQGHVHVHAHATHGHSHGSGAIAPE  192

Query  1333  PPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQF  1512
                S+ E+V      R RV+SQVLELGI+VHSVIIG+ LG SQ+ +TI+PL+ AL+FHQF
Sbjct  193   DSISSFEIV------RHRVISQVLELGILVHSVIIGISLGASQSPKTIKPLVAALTFHQF  246

Query  1513  FEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLN  1692
             FEGMGLGGCI QA FKS + A M +FFSLTTP+GI  G+GIS++YN  S  ALI +GV N
Sbjct  247   FEGMGLGGCITQANFKSRAIATMVLFFSLTTPIGIGVGMGISNIYNETSPIALIVEGVFN  306

Query  1693  SASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SASAGILIYMALV+LLAADFM P++Q+N+R+QLG +VSL+LG+G MS LA WA
Sbjct  307   SASAGILIYMALVNLLAADFMNPRMQSNLRIQLGANVSLLLGSGCMSFLAKWA  359



>gb|AAX28837.1| zinc transporter protein ZIP1 [Fragaria x ananassa]
Length=353

 Score =   340 bits (871),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 241/346 (70%), Gaps = 18/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             ECTC+   EG             ++LKY+L AIASILVAGA GV  P+L +    L PEK
Sbjct  26    ECTCDAEEEGGNRS---------EALKYKLGAIASILVAGAVGVCTPILGKTIPSLQPEK  76

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
              IF +IKAFAAGVIL+TGF+H+LPDAF+ LTSP L++ NPW KFPF+G +A+ A+I TLM
Sbjct  77    PIFLIIKAFAAGVILATGFIHVLPDAFERLTSPCLEE-NPWGKFPFTGFVAMMAAIGTLM  135

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD++A S+F     H  K +      +E+  +               A   LD   + ++
Sbjct  136   VDSIATSYFN--WSHLKKAQNQVNGDEEKVGEHEGHVHVHTHGTHGHAHGSLDTNSAESQ  193

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
             L      +R RV+S+VLELGIVVHSVIIG+ LG S++  T+RPL+ AL+FHQFFEGMGLG
Sbjct  194   L------LRHRVISKVLELGIVVHSVIIGISLGASESAATVRPLVAALTFHQFFEGMGLG  247

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCIAQA+   ++T +M +FFSLTTPVGI  GIGISS Y  +SSTALI +G+ ++ASAGIL
Sbjct  248   GCIAQARESRLTTIIMVLFFSLTTPVGIGIGIGISSRYEENSSTALILEGLFDAASAGIL  307

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM PK+Q NV+LQ+G + SL+ GAG MS++A WA
Sbjct  308   IYMALVDLLAADFMNPKMQKNVKLQVGANASLLFGAGCMSLIAKWA  353



>ref|XP_004146060.1| PREDICTED: zinc transporter 1-like [Cucumis sativus]
Length=357

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 251/363 (69%), Gaps = 18/363 (5%)
 Frame = +1

Query  778   PCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPL  957
             P + S   +  +  T N N+   L +S  +T     SLKY++VAIA+ILVAG  GV IPL
Sbjct  8     PLSKSMMDSENASATGNNNMPLPLPHSPPQTTY---SLKYKVVAIATILVAGIIGVVIPL  64

Query  958   LARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSG  1137
             L +    L PEKDIFF+IKAFAAGVIL+TGF+H+LPDA+  LTS  L + +PW KFPF+G
Sbjct  65    LGKLIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAYGNLTSSKLNE-HPWGKFPFTG  123

Query  1138  LIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeea-----kdaaaadhmhrh  1302
             L+A+ A+I TLMVD  A S++ +  +H +K + P+++ D+E                   
Sbjct  124   LVAMVAAIGTLMVDAGASSYYTR--IHLNKAQ-PELNGDDEMRGGGCGAHDGHVHVHTHG  180

Query  1303  gaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRP  1482
                 A    D   S+ E+      +R RV+SQVLELGIVVHSVIIG+ LG S++ ETIRP
Sbjct  181   THGHAHGSADVGGSSTEI------LRHRVISQVLELGIVVHSVIIGIGLGVSESPETIRP  234

Query  1483  LLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSS  1662
             L+ A++FHQ FEGMGLGGCIAQAKFK+ +T +M +FF LTTP+GIA GI ++  Y+  S 
Sbjct  235   LVAAITFHQLFEGMGLGGCIAQAKFKNRATILMGLFFCLTTPIGIAIGIAVTKTYDEDSP  294

Query  1663  TALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLA  1842
              ALI +G+LN+AS+GILIYMALVDLLAADFM P++Q+N +LQL  +VSL+LGA  MS+LA
Sbjct  295   KALIVEGILNAASSGILIYMALVDLLAADFMNPRMQSNGKLQLLANVSLILGAALMSLLA  354

Query  1843  MWA  1851
             +WA
Sbjct  355   IWA  357



>ref|XP_009393263.1| PREDICTED: zinc transporter 4-like [Musa acuminata subsp. malaccensis]
Length=354

 Score =   340 bits (871),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 182/346 (53%), Positives = 240/346 (69%), Gaps = 15/346 (4%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C  + E   H ++K +         +LVAIASIL AGA GV IP+L R    L PE 
Sbjct  24    DCGCTRDAES--HSTTKAS-------HLKLVAIASILTAGAVGVLIPILGRAVSALRPEN  74

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D+FF+IKAFAAGVIL+TG +HILP AFQ+LTSP L D +PW  FP +G + +++++ T+M
Sbjct  75    DMFFVIKAFAAGVILATGLIHILPAAFQSLTSPCL-DEHPWQDFPVTGFVVMSSALGTMM  133

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             +D+ A S++++   HF K +  +   +  +      A          A        +  E
Sbjct  134   IDSFATSYYKRS--HFSKARPVEEDDEAGQGSSGDHAHVDTHRSHGHAHASAA---AATE  188

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                LS+RIRQ+V+SQVLELGI+VHSVIIG+ LG SQ+  TIRPL+ ALSFHQFFEG+GLG
Sbjct  189   AASLSERIRQQVISQVLELGILVHSVIIGISLGASQSPSTIRPLVGALSFHQFFEGIGLG  248

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QA F++ S+ +MAVFFSLT P+GIA G  IS VY+  SSTALI +GV N+ASAGIL
Sbjct  249   GCIVQANFRAKSSLMMAVFFSLTAPIGIAVGTAISFVYDETSSTALIVEGVFNAASAGIL  308

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +YM+LVDLLAADF  P++Q+N RLQLG H++L++GAG MS+LA WA
Sbjct  309   VYMSLVDLLAADFTNPRMQSNGRLQLGAHLALLVGAGLMSLLAKWA  354



>ref|XP_010941688.1| PREDICTED: zinc transporter 4 [Elaeis guineensis]
Length=362

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 245/349 (70%), Gaps = 14/349 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ++C C  N EGQ          T  +LK + +AIASIL AGA GV +P+L R    L PE
Sbjct  26    ADCECTTNPEGQ---------DTPKALKLKFMAIASILTAGAIGVLLPILGRSVAALRPE  76

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              D+FF+IKAFAAGVIL+TG +HILP AF++LTSP LK+ +PW  FP +G +A+ ++I T+
Sbjct  77    NDVFFVIKAFAAGVILATGLIHILPGAFESLTSPCLKE-DPWHNFPVAGFVAMLSAIGTM  135

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQV--SadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             MVD+ A S++ +   HF K +  +     + +    A    H+H H  A         P+
Sbjct  136   MVDSFATSYYTRS--HFSKARPVEEYEGGNGDVETSADHDGHVHVHTHATHGHAHGSVPA  193

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             + E   L++RIR R++SQVLELGIVVHS+IIG+ LG S++  TIRPLL ALSFHQFFEG+
Sbjct  194   SPEDASLAERIRHRIISQVLELGIVVHSLIIGISLGASESPSTIRPLLGALSFHQFFEGI  253

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI QA F++ +T +MAVFFSLT P+GI+ GI ISS Y  +S  ALI +G+ NSASA
Sbjct  254   GLGGCIVQANFRAKATVIMAVFFSLTAPIGISLGIAISSSYKENSPIALIVEGIFNSASA  313

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADF  PK+QNN RLQLG H++L+LGAG MS+LA WA
Sbjct  314   GILIYMALVDLLAADFTHPKMQNNGRLQLGTHLALLLGAGLMSILAKWA  362



>gb|EYU42823.1| hypothetical protein MIMGU_mgv1a019299mg [Erythranthe guttata]
Length=345

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 187/346 (54%), Positives = 247/346 (71%), Gaps = 21/346 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC    +G    S         +LKY+L AIA+ILVA A GVS+P++ R+   L PE+
Sbjct  21    DCTCEAEEDGDRSRSL--------ALKYKLAAIAAILVASAVGVSLPVVGRRVPALSPER  72

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             + FF+IKAFAAGVILSTGF+H+LPDAF++LTSP +   +PW  FPF+G IA+ ++I TLM
Sbjct  73    NFFFVIKAFAAGVILSTGFIHVLPDAFESLTSPCIP-ASPWGDFPFTGFIAMVSAIGTLM  131

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT A S++R++     K K  +      E          H H   + ++  D    + E
Sbjct  132   VDTYATSYYRRR----SKDKAAEGVGGAGEGILPVHTHATHGHAHGSVSMEAD----SGE  183

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                 SD +R RV+SQVLELGI+VHSVIIG+ LG SQ+ +TIRPL+ ALSFHQFFEG+GLG
Sbjct  184   ----SDVLRHRVISQVLELGIIVHSVIIGIALGASQSPKTIRPLIAALSFHQFFEGIGLG  239

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QA+FK+ +  +MA+FFS+TTP GIA GIGI+++Y+  S TALI QGV N+ASAGIL
Sbjct  240   GCITQARFKARAVTIMAIFFSITTPTGIAIGIGITNIYSETSPTALIVQGVFNAASAGIL  299

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLL+ADFM PK+Q+N +LQLG ++SL++GAG MS++A WA
Sbjct  300   IYMALVDLLSADFMSPKMQSNGKLQLGANLSLLIGAGCMSLIAKWA  345



>ref|XP_009397090.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=349

 Score =   338 bits (868),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 242/365 (66%), Gaps = 24/365 (7%)
 Frame = +1

Query  757   YIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGA  936
             ++I++  P        A  +C C+ + EG+     K+      +L  ++ AI SILV G 
Sbjct  9     FLIVLLLPLV------ARGDCDCSADEEGR---DKKK------ALPLKIAAIFSILVCGG  53

Query  937   AGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPW  1116
              GV IP+L +    L P+KDIFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L  ++PW
Sbjct  54    IGVCIPILGKWIPALRPDKDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLA-SSPW  112

Query  1117  AKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmh  1296
               FPF+G  A+ A++ATLM+DTLA  +F +  +H    +         + +  +      
Sbjct  113   QDFPFAGFGAMVAAVATLMIDTLATGYFNR--LHRKNMRTTASDETTADVEKTSDGSDHV  170

Query  1297  rhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETI  1476
                A     +     ++ +L      IR RV+SQVLELGIVVHSVIIG+ LG S+   TI
Sbjct  171   HTHATHGHAHGSDGDASAQL------IRNRVISQVLELGIVVHSVIIGISLGASEVPSTI  224

Query  1477  RPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPH  1656
             RPL+ ALSFHQFFEGMGLGGCI QAKFK+ S   M +FFSLTTPVGIA GIGI+SVY+ +
Sbjct  225   RPLVAALSFHQFFEGMGLGGCIVQAKFKAKSIVTMGLFFSLTTPVGIAIGIGIASVYDEN  284

Query  1657  SSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSV  1836
             S TALI +G LNS ++GILIYMALVDLLAADFM P++Q+  RLQ   +VSL++GAG MS+
Sbjct  285   SPTALIVEGCLNSVASGILIYMALVDLLAADFMNPRVQSKARLQFMINVSLLVGAGLMSL  344

Query  1837  LAMWA  1851
             LA WA
Sbjct  345   LAKWA  349



>ref|XP_002264621.1| PREDICTED: zinc transporter 8 [Vitis vinifera]
Length=351

 Score =   338 bits (867),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 183/346 (53%), Positives = 246/346 (71%), Gaps = 17/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+ + +G    +         +L+Y++ AI +IL  GA GV IP+L +    L PEK
Sbjct  23    DCTCDKD-DGDRDKNK--------ALRYKIAAIIAILAGGAIGVCIPILGKTIPALHPEK  73

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             ++FF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP L + NPW  FPF+G +A+ ++I TLM
Sbjct  74    NVFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLSE-NPWGNFPFTGFVAMVSAIGTLM  132

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD  A S++ +   HF K +         + + A   +            +     S+ E
Sbjct  133   VDACATSYYSRS--HFKKAQ-----QAVGDEEKAGEHEGHVHVHTHGTHGHAHGSASSAE  185

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
              +  ++ IR RV+SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ AL+FHQFFEGMGLG
Sbjct  186   EMGSAELIRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALTFHQFFEGMGLG  245

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKFK  + A+MA+FFSLTTPVGIA GIGIS+VY+ +SSTALI +G+ N+ASAGIL
Sbjct  246   GCIVQAKFKLRAAAIMALFFSLTTPVGIAIGIGISNVYDENSSTALIVEGIFNAASAGIL  305

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +YMALVDLLAADFM P++Q N RLQ+G ++SL++GAG MS+LA WA
Sbjct  306   VYMALVDLLAADFMNPRMQGNGRLQVGANISLLVGAGCMSLLAKWA  351



>ref|XP_010044860.1| PREDICTED: zinc transporter 5-like [Eucalyptus grandis]
 gb|KCW88544.1| hypothetical protein EUGRSUZ_A00916 [Eucalyptus grandis]
Length=364

 Score =   338 bits (866),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 194/372 (52%), Positives = 252/372 (68%), Gaps = 34/372 (9%)
 Frame = +1

Query  763   IIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAG  942
             +++ FP  + G      +C+C+    G     +K  +     LKY++ AI +IL A A G
Sbjct  18    VLVLFPSLVLG------DCSCDSAGGGD----TKNVV-----LKYKVAAIFAILFASAVG  62

Query  943   VSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAK  1122
             V IPLLAR    +GP++D FF++KAFAAGVIL+TG +H+LPDAF +LTSP L D NPW  
Sbjct  63    VCIPLLARVIPAIGPDRDAFFVVKAFAAGVILATGLIHVLPDAFDSLTSPCL-DQNPWGN  121

Query  1123  FPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrh  1302
             FPF+G +A+ A+IATLMVD  A S++ +   HF K + P  S  +EE K AA ++    H
Sbjct  122   FPFAGFVAMVAAIATLMVDAYATSYYTRS--HFSKAR-PAASKGDEETKAAAGSEDHAGH  178

Query  1303  gaaaa---------aVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGT  1455
                           + Y D  P  +EL      +R RV+SQVLELGIVVHSVIIG+ +GT
Sbjct  179   LHMHTHTTHGHAHGSAYQDQEPGTSEL------LRHRVISQVLELGIVVHSVIIGISVGT  232

Query  1456  SQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGI  1635
             S + +T++ L+ AL+FHQFFEGMGLGGCIAQAKFK+ ST +MA+FFSLTTP+GIA GIGI
Sbjct  233   SGSLQTVKTLMAALTFHQFFEGMGLGGCIAQAKFKATSTVIMAIFFSLTTPLGIAIGIGI  292

Query  1636  SSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVL  1815
             SS Y+ +S  ALI QG+ ++ASAGIL+YM+LVDLLAADFM  K+Q N RL L  +V L+ 
Sbjct  293   SSSYDDNSPRALIIQGIFDAASAGILVYMSLVDLLAADFMSAKVQGNGRLLLLCNVFLLF  352

Query  1816  GAGSMSVLAMWA  1851
             GAG MS LA WA
Sbjct  353   GAGCMSFLAKWA  364



>ref|XP_004167569.1| PREDICTED: zinc transporter 1-like [Cucumis sativus]
 gb|KGN54984.1| ZIP transporter [Cucumis sativus]
Length=367

 Score =   338 bits (866),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 188/356 (53%), Positives = 249/356 (70%), Gaps = 23/356 (6%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             AA + +C  +   +G+      ETL    +LKY++VAIA+ILVAG  GV IPLL +    
Sbjct  30    AAPDCQCPEDSEDDGK----RDETL----ALKYKVVAIATILVAGIIGVVIPLLGKLIPA  81

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PEKDIFF+IKAFAAGVIL+TGF+H+LPDA+  LTS  L + +PW KFPF+GL+A+ A+
Sbjct  82    LSPEKDIFFIIKAFAAGVILATGFIHVLPDAYGNLTSSKLNE-HPWGKFPFTGLVAMVAA  140

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeea-----kdaaaadhmhrhgaaaaaV  1323
             I TLMVD  A S++ +  +H +K + P+++ D+E                       A  
Sbjct  141   IGTLMVDAGASSYYTR--IHLNKAQ-PELNGDDEMRGGGCGAHDGHVHVHTHGTHGHAHG  197

Query  1324  YLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSF  1503
               D   S+ E+      +R RV+SQVLELGIVVHSVIIG+ LG S++ ETIRPL+ A++F
Sbjct  198   SADVGGSSTEI------LRHRVISQVLELGIVVHSVIIGIGLGVSESPETIRPLVAAITF  251

Query  1504  HQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQG  1683
             HQ FEGMGLGGCIAQAKFK+ +T +M +FF LTTP+GIA GI ++  Y+  S  ALI +G
Sbjct  252   HQLFEGMGLGGCIAQAKFKNRATILMGLFFCLTTPIGIAIGIAVTKTYDEDSPKALIVEG  311

Query  1684  VLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +LN+AS+GILIYMALVDLLAADFM P++Q+N +LQL  +VSL+LGA  MS+LA+WA
Sbjct  312   ILNAASSGILIYMALVDLLAADFMNPRMQSNGKLQLLANVSLILGAALMSLLAIWA  367



>gb|EPS63182.1| hypothetical protein M569_11603, partial [Genlisea aurea]
Length=344

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 195/368 (53%), Positives = 247/368 (67%), Gaps = 31/368 (8%)
 Frame = +1

Query  760   IIIIFF--PCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             ++ +FF  P  I+G +A      C+G   GQ          + ++LK++L A+ASILVAG
Sbjct  4     VLTLFFLIPATIAGDSA------CSGEDIGQRQ--------STEALKFKLAAVASILVAG  49

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV +P+L R+     PE ++FFMIK+FAAGVIL+TGF+HILPDAF TL+SP L D NP
Sbjct  50    AIGVGLPVLGRRISVFLPENNMFFMIKSFAAGVILATGFIHILPDAFATLSSPCL-DPNP  108

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W KFPF+G IA+ A+IATL  DT A  F+R+K  HF             +A  A      
Sbjct  109   WQKFPFAGFIAMMAAIATLTADTAASGFYRRK--HFSSKN---------QAVLAVKDVEE  157

Query  1294  hrhgaaaaaVYLDPPPSNNELVH--LSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTR  1467
                   +  V++    S+    H  L D  RQR++S+VLELGIVVHSVIIG+ LGTSQ  
Sbjct  158   GNGDVHSGHVHVHTHASHGH-AHGALPDLSRQRIISKVLELGIVVHSVIIGISLGTSQKL  216

Query  1468  ETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVY  1647
             ETI+ L+ ALSFHQFFEGMGLGGCI+QAKF+  +  +M  FFS+TTP GI  GIGIS+ Y
Sbjct  217   ETIKTLMAALSFHQFFEGMGLGGCISQAKFERSTATLMMAFFSITTPAGIGIGIGISNFY  276

Query  1648  NPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGS  1827
                S  ALI +G  NSASAGILIYM+LVDLLAADFM P +Q+NVRLQ+G +VSL+LG+G 
Sbjct  277   RESSPRALIVEGSFNSASAGILIYMSLVDLLAADFMNPVMQDNVRLQVGAYVSLLLGSGC  336

Query  1828  MSVLAMWA  1851
             M+ LA WA
Sbjct  337   MAFLAKWA  344



>ref|XP_008464645.1| PREDICTED: zinc transporter 5-like [Cucumis melo]
Length=365

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 243/351 (69%), Gaps = 14/351 (4%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             AAA+ +C  +   +G       +TL    +LKY++VAIA+IL+AG  GV IPLL +    
Sbjct  29    AAADCQCPEDSEEDGG---KRDDTL----ALKYKIVAIATILLAGIIGVVIPLLGKVIPA  81

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PEKDIFF+IKAFAAGVIL+TGF+H+LPDA++ LTS  L + +PW KFPF+GL+A+ A+
Sbjct  82    LSPEKDIFFVIKAFAAGVILATGFIHVLPDAYEKLTSSKLNE-HPWGKFPFTGLVAMVAA  140

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TLM+D  A S++ +  ++  + +L                          A    D  
Sbjct  141   IGTLMMDAGASSYYTRIHLNKAQPELNGDDEMRGGGGHDGHVHVHTHGTHGHAHGSADVG  200

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S+ E+      +R RV+SQVLELGIVVHS+IIG+ LG S+T +TIRPL+ A++FHQ FE
Sbjct  201   GSSTEI------LRHRVISQVLELGIVVHSIIIGIGLGVSETPKTIRPLVAAITFHQLFE  254

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             GMGLGGCIAQAKFK+ +T +M +FF LTTP+GIA GI ++  Y+  S  ALI +G+LN+A
Sbjct  255   GMGLGGCIAQAKFKNRATILMGLFFCLTTPLGIAIGIAVTKGYDEDSPKALIVEGILNAA  314

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             S+GILIYMALVDLLAADFM P++Q+N +LQL  +VSL+LGA  MS+LA+WA
Sbjct  315   SSGILIYMALVDLLAADFMNPRMQSNGKLQLLANVSLILGAALMSLLAIWA  365



>ref|XP_007145957.1| hypothetical protein PHAVU_006G001000g [Phaseolus vulgaris]
 gb|ESW17951.1| hypothetical protein PHAVU_006G001000g [Phaseolus vulgaris]
Length=354

 Score =   336 bits (861),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 249/364 (68%), Gaps = 25/364 (7%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             II+I  P  +       +ECTC+   E +     +E      +++Y++ A+ SIL+A A 
Sbjct  16    IILIVLPTLV------RAECTCDAEDENR----DREK-----AMRYKIAALVSILIASAI  60

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GV IPLL +    L PEKDIFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK+ +PW 
Sbjct  61    GVCIPLLGKVIPALSPEKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLKE-HPWG  119

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
              FPF+G +A+  ++ TLMVDT A ++F+K      +++   V  +     D     H   
Sbjct  120   DFPFTGFVAMCTAMGTLMVDTYATAYFQKHHSQEIQSENRDVEKEAGHEGDVHLHTHATH  179

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
               A        P P  ++  H S  +R RV+SQVLELGIVVHSVIIG+ LG S++  TIR
Sbjct  180   GHA--------PGPVQSD-DHSSQLLRHRVISQVLELGIVVHSVIIGISLGASESPNTIR  230

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHS  1659
             PL+ AL+FHQFFEGMGLG CI+QA FK VS  VM +FF+LTTPVGI  GIGI++VY+ +S
Sbjct  231   PLVAALTFHQFFEGMGLGSCISQANFKRVSVIVMGLFFALTTPVGIGIGIGITNVYDENS  290

Query  1660  STALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVL  1839
              TALI +GV N+ASAGILIYM+LVDLLA DFM P++Q + RL+LG +VSL+LGAG MS++
Sbjct  291   PTALIVEGVFNAASAGILIYMSLVDLLATDFMNPRMQQSGRLRLGANVSLLLGAGFMSLI  350

Query  1840  AMWA  1851
             A WA
Sbjct  351   AKWA  354



>ref|XP_010044870.1| PREDICTED: zinc transporter 1-like [Eucalyptus grandis]
Length=366

 Score =   335 bits (860),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 194/355 (55%), Positives = 243/355 (68%), Gaps = 26/355 (7%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+G   G  +          ++LKY++ AIA+IL+AGA GV IPLL +    L PEK
Sbjct  29    DCTCDGAAGGGRNKR--------EALKYKVGAIAAILLAGAVGVCIPLLGKVVPALRPEK  80

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D+FF++KAFAAGVIL+TG +H+LPDAF +LTSP L D NPW KFPF+G +A+ A++ TLM
Sbjct  81    DVFFLVKAFAAGVILATGLIHVLPDAFDSLTSPCL-DENPWGKFPFAGFVAMVAAVGTLM  139

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaa---------adhmhrhgaaaaaVY  1326
             VDT A S++ +   HF K +  +   DEE    A A               HG A  + Y
Sbjct  140   VDTYATSYYTRS--HFSKARPAESEGDEESDAAATAGDDHAGHLHVHTHATHGHAHGSAY  197

Query  1327  LDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFH  1506
                 P  +EL      +R RVVSQVLELGIVVHSVIIG+ LGTS + +T++PL+ AL+FH
Sbjct  198   QGHEPGTSEL------LRHRVVSQVLELGIVVHSVIIGISLGTSGSAKTVKPLMAALTFH  251

Query  1507  QFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGV  1686
             QFFEGMGLGGCI QAKFK+ +T +MA+FFSLTTP GIA GIGIS  Y+  S  ALI +GV
Sbjct  252   QFFEGMGLGGCITQAKFKARTTIIMALFFSLTTPAGIAIGIGISDTYDESSQRALIIEGV  311

Query  1687  LNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              N+ASAGIL+YMALVDLLAADFM  K+Q N RLQL  +  L+ GAG M+ LA WA
Sbjct  312   FNAASAGILVYMALVDLLAADFMSAKVQGNGRLQLLCNCFLLFGAGCMAFLAKWA  366



>ref|XP_008378330.1| PREDICTED: zinc transporter 8-like [Malus domestica]
 ref|XP_008378331.1| PREDICTED: zinc transporter 8-like [Malus domestica]
Length=351

 Score =   335 bits (858),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 187/373 (50%), Positives = 251/373 (67%), Gaps = 38/373 (10%)
 Frame = +1

Query  751   SFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVA  930
             +F+ ++   P  + G      +CTC    E      +       ++LKY++ AIASIL+A
Sbjct  11    AFFCLLFILPTLVFG------DCTCEKEEEDGDRNRT-------EALKYKIGAIASILIA  57

Query  931   GAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTN  1110
             GA GV IP+L +    L P+++IFF+IKAFAAGVIL+TGF+H+LPDAF+ LT P+LK+ N
Sbjct  58    GALGVGIPILGKTIPALHPDRNIFFIIKAFAAGVILATGFIHVLPDAFENLTDPVLKE-N  116

Query  1111  PWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHF------DKTKLPQVSadeeeakd  1272
             PW KFPF+G +A+ A+I TLMVD+ A S++     HF      D+ K  +          
Sbjct  117   PWGKFPFTGFVAMMAAIGTLMVDSYATSYYSNS--HFENNINRDEEKAQEHGGHVHVHTH  174

Query  1273  aaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLG  1452
             +                 +D  PS       ++ +R RV+SQVLELGI+VHSVIIG+ LG
Sbjct  175   STHGHAHGA---------VDTSPS-------TELLRHRVISQVLELGIIVHSVIIGISLG  218

Query  1453  TSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIG  1632
              S++ +TI+PL+ ALSFHQFFEGMGLGGCI QA F++ + A+M++FFSLTTPVGI  GIG
Sbjct  219   ASESPKTIKPLVAALSFHQFFEGMGLGGCITQAMFENRAVAIMSLFFSLTTPVGIGIGIG  278

Query  1633  ISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLV  1812
             IS+VY+  S TALI +GV N+ASAGILIYMALVDLLAADFM  K+Q++ RLQ G ++SL+
Sbjct  279   ISNVYDESSPTALIVEGVFNAASAGILIYMALVDLLAADFMNQKMQSDGRLQAGANISLL  338

Query  1813  LGAGSMSVLAMWA  1851
             +GAG MS+LA WA
Sbjct  339   VGAGCMSLLAKWA  351



>ref|XP_007041017.1| Zinc transporter 1 precursor [Theobroma cacao]
 gb|EOX96848.1| Zinc transporter 1 precursor [Theobroma cacao]
Length=612

 Score =   343 bits (881),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 180/346 (52%), Positives = 248/346 (72%), Gaps = 18/346 (5%)
 Frame = +1

Query  817   CTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKD  996
             C C    E +L  SS        +LKY+LVAI+SIL+A A GVS+P+L +K     PE +
Sbjct  282   CAC----ENELGDSSSNK---TKALKYKLVAISSILIASALGVSLPILGKKIPTFQPENN  334

Query  997   IFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMV  1176
             +FF+IKAFA GVIL+TGFVHILPDA+++L+SP + +  PW  FPF+G +A+ ++I T+M+
Sbjct  335   VFFLIKAFAGGVILATGFVHILPDAYESLSSPCIGE-KPWGVFPFTGFLAMVSAIVTMMI  393

Query  1177  DTLAMSFFRKKMMHFDKTKLP--QVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             DT+A SF+++   HF+K  LP         E            HG A  + ++     ++
Sbjct  394   DTIATSFYKRS--HFNKA-LPVNGDEEMLGEHGGHVHVHTHATHGHAHGSAFVSEDSGSS  450

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
              L+     IRQR++SQVLE+GIVVHSVIIG+ LG SQT +TI+PL+ AL+FHQFFEGMGL
Sbjct  451   GLI-----IRQRIISQVLEVGIVVHSVIIGIALGASQTAKTIKPLVAALTFHQFFEGMGL  505

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKFK+ +  +M +FFS TTP+GIA G+G+S +YN +SS AL+ +G+ NS SAGI
Sbjct  506   GGCISQAKFKTRAIGIMLLFFSFTTPMGIAFGMGVSKIYNENSSKALVVEGIFNSLSAGI  565

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMW  1848
             LIYM+LVDLLAADFM P++Q++++LQLG ++SL+LGA  MS+LA W
Sbjct  566   LIYMSLVDLLAADFMNPRMQSSIKLQLGCNLSLLLGAACMSLLAKW  611


 Score =   206 bits (524),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = +1

Query  1366  SDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIA  1545
             SD IR R+VSQVLELGIVVHSVIIGL LG S+   TI+PL+ A+SFHQFFEGMGLGGCI 
Sbjct  128   SDLIRHRIVSQVLELGIVVHSVIIGLSLGASENPRTIKPLVAAISFHQFFEGMGLGGCIL  187

Query  1546  QAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMA  1725
              AKFK  + A+M +F SLT P+GIA GIG+S+ YN +S TALI QG+LNSASAGILIYMA
Sbjct  188   PAKFKHRAVAIMVLFISLTAPIGIAVGIGLSNAYNENSPTALIVQGLLNSASAGILIYMA  247

Query  1726  LVDLLAADFMKPKIQNNVRLQLGGHVSLVLG  1818
             LVDLLA  FM P++ +N+RLQL    +L+LG
Sbjct  248   LVDLLADVFMSPQMLSNIRLQLATAFTLLLG  278



>ref|XP_006858211.1| hypothetical protein AMTR_s00062p00183460 [Amborella trichopoda]
 gb|ERN19678.1| hypothetical protein AMTR_s00062p00183460 [Amborella trichopoda]
Length=352

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 242/333 (73%), Gaps = 11/333 (3%)
 Frame = +1

Query  856   SSKETLV-TVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGV  1032
             SS+ET V    +L  +L AI  IL AGA GV +P++ R    L PE++ FF+IKAFAAGV
Sbjct  30    SSEETDVDKAKALSLKLAAIGCILFAGAVGVCLPIVGRSIPALQPERNAFFVIKAFAAGV  89

Query  1033  ILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKM  1212
             IL+TG +H+LPDAF  L +  L + +PW KFPF+G +A+ ++I TL+VD+LA  ++++  
Sbjct  90    ILATGMIHVLPDAFDKLGNACLNE-DPWGKFPFAGFVAMLSAIGTLVVDSLATGYYQR--  146

Query  1213  MHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVV  1392
             +HF K   P V+++ E+A+   A D            +        EL   ++ +R RV+
Sbjct  147   IHFKK---PPVASNGEDAERNEAHDGHVHVHTHGTHGHTH---GAVELAG-AETLRHRVI  199

Query  1393  SQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVST  1572
             SQVLELGI+VHSVIIG+ LG S++  TIRPL+ ALSFHQFFEGMGLGGCI QAKFKS +T
Sbjct  200   SQVLELGIIVHSVIIGISLGASESPSTIRPLVAALSFHQFFEGMGLGGCIVQAKFKSRAT  259

Query  1573  AVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADF  1752
             A MA+FF++TTP GIA GIGI+SVYN +S TALI +G LN+ASAGILIYM+LVDLLAADF
Sbjct  260   ACMALFFAITTPAGIAVGIGIASVYNENSPTALIVEGCLNAASAGILIYMSLVDLLAADF  319

Query  1753  MKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             M PK+Q+N +LQ+  +VSL+ GAG+MS++A WA
Sbjct  320   MNPKMQSNGKLQIWANVSLLFGAGAMSLMAKWA  352



>emb|CAN67594.1| hypothetical protein VITISV_000700 [Vitis vinifera]
Length=345

 Score =   333 bits (854),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 189/366 (52%), Positives = 248/366 (68%), Gaps = 29/366 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F + II  P  + G      EC C+            E      +L+Y++ AIASILV G
Sbjct  9     FILFIIRLPTLVLG------ECACD---------EEDEDRDRDKALRYKIAAIASILVGG  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
               GV IP++ +K   L PEK++FF+IKAFAAGVIL+TGF+H+LPDAF++LTSP L + NP
Sbjct  54    TIGVCIPIIGKKIPALQPEKNVFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLSE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             WA FPF+G +A+ ++I TLMVD+L+ S++ +  +   K  LP +  +E+  +        
Sbjct  113   WANFPFTGFVAMLSAIGTLMVDSLSTSYYTRSHL---KNSLPVLGDEEKVGEHEGQVYVH  169

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                             S +E+   SD IR RV+SQVLELGIV HSVIIG+ LG S++ +T
Sbjct  170   THATHGHT--------SADEVG--SDLIRHRVISQVLELGIVAHSVIIGISLGASESPQT  219

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQFFEGMGLG CI QAKFKS +  +M +FFSLTTPVGI  GIGIS VY+ 
Sbjct  220   IRPLVAALTFHQFFEGMGLGSCIVQAKFKSRAATIMGLFFSLTTPVGIGIGIGISQVYDE  279

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +SSTALI +G+ N+ASAGILIYMALVDLLAADFM PK+Q N  L++  ++SL+LGAG MS
Sbjct  280   NSSTALIIEGIFNAASAGILIYMALVDLLAADFMSPKMQTNEMLKVMANISLLLGAGCMS  339

Query  1834  VLAMWA  1851
             ++A WA
Sbjct  340   LIAKWA  345



>ref|XP_010922623.1| PREDICTED: zinc transporter 8-like isoform X2 [Elaeis guineensis]
Length=349

 Score =   333 bits (854),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 230/347 (66%), Gaps = 22/347 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C+ + +G  + S    L        ++ A  SILV GA GV +P+L++    L PE 
Sbjct  24    DCDCSPD-DGDRNKSKARPL--------KIAAFFSILVCGAIGVCLPILSKSIPALSPEN  74

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L D NPW KFPF+G  A+  ++ TLM
Sbjct  75    DIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLND-NPWGKFPFAGFGAMLGALGTLM  133

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDTLA S+F +                        A  +          V+     ++  
Sbjct  134   VDTLATSYFSRAARAVGNED-----------NKGDAEMNGSAGDHRVVHVHATHGHAHGP  182

Query  1354  LVHLSDR-IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
              V  S++ +R RV+SQVLELGIVVHSVIIG+ LG S +  TIRPL+ ALSFHQFFEGMGL
Sbjct  183   AVDGSEKLVRNRVISQVLELGIVVHSVIIGISLGASDSPSTIRPLVAALSFHQFFEGMGL  242

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCIAQAKFK  S A M +FFSLTTPVGIA G GISSVYN +S TALI +G LNS +AGI
Sbjct  243   GGCIAQAKFKIKSMATMILFFSLTTPVGIAIGFGISSVYNENSPTALIVEGCLNSVAAGI  302

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLA DFM P++Q+  +LQ   ++SL++GAG MS+LA WA
Sbjct  303   LIYMALVDLLAEDFMNPRVQSKGKLQFWINISLLIGAGLMSLLAKWA  349



>gb|ABF55689.1| putative zinc transporter [Triticum aestivum]
Length=360

 Score =   333 bits (855),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 237/353 (67%), Gaps = 17/353 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             AAA   C C    +G    + K+      ++K +LVAIASIL AGAAGV +P+L R    
Sbjct  23    AAASGGCECTTATDG----ADKQ-----GAMKLKLVAIASILTAGAAGVLVPVLGRSMAA  73

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL-KDTNPWAKFPFSGLIALTA  1155
             L P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP + K       FPF+GL+A++A
Sbjct  74    LRPDGDIFFAVKAFAAGVILATGMVHILPAAFDGLTSPCIHKGGGDRNGFPFAGLVAMSA  133

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadhmhrhgaaaaaVYLD  1332
             ++AT+++D+LA  ++R+   HF K + L  +    +E   A          +   A+ + 
Sbjct  134   AMATMVIDSLAAGYYRRS--HFSKARPLDNIDMPGDEEGRADHPHMHAHGHSHGEAIVVS  191

Query  1333  PPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQF  1512
              P    E   ++D IR RVVSQVLELGI+VHSVIIG+ LG S    TI+PL+ ALSFHQF
Sbjct  192   SP----EEAAIADTIRHRVVSQVLELGILVHSVIIGVSLGASVRPSTIKPLVGALSFHQF  247

Query  1513  FEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLN  1692
             FEG+GLGGCI QA FK  +T +MA FFSLT PVGI  GI ISS YN HSSTA I +GV N
Sbjct  248   FEGIGLGGCIVQANFKVRATIIMATFFSLTAPVGIVLGIAISSSYNVHSSTAFIIEGVFN  307

Query  1693  SASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SASAGILIYM+LVDLLA DF  PK+Q N +LQL  H++L LGAG MS+LA+WA
Sbjct  308   SASAGILIYMSLVDLLATDFNNPKLQTNTKLQLMTHLALFLGAGMMSMLAIWA  360



>emb|CAN83129.1| hypothetical protein VITISV_029537 [Vitis vinifera]
Length=397

 Score =   335 bits (858),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 241/347 (69%), Gaps = 23/347 (7%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ++CTC  + E Q    S  T  T    +Y+L AI SIL A   GV++P L +K   L PE
Sbjct  74    AQCTCESDPEEQ----SSRTGAT----RYKLAAIFSILAASLIGVALPTLGKKIPALRPE  125

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              D+FF +KAFAAGVIL+TGF+H+LPDAF++LTSP L ++ PW  FPFSG +A+ ++I T+
Sbjct  126   NDVFFAVKAFAAGVILATGFIHVLPDAFESLTSPCLGES-PWGSFPFSGFVAMLSAIGTM  184

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             M+D  A  F+++      ++K   V  DEE   +     H H HG+   +  L  P    
Sbjct  185   MMDAFATGFYQR----LQRSKAQPVKEDEEMQCENQDQVHGHPHGSGFVSGELGSP----  236

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                   +  R RV++QVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGL
Sbjct  237   ------ELARHRVIAQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFFEGMGL  290

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKFKS + AVM VFFSLTTPVGIA G+GIS++Y+ +S  AL+ +GV NSASAGI
Sbjct  291   GGCISQAKFKSKAVAVMVVFFSLTTPVGIAVGMGISNIYDENSPKALVVEGVFNSASAGI  350

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDL+AADFM P++Q N +LQ+  ++ L+LG   MS+LA WA
Sbjct  351   LIYMALVDLVAADFMSPRMQTNFKLQIAANILLLLGTACMSLLAKWA  397



>ref|XP_010922622.1| PREDICTED: zinc transporter 8-like isoform X1 [Elaeis guineensis]
Length=349

 Score =   333 bits (853),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 230/347 (66%), Gaps = 22/347 (6%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C+ + +G  + S    L        ++ A  SILV GA GV +P+L++    L PE 
Sbjct  24    DCDCSPD-DGDRNKSKARPL--------KIAAFFSILVCGAIGVCLPILSKSIPALSPEN  74

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L D NPW KFPF+G  A+  ++ TLM
Sbjct  75    DIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLND-NPWGKFPFAGFGAMLGALGTLM  133

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDTLA S+F +                        A  +          V+     ++  
Sbjct  134   VDTLATSYFSRAARAVGNED-----------NKGDAEMNGSAGDHRVVHVHATHGHAHGP  182

Query  1354  LVHLSDR-IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
              V  S++ +R RV+SQVLELGIVVHSVIIG+ LG S +  TIRPL+ ALSFHQFFEGMGL
Sbjct  183   AVDGSEKLVRNRVISQVLELGIVVHSVIIGISLGASDSPSTIRPLVAALSFHQFFEGMGL  242

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCIAQAKFK  S A M +FFSLTTPVGIA G GIS+VYN +S TALI +G LNS +AGI
Sbjct  243   GGCIAQAKFKIKSIATMILFFSLTTPVGIAIGFGISTVYNENSPTALIVEGCLNSVAAGI  302

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLA DFM P++Q+  +LQ   +VSL++GAG MS+LA WA
Sbjct  303   LIYMALVDLLAEDFMNPRVQSKGKLQFWINVSLLIGAGLMSLLAKWA  349



>ref|XP_009396993.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=353

 Score =   333 bits (854),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 247/369 (67%), Gaps = 28/369 (8%)
 Frame = +1

Query  757   YIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGA  936
             ++I++  P        A  +C C+ + E +     K+      +L  ++ AI SILV G 
Sbjct  9     FLIVLLLPLV------ARGDCDCSADEESR---DKKK------ALPLKIAAIFSILVCGG  53

Query  937   AGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPW  1116
              GV IP+L +    L P+KDIFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L  ++PW
Sbjct  54    FGVCIPILGKWIPALRPDKDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCLP-SSPW  112

Query  1117  AKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKL----PQVSadeeeakdaaaa  1284
               FPF+G  A+ A++ TLM+DT+A  +F +  +H +K +        +  E+ +      
Sbjct  113   QDFPFAGFGAMVAAVGTLMIDTIATGYFNR--LHGNKMRTTVSDETNADVEKTSDGLDHV  170

Query  1285  dhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQT  1464
                  HG A  +  +D   ++ +L      IR RV+SQVLELGI+VHSVIIG+ LG S+ 
Sbjct  171   HTHATHGHAHGSTMMDSADASAQL------IRNRVISQVLELGIIVHSVIIGISLGASEV  224

Query  1465  RETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSV  1644
               TIRPL+ ALSFHQFFEGMGLGGCI QAKFK+ S   M +FFSLTTPVGIA GIGI+SV
Sbjct  225   PSTIRPLVAALSFHQFFEGMGLGGCIVQAKFKAKSIVTMGLFFSLTTPVGIAIGIGIASV  284

Query  1645  YNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAG  1824
             Y+ +S TALI +G LNS ++GILIYMALVDLLAADFM P++Q+  RLQ   +VSL++GAG
Sbjct  285   YDENSPTALIVEGCLNSVASGILIYMALVDLLAADFMNPRVQSKARLQFMINVSLLVGAG  344

Query  1825  SMSVLAMWA  1851
              MS+LA WA
Sbjct  345   LMSLLAKWA  353



>gb|ACN38063.1| zinc transporter protein [Sedum alfredii]
Length=368

 Score =   333 bits (854),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 240/347 (69%), Gaps = 15/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ++CTC+G  +  +  SSK+  V   +LKY++VA+ +IL+ G  G+  P+ + K   L PE
Sbjct  37    AKCTCDGPED--ISSSSKDKAV---ALKYKIVAVVTILIGGVIGICFPVFSHKIPQLSPE  91

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              ++FFMIKAFAAGVILSTGF+H+LP+AF+ L SP L +T PW KFPF+G +A+ A++ TL
Sbjct  92    TNVFFMIKAFAAGVILSTGFIHVLPEAFKRLMSPCLSET-PWDKFPFTGFVAMVATMLTL  150

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             M+D  A  F+ +K     K ++  V  +E+ +    A  H           +     S +
Sbjct  151   MIDAFATPFYTRKSNATTKLQVVGVDEEEQGSHMQQAHTHT---------AHGHSHGSAD  201

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             +    SD +RQRV+SQVLELGIVVHSVIIG+ LG S    TI+PLL AL+FHQFFEG+GL
Sbjct  202   QGTGASDLLRQRVISQVLELGIVVHSVIIGVSLGASNDLATIKPLLAALTFHQFFEGLGL  261

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCIAQAKFK+ + A M +FFSLT P+GIA GIG+SS Y  +SS  LI  G+ ++ASAGI
Sbjct  262   GGCIAQAKFKARTIATMVLFFSLTAPIGIAIGIGVSSTYKENSSKELILPGLFDAASAGI  321

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIY ALVDLLAADFM  ++Q+N  LQ+G  +SL +GAG MS+LA+WA
Sbjct  322   LIYTALVDLLAADFMGQRLQSNGMLQIGASISLFIGAGCMSLLAIWA  368



>ref|XP_006468557.1| PREDICTED: zinc transporter 8-like isoform X2 [Citrus sinensis]
 ref|XP_006468559.1| PREDICTED: zinc transporter 8-like isoform X2 [Citrus sinensis]
 gb|KDO77254.1| hypothetical protein CISIN_1g018051mg [Citrus sinensis]
Length=361

 Score =   333 bits (853),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 243/352 (69%), Gaps = 12/352 (3%)
 Frame = +1

Query  796   TAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE  975
             +A+AE +C     + G  H +         +LK ++VAI SIL+AGA GVSIP   +   
Sbjct  22    SASAECKCDLTETIGGSGHKN--------KALKLKIVAILSILIAGAFGVSIPSFGKNIS  73

Query  976   FLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTA  1155
                PE +IFF+IKAFAAGVIL+TGFVHILPDA+++LTSP L    PW  FPF+G +A+ +
Sbjct  74    TFHPENNIFFIIKAFAAGVILATGFVHILPDAYESLTSPCL-SPKPWQDFPFTGFVAMVS  132

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             +I T+MVD  A SF+++  +HF K  LP    D+E   +     H+H H     A     
Sbjct  133   AILTMMVDAFATSFYQR--LHFSKA-LPVNDDDKEMHAEHEGHVHVHTHATHGHAHGSAF  189

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
               S+      SD  R R+VSQVLELGIVVHSVIIG+ LG S + +TI+PL+ AL+FHQFF
Sbjct  190   ASSDASGSGTSDLFRHRIVSQVLELGIVVHSVIIGISLGASGSVKTIKPLVAALTFHQFF  249

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EGMGLGGCI+QAKFKS + A M +FFSLTTPVGI  GIGIS VY  +S TAL+ +G+ NS
Sbjct  250   EGMGLGGCISQAKFKSKAVAAMILFFSLTTPVGIGIGIGISKVYKENSPTALVIEGIFNS  309

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYMALVDLLA DFM PK+Q N +LQLG + SL+LG+G MS+LA WA
Sbjct  310   ASAGILIYMALVDLLATDFMSPKLQTNFKLQLGANFSLLLGSGCMSLLAKWA  361



>gb|AFK49414.1| unknown [Medicago truncatula]
Length=358

 Score =   332 bits (852),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 242/347 (70%), Gaps = 14/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E  L     +      +L+Y++ A+ SILVA   GV IPLL +    L PE
Sbjct  26    AECTCD---EEDLDRDKPK------ALRYKIAALVSILVASGIGVCIPLLGKVIPALSPE  76

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KDIFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK  +PW  FPF+G +A+  ++ TL
Sbjct  77    KDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPRLKK-HPWGDFPFTGFVAMCTAMGTL  135

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A ++F+    H+ K    QV  +     +     HM  H  A+   +  P  S+ 
Sbjct  136   MVDTYATAYFQN---HYSKKAPAQVENEVSPDVEKDHEGHMDVHTHASHG-HAHPHMSSV  191

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  ++ +R RV++QVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGL
Sbjct  192   SSGPSTELLRHRVITQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFHQFFEGMGL  251

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             G CI QA FKS+S  +M +FF+LTTPVGIA GIGISS Y+ +S TALI +G+ N+AS+GI
Sbjct  252   GSCITQANFKSLSITIMGLFFALTTPVGIAIGIGISSGYDENSPTALIVEGIFNAASSGI  311

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++Q +  L+LG ++ L+LG+G M ++A WA
Sbjct  312   LIYMALVDLLAADFMNPRMQKSGILRLGCNIFLLLGSGLMFLIAKWA  358



>ref|XP_004243649.1| PREDICTED: zinc transporter 5-like [Solanum lycopersicum]
Length=342

 Score =   332 bits (850),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 188/367 (51%), Positives = 254/367 (69%), Gaps = 34/367 (9%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+ I++  P  + G      +CTC+   E    Y +K+     ++LKY++ A+ASILVA 
Sbjct  9     FWYILLVLPAIVLGDLG---DCTCDPEDE----YRNKK-----EALKYKMAALASILVAS  56

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             + GV IP+L +    L PE+++FF+IKAFAAGVILSTGF+H+LPDA+ +LTSP L   +P
Sbjct  57    SIGVIIPVLGKAIPALSPERNLFFIIKAFAAGVILSTGFIHVLPDAYGSLTSPCLAK-HP  115

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPFSG IA+ +++ATLMVDT A S++ KK +  +   + Q                 
Sbjct  116   WGDFPFSGFIAMVSALATLMVDTYANSYYSKKNLE-NGVAVAQ-----------------  157

Query  1294  hrhgaaaaaVYLDPPPSNNELVH-LSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRE  1470
                G     V+     S + +V   S+ +R RV+SQVLELGI+VHSVIIG+ LG S+T +
Sbjct  158   --SGDEGGVVHPHSHGSGSMMVDSKSELLRYRVISQVLELGIIVHSVIIGIALGASETPK  215

Query  1471  TIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYN  1650
              I+PL+ AL+FHQFFEG+GLGGCIAQAK KS + A+M + FSLTTP+GI  G+GI++VY+
Sbjct  216   NIKPLVAALTFHQFFEGLGLGGCIAQAKLKSRTIAIMTLLFSLTTPIGIGIGLGITNVYD  275

Query  1651  PHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSM  1830
              +S TALI +GV NSASAGILIYMALVD LAADFM P++Q+N +LQLG + SL+LGAG M
Sbjct  276   ENSPTALIVEGVFNSASAGILIYMALVDFLAADFMHPRMQSNGKLQLGANFSLLLGAGLM  335

Query  1831  SVLAMWA  1851
             S+LA+WA
Sbjct  336   SMLAIWA  342



>emb|CAN74488.1| hypothetical protein VITISV_029272 [Vitis vinifera]
Length=351

 Score =   332 bits (851),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 245/346 (71%), Gaps = 17/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +CTC+ + +G    +         +L+Y++ AI +IL  GA GV IP+L +    L PEK
Sbjct  23    DCTCDKD-DGDRDKNK--------ALRYKIAAIIAILAGGAIGVCIPILGKTIPALHPEK  73

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             ++FF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP L + NP   FPF+G +A+ ++I TLM
Sbjct  74    NVFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLNE-NPXGDFPFTGFVAMVSAIGTLM  132

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD  A S++     HF K +         + + A   +        A   +     S+ E
Sbjct  133   VDACATSYYSXS--HFKKAQ-----QAVGDEEKAGEHEGHVHVHTHATHGHAHGSASSAE  185

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
              +  ++ IR RV+SQVLELGIVVHSVIIG+ LG S++ +TI+PL+ AL+FHQFFEGMGLG
Sbjct  186   EMGSAELIRHRVISQVLELGIVVHSVIIGISLGASESPKTIKPLVAALTFHQFFEGMGLG  245

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKFK  + A+MA+FFSLTTPVGIA GIGIS+VY+ +SSTALI +G+ N+ASAGIL
Sbjct  246   GCIVQAKFKLRAAAIMALFFSLTTPVGIAIGIGISNVYDENSSTALIVEGIFNAASAGIL  305

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDLLAADFM P++Q N RLQ+G ++SL++GAG MS+LA WA
Sbjct  306   IYMALVDLLAADFMNPRMQGNGRLQVGANISLLVGAGCMSLLAKWA  351



>ref|XP_002265102.1| PREDICTED: zinc transporter 8 [Vitis vinifera]
Length=345

 Score =   332 bits (850),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 248/366 (68%), Gaps = 29/366 (8%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F + II  P  + G      EC C+            E      +L+Y++ AIASILV G
Sbjct  9     FILFIIRLPTLVLG------ECACD---------EEDEDRDRDKALRYKIAAIASILVGG  53

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
               GV IP++ +K   L PEK++FF+IKAFAAGVIL+TGF+H+LPDAF++LTSP L + NP
Sbjct  54    TIGVCIPIIGKKIPALQPEKNVFFVIKAFAAGVILATGFIHVLPDAFESLTSPCLSE-NP  112

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             WA FPF+G +A+ ++I TLMVD+L+ S++ +  +   K  LP +  +E+  +        
Sbjct  113   WANFPFTGFVAMLSAIGTLMVDSLSTSYYTRSHL---KNSLPVLGDEEKVGEHEGQVYVH  169

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                             S +E+   SD IR RV+SQVLELGIV HSVIIG+ LG S++ +T
Sbjct  170   THATHGHT--------SADEVG--SDLIRHRVISQVLELGIVAHSVIIGISLGASESPQT  219

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             I+PL+ AL+FHQFFEGMGLG CI QAKFKS +  +M +FFSLTTPVGI  GIGIS VY+ 
Sbjct  220   IKPLVAALTFHQFFEGMGLGSCIVQAKFKSRAATIMGLFFSLTTPVGIGIGIGISQVYDE  279

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +SSTALI +G+ N+ASAGILIYMALVDLLAADFM PK+Q N  L++  ++SL+LGAG MS
Sbjct  280   NSSTALIIEGIFNAASAGILIYMALVDLLAADFMSPKMQTNEMLKVMANISLLLGAGCMS  339

Query  1834  VLAMWA  1851
             ++A WA
Sbjct  340   LIAKWA  345



>ref|XP_010931295.1| PREDICTED: zinc transporter 8-like [Elaeis guineensis]
Length=350

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 227/347 (65%), Gaps = 18/347 (5%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
              +C C+ + +G+    ++           ++ AI SIL+ GA GV +P+  +  + L PE
Sbjct  22    GDCDCSPDDDGRDKSKAQ---------PLKIAAIFSILIFGAIGVCLPIFGKSIQSLRPE  72

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              DIFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L D NPW  FPF+G  A+  ++ TL
Sbjct  73    NDIFFVIKAFAAGVILATGFIHILPDAFENLTSPCL-DENPWGNFPFAGFGAMLGALGTL  131

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDTLA  +F++            V                H H    AA+  D  P   
Sbjct  132   MVDTLATGYFKRAARAVGDELKGDVEMSGPGGDRGVHVHATHGHAHGPAALEADEGPQK-  190

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                     +R RV+SQVLELGIVVHSVIIG+ LG S+T  TIRPL+VALSFHQFFEG+GL
Sbjct  191   -------LVRHRVISQVLELGIVVHSVIIGISLGASETPATIRPLIVALSFHQFFEGVGL  243

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCIAQAKFK    A M +FFSLTTPVGIA G GISSVYN  S TALI +G+LNS +AGI
Sbjct  244   GGCIAQAKFKVRPMATMILFFSLTTPVGIAIGFGISSVYNEDSPTALIVEGILNSVAAGI  303

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYM+LVDLLA DFM P++Q+N  LQ   +VSL++G G MS+LA WA
Sbjct  304   LIYMSLVDLLAEDFMNPRVQSNGTLQFEINVSLLIGVGLMSLLAKWA  350



>ref|XP_003568257.1| PREDICTED: zinc transporter 9-like [Brachypodium distachyon]
Length=369

 Score =   332 bits (852),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 187/353 (53%), Positives = 244/353 (69%), Gaps = 10/353 (3%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             A   +C C  + E       K +     +L  +++A+ SILVAGAAG +IP L R++  L
Sbjct  24    ALAGDCECEASSEADDGGDDKAS-----ALNLKIIAVFSILVAGAAGCAIPSLGRRFPAL  78

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
             GP+ ++FF +KAFAAGVIL+T FVHILP+AF  L SP L+   PW KFPF+GL+A+ A+I
Sbjct  79    GPDTNLFFAVKAFAAGVILATAFVHILPEAFDRLGSPCLEGHGPWRKFPFAGLVAMLAAI  138

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             ATL+VDT+A  +F++   H  K   P V  D+ E   +AA    H HG  A++  +    
Sbjct  139   ATLVVDTVATGYFQRA--HGAKKLAPAVDGDDVEGSGSAADHRSHVHGHGASSAAVIASS  196

Query  1342  SNNELVHLSDR---IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQF  1512
             S+       D    IR R++SQVLELGIVVHSVIIG+ LG SQ  +TIRPL++AL+FHQF
Sbjct  197   SSAASHSHVDGAELIRHRIISQVLELGIVVHSVIIGMSLGASQNADTIRPLVIALTFHQF  256

Query  1513  FEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLN  1692
             FEG+GLGGCI QAKF+  S   MA+FFSLTTPVG+  GIGISS YN  S  AL+ QG+L+
Sbjct  257   FEGIGLGGCIVQAKFRLRSVLAMALFFSLTTPVGVVIGIGISSGYNETSPRALVVQGLLS  316

Query  1693  SASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +A+AGIL YMALVDLLA DFM P++QNN RLQ+  ++SL+LG   MS+LA+WA
Sbjct  317   AAAAGILNYMALVDLLAEDFMNPRVQNNGRLQVVVNISLLLGTALMSMLAIWA  369



>ref|XP_008792254.1| PREDICTED: zinc transporter 8-like [Phoenix dactylifera]
Length=349

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 181/346 (52%), Positives = 229/346 (66%), Gaps = 19/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C+ + EGQ    ++           ++ +I SILV GA G+ +P+ ++    L PE 
Sbjct  23    DCECSPDDEGQDKSKAR---------PLKIASIFSILVFGAIGICLPIFSKSIPSLRPEN  73

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             DIFF+IKAFAAGVIL+TGF+HILPDAF  LTSP L D NPW  FPF+G +A+  ++ TLM
Sbjct  74    DIFFVIKAFAAGVILATGFIHILPDAFANLTSPCL-DENPWGNFPFAGFVAMLGALGTLM  132

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDTLAM + ++            V                 R    AA   L+    + +
Sbjct  133   VDTLAMGYLKRSAREEGDELKGDVEMSGPAGDHLHVHATHARARGHAA---LEVDDGSQK  189

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
             LV      R RV+SQVLELGIVVHS+IIG+ LG S++   I+ L+VALSFHQFFEGMGLG
Sbjct  190   LV------RHRVISQVLELGIVVHSIIIGISLGASESPSIIKSLIVALSFHQFFEGMGLG  243

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QAKFK  S A M +FFSLTTPVGI  G GISSVYN +S TALI +G+LNSA+AGIL
Sbjct  244   GCIVQAKFKVKSRATMILFFSLTTPVGIVIGFGISSVYNENSPTALIVEGILNSAAAGIL  303

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYM+LVDLLA DFM P++Q+  +LQ G +VSL++GAG MS+LA WA
Sbjct  304   IYMSLVDLLAEDFMNPRVQSKGKLQFGINVSLLIGAGLMSLLAKWA  349



>ref|XP_006448619.1| hypothetical protein CICLE_v10015713mg [Citrus clementina]
 gb|ESR61859.1| hypothetical protein CICLE_v10015713mg [Citrus clementina]
Length=361

 Score =   331 bits (848),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 241/352 (68%), Gaps = 12/352 (3%)
 Frame = +1

Query  796   TAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE  975
             +A+AE +C       G  H +         +LK ++VAI SIL+AGA GVSIP   +   
Sbjct  22    SASAECKCDLTETTGGSGHKN--------KALKLKIVAILSILIAGAFGVSIPSFGKNIS  73

Query  976   FLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTA  1155
                PE +IFF+IKAFAAGVIL+TGFVHILPDA+++LTSP L    PW  FPF+G +A+ +
Sbjct  74    TFHPENNIFFIIKAFAAGVILATGFVHILPDAYESLTSPCL-SPKPWQDFPFTGFVAMVS  132

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             +I T+MVD  A SF+++  +HF K  LP    D+E   +     H+H H     A     
Sbjct  133   AILTMMVDAFATSFYQR--LHFSKA-LPVNDDDKEMHAEHEGHVHVHTHATHGHAHGSAF  189

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
               S+      SD  R R+VSQVLELGIVVHSVIIG+ LG S + +TI+PL+ AL+FHQFF
Sbjct  190   ASSDASGSGTSDLFRHRIVSQVLELGIVVHSVIIGISLGASGSVKTIKPLVAALTFHQFF  249

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EGMGLGGCI+QAKFKS S   M +FFSLTTPVGI  GIGIS VY  +S TAL+ +G+ NS
Sbjct  250   EGMGLGGCISQAKFKSKSIVAMILFFSLTTPVGIGIGIGISKVYKENSPTALVIEGIFNS  309

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYMALVDLLA DFM PK+Q N +LQLG + SL+LG+G MS+LA WA
Sbjct  310   ASAGILIYMALVDLLATDFMSPKLQTNFKLQLGANFSLLLGSGCMSLLAKWA  361



>gb|KDP35622.1| hypothetical protein JCGZ_09060 [Jatropha curcas]
Length=350

 Score =   330 bits (847),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 193/349 (55%), Positives = 244/349 (70%), Gaps = 20/349 (6%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A  ECTC          +  E +    + KY++ AIA+ILVAGA GV +P+  +    L 
Sbjct  22    AHGECTCE---------AEDEVIDKSLARKYKVAAIAAILVAGAIGVCLPIAGKFIPALR  72

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PEKDIFF+IKAFAAGVILSTGF+H+LPDAF+ LTSP L D NPW KFPF+G IA+ ++I 
Sbjct  73    PEKDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCL-DENPWGKFPFTGFIAMVSAIG  131

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLMVD  A S++ K  +   ++    +SADEE+  D     H H     +  + L     
Sbjct  132   TLMVDAFATSYYSKSHLKNQQS----ISADEEKVGDGEVHVHTHASHGHSHGMVLAENSV  187

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
              +EL      +R RV+SQVLELGIVVHSVIIG+ LG S+  +TIRPL+ AL+FHQFFEGM
Sbjct  188   TSEL------LRHRVISQVLELGIVVHSVIIGISLGASENPKTIRPLIAALTFHQFFEGM  241

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAKFK+ + A+M+ FFSLTTPVGIA GI IS+ Y+ +S  ALI QGV N+AS+
Sbjct  242   GLGGCISQAKFKAKTVAIMSTFFSLTTPVGIAIGIAISNGYDENSPKALIVQGVFNAASS  301

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYM+LVDLLAADFM P++Q N +LQLG +  L+ GAG MS+LA WA
Sbjct  302   GILIYMSLVDLLAADFMNPRVQANGKLQLGVNFFLLFGAGCMSLLAKWA  350



>ref|XP_010691362.1| PREDICTED: zinc transporter 1-like [Beta vulgaris subsp. vulgaris]
Length=356

 Score =   330 bits (847),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 193/367 (53%), Positives = 254/367 (69%), Gaps = 21/367 (6%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F +++IF+   ++      S+CTC+   EG      K      D+LKY+L AIA+IL AG
Sbjct  10    FSLVVIFYATLVA------SDCTCDS--EGLQATDPKS-----DTLKYKLGAIAAILAAG  56

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             + GV +P+L +    L PE ++FF++K+FAAGVILSTGF+HILPDAF+ LT+P LKD  P
Sbjct  57    SLGVFLPILGKNIPALHPESNLFFLVKSFAAGVILSTGFIHILPDAFEDLTNPCLKD--P  114

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPF+GL A+  ++ +LM+D  A  ++R+   H+ K   P  SA  +E + A  A H+
Sbjct  115   WGSFPFTGLFAMVGALGSLMIDAFATGYYRRA--HYAK---PASSASVDEERSAEHAGHV  169

Query  1294  hrhgaaaaaVYLDPPP-SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRE  1470
             H H          P P +  E +   D IR ++ SQVLE+GI+VHSVIIGL LGTSQ+ +
Sbjct  170   HLHSHGTHGHAHGPGPGATPEGLKELDLIRYKITSQVLEMGILVHSVIIGLSLGTSQSLD  229

Query  1471  TIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYN  1650
             TI+PL+ AL FHQFFEG+GLGGCI QA FKS ST  MA+FFSLTTPVG+A GIGIS+ Y+
Sbjct  230   TIKPLMAALCFHQFFEGVGLGGCIVQAAFKSASTLCMALFFSLTTPVGVAVGIGISNSYD  289

Query  1651  PHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSM  1830
               S TALI QG+LN+ + GILIYMALVDLLA DFM PK+Q N RL  G +++L+LGAG M
Sbjct  290   DSSPTALIVQGLLNAIAGGILIYMALVDLLAQDFMSPKVQTNTRLFFGANITLLLGAGCM  349

Query  1831  SVLAMWA  1851
             +VLA+WA
Sbjct  350   AVLAIWA  356



>gb|AFN88220.1| zinc transporter protein [Phaseolus vulgaris]
Length=354

 Score =   330 bits (846),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 239/363 (66%), Gaps = 40/363 (11%)
 Frame = +1

Query  778   PCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPL  957
             PC + G      EC C  N E +     ++ L  V + KY++ A+ SIL+A A GV++PL
Sbjct  27    PCTVDG------ECKCCKNDEDE---GGEKVLDKVLARKYKIGALVSILLASAVGVTLPL  77

Query  958   LARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSG  1137
             L++ +  L PEKD FFM+KAFAAGVILSTGF+H+LPDAF+ LT P L D +PW  F F+G
Sbjct  78    LSKIFPALHPEKDFFFMVKAFAAGVILSTGFIHVLPDAFEKLTPPSLCD-HPWDDFSFAG  136

Query  1138  LIALTASIATLMVDTLAMSFFRKKMMH-----FDKTKLPQVSadeeeakdaaaadhmhrh  1302
              +A+ A+I TLMVD+LA ++F+K  +       D+  L    A    A  + A+      
Sbjct  137   FVAMLAAIGTLMVDSLATAYFKKSTIRDMDGVVDEEDLHNHHATHSHAPASMAS------  190

Query  1303  gaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRP  1482
                         PS       +D +R RVVSQVLELGIVVHSVIIG+ LG S+  +TIRP
Sbjct  191   ------------PS-------TDLLRHRVVSQVLELGIVVHSVIIGISLGASENPKTIRP  231

Query  1483  LLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSS  1662
             L+ AL+FHQFFEGMGLGGCI+QA+ K  +  +MA+FFSLTTPVGIA G+ IS  Y   S 
Sbjct  232   LIAALTFHQFFEGMGLGGCISQARLKRRAVIIMALFFSLTTPVGIAIGMIISGGYEEDSP  291

Query  1663  TALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLA  1842
              ALI +G+LN+ASAGILIYM+LVDLLA D M PKIQ +  LQ+G + SL++GA  MS+LA
Sbjct  292   RALIVEGILNAASAGILIYMSLVDLLAPDLMHPKIQASTTLQIGVNASLLIGAAFMSLLA  351

Query  1843  MWA  1851
              WA
Sbjct  352   KWA  354



>ref|XP_004502089.1| PREDICTED: zinc transporter 5-like [Cicer arietinum]
Length=353

 Score =   330 bits (846),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 244/347 (70%), Gaps = 20/347 (6%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E +    SK       +L+Y++ A+ SILVA   GV IPLL +    L PE
Sbjct  27    AECTCDEEDEDR--NKSK-------ALRYKIAALVSILVASTIGVCIPLLGKVIPALSPE  77

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KDIFF+IKAFAAGVILSTGF+H+LPDAF+ LTSP LK+ +PW  FPF+G +A+  ++ TL
Sbjct  78    KDIFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLKE-HPWGDFPFTGFVAMCTAMGTL  136

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A ++F+K   H  KT   QV  +     D     H H     A        P +N
Sbjct  137   MVDTYATAYFQKH--HSKKTPTTQVDCETNPEVDGHIDLHTHVSHGHAHGHV----PFDN  190

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  S+ +R RV+SQVLELGI+VHS+IIG+ LG S++ +TIRPL+ AL+FHQFFEGMGL
Sbjct  191   S----SELLRHRVISQVLELGIIVHSIIIGISLGASESPKTIRPLVAALTFHQFFEGMGL  246

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             G CI QA FKSVS  +M +FF+LTTPVGI  G+GISSVY+ +S TALI +G+ N+AS+GI
Sbjct  247   GSCITQANFKSVSITIMGLFFALTTPVGIGIGLGISSVYDENSPTALIVEGIFNAASSGI  306

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++Q + RL LG +VSL+LGAG MS++A WA
Sbjct  307   LIYMALVDLLAADFMNPRMQKSGRLTLGCNVSLLLGAGCMSLIAKWA  353



>gb|KCW88546.1| hypothetical protein EUGRSUZ_A00918 [Eucalyptus grandis]
Length=356

 Score =   330 bits (845),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 235/332 (71%), Gaps = 18/332 (5%)
 Frame = +1

Query  883   DSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHIL  1062
             ++LKY++ AIA+IL+AGA GV IPLL +    L PEKD+FF++KAFAAGVIL+TG +H+L
Sbjct  34    EALKYKVGAIAAILLAGAVGVCIPLLGKVVPALRPEKDVFFLVKAFAAGVILATGLIHVL  93

Query  1063  PDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQ  1242
             PDAF +LTSP L D NPW KFPF+G +A+ A++ TLMVDT A S++ +   HF K +  +
Sbjct  94    PDAFDSLTSPCL-DENPWGKFPFAGFVAMVAAVGTLMVDTYATSYYTRS--HFSKARPAE  150

Query  1243  VSadeeeakdaaa---------adhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVS  1395
                DEE    A A               HG A  + Y    P  +EL      +R RVVS
Sbjct  151   SEGDEESDAAATAGDDHAGHLHVHTHATHGHAHGSAYQGHEPGTSEL------LRHRVVS  204

Query  1396  QVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTA  1575
             QVLELGIVVHSVIIG+ LGTS + +T++PL+ AL+FHQFFEGMGLGGCI QAKFK+ +T 
Sbjct  205   QVLELGIVVHSVIIGISLGTSGSAKTVKPLMAALTFHQFFEGMGLGGCITQAKFKARTTI  264

Query  1576  VMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFM  1755
             +MA+FFSLTTP GIA GIGIS  Y+  S  ALI +GV N+ASAGIL+YMALVDLLAADFM
Sbjct  265   IMALFFSLTTPAGIAIGIGISDTYDESSQRALIIEGVFNAASAGILVYMALVDLLAADFM  324

Query  1756  KPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
               K+Q N RLQL  +  L+ GAG M+ LA WA
Sbjct  325   SAKVQGNGRLQLLCNCFLLFGAGCMAFLAKWA  356



>ref|XP_009400783.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=345

 Score =   329 bits (844),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 187/349 (54%), Positives = 236/349 (68%), Gaps = 25/349 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
              + E  C+ + EG+    +         L  ++ AI SILV G  GV +P+L    + L 
Sbjct  22    GDGEGDCSADDEGRDRKKA---------LPLKIGAIVSILVCGGIGVGVPVLGMWIQSLR  72

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PEKDIFF+IKAFAAGVIL+TGF+HILPDAF+TLTS  L   +PW  FPF+G  A+  +I 
Sbjct  73    PEKDIFFVIKAFAAGVILATGFIHILPDAFETLTSSCLA-ASPWQDFPFAGFCAMVGAIG  131

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLMVDTLA  +F +  ++ D+ +   +S       +A   D    HG    A  + P  S
Sbjct  132   TLMVDTLATGYFSR--LNGDRLRSTSLS-------EATNGDVEATHGHTHGAAVMQPEDS  182

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             + +L      IR RVVSQVLELGIVVHSVIIG+ LG S++  TIRPL+VALSFHQFFEGM
Sbjct  183   SAQL------IRHRVVSQVLELGIVVHSVIIGISLGASESPSTIRPLVVALSFHQFFEGM  236

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI QA+F   +   M +FFSLTTPVGIA G GISSVYN +S TALI QG+L+S +A
Sbjct  237   GLGGCIVQARFDFKAMVTMGLFFSLTTPVGIAIGTGISSVYNENSPTALIVQGLLDSVAA  296

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLAADFM P++Q+  +LQ   +VSL+ G+G M++LA WA
Sbjct  297   GILIYMALVDLLAADFMHPRVQSKPKLQFALNVSLLAGSGLMALLAKWA  345



>ref|NP_001149008.1| zinc transporter 1 precursor [Zea mays]
 ref|XP_008667983.1| PREDICTED: zinc transporter 1 isoform X1 [Zea mays]
 gb|ACG33791.1| zinc transporter 1 precursor [Zea mays]
 tpg|DAA36061.1| TPA: zinc transporter 1 [Zea mays]
Length=367

 Score =   330 bits (846),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 231/335 (69%), Gaps = 16/335 (5%)
 Frame = +1

Query  877   TVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVH  1056
             ++ ++K +L+AIASIL AGAAGV +P+L R    L P+ DIFF +KAFAAGVIL+TG VH
Sbjct  39    SLGAMKLKLIAIASILTAGAAGVLVPVLGRSMAALHPDGDIFFAVKAFAAGVILATGMVH  98

Query  1057  ILPDAFQTLTSP-LLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK  1233
             ILP AF  LTSP L K  +    FPF+GLIA++A++AT+++D+LA  ++R+   HF K +
Sbjct  99    ILPAAFDGLTSPCLYKGGSGGNIFPFAGLIAMSAAMATMVIDSLAAGYYRRS--HFKKAR  156

Query  1234  ---------LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQR  1386
                       P        A+      H     +      +  P    E   ++D IR R
Sbjct  157   PIDILEIHEQPGDEERSGHAQHVHVHTHATHGHSHGEVDVISSP----EEASIADTIRHR  212

Query  1387  VVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSV  1566
             VVSQVLELGI+VHSVIIG+ LG S    TIRPL+ ALSFHQFFEG+GLGGCI QA FK  
Sbjct  213   VVSQVLELGILVHSVIIGVSLGASVRSSTIRPLVGALSFHQFFEGIGLGGCIVQANFKLR  272

Query  1567  STAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAA  1746
             +T +MA+FFSLT P+GIA GIGISS YN HS+TA I +GV NSASAGILIYM+LVDLLA 
Sbjct  273   ATVMMAIFFSLTAPIGIALGIGISSSYNGHSTTAFIVEGVFNSASAGILIYMSLVDLLAT  332

Query  1747  DFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             DF KPK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  333   DFNKPKLQTNTKLQLMTYLALFLGAGMMSMLAIWA  367



>ref|XP_009419521.1| PREDICTED: zinc transporter 3-like [Musa acuminata subsp. malaccensis]
Length=403

 Score =   330 bits (845),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/358 (53%), Positives = 245/358 (68%), Gaps = 26/358 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A  +C C          + +E   +  +L  +L+AIA+IL AGA GV IP+L R +  + 
Sbjct  63    ASGDCDCT---------TKREARDSAKALTLKLIAIAAILSAGAMGVLIPILGRSFAAMS  113

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE D+FF+IKAFAAGVIL+TG +HILPDAF++LTSP L +   W  FP +G IA+++++ 
Sbjct  114   PESDVFFVIKAFAAGVILATGLIHILPDAFESLTSPCLGEQQ-WQDFPVAGFIAMSSAMV  172

Query  1165  TLMVDTLAMSFFRKKMMHF---------DKTKLPQVSadeeeakdaaaadhmhrhgaaaa  1317
             TLM+D+ A S++ +   HF         D+ K  + SA +            H H   +A
Sbjct  173   TLMIDSFATSYYERS--HFSKARPVEEKDERKGDEESARDHAGHVHVHTHATHGHAHGSA  230

Query  1318  aVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVAL  1497
             A    P     E   LSD+IR RV+SQVLELGI+VHSVIIG+ LG S+T  TIRPL+ AL
Sbjct  231   AAAGSP-----EEASLSDKIRHRVISQVLELGILVHSVIIGISLGASETSSTIRPLVAAL  285

Query  1498  SFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALIT  1677
             SFHQFFEG+GLGGCI QAKF++ +T +MAVFFSLT P+GI+ GI ISS Y+  SSTALI 
Sbjct  286   SFHQFFEGIGLGGCIVQAKFRAKATVIMAVFFSLTAPIGISLGIAISSSYDETSSTALII  345

Query  1678  QGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             QG+ N+ASAGILIYM+LVDLLAADF  P++Q+N RLQ G H++L+LGAG MS+LA WA
Sbjct  346   QGIFNAASAGILIYMSLVDLLAADFKNPRMQSNGRLQFGAHLALLLGAGLMSLLARWA  403



>ref|XP_003581657.2| PREDICTED: zinc transporter 3-like isoform X1 [Brachypodium distachyon]
Length=360

 Score =   328 bits (841),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 188/355 (53%), Positives = 236/355 (66%), Gaps = 20/355 (6%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             AA S C C    +G    + K+      ++K +LVAIASIL AGAAGV +P+L R    L
Sbjct  21    AAASGCDCTAATDG----ADKQ-----GAMKLKLVAIASILTAGAAGVLVPVLGRSLAAL  71

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL-KDTNPWAKFPFSGLIALTAS  1158
              P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP L K       FPF+GL+A++A+
Sbjct  72    RPDGDIFFAVKAFAAGVILATGMVHILPAAFDGLTSPCLHKGGGGRNGFPFAGLVAMSAA  131

Query  1159  IATLMVDTLAMSFFRK----KMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVY  1326
             +AT+++D+LA  ++R+    K    +   +P  + +EE   +             A  V 
Sbjct  132   MATMVIDSLAAGYYRRSNFSKARPIENVDIPGQAGEEEGRTEHVHHATHGHSHGEAVVV-  190

Query  1327  LDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFH  1506
                  S+ E   ++D IR RVVSQVLELGI+VHSVIIG+ LG S    TIRPL+ ALSFH
Sbjct  191   -----SSPEEASIADTIRHRVVSQVLELGILVHSVIIGVSLGASVRPSTIRPLVGALSFH  245

Query  1507  QFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGV  1686
             QFFEG+GLGGCI QA FK  +T +MA FFSLT PVGI  GI ISS YN HSSTA I +GV
Sbjct  246   QFFEGIGLGGCIVQANFKVRATIIMATFFSLTAPVGIVLGIAISSSYNVHSSTAFIIEGV  305

Query  1687  LNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              NSASAGILIYM+LVDLLA DF  PK+Q N +LQL  +++L +GAG MS+LA+WA
Sbjct  306   FNSASAGILIYMSLVDLLATDFNNPKLQTNTKLQLMTYLALFMGAGMMSMLAIWA  360



>ref|XP_003557360.1| PREDICTED: zinc transporter 8-like [Brachypodium distachyon]
Length=366

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/344 (53%), Positives = 228/344 (66%), Gaps = 8/344 (2%)
 Frame = +1

Query  838   EGQLHYSSKETLVTVDSLKYRLVAIA---SILVAGAAGVSIPLLARKYEFLGPEKDIFFM  1008
             EG+            D  + R + IA   SILV+GA G S+P+LAR+   L P+ D+FF+
Sbjct  25    EGEEDECGSAESAAADRARVRPLKIAAFFSILVSGALGCSLPVLARRVPGLRPDGDVFFL  84

Query  1009  IKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLA  1188
             +KAFAAGVIL+TGF+HILPDAF+ L SP L    PW  FPF+GL A+  +I TL+VDTLA
Sbjct  85    VKAFAAGVILATGFIHILPDAFENLGSPCLPSDGPWKDFPFAGLGAMVGAIGTLVVDTLA  144

Query  1189  MSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLS  1368
               +F +   H  K     V  +++ A  A   D      A     +              
Sbjct  145   TGYFTRA--HSKKGGGAVVDEEKQAAAAAGEEDVHVHTHATHGHAHGSAALVAAVGGAED  202

Query  1369  DR---IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGC  1539
             D+   IR RV+SQVLELGIVVHSVIIG+ LG SQ  +TI+PL+VALSFHQ FEGMGLGGC
Sbjct  203   DKMDTIRYRVISQVLELGIVVHSVIIGISLGASQEPDTIKPLVVALSFHQMFEGMGLGGC  262

Query  1540  IAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIY  1719
             I QAKFK+ S   M +FF LTTPVGIA G+GIS VYN +S TAL+ +G LNS +AGIL+Y
Sbjct  263   IVQAKFKARSIVTMILFFCLTTPVGIAVGVGISRVYNENSPTALVVEGGLNSVAAGILVY  322

Query  1720  MALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             MALVDLLA DFM PK+Q+  +LQLG ++S++LGAG MS+LA WA
Sbjct  323   MALVDLLAEDFMNPKVQSRGKLQLGINLSMLLGAGLMSMLAKWA  366



>ref|XP_004976785.1| PREDICTED: zinc transporter 3-like [Setaria italica]
Length=367

 Score =   328 bits (840),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 184/330 (56%), Positives = 231/330 (70%), Gaps = 12/330 (4%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             ++K +L+AIASIL AGAAGV +P+L R    L P+ DIFF +KAFAAGVIL+TG VHILP
Sbjct  42    AMKLKLIAIASILTAGAAGVLVPVLGRSMAALNPDGDIFFAVKAFAAGVILATGMVHILP  101

Query  1066  DAFQTLTSPLL----KDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFR----KKMMHF  1221
              AF  LTSP L    +D N    FPF+GLIA++A++AT+++D+LA  ++R    KK    
Sbjct  102   AAFDGLTSPCLYKVGRDRNV---FPFAGLIAMSAAMATMVIDSLAAGYYRRSHFKKARPI  158

Query  1222  DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQV  1401
             D  ++ +   DEE    A             +   +D   S  E   ++D IR RVVSQV
Sbjct  159   DNLEIHEQPGDEERTGHAQHVHVHTHQTQGHSHGEVDIIGSPEEAA-IADTIRHRVVSQV  217

Query  1402  LELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVM  1581
             LELGI+VHSVIIG+ LGTS    TIRPL+ ALSFHQ FEG+GLGGCI QA FK  +T +M
Sbjct  218   LELGILVHSVIIGVSLGTSVRSSTIRPLVGALSFHQLFEGIGLGGCIVQANFKLRATVMM  277

Query  1582  AVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKP  1761
             A+FFSLT P+GIA GIGISS YN HS+TA + +GV NSASAGILIYM+LVDLLA DF  P
Sbjct  278   AIFFSLTAPIGIALGIGISSSYNGHSATAFVVEGVFNSASAGILIYMSLVDLLATDFNNP  337

Query  1762  KIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             K+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  338   KLQTNTKLQLMTYLALFLGAGMMSMLAIWA  367



>ref|XP_010693319.1| PREDICTED: zinc transporter 1-like [Beta vulgaris subsp. vulgaris]
Length=368

 Score =   328 bits (840),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 237/362 (65%), Gaps = 22/362 (6%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             A   +EC+C  N   +L   SK       +LK++L AI +IL A A GV +P+L ++   
Sbjct  18    AMVAAECSCETN---ELTGDSKSL-----TLKFKLGAIGAILGASAIGVGLPMLGKRVSI  69

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE DIFFM+KAFAAGVIL+TGF+HILP AF+ LTSP + +T PW  FPF+  IA+ AS
Sbjct  70    LRPENDIFFMVKAFAAGVILATGFIHILPGAFEGLTSPCIDET-PWQNFPFAAFIAMVAS  128

Query  1159  IATLMVDTLAMSFFRKKMMHF-----------DKTKLPQVSadeeeakdaaaadhmhrhg  1305
             I +LMVD+LA   +RK  +HF           +K    + + +                 
Sbjct  129   IGSLMVDSLATGHYRK--VHFGGNNNNSKEGSNKVVDEERNDEHAGHVHVHTHATHGHAH  186

Query  1306  aaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPL  1485
                   ++       E +   + IR RV +QVLELGIVVHSVIIG+ LGTS+  +TI+PL
Sbjct  187   GHGGGSFVTESGEFGEELSKLELIRHRVTAQVLELGIVVHSVIIGISLGTSERLDTIKPL  246

Query  1486  LVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSST  1665
             + AL FHQFFEGMGLGGCI QAKFKS S A MA+FFSLTTP+GIA GI I+ VY+  S  
Sbjct  247   MAALCFHQFFEGMGLGGCITQAKFKSRSMATMALFFSLTTPIGIAIGIAIAGVYDEKSPR  306

Query  1666  ALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAM  1845
             +LI QG+  +A+AGILIYMALVDLLAADFM P++Q N R+Q G H+SL+LGAG MSVLA+
Sbjct  307   SLIIQGIFEAAAAGILIYMALVDLLAADFMNPRMQANTRIQFGSHLSLLLGAGCMSVLAI  366

Query  1846  WA  1851
             WA
Sbjct  367   WA  368



>gb|ACN93834.1| metal ion transporter ZIP8 [Hordeum vulgare]
Length=359

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 229/322 (71%), Gaps = 7/322 (2%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             SL+ R++AI  ILVA AAG +IP L R++  L P++D+FF +KAFAAGVIL+T FVHILP
Sbjct  45    SLRLRIIAIFCILVASAAGCAIPSLGRRFPALSPDRDLFFGVKAFAAGVILATSFVHILP  104

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             +AF+ L SP L D  PW KFPF+GL+A+ A+IATL+VDT+A  +F++         +   
Sbjct  105   EAFERLGSPCLVD-GPWQKFPFAGLVAMLAAIATLVVDTIATGYFQRAAHAKKAAAVVGA  163

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
                E          H H   A  A+          +L      IRQRV+SQVLELGI+VH
Sbjct  164   DDVEATPAHHGLVGHSHGVSAVVASSAAAADDGGAQL------IRQRVISQVLELGIIVH  217

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG SQ+  TIRPL+VAL+FHQFFEG+GLGGCI QAKF+  S  +MA+FFSLTT
Sbjct  218   SVIIGMSLGASQSASTIRPLVVALTFHQFFEGIGLGGCIVQAKFRLKSVLLMALFFSLTT  277

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVG+  GIGISSVYN +S   LITQG+L++A+AGIL YMALVDLLA DFM P++Q+N RL
Sbjct  278   PVGVVIGIGISSVYNENSPNTLITQGILSAAAAGILNYMALVDLLAEDFMNPRVQSNGRL  337

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             Q+  ++SL+LG   MS+LA+WA
Sbjct  338   QVIVNLSLLLGTALMSMLAVWA  359



>ref|XP_002448514.1| hypothetical protein SORBIDRAFT_06g028270 [Sorghum bicolor]
 gb|EES12842.1| hypothetical protein SORBIDRAFT_06g028270 [Sorghum bicolor]
Length=367

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 190/360 (53%), Positives = 240/360 (67%), Gaps = 25/360 (7%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             A  S+CT   N          ET  ++ ++K +L+AIASIL AGAAGV +P+L R    L
Sbjct  23    ATTSKCTNATN--------GTET-DSLGAMKLKLIAIASILTAGAAGVLVPVLGRSMAAL  73

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSP-LLKDTNPWAKFPFSGLIALTAS  1158
              P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP L K  +    FPF+GLIA++A+
Sbjct  74    HPDGDIFFAVKAFAAGVILATGMVHILPAAFDGLTSPCLYKGGSGGNIFPFAGLIAMSAA  133

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTK---------LPQVSadeeeakdaaaadhmhrhgaa  1311
             +AT+++D+LA  ++R+   HF K +          P        A+      H     + 
Sbjct  134   MATMVIDSLAAGYYRRS--HFKKARPIDNLEIHEQPGDEERTGHAQHVHVHTHATHGHSH  191

Query  1312  aaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLV  1491
               A  ++ P    E   ++D IR RVVSQVLELGI+VHSVIIG+ LG S    TIRPL+ 
Sbjct  192   GEADGINSP----EEASIADTIRHRVVSQVLELGILVHSVIIGVSLGASVRPNTIRPLVG  247

Query  1492  ALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTAL  1671
             ALSFHQFFEG+GLGGCI QA FK  +T +MA+FFSLT P+GIA GI ISS YN HS+TA 
Sbjct  248   ALSFHQFFEGIGLGGCIVQANFKLRATVMMAIFFSLTAPIGIALGIAISSSYNGHSTTAF  307

Query  1672  ITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             I +GV NSASAGILIYM+LVDLLA DF KPK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  308   IVEGVFNSASAGILIYMSLVDLLATDFNKPKLQTNTKLQLMTYLALFLGAGMMSMLAIWA  367



>dbj|BAJ87579.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 239/358 (67%), Gaps = 24/358 (7%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             AAA   C C    +G    + K+      ++K +LVAIASIL AGAAGV +P+L R    
Sbjct  30    AAASGGCECTTATDG----ADKQ-----GAMKLKLVAIASILAAGAAGVLVPVLGRSMAA  80

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL-KDTNPWAKFPFSGLIALTA  1155
             L P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP + K       FPF+GL+A++A
Sbjct  81    LRPDGDIFFAVKAFAAGVILATGMVHILPAAFDGLTSPCIHKGGGDRNGFPFAGLVAMSA  140

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTK------LPQVSadeeeakdaaaadhmhrhgaaaa  1317
             ++AT+++D+LA  ++R+   HF K +      +P  + DEE   D             A 
Sbjct  141   AMATMVIDSLAAGYYRRS--HFSKARPLDNIDIPGHTGDEEGRADHPHVHTHGHSHGEAI  198

Query  1318  aVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVAL  1497
             AV      S+ E   ++D IR RVVSQVLELGI+VHSVIIG+ LG S    TI+PL+ AL
Sbjct  199   AV------SSPEEAAIADTIRHRVVSQVLELGILVHSVIIGVSLGASVRPSTIKPLVGAL  252

Query  1498  SFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALIT  1677
             SFHQFFEG+GLGGCI QA FK  +T +MA FFSLT PVGI  GI +SS YN HSSTA I 
Sbjct  253   SFHQFFEGIGLGGCIVQANFKVRATIIMATFFSLTAPVGIVLGIAVSSSYNVHSSTAFII  312

Query  1678  QGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +GV NSASAGILIYM+LVDLLA DF  PK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  313   EGVFNSASAGILIYMSLVDLLATDFNNPKLQTNTKLQLMTYLALFLGAGMMSMLAIWA  370



>ref|XP_006468556.1| PREDICTED: zinc transporter 8-like isoform X1 [Citrus sinensis]
 ref|XP_006468558.1| PREDICTED: zinc transporter 8-like isoform X1 [Citrus sinensis]
Length=365

 Score =   327 bits (837),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 193/356 (54%), Positives = 243/356 (68%), Gaps = 16/356 (4%)
 Frame = +1

Query  796   TAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE  975
             +A+AE +C     + G  H +         +LK ++VAI SIL+AGA GVSIP   +   
Sbjct  22    SASAECKCDLTETIGGSGHKN--------KALKLKIVAILSILIAGAFGVSIPSFGKNIS  73

Query  976   FLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTA  1155
                PE +IFF+IKAFAAGVIL+TGFVHILPDA+++LTSP L    PW  FPF+G +A+ +
Sbjct  74    TFHPENNIFFIIKAFAAGVILATGFVHILPDAYESLTSPCL-SPKPWQDFPFTGFVAMVS  132

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             +I T+MVD  A SF+++  +HF K  LP    D+E   +     H+H H     A     
Sbjct  133   AILTMMVDAFATSFYQR--LHFSKA-LPVNDDDKEMHAEHEGHVHVHTHATHGHAHGSAF  189

Query  1336  PPSNNELVHLSDRIRQRVVSQV----LELGIVVHSVIIGLCLGTSQTRETIRPLLVALSF  1503
               S+      SD  R R+VSQV    LELGIVVHSVIIG+ LG S + +TI+PL+ AL+F
Sbjct  190   ASSDASGSGTSDLFRHRIVSQVSIDVLELGIVVHSVIIGISLGASGSVKTIKPLVAALTF  249

Query  1504  HQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQG  1683
             HQFFEGMGLGGCI+QAKFKS + A M +FFSLTTPVGI  GIGIS VY  +S TAL+ +G
Sbjct  250   HQFFEGMGLGGCISQAKFKSKAVAAMILFFSLTTPVGIGIGIGISKVYKENSPTALVIEG  309

Query  1684  VLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             + NSASAGILIYMALVDLLA DFM PK+Q N +LQLG + SL+LG+G MS+LA WA
Sbjct  310   IFNSASAGILIYMALVDLLATDFMSPKLQTNFKLQLGANFSLLLGSGCMSLLAKWA  365



>gb|ACN93832.1| metal ion transporter ZIP3 [Hordeum vulgare]
Length=362

 Score =   327 bits (837),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 239/358 (67%), Gaps = 24/358 (7%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             AAA   C C    +G    + K+      ++K +LVAIASIL AGAAGV +P+L R    
Sbjct  22    AAASGGCECTTATDG----ADKQ-----GAMKLKLVAIASILAAGAAGVLVPVLGRSMAA  72

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL-KDTNPWAKFPFSGLIALTA  1155
             L P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP + K       FPF+GL+A++A
Sbjct  73    LRPDGDIFFAVKAFAAGVILATGMVHILPAAFDGLTSPCIHKGGGDRNGFPFAGLVAMSA  132

Query  1156  SIATLMVDTLAMSFFRKKMMHFDKTK------LPQVSadeeeakdaaaadhmhrhgaaaa  1317
             ++AT+++D+LA  ++R+   HF K +      +P  + DEE   D             A 
Sbjct  133   AMATMVIDSLAAGYYRRS--HFSKARPLDNIDIPGHTGDEEGRADHPHVHTHGHSHGEAI  190

Query  1318  aVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVAL  1497
             AV      S+ E   ++D IR RVVSQVLELGI+VHSVIIG+ LG S    TI+PL+ AL
Sbjct  191   AV------SSPEEAAIADTIRHRVVSQVLELGILVHSVIIGVSLGASVRPSTIKPLVGAL  244

Query  1498  SFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALIT  1677
             SFHQFFEG+GLGGCI QA FK  +T +MA FFSLT PVGI  GI +SS YN HSSTA I 
Sbjct  245   SFHQFFEGIGLGGCIVQANFKVRATIIMATFFSLTAPVGIVLGIAVSSSYNVHSSTAFII  304

Query  1678  QGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +GV NSASAGILIYM+LVDLLA DF  PK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  305   EGVFNSASAGILIYMSLVDLLATDFNNPKLQTNTKLQLMTYLALFLGAGMMSMLAIWA  362



>ref|XP_007145986.1| hypothetical protein PHAVU_006G003300g [Phaseolus vulgaris]
 gb|ESW17980.1| hypothetical protein PHAVU_006G003300g [Phaseolus vulgaris]
Length=352

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 244/351 (70%), Gaps = 25/351 (7%)
 Frame = +1

Query  808   ESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
              +ECTC+         +  E      +++Y++ A+ SIL+A A GV IPLL +    L P
Sbjct  24    RAECTCD---------AEDEDRDKGKAMRYKITALISILIASAIGVCIPLLGKVIPALSP  74

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             EKDIFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK+ +PW  FPF+G +A+  ++ T
Sbjct  75    EKDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPCLKE-HPWGDFPFTGFVAMCTAMGT  133

Query  1168  LMVDTLAMSFFRK---KMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             LMVDT A ++F+K   K +H +   + + +  E        A H H HG         P 
Sbjct  134   LMVDTYATAYFQKHHSKEIHSENGDVEKEAGHEGHVHLHTHATHGHAHG---------PV  184

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S++   H S  +R RV+SQVLELGI+VHSVIIG+ LG S++  TIRPL+ AL+FHQFFE
Sbjct  185   HSDD---HSSQLLRHRVISQVLELGIIVHSVIIGISLGASESPNTIRPLVAALTFHQFFE  241

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             GMGLG CI+QA FK  S  VM +FF+LTTPVGI  GIGI++VY+ +S TALI +GV N+A
Sbjct  242   GMGLGSCISQANFKRGSVIVMGLFFALTTPVGIGIGIGITNVYDENSPTALIVEGVFNAA  301

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYMALVDLLA DFM P++Q + RL+LG ++ L+LGAG MS++A WA
Sbjct  302   SAGILIYMALVDLLATDFMSPRMQQSGRLRLGANIFLLLGAGLMSLVAKWA  352



>gb|ADE87884.1| zinc transporter ZIP1 [Triticum turgidum subsp. durum]
Length=360

 Score =   325 bits (833),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 225/322 (70%), Gaps = 8/322 (2%)
 Frame = +1

Query  892   KYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDA  1071
             K +LVAIASIL AGAAGV +P+L R    L P+ DIFF +KAFAAGVIL+TG VHILP A
Sbjct  45    KLKLVAIASILTAGAAGVLVPVLGRSMAALRPDGDIFFAVKAFAAGVILATGMVHILPAA  104

Query  1072  FQTLTSP-LLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK-LPQV  1245
             F  LTSP + K       FPF+GL+A++A++AT+++D+LA  ++R+   HF K + L  +
Sbjct  105   FDGLTSPCIYKGGGDRNGFPFAGLVAMSAAMATMVIDSLAAGYYRRS--HFSKARPLDNI  162

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
                 +E   A          +   A+ +  P    E   ++D IR RVVSQVLELGI+VH
Sbjct  163   DIPGDEEGRADHPHVHAHGRSHGDAIVVSSP----EEAAIADTIRHRVVSQVLELGILVH  218

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S    TI+PL+ ALSFHQFFEG+GLGGCI QA FK  +T +MA FFSLT 
Sbjct  219   SVIIGVSLGASVRPSTIKPLVGALSFHQFFEGIGLGGCIVQANFKVRATIIMATFFSLTA  278

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  GI ISS YN HSSTA I +GV NSASAGILIYM+LVDLLA DF  PK+Q N +L
Sbjct  279   PVGIVLGIAISSSYNVHSSTAFIIEGVFNSASAGILIYMSLVDLLAKDFNNPKLQTNTKL  338

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QL  +++L LGAG MS+LA+WA
Sbjct  339   QLMTYLALFLGAGMMSMLAIWA  360



>gb|ADE87887.1| zinc transporter ZIP1 [Triticum dicoccoides]
Length=360

 Score =   325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 225/322 (70%), Gaps = 8/322 (2%)
 Frame = +1

Query  892   KYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDA  1071
             K +LVAIASIL AGAAGV +P+L R    L P+ DIFF +KAFAAGVIL+TG VHILP A
Sbjct  45    KLKLVAIASILTAGAAGVLVPVLGRSMAALRPDGDIFFAVKAFAAGVILATGIVHILPAA  104

Query  1072  FQTLTSP-LLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK-LPQV  1245
             F  LTSP + K       FPF+GL+A++A++AT+++D+LA  ++R+   HF K + L  +
Sbjct  105   FDGLTSPCIYKGGGDRNGFPFAGLVAMSAAMATMVIDSLAAGYYRRS--HFSKARPLDNI  162

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
                 +E   A          +   A+ +  P    E   ++D IR RVVSQVLELGI+VH
Sbjct  163   DIPGDEEGRADHPHVHAHGHSHGDAIVVSSP----EEAAIADTIRHRVVSQVLELGILVH  218

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S    TI+PL+ ALSFHQFFEG+GLGGCI QA FK  +T +MA FFSLT 
Sbjct  219   SVIIGVSLGASVRPSTIKPLVGALSFHQFFEGIGLGGCIVQANFKVRATIIMATFFSLTA  278

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  GI ISS YN HSSTA I +GV NSASAGILIYM+LVDLLA DF  PK+Q N +L
Sbjct  279   PVGIVLGIAISSSYNVHSSTAFIIEGVFNSASAGILIYMSLVDLLAKDFNNPKLQTNTKL  338

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QL  +++L LGAG MS+LA+WA
Sbjct  339   QLMTYLALFLGAGMMSMLAIWA  360



>gb|AAW68439.1| zinc transporter ZIP [Triticum aestivum]
 gb|ADE87885.1| zinc transporter ZIP1 [Triticum dicoccoides]
 gb|ADE87886.1| zinc transporter ZIP1 [Triticum dicoccoides]
Length=360

 Score =   325 bits (833),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 225/322 (70%), Gaps = 8/322 (2%)
 Frame = +1

Query  892   KYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDA  1071
             K +LVAIASIL AGAAGV +P+L R    L P+ DIFF +KAFAAGVIL+TG VHILP A
Sbjct  45    KLKLVAIASILTAGAAGVLVPVLGRSMAALRPDGDIFFAVKAFAAGVILATGMVHILPAA  104

Query  1072  FQTLTSP-LLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTK-LPQV  1245
             F  LTSP + K       FPF+GL+A++A++AT+++D+LA  ++R+   HF K + L  +
Sbjct  105   FDGLTSPCIYKGGGDRNGFPFAGLVAMSAAMATMVIDSLAAGYYRRS--HFSKARPLDNI  162

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
                 +E   A          +   A+ +  P    E   ++D IR RVVSQVLELGI+VH
Sbjct  163   DIPGDEEGRADHPHVHAHGHSHGDAIVVSSP----EEAAIADTIRHRVVSQVLELGILVH  218

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S    TI+PL+ ALSFHQFFEG+GLGGCI QA FK  +T +MA FFSLT 
Sbjct  219   SVIIGVSLGASVRPSTIKPLVGALSFHQFFEGIGLGGCIVQANFKVRATIIMATFFSLTA  278

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  GI ISS YN HSSTA I +GV NSASAGILIYM+LVDLLA DF  PK+Q N +L
Sbjct  279   PVGIVLGIAISSSYNVHSSTAFIIEGVFNSASAGILIYMSLVDLLAKDFNNPKLQTNTKL  338

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             QL  +++L LGAG MS+LA+WA
Sbjct  339   QLMTYLALFLGAGMMSMLAIWA  360



>ref|XP_007049047.1| Zinc transporter 5 precursor [Theobroma cacao]
 gb|EOX93204.1| Zinc transporter 5 precursor [Theobroma cacao]
Length=352

 Score =   325 bits (832),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 194/350 (55%), Positives = 248/350 (71%), Gaps = 22/350 (6%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A  ECTC    E +      + L    +LKY++ AIA ILVAGA GV  PLL +  + L 
Sbjct  24    ARGECTCEPEDEDR-----NKPL----ALKYKMAAIALILVAGAIGVCFPLLGKTIKALR  74

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE ++FF+IKAFAAGVILSTGF+H+LPDA ++LTSP L + NPW KFPF+GL+A+ ++IA
Sbjct  75    PENNLFFIIKAFAAGVILSTGFIHVLPDATESLTSPCLNE-NPWGKFPFAGLVAMASAIA  133

Query  1165  TLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             TLMVD  A S + K   H ++T+ +        E +    A     HG A  +V L    
Sbjct  134   TLMVDAFATSHYTKS--HSNETQQIDGDKEKTGEHESHVHAHTHATHGHAHGSVSLVDRS  191

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
              ++EL      +R RVVSQ   LGIVVHSVIIG+ LG S++ +TI+PL+ AL+FHQFFEG
Sbjct  192   GSSEL------LRHRVVSQ---LGIVVHSVIIGISLGASESPKTIKPLVAALTFHQFFEG  242

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI+QAKFKS + AVMA+FFSLTTPVGIA GIG+S++Y+    TALI +G+ N+AS
Sbjct  243   MGLGGCISQAKFKSRAVAVMALFFSLTTPVGIAIGIGVSNMYHESRPTALIVEGIFNAAS  302

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYMALVDLLAADFM PK+QNN  LQ+G   +L+LG+G MS+LA+WA
Sbjct  303   AGILIYMALVDLLAADFMNPKLQNNGMLQVGASGALLLGSGLMSLLAIWA  352



>ref|XP_002274548.2| PREDICTED: zinc transporter 5 [Vitis vinifera]
Length=660

 Score =   334 bits (857),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 241/347 (69%), Gaps = 23/347 (7%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ++CTC  + E Q    S  T  T    +Y+L AI SIL A   GV++P L +K   L PE
Sbjct  337   AQCTCESDPEEQ----SSRTGAT----RYKLAAIFSILAASLIGVALPTLGKKIPALRPE  388

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
              D+FF +KAFAAGVIL+TGF+H+LPDAF++LTSP L ++ PW  FPFSG +A+ ++I T+
Sbjct  389   NDVFFAVKAFAAGVILATGFIHVLPDAFESLTSPCLGES-PWGSFPFSGFVAMLSAIGTM  447

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             M+D  A  F+++      ++K   V  DEE   +     H H HG+   +  L  P    
Sbjct  448   MMDAFATGFYQR----LQRSKAQPVKEDEEMQCENQDQVHGHPHGSGFVSGELGSP----  499

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                   +  R RV++QVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGL
Sbjct  500   ------ELARHRVIAQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFFEGMGL  553

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAKFKS + AVM VFFSLTTPVGIA G+GIS++Y+ +S  AL+ +GV NSASAGI
Sbjct  554   GGCISQAKFKSKAVAVMVVFFSLTTPVGIAVGMGISNIYDENSPKALVVEGVFNSASAGI  613

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDL+AADFM P++Q N +LQ+  ++ L+LG   MS+LA WA
Sbjct  614   LIYMALVDLVAADFMSPRMQTNFKLQIAANILLLLGTACMSLLAKWA  660


 Score =   333 bits (853),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 199/371 (54%), Positives = 248/371 (67%), Gaps = 38/371 (10%)
 Frame = +1

Query  709   LQFPFRYSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDS  888
             LQF + Y +  I +   ++I+F P  +S      S CTC    E Q    +    VT   
Sbjct  4     LQF-YPYRILTISS---LLILFQPLLVS------SLCTC----ETQHKDQNASQAVT---  46

Query  889   LKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPD  1068
               Y+LVAIASILV+ A GV +PLL +    L PEK I+F+IKAFAAGVIL+TGF+HILPD
Sbjct  47    --YKLVAIASILVSSAIGVCLPLLLKNVPSLRPEKAIYFLIKAFAAGVILATGFLHILPD  104

Query  1069  AFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVS  1248
             A+ +L SP L + NPW  FPF+G IA+ A+I TLM++  A  + R+  +     K   V+
Sbjct  105   AYDSLKSPCLSE-NPWGGFPFTGFIAMMAAILTLMMEAFATGYHRRSELR----KAQPVN  159

Query  1249  adeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHS  1428
              DEE   D A   H                    E  + SD IR RVVSQVLELGIVVHS
Sbjct  160   GDEESDGDHAGHVHGSAFVL--------------ERSNSSDLIRHRVVSQVLELGIVVHS  205

Query  1429  VIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTP  1608
             VIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGLGGCI+QAK+K  +T +M +FFSLTTP
Sbjct  206   VIIGISLGASESPKTIKPLVAALSFHQFFEGMGLGGCISQAKYKIKATIIMVLFFSLTTP  265

Query  1609  VGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQ  1788
              GIA G+GIS +Y+ +S TALI QGVLNSASAGILIYMALVDLLA DFM PK+Q+NVRLQ
Sbjct  266   TGIAVGLGISKIYDENSPTALIVQGVLNSASAGILIYMALVDLLATDFMNPKMQSNVRLQ  325

Query  1789  LGGHVSLVLGA  1821
             LG + +L+LGA
Sbjct  326   LGAYATLLLGA  336



>ref|XP_009384788.1| PREDICTED: zinc transporter 5-like [Musa acuminata subsp. malaccensis]
Length=423

 Score =   327 bits (838),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 243/364 (67%), Gaps = 21/364 (6%)
 Frame = +1

Query  769   IFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVS  948
             +FF   +        +C C+ +  G+     K+      +L  ++ AI SILV G+ GV 
Sbjct  78    VFFLAVVLLPLLVHGDCECSTDEAGR---DKKK------ALPLKIAAIFSILVCGSIGVC  128

Query  949   IPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFP  1128
             IP+L + +  L PEKD+FF+IK+FAAGVIL+TGFVHILPDAF  LTS  L D +PW KFP
Sbjct  129   IPILGKWWPALHPEKDVFFVIKSFAAGVILATGFVHILPDAFDGLTSSCL-DPSPWQKFP  187

Query  1129  FSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhga  1308
             F+G  A+ A+IATLM+DT+A  +F +   H  + +   V+ + +   +A    H H    
Sbjct  188   FAGFGAMVAAIATLMMDTVATGYFSRS--HSARARTAAVTDETKADMEAPHGMHGHNDVH  245

Query  1309  aaaaV---YLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
               +     ++   PS  +L      IR RV+SQVLELGIVVHSVIIG+ LG S+T  TIR
Sbjct  246   VHSHANHGHIHEDPSAQQL------IRHRVISQVLELGIVVHSVIIGISLGASETPSTIR  299

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHS  1659
              LL ALSFHQFFEG+GLGGCI QAK++  S   M +FFSLTTPVGIA G+G SSVY+ +S
Sbjct  300   SLLAALSFHQFFEGVGLGGCIVQAKYQMKSMVTMGLFFSLTTPVGIAVGMGTSSVYDENS  359

Query  1660  STALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVL  1839
              TAL+ +G+L+SASAGILIYMALVDLLA DF  P++Q+  +LQL  ++SL+LGA  MS+L
Sbjct  360   PTALVVEGLLDSASAGILIYMALVDLLAQDFTNPRVQSKPKLQLAMNISLLLGAALMSIL  419

Query  1840  AMWA  1851
             A W+
Sbjct  420   AKWS  423



>ref|XP_004961773.1| PREDICTED: zinc transporter 9-like [Setaria italica]
Length=354

 Score =   324 bits (831),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 233/349 (67%), Gaps = 17/349 (5%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A ++C C          S+ E      +L  ++VAI  ILVA + G +IP L R++  L 
Sbjct  23    AVADCECEA--------STDEDSDKARALTLKIVAIFCILVASSVGCAIPSLGRRFPALR  74

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             P+ D+F  +KAFAAGVIL+T FVHILPDAF+ L SP L D  PW KFPF+GL+A+ A+IA
Sbjct  75    PDTDLFIAVKAFAAGVILATAFVHILPDAFEKLGSPCLVD-GPWQKFPFTGLVAMLAAIA  133

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TL+VDT+A  +F++   H  KT    V  D E +  A           +  A   +    
Sbjct  134   TLVVDTIATGYFQRA--HSAKTAAAPVIGDVEASDHAHGGHGHAHGVVSVMASTSNADGG  191

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
               +L      IR RV++QVLELGI+VHSVIIG+ +G S++  TIRPL+ AL+FHQFFEG+
Sbjct  192   GAQL------IRHRVIAQVLELGIIVHSVIIGMSVGASESPSTIRPLVAALTFHQFFEGI  245

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI QAKF+  S   MA+FFSLTTPVG+  GIGISS YN +S  ALI +GVLN+A+A
Sbjct  246   GLGGCIVQAKFRLKSMLTMALFFSLTTPVGVVIGIGISSTYNENSPRALIVEGVLNAAAA  305

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GIL YMALVDLLA DFM P++QNN RLQ+   VSL++GA  MS+LA+WA
Sbjct  306   GILNYMALVDLLAEDFMNPRVQNNGRLQVIVSVSLLVGAALMSMLAIWA  354



>ref|XP_010499439.1| PREDICTED: zinc transporter 1 [Camelina sativa]
Length=357

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/352 (51%), Positives = 245/352 (70%), Gaps = 25/352 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT + + +      SK+      + K +L +IA +LVAG  GVS+PL+ +K   L 
Sbjct  28    ASSDCTSHDDRDA----VSKDE--AEKATKLKLGSIALLLVAGGLGVSLPLIGKKIPALQ  81

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++ 
Sbjct  82    PENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLEDTTA-GKFPFAGFVAMLSAMG  140

Query  1165  TLMVDTLAMSFFRKKMMHF-DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             TLM+DT A  +++++  HF + +   QV+   +E + A               V++    
Sbjct  141   TLMIDTFATGYYKRQ--HFSNNSGSKQVNVVVDEEEHAGH-------------VHVHTHA  185

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ +TI+PL+ ALSFHQFFEG
Sbjct  186   SHGHAHGSTEMIRRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEG  245

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNS  1695
             +GLGGCI+ A+ KS ST +MA FFS+T PVGI  G+G+SS   Y   S  A++ +G+LN+
Sbjct  246   LGLGGCISLAELKSKSTVIMATFFSVTAPVGIGIGMGMSSGLGYRKESKEAIMVEGMLNA  305

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYM+LVDLLA DFM P++Q+N+ L L  ++SLVLGA SMS+LA+WA
Sbjct  306   ASAGILIYMSLVDLLAPDFMNPRLQSNLWLHLAAYLSLVLGAASMSLLAIWA  357



>ref|XP_010487001.1| PREDICTED: zinc transporter 1-like [Camelina sativa]
Length=357

 Score =   324 bits (830),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 179/352 (51%), Positives = 246/352 (70%), Gaps = 25/352 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT + + +      SK+      + K +L +IA +LVAG  GVS+PL+ +K   L 
Sbjct  28    ASSDCTSHDDRDA----VSKDE--AEKATKLKLGSIALLLVAGGLGVSLPLIGKKIPALQ  81

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++ 
Sbjct  82    PENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLEDTTA-GKFPFAGFVAMLSAMG  140

Query  1165  TLMVDTLAMSFFRKKMMHF-DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             TLM+DT A  +++++  HF + +   QV+  E+E + A               V++    
Sbjct  141   TLMIDTFATGYYKRQ--HFSNNSGSKQVNVVEDEEEHAGH-------------VHVHTHA  185

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ +TI+PL+ ALSFHQFFEG
Sbjct  186   SHGHAHGSTEMIRRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEG  245

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNS  1695
             +GLGGCI+ A+ KS ST +MA FFS+T PVGI  G+G+SS   Y   S  A++ +G+LN+
Sbjct  246   LGLGGCISLAELKSKSTVIMATFFSVTAPVGIGIGMGMSSGLGYRKESKEAIMVEGMLNA  305

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYM+LVDLLA DFM P++Q+N+ L L  ++SLVLGA SMS+LA+WA
Sbjct  306   ASAGILIYMSLVDLLAPDFMNPRLQSNLWLHLAAYLSLVLGAASMSLLAIWA  357



>emb|CDP18202.1| unnamed protein product [Coffea canephora]
Length=344

 Score =   323 bits (827),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 238/372 (64%), Gaps = 33/372 (9%)
 Frame = +1

Query  736   FNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIA  915
             +NIV   ++ I+F P  +       ++CTC   ++G          +  ++L+++L+ I 
Sbjct  4     YNIVMLVHLSILFLPKLVF------AKCTCESQIKGHG--------IEHEALEFKLIGIG  49

Query  916   SILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPL  1095
             SIL+A A GV IPLL +    L PE  + F+IKAFAAGVIL+TGF+HILPDAF +LTSP 
Sbjct  50    SILLASAIGVCIPLLLKNVRALQPETGLHFLIKAFAAGVILATGFIHILPDAFASLTSPC  109

Query  1096  LKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakda  1275
             L + NPW  FPF+G IA+ A+I TLM++ LA  + R+  M     + PQ           
Sbjct  110   LPE-NPWGGFPFAGFIAMMAAIVTLMMEALATGYHRRAEM-----QKPQ-----------  152

Query  1276  aaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGT  1455
                           A ++  P    E  + S  IR R+VSQVLELGIV HS +IG+ +G 
Sbjct  153   --PLDADEEANPTDAGHVHGPAILLERSNSSSLIRNRIVSQVLELGIVFHSTVIGVSMGA  210

Query  1456  SQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGI  1635
             +Q  + I+ L+ ALSFHQFFEG+GLGGCI+QAKFK+ +   M +FFSLTTP GIA GI I
Sbjct  211   TQNPKIIKSLIAALSFHQFFEGIGLGGCISQAKFKARTITTMVLFFSLTTPAGIAIGILI  270

Query  1636  SSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVL  1815
             S  YN +S TAL+ QGVL+SAS+GILIYMALVDLLAADFM PK+Q + R+Q G + SL+L
Sbjct  271   SKRYNEYSPTALVVQGVLDSASSGILIYMALVDLLAADFMNPKLQTDFRVQFGANFSLLL  330

Query  1816  GAGSMSVLAMWA  1851
             GA  MS++A W 
Sbjct  331   GACCMSLMAKWG  342



>ref|XP_010538635.1| PREDICTED: probable zinc transporter 12 [Tarenaya hassleriana]
Length=357

 Score =   323 bits (828),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 230/322 (71%), Gaps = 10/322 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +LK+++ AI SI + G  GV +P+L RK+ FL PE + FF+I+AFAAGVIL+TGF+HILP
Sbjct  46    ALKFKIAAILSIFIGGVFGVCLPVLGRKFSFLRPESNFFFLIRAFAAGVILATGFIHILP  105

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DA + LTSP L +  PW  FP SGLIA+ ++I T+++++ A  +F+ +++  +K  LP V
Sbjct  106   DAGENLTSPCLGEA-PWGDFPMSGLIAMASAIVTMLIESFAAGYFQ-RLLSGEKNSLPVV  163

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
             +   ++          H H     + +       NE   +   IR ++V+QVLELGIVVH
Sbjct  164   AGGGKQVLGTGGGHEGHVHVHLHGSTF-------NESGEI-KLIRHKIVTQVLELGIVVH  215

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIGL LG SQ  +TI+PLLVAL+FHQ FEG+GLGGCI+QAKFK  + A M +FF+LTT
Sbjct  216   SVIIGLSLGASQDLDTIKPLLVALTFHQLFEGLGLGGCISQAKFKVGTIATMVLFFALTT  275

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  GIG++  YN +S TAL+  G+LNSA+AGILIYMALVDLLAA+F  PK+Q + R+
Sbjct  276   PVGIGIGIGVAETYNENSPTALMVSGILNSAAAGILIYMALVDLLAAEFNDPKVQGSFRM  335

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             Q+   +SL+LGA +MS+LA+WA
Sbjct  336   QISCSLSLLLGAAAMSLLAIWA  357



>emb|CBI27217.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   328 bits (842),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 230/320 (72%), Gaps = 15/320 (5%)
 Frame = +1

Query  892   KYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDA  1071
             +Y+L AI SIL A   GV++P L +K   L PE D+FF +KAFAAGVIL+TGF+H+LPDA
Sbjct  218   RYKLAAIFSILAASLIGVALPTLGKKIPALRPENDVFFAVKAFAAGVILATGFIHVLPDA  277

Query  1072  FQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSa  1251
             F++LTSP L ++ PW  FPFSG +A+ ++I T+M+D  A  F+++      ++K   V  
Sbjct  278   FESLTSPCLGES-PWGSFPFSGFVAMLSAIGTMMMDAFATGFYQR----LQRSKAQPVKE  332

Query  1252  deeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSV  1431
             DEE   +     H H HG+   +  L  P          +  R RV++QVLELGIVVHSV
Sbjct  333   DEEMQCENQDQVHGHPHGSGFVSGELGSP----------ELARHRVIAQVLELGIVVHSV  382

Query  1432  IIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPV  1611
             IIG+ LG S++ +TI+PL+ ALSFHQFFEGMGLGGCI+QAKFKS + AVM VFFSLTTPV
Sbjct  383   IIGISLGASESPKTIKPLVAALSFHQFFEGMGLGGCISQAKFKSKAVAVMVVFFSLTTPV  442

Query  1612  GIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQL  1791
             GIA G+GIS++Y+ +S  AL+ +GV NSASAGILIYMALVDL+AADFM P++Q N +LQ+
Sbjct  443   GIAVGMGISNIYDENSPKALVVEGVFNSASAGILIYMALVDLVAADFMSPRMQTNFKLQI  502

Query  1792  GGHVSLVLGAGSMSVLAMWA  1851
               ++ L+LG   MS+LA WA
Sbjct  503   AANILLLLGTACMSLLAKWA  522


 Score =   243 bits (620),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 141/166 (85%), Gaps = 0/166 (0%)
 Frame = +1

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             E  + SD IR RVVSQVLELGIVVHSVIIG+ LG S++ +TI+PL+ ALSFHQFFEGMGL
Sbjct  42    ERSNSSDLIRHRVVSQVLELGIVVHSVIIGISLGASESPKTIKPLVAALSFHQFFEGMGL  101

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+QAK+K  +T +M +FFSLTTP GIA G+GIS +Y+ +S TALI QGVLNSASAGI
Sbjct  102   GGCISQAKYKIKATIIMVLFFSLTTPTGIAVGLGISKIYDENSPTALIVQGVLNSASAGI  161

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMW  1848
             LIYMALVDLLA DFM PK+Q+NVRLQLG + +L+LGA SMSVLA W
Sbjct  162   LIYMALVDLLATDFMNPKMQSNVRLQLGAYATLLLGAASMSVLAKW  207



>gb|KHG04713.1| Zinc transporter 1 -like protein [Gossypium arboreum]
Length=353

 Score =   323 bits (827),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 191/371 (51%), Positives = 257/371 (69%), Gaps = 24/371 (6%)
 Frame = +1

Query  739   NIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIAS  918
             + ++S +I +++ P  ++      +EC+C   V       SK+T     +LKY+ VAI+S
Sbjct  7     SFISSLFICLLYLPVLVT------AECSCENEVL------SKDTGNKTKALKYKFVAISS  54

Query  919   ILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL  1098
             IL+AGA GVS+P++ +K    GP+ +IFF+IKAFA GVIL+T FVHILPDA+Q+LTSP L
Sbjct  55    ILMAGAVGVSLPIMVKKIPTFGPQNNIFFLIKAFAGGVILATAFVHILPDAYQSLTSPCL  114

Query  1099  KDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaa  1278
              +  PW  FPF+G +A+ ++I T+M+DT A SF++    HFDK    QV+ DEE   +  
Sbjct  115   SE-KPWGVFPFTGFLAMVSAILTMMMDTFATSFYKSS--HFDKAL--QVNGDEEMLGEHE  169

Query  1279  aadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTS  1458
                H+H H             S     HL   I QR++SQVLE+GIVVHSVIIG+ LG S
Sbjct  170   GHVHVHTHPTHG-----HAHGSTESSHHL--MITQRIISQVLEVGIVVHSVIIGVALGAS  222

Query  1459  QTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGIS  1638
             Q+ +TI+PL+ AL FHQFFEGMGLGGCI+QAKFKS + A+M V FSLTTP+GIA G+GIS
Sbjct  223   QSAKTIKPLVAALIFHQFFEGMGLGGCISQAKFKSRAIAMMLVIFSLTTPMGIALGMGIS  282

Query  1639  SVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLG  1818
              +YN +S  AL+ +G+ NS SAGILIYM+LVDLL  DFM P +Q N++L LG ++SL+LG
Sbjct  283   KIYNENSPKALVVEGIFNSLSAGILIYMSLVDLLGVDFMNPLMQTNLKLLLGSNLSLLLG  342

Query  1819  AGSMSVLAMWA  1851
             A SMS+LA W+
Sbjct  343   AASMSLLAKWS  353



>ref|XP_011085461.1| PREDICTED: zinc transporter 5-like [Sesamum indicum]
Length=344

 Score =   322 bits (826),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 185/366 (51%), Positives = 240/366 (66%), Gaps = 34/366 (9%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F+  II  P      A   +ECTC            +E      +LKY+L AI +IL A 
Sbjct  13    FWASIILLP------AVVLAECTCE--------LKGEEDRNRAGALKYKLAAIVAILAAS  58

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
             A GV +P+L R    L PE+++FF++KAFAAGVILSTGF+H+LPDAF++LTSP L +  P
Sbjct  59    AVGVCLPVLGRTVAALSPERNLFFILKAFAAGVILSTGFIHVLPDAFESLTSPCLGE-KP  117

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W  FPF+G +A+ A+I TLMVDT A + +++           Q      + ++       
Sbjct  118   WEDFPFAGFVAMVAAIGTLMVDTYATAHYQR-----------QAEKKNCKKEEEEEGMVP  166

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
                 A   AV L+      EL      +R RV+SQVLELGI+VHSVIIG+ LG S + +T
Sbjct  167   VHTHATHGAVSLES--GETEL------LRHRVISQVLELGIIVHSVIIGIALGASDSPKT  218

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             IRPL+ AL+FHQ FEG+GLGGCI QAKF + +  +MA+FFSLTTP GIA GIG+S++Y+ 
Sbjct  219   IRPLIGALTFHQLFEGIGLGGCITQAKFDAAAITLMAIFFSLTTPTGIAVGIGLSNIYSE  278

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
              S TALI +GV NSASAGILIYMALVDLL+ADFM  K+Q N++LQLG + SL+LGAG MS
Sbjct  279   TSPTALIVEGVFNSASAGILIYMALVDLLSADFMSHKMQTNLKLQLGANASLLLGAGCMS  338

Query  1834  VLAMWA  1851
             +LA WA
Sbjct  339   LLAKWA  344



>ref|NP_187881.1| zinc transporter 1 [Arabidopsis thaliana]
 sp|O81123.1|ZIP1_ARATH RecName: Full=Zinc transporter 1; AltName: Full=ZRT/IRT-like 
protein 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24197.1| putative zinc transporter [Arabidopsis thaliana]
 dbj|BAB02419.1| zinc transporter-like protein [Arabidopsis thaliana]
 dbj|BAE98670.1| putative zinc transporter [Arabidopsis thaliana]
 gb|AEE75242.1| zinc transporter 1 [Arabidopsis thaliana]
Length=355

 Score =   322 bits (826),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 239/351 (68%), Gaps = 25/351 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT + +   Q   + K T       K +L +IA +LVAG  GVS+PL+ ++   L 
Sbjct  28    ASSDCTSHDDPVSQ-DEAEKAT-------KLKLGSIALLLVAGGVGVSLPLIGKRIPALQ  79

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++ 
Sbjct  80    PENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLEDTTA-GKFPFAGFVAMLSAMG  138

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLM+DT A  +++++  HF      +              + +      A  V++    S
Sbjct  139   TLMIDTFATGYYKRQ--HFSNNHGSK------------QVNVVVDEEEHAGHVHIHTHAS  184

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             +      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ +TI+PL+ ALSFHQFFEG+
Sbjct  185   HGHTHGSTELIRRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEGL  244

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNSA  1698
             GLGGCI+ A  KS ST +MA FFS+T P+GI  G+G+SS   Y   S  A++ +G+LN+A
Sbjct  245   GLGGCISLADMKSKSTVLMATFFSVTAPLGIGIGLGMSSGLGYRKESKEAIMVEGMLNAA  304

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVDLLA DFM P++Q+N+ L L  ++SLVLGAGSMS+LA+WA
Sbjct  305   SAGILIYMSLVDLLATDFMNPRLQSNLWLHLAAYLSLVLGAGSMSLLAIWA  355



>ref|XP_002884924.1| hypothetical protein ARALYDRAFT_897485 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61183.1| hypothetical protein ARALYDRAFT_897485 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score =   322 bits (826),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 244/352 (69%), Gaps = 27/352 (8%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT + +   Q   + K T       K +L +IA +LVAG  GVS+PL+ ++   L 
Sbjct  28    ASSDCTSHDDPVSQ-DEAEKAT-------KLKLGSIALLLVAGGVGVSLPLIGKRIPALQ  79

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++ 
Sbjct  80    PENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLQDTTA-GKFPFAGFVAMLSAMG  138

Query  1165  TLMVDTLAMSFFRKKMMHFD-KTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             TLM+DT A  +++++  HF+  +   QV+   +E + A               V++    
Sbjct  139   TLMIDTFATGYYKRQ--HFNSNSGSKQVNVVVDEEEHAGH-------------VHVHTHA  183

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ +TI+PL+ ALSFHQFFEG
Sbjct  184   SHGHTHGSTELIRKRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEG  243

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNS  1695
             +GLGGCI+ A+ KS ST +MA FFS+T P+GI  G+G+SS   Y   S  A++ +G+LN+
Sbjct  244   LGLGGCISMAEMKSKSTVIMATFFSVTAPLGIGIGLGMSSGFGYRKESKEAIMVEGMLNA  303

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYM+LVDLLA DFM P++Q+N+ L L  ++SLVLGA SMS+LA+WA
Sbjct  304   ASAGILIYMSLVDLLAPDFMNPRLQSNLWLHLAAYLSLVLGAASMSLLAIWA  355



>ref|XP_004976446.1| PREDICTED: zinc transporter 9-like [Setaria italica]
Length=359

 Score =   322 bits (826),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 237/349 (68%), Gaps = 11/349 (3%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A ++C C+         S+ E      +LK +++AI SILV+ A G +IP L RK   L 
Sbjct  22    AVADCECS--------VSADEDSDKSRALKLKIIAIFSILVSSAVGCAIPSLGRKIPALR  73

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             P+ D+FF +KAFAAGVIL+T FVHILPDAF+ L SP L D  PW K PF+G +A+ A+IA
Sbjct  74    PDTDLFFAVKAFAAGVILATAFVHILPDAFEKLGSPCLVD-GPWQKLPFAGFVAMLAAIA  132

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TL+VDT+A  +F++     +   +  V          A A   H H     A+      +
Sbjct  133   TLVVDTIATGYFQRAHAK-NAAAVGDVETPGHHHHVHAHAHGDHGHNHGMPALIASSSST  191

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             +N   H +  IR RV+SQVLELGI+VHSVIIG+ LG S++  TIRPLLVAL+FHQFFEG+
Sbjct  192   SNTDDH-AQLIRHRVISQVLELGIIVHSVIIGMSLGASESPITIRPLLVALTFHQFFEGI  250

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI QA+F+  S   MA+FFSLTTPVG+A GIGISS YN +S  ALIT+GVL +A+A
Sbjct  251   GLGGCIVQARFRLRSVVTMALFFSLTTPVGVAIGIGISSAYNENSPRALITEGVLTAAAA  310

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GIL YMALVDLLA DFM P++QN+ +LQ+  +VSL+LG   MS+LA+WA
Sbjct  311   GILNYMALVDLLAEDFMNPRVQNSGKLQVILNVSLLLGTALMSMLAIWA  359



>gb|EAY95519.1| hypothetical protein OsI_17365 [Oryza sativa Indica Group]
Length=364

 Score =   322 bits (826),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 235/358 (66%), Gaps = 24/358 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S C C    +G    + ++      ++K +L+AIASIL AGAAGV +P++ R    L 
Sbjct  22    AASACDCANTTDG----ADRQ-----GAMKLKLIAIASILAAGAAGVLVPVIGRSMAALR  72

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLK----DTNPWAKFPFSGLIALT  1152
             P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP LK    D NP   FPF+GL++++
Sbjct  73    PDGDIFFAVKAFAAGVILATGMVHILPAAFDALTSPCLKRSGGDRNP---FPFAGLVSMS  129

Query  1153  ASIATLMVDTLAMSFFRK----KMMHFDKTKL-PQVSadeeeakdaaaadhmhrhgaaaa  1317
             A++AT++VD+LA  ++ +    K    D   +      +  E      A     H  +  
Sbjct  130   AAVATMVVDSLAAGYYHRSQFRKARPVDNINIHKHAGDESTEHAQHINAHTHGAHTHSHG  189

Query  1318  aVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVAL  1497
              + +   P    +   ++ IR +VVSQVLELGI+VHSVIIG+ LG S    TIRPL+ AL
Sbjct  190   DIVVHGSPEEGSV---AESIRHKVVSQVLELGILVHSVIIGVSLGASVRPSTIRPLVGAL  246

Query  1498  SFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALIT  1677
             SFHQFFEG+GLGGCI QA FK  ST +MA+FFSLT PVGI  GI ISS YN HSSTA + 
Sbjct  247   SFHQFFEGVGLGGCIVQANFKVRSTVIMAIFFSLTAPVGIVLGIAISSSYNVHSSTAFVV  306

Query  1678  QGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +GV NSASAGILIYM+LVDLLA DF  PK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  307   EGVFNSASAGILIYMSLVDLLATDFNNPKLQINTKLQLMAYLALFLGAGLMSMLAIWA  364



>ref|XP_010260697.1| PREDICTED: zinc transporter 8-like [Nelumbo nucifera]
Length=674

 Score =   332 bits (852),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 236/345 (68%), Gaps = 19/345 (6%)
 Frame = +1

Query  817   CTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKD  996
             CTC+ +V+ +    S        +LKY++ A  SIL+A A GV IP+L R    L P+++
Sbjct  349   CTCDVDVQDEKQDRSL-------ALKYKIAAFVSILLASAIGVCIPVLGRTIPALHPDRN  401

Query  997   IFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMV  1176
             +FF+IKAFAAGVIL+TGF+HILPDAF+ LTSP LK    W  FPF+G +A+ +++ T MV
Sbjct  402   VFFLIKAFAAGVILATGFIHILPDAFEQLTSPCLKG-KVWENFPFTGFVAMMSAMGTFMV  460

Query  1177  DTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNEL  1356
             +TLA  ++++  +HF K+    V  + +         H H     +        P     
Sbjct  461   ETLATGYYKR--LHFSKSLPTNVDEEMQGDHVGHLHVHTHATHGHSHGSGDSTAP-----  513

Query  1357  VHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGG  1536
                 D +R RV SQVLELGI+VHSVIIG+ LG SQ   TI+PL+ ALSFHQFFEGMGLGG
Sbjct  514   ----DLLRHRVTSQVLELGILVHSVIIGISLGASQEPSTIKPLVAALSFHQFFEGMGLGG  569

Query  1537  CIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILI  1716
             CI QA F++ +  VM +FFSLTTP GIA GIGI++VY+ +S TALI +G+ +SA+AGILI
Sbjct  570   CITQANFRTRAVVVMTLFFSLTTPAGIAVGIGITNVYDENSPTALIVEGIFDSAAAGILI  629

Query  1717  YMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             YMALVDLLA+DFM P++Q+N +LQL  ++ L+LGAG MS+LA+WA
Sbjct  630   YMALVDLLASDFMNPRMQSNGKLQLWANICLLLGAGCMSLLAIWA  674


 Score =   329 bits (843),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 239/348 (69%), Gaps = 28/348 (8%)
 Frame = +1

Query  778   PCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPL  957
             P ++SG      ECTC+         + +    T +++KY++  IASIL++GA GV IP+
Sbjct  27    PSSVSG------ECTCD---------AKENNRGTGETIKYKVAGIASILISGAIGVCIPV  71

Query  958   LARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSG  1137
             L +    L PE DIFF+IKAFAAGVIL+TGF+HILP+AF+ LTSP LK    W  FPF+G
Sbjct  72    LGKAIPALHPENDIFFIIKAFAAGVILATGFIHILPNAFEKLTSPCLKG-KAWQNFPFTG  130

Query  1138  LIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaa  1317
              IA+ + I TLMVDTL   ++++   +F K +               A + +        
Sbjct  131   FIAMMSGIGTLMVDTLVTGYYKRS--NFSKAQ-------PLNGDVERAGEPVDHVHVHTH  181

Query  1318  aVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVAL  1497
             A +     SN+     SD +R R++SQVLELGIVVHSVIIG+ LGTS++  TI+PL+ AL
Sbjct  182   ATHGHAHGSNSTS---SDLLRHRIISQVLELGIVVHSVIIGISLGTSESSSTIKPLIAAL  238

Query  1498  SFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALIT  1677
             SFHQFFEG+GLGGCI QA+ KS + A+MAVFFSLTTPVGIA GIGI++VY+ +SST+L  
Sbjct  239   SFHQFFEGIGLGGCITQARIKSSAVAIMAVFFSLTTPVGIAVGIGITNVYDANSSTSLSV  298

Query  1678  QGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGA  1821
             +GV +SAS+GILIYMALVDLLAADFM PK+Q+N RLQ+  ++SL+ GA
Sbjct  299   EGVFDSASSGILIYMALVDLLAADFMDPKMQSNGRLQIIANISLLFGA  346



>emb|CDP03480.1| unnamed protein product [Coffea canephora]
Length=354

 Score =   322 bits (825),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 230/322 (71%), Gaps = 6/322 (2%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +LKY+  AIASILVA   GV +P+  +K   L PE ++FF+IKAFAAGVIL+TGF+H+LP
Sbjct  39    ALKYKSGAIASILVASFIGVLLPVWGKKIPSLSPENNLFFVIKAFAAGVILATGFIHVLP  98

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF++LTSP L D NPW KFPF+G +A+ ASI TLMVD  A S ++K   +     + + 
Sbjct  99    DAFESLTSPCLPD-NPWGKFPFTGFVAMLASIGTLMVDVYATSHYKKMAGNKGIQAIAEE  157

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
                  E+  +             A   L     + E   LS ++R RV+SQVLELGI+VH
Sbjct  158   GDRNGESNLSGVLPLHTHATHGHAHTSL-----SMEGDTLSTQLRYRVISQVLELGIIVH  212

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ +G S + +TIRPLL AL+FHQFFEG+GLGGCI QAKF + +  +MA+FFSLTT
Sbjct  213   SVIIGIAMGASDSPKTIRPLLAALTFHQFFEGVGLGGCITQAKFNARAITIMAIFFSLTT  272

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             P GIA GIGI++VYN +S  ALI QG+ +SASAGILIYMALVDLL+ADFM PK+QNN +L
Sbjct  273   PAGIAIGIGIANVYNENSPKALIVQGIFDSASAGILIYMALVDLLSADFMNPKMQNNGKL  332

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
              +G +VSL+ GAG MS+LA WA
Sbjct  333   LMGANVSLLFGAGCMSLLAKWA  354



>gb|ACJ84426.1| unknown [Medicago truncatula]
 gb|KEH35200.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=358

 Score =   322 bits (825),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 244/347 (70%), Gaps = 14/347 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E  L     +      +L+Y++ A+ SILVA   GV IPLL +    L PE
Sbjct  26    AECTCD---EEDLDRDKPK------ALRYKIAALVSILVASGIGVCIPLLGKVIPALSPE  76

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KDIFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK  +PW  FPF+G +A+  ++ TL
Sbjct  77    KDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPRLKK-HPWGDFPFTGFVAMCTAMGTL  135

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A ++F+    H+ K    QV  +     +     HM  H  A+   +  P  S+ 
Sbjct  136   MVDTYATAYFQN---HYSKKAPAQVENEVSPDVEKDHEGHMDVHTHASHG-HAHPHMSSV  191

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  ++ +R RV++QVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGL
Sbjct  192   SSGPSTELLRHRVITQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFHQFFEGMGL  251

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             G CI QA FKS+S  +M +FF+LTTPVGIA GIGISS Y+ +S TALI +G+ N+AS+GI
Sbjct  252   GSCITQANFKSLSITIMGLFFALTTPVGIAIGIGISSGYDENSPTALIVEGIFNAASSGI  311

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++Q +  L+LG ++SL+LG+G MS++A WA
Sbjct  312   LIYMALVDLLAADFMNPRMQKSGILRLGCNISLLLGSGLMSLIAKWA  358



>ref|XP_010465054.1| PREDICTED: zinc transporter 1-like [Camelina sativa]
Length=358

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 243/351 (69%), Gaps = 22/351 (6%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT + + +      SK+      + K +L +IA +LVAG  GVS+PL+ +K   L 
Sbjct  28    ASSDCTSHDDRDA----VSKDE--AEKATKLKLGSIALLLVAGGLGVSLPLIGKKIPALQ  81

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++ 
Sbjct  82    PENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLEDTTA-GKFPFAGFVAMLSAMG  140

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLM+DT A  +++++    + +   QV+  E+E + A               V++    S
Sbjct  141   TLMIDTFATGYYKRQQHFSNNSGSKQVNVVEDEEEHAGH-------------VHVHTHAS  187

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             +      ++ IR+R+V+QVLE+GIVVHSVIIG+ LG S + +TI+PL+ ALSFHQFFEG+
Sbjct  188   HGHAHGSTEVIRRRIVAQVLEIGIVVHSVIIGISLGASHSIDTIKPLMAALSFHQFFEGL  247

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNSA  1698
             GLGGCI+ A+ KS ST +MA FFS+T PVGI  G+G+SS   Y   S  A++ +G+LN+A
Sbjct  248   GLGGCISLAELKSKSTVIMATFFSVTAPVGIGIGMGMSSGLGYRKESKEAIMVEGMLNAA  307

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVDLLA DFM P++Q+N+ L L  ++SL+LGA SMS+LA+WA
Sbjct  308   SAGILIYMSLVDLLAPDFMNPRLQSNLWLHLAAYLSLILGAASMSLLAIWA  358



>ref|XP_010557015.1| PREDICTED: zinc transporter 5-like [Tarenaya hassleriana]
Length=357

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 234/351 (67%), Gaps = 15/351 (4%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             AA E+ C C+   +G+   S++         KY++ AI S+LVAG  GV  PLL   +  
Sbjct  22    AAGENRCECSHEHDGENKSSAQ---------KYKIAAIPSVLVAGIIGVLFPLLGNVFPS  72

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE   FF+ +AFAAGVILSTGF+H+LP+AF+ LTSP L + +PW +FPF+G IA+ A+
Sbjct  73    LRPETTFFFVTRAFAAGVILSTGFLHVLPEAFKMLTSPCLSE-HPW-EFPFTGFIAMMAA  130

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD  A S+F+K   HF   ++      +E   +     H H H            
Sbjct  131   ILTLSVDAFATSYFQKS--HFKNQRIGSEGEGKEGGGELGLHVHAHAHSHGGLTAAESGG  188

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  E   ++  +R RV++QVLELGI+VHSV+IG+ LG SQ  +T + L  AL FHQ FE
Sbjct  189   GSAGE--SMTQLLRNRVIAQVLELGIIVHSVVIGISLGASQDPDTAKTLFAALMFHQCFE  246

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCI Q KFK ++  +MA+FFS+TTP+GIA G+GISS Y+  S TALI QGVLN+A
Sbjct  247   GLGLGGCITQGKFKWMTITIMAMFFSVTTPIGIAVGMGISSSYDESSPTALIVQGVLNAA  306

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             S+GILIYM+LVDLLAADFM PK+Q+N  LQ+  H+SL+LGAG MS+LA WA
Sbjct  307   SSGILIYMSLVDLLAADFMHPKMQSNSGLQIMAHISLLLGAGVMSLLAKWA  357



>ref|XP_010051825.1| PREDICTED: zinc transporter 1-like [Eucalyptus grandis]
Length=373

 Score =   321 bits (822),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 231/352 (66%), Gaps = 11/352 (3%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKE-TLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
             +EC C  + E Q     K        +LKY+L AI SIL A   GVS+P+L +K   L P
Sbjct  28    AECRCESSTETQFPDLEKSYGSANHQALKYKLAAIFSILAASFLGVSLPILGKKLPSLHP  87

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             +  IFF++K+FAAGVILST FVHILPDAF +L SP L DT PW  FPF+G IA+ A+I T
Sbjct  88    DNPIFFLVKSFAAGVILSTAFVHILPDAFASLASPALADT-PWHNFPFAGFIAMLAAIGT  146

Query  1168  LMVDTLAMSFFRKKMMHF----DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDP  1335
             +MVDT A S+F +   HF    D+   P  +A  +  ++    +        A   +   
Sbjct  147   MMVDTFATSYFERS--HFGKAADEVLQPPPAAAGKGDEEMDMHEGHVHVHTHATHGHAHG  204

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
                ++    L+   R R++SQVLELG+VVHSVIIG+ LG S++  TI+PL+ AL+FHQ F
Sbjct  205   SAHDSRSSQLT---RHRIISQVLELGVVVHSVIIGVSLGASESPRTIKPLVAALTFHQLF  261

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EG+GLGGCI+QAKFKS     M  FF LTTPVGI  G+G+SS+Y     +ALI +G LNS
Sbjct  262   EGIGLGGCISQAKFKSRKIVAMMAFFCLTTPVGIGVGMGMSSIYGEGKPSALIVEGSLNS  321

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGIL YMALVDL+AAD+M P +  N++LQ+G ++SL+LG+ SMS+LA WA
Sbjct  322   ASAGILTYMALVDLIAADYMNPIMLQNLKLQMGANLSLLLGSASMSLLATWA  373



>gb|AAR08413.1| metal transport protein [Medicago truncatula]
Length=359

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 174/331 (53%), Positives = 230/331 (69%), Gaps = 14/331 (4%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E  L     +      +L+Y++ A+ SILVA   GV IPLL +    L PE
Sbjct  26    AECTCD---EEDLDRDKPK------ALRYKIAALVSILVASGIGVCIPLLGKVIPALSPE  76

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KDIFF+IKAFAAGVIL+TGF+H+LPDAF+ LTSP LK  +PW  FPF+G +A+  ++ TL
Sbjct  77    KDIFFIIKAFAAGVILATGFIHVLPDAFENLTSPRLKK-HPWGDFPFTGFVAMCTAMGTL  135

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A ++F+    H+ K    QV  +     +     HM  H  A+   +  P  S+ 
Sbjct  136   MVDTYATAYFQN---HYSKKAPAQVENEVSPDVEKDHEGHMDVHTHASHG-HAHPHMSSV  191

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  ++ +R RV++QVLELGI+VHSVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGL
Sbjct  192   SSGPSTELLRHRVITQVLELGIIVHSVIIGISLGASESPKTIRPLVAALTFHQFFEGMGL  251

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             G CI QA FKS+S  +M +FF+LTTPVGIA GIGISS Y+ +S TALI +G+ N+AS+GI
Sbjct  252   GSCITQANFKSLSITIMGLFFALTTPVGIAIGIGISSGYDENSPTALIVEGIFNAASSGI  311

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHV  1803
             LIYMALVDLLAADFM P++Q N  L+LG ++
Sbjct  312   LIYMALVDLLAADFMNPRMQKNGILRLGCNI  342



>ref|XP_009402753.1| PREDICTED: zinc transporter 8-like [Musa acuminata subsp. malaccensis]
Length=343

 Score =   320 bits (819),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 230/348 (66%), Gaps = 24/348 (7%)
 Frame = +1

Query  808   ESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGP  987
               +C C+ + E +   +++           ++VAI SILV G+ GV IP+L +    L P
Sbjct  20    HGDCDCSADEEARDKKAAR---------PLKIVAIFSILVCGSIGVCIPILGKWIPALDP  70

Query  988   EKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
             ++D FF+IK+FAAGVIL+T FVHILPD+F +LTS  L   +PW  FPF+G  A+ A+I T
Sbjct  71    DRDTFFVIKSFAAGVILATAFVHILPDSFDSLTSSCLH-PDPWHNFPFAGFGAMIAAIGT  129

Query  1168  LMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSN  1347
             LM+DTLA  +F +            VS + +   +         +       +    PS+
Sbjct  130   LMIDTLATGYFSRPHN--------AVSDETKTDIEIRPDVVHEENIHVHTHAHAHGHPSS  181

Query  1348  NELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMG  1527
              +L      IR RV+SQVLELGIVVHSVIIG+ LG S+T  TI+PL+VALSFHQFFEG+G
Sbjct  182   PQL------IRHRVISQVLELGIVVHSVIIGIALGASETPSTIKPLVVALSFHQFFEGVG  235

Query  1528  LGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAG  1707
             LGGC+ QAK K  +   M +FFSLTTPVG+A G G+SS Y+ +S TALI +G+LNSASAG
Sbjct  236   LGGCLVQAKLKPRTAVTMGLFFSLTTPVGVAVGAGLSSAYDENSPTALIVEGLLNSASAG  295

Query  1708  ILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ILIYM+LVDLLA DFM P++Q+  RLQ+G ++SL+ GAG MS+LA WA
Sbjct  296   ILIYMSLVDLLAEDFMNPRVQSKGRLQVGMNISLLTGAGLMSLLAKWA  343



>ref|XP_009363363.1| PREDICTED: zinc transporter 8-like [Pyrus x bretschneideri]
Length=344

 Score =   320 bits (819),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 175/355 (49%), Positives = 228/355 (64%), Gaps = 49/355 (14%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             S CT     E   H +  + L+     +Y+L+AIAS+LV+GA GV +P + +   F  PE
Sbjct  29    SACTYEKKDE---HRNESKLLI-----RYKLIAIASVLVSGALGVCLPFVVKNIPFFHPE  80

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KD + +IKAFAAGVIL+TGFVH+LPDA  +LTSP L + NPW +FPF+G +A+ ++I TL
Sbjct  81    KDFYLLIKAFAAGVILATGFVHVLPDANDSLTSPCLSE-NPWRRFPFTGFVAMVSAIGTL  139

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             M++ +A  + ++      + + PQ                            +D    N+
Sbjct  140   MMEAIATGYQKR-----SELRKPQP---------------------------VDGDEEND  167

Query  1351  ELVHL-------SDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
               VH        S+ IR R++SQVLELGI+VHSVIIG+ LG  Q++ TI+PL+ ALSFHQ
Sbjct  168   HAVHFHGSASNSSELIRHRIISQVLELGILVHSVIIGISLGACQSQHTIKPLVAALSFHQ  227

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
             FFEGMGLGGCI QAKF   + A+M VFFSLTTP GIA GI IS  YN  SSTALI QG+L
Sbjct  228   FFEGMGLGGCIYQAKFNHKTMAIMVVFFSLTTPTGIAVGIAISKTYNESSSTALIVQGLL  287

Query  1690  NSASAGILIYMALVDLLAADFM-KPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              SASAGILIYMALVDLLAADF+   K+ +N +LQLG   +L+LG   MS++A W 
Sbjct  288   LSASAGILIYMALVDLLAADFINNTKMLSNPKLQLGASFTLLLGVCFMSLMAKWG  342



>dbj|BAJ34313.1| unnamed protein product [Thellungiella halophila]
Length=346

 Score =   319 bits (818),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 243/366 (66%), Gaps = 25/366 (7%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             I IIF  C      +A S+CT + + E      +++      + K +L +IA +LVAG  
Sbjct  4     IYIIFMICL--HVCSASSDCTSHDDQEAVSQDEAEK------ATKLKLGSIALLLVAGGV  55

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GVS+PL+ +K   L PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L SP L+ T    
Sbjct  56    GVSLPLVGKKIPALQPENDIFFMVKAFAAGVILCTGFVHILPDAFERLGSPCLQSTAA-G  114

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+G +A+ +++ TLM+DT A  +++++  HF      +               ++  
Sbjct  115   KFPFAGFVAMLSAMGTLMIDTFATGYYKRQ--HFGSNNGNK------------QVVNVVD  160

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
                 A  V++    S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ ETI+
Sbjct  161   EEEHAGHVHVHTHASHGHAHGSTELIRRRIVSQVLEIGIVVHSVIIGISLGASQSIETIK  220

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNP  1653
             PL+ ALSFHQFFEG+GLGGCI+ A+ KS ST +MA FFS+T PVGI  G+G+SS   Y  
Sbjct  221   PLMAALSFHQFFEGLGLGGCISLAELKSKSTVIMATFFSVTAPVGIGIGMGMSSGLGYRK  280

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
              S  AL+ +G+LN+ASAGILIYM+LVDLLA DF+ P++Q+N+ L L   +SL+LGA SMS
Sbjct  281   ESKEALMVEGMLNAASAGILIYMSLVDLLAPDFVNPRLQSNLWLHLAAFLSLLLGAASMS  340

Query  1834  VLAMWA  1851
             +LA+WA
Sbjct  341   LLAIWA  346



>ref|XP_006407300.1| hypothetical protein EUTSA_v10021018mg [Eutrema salsugineum]
 gb|ESQ48753.1| hypothetical protein EUTSA_v10021018mg [Eutrema salsugineum]
Length=356

 Score =   319 bits (818),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 178/366 (49%), Positives = 243/366 (66%), Gaps = 25/366 (7%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             I IIF  C      +A S+CT + + E      +++      + K +L +IA +LVAG  
Sbjct  14    IYIIFMICL--HVCSASSDCTSHDDQEAVSQDEAEK------ATKLKLGSIALLLVAGGV  65

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GVS+PL+ +K   L PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L SP L+ T    
Sbjct  66    GVSLPLVGKKIPALQPENDIFFMVKAFAAGVILCTGFVHILPDAFERLGSPCLQSTAA-G  124

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+G +A+ +++ TLM+DT A  +++++  HF      +               ++  
Sbjct  125   KFPFAGFVAMLSAMGTLMIDTFATGYYKRQ--HFGSNNGNK------------QVVNVVD  170

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
                 A  V++    S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ ETI+
Sbjct  171   EEEHAGHVHVHTHASHGHAHGSTELIRRRIVSQVLEIGIVVHSVIIGISLGASQSIETIK  230

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNP  1653
             PL+ ALSFHQFFEG+GLGGCI+ A+ KS ST +MA FFS+T PVGI  G+G+SS   Y  
Sbjct  231   PLMAALSFHQFFEGLGLGGCISLAELKSKSTVIMATFFSVTAPVGIGIGMGMSSGLGYRK  290

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
              S  AL+ +G+LN+ASAGILIYM+LVDLLA DF+ P++Q+N+ L L   +SL+LGA SMS
Sbjct  291   ESKEALMVEGMLNAASAGILIYMSLVDLLAPDFVNPRLQSNLWLHLAAFLSLLLGAASMS  350

Query  1834  VLAMWA  1851
             +LA+WA
Sbjct  351   LLAIWA  356



>ref|XP_006299048.1| hypothetical protein CARUB_v10015186mg [Capsella rubella]
 gb|EOA31946.1| hypothetical protein CARUB_v10015186mg [Capsella rubella]
Length=357

 Score =   318 bits (815),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/352 (50%), Positives = 240/352 (68%), Gaps = 25/352 (7%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT + + +      SK+      +LK  L +IA +LVAG  GVS+PL+ +K   L 
Sbjct  28    ASSDCTSHDDHD----VVSKDEAEKATTLK--LGSIALLLVAGGLGVSLPLIGKKIPALQ  81

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++ 
Sbjct  82    PENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLEDTTA-GKFPFAGFVAMLSAMG  140

Query  1165  TLMVDTLAMSFFRKKMMHF-DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             TLM+DT A  +++++  HF + +   QV+   +E +                        
Sbjct  141   TLMIDTFATGYYKRQ--HFSNNSGSKQVNVVVDEEEHGGHVHVHTHA-------------  185

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ +TI+PL+ ALSFHQFFEG
Sbjct  186   SHGHAHGSTEMIRRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEG  245

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNS  1695
             +GLGGCI+ A+ KS ST +MA FFS+T PVGI  G+G+SS   Y   S  A++ +G+LN+
Sbjct  246   LGLGGCISLAELKSKSTVIMATFFSVTAPVGIGIGMGMSSGLGYRKESKEAIMVEGMLNA  305

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AS GILIYM+LVDLLA DFM P++Q+N+ L L  ++SLVLGA SMS+LA+WA
Sbjct  306   ASGGILIYMSLVDLLAPDFMNPRLQSNLWLHLAAYLSLVLGAASMSLLAIWA  357



>gb|KFK38622.1| hypothetical protein AALP_AA3G138000 [Arabis alpina]
Length=334

 Score =   317 bits (812),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 173/353 (49%), Positives = 239/353 (68%), Gaps = 25/353 (7%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             AA S+CT + +    +     E      + K +L +IA +L+AG  GVS+PL+ +K   L
Sbjct  4     AASSDCTSHDDDHDSVSQEEAE-----KATKLKLGSIALLLMAGGVGVSLPLVGKKIPAL  58

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
              PE DIFFM+KAFAAGVIL TGFVHILPDAF+ L+SP L+DT    KFPF+G +A+ +++
Sbjct  59    QPENDIFFMVKAFAAGVILCTGFVHILPDAFERLSSPCLEDTVA-GKFPFAGFVAMVSAM  117

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTK-LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
              TLM+DT A  +++++  HF     + QV+  +EE                   V++   
Sbjct  118   GTLMIDTFATGYYKRQ--HFSSNNGIKQVNVVDEEEHAGH--------------VHVHTH  161

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S+      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ ETI+PL+ ALSFHQFFE
Sbjct  162   ASHGHAHGSTELIRRRIVSQVLEIGIVVHSVIIGISLGASQSIETIKPLMAALSFHQFFE  221

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLN  1692
             G+GLGGCI+ A+ KS ST +MA FFS+T  +GI  G+G+SS   Y   S  A++ +G+LN
Sbjct  222   GLGLGGCISLAELKSKSTVIMATFFSVTASIGIGIGMGMSSGLGYRRESKEAIMVEGMLN  281

Query  1693  SASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +ASAGILIYM+LVDLLA DF+ P++Q+N+ L L   +SL+LG  SMS+LA+WA
Sbjct  282   AASAGILIYMSLVDLLAPDFVNPRLQSNLWLHLAAFLSLLLGGASMSLLAIWA  334



>ref|NP_001053851.1| Os04g0613000 [Oryza sativa Japonica Group]
 sp|Q7XLD4.2|ZIP3_ORYSJ RecName: Full=Zinc transporter 3; AltName: Full=ZRT/IRT-like 
protein 3; Short=OsZIP3; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAP85537.1| zinc transporter ZIP3 [Oryza sativa Japonica Group]
 emb|CAE05208.2| OSJNBa0070C17.15 [Oryza sativa Japonica Group]
 dbj|BAF15765.1| Os04g0613000 [Oryza sativa Japonica Group]
 gb|EAZ31960.1| hypothetical protein OsJ_16134 [Oryza sativa Japonica Group]
 dbj|BAG91613.1| unnamed protein product [Oryza sativa Japonica Group]
Length=364

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/360 (50%), Positives = 235/360 (65%), Gaps = 28/360 (8%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S C C    +G    + ++      ++K +L+AIASIL AGAAGV +P++ R    L 
Sbjct  22    AASACDCANTTDG----ADRQ-----GAMKLKLIAIASILAAGAAGVLVPVIGRSMAALR  72

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLK----DTNPWAKFPFSGLIALT  1152
             P+ DIFF +KAFAAGVIL+TG VHILP AF  LTSP LK    D NP   FPF+GL++++
Sbjct  73    PDGDIFFAVKAFAAGVILATGMVHILPAAFDALTSPCLKRGGGDRNP---FPFAGLVSMS  129

Query  1153  ASIATLMVDTLAMSFFRKKMMHFDKTK-------LPQVSadeeeakdaaaadhmhrhgaa  1311
             A+++T++VD+LA  ++ +    F K +             +  E      A     H  +
Sbjct  130   AAVSTMVVDSLAAGYYHRS--QFRKARPVDNINVHKHAGDERAEHAQHINAHTHGGHTHS  187

Query  1312  aaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLV  1491
                + +   P    +   ++ IR +VVSQVLELGI+VHSVIIG+ LG S    TIRPL+ 
Sbjct  188   HGDIVVCGSPEEGSV---AESIRHKVVSQVLELGILVHSVIIGVSLGASVRPSTIRPLVG  244

Query  1492  ALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTAL  1671
             ALSFHQFFEG+GLGGCI QA FK  +T +MA+FFSLT PVGI  GI ISS YN HSSTA 
Sbjct  245   ALSFHQFFEGVGLGGCIVQANFKVRATVIMAIFFSLTAPVGIVLGIAISSSYNVHSSTAF  304

Query  1672  ITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             + +GV NSASAGILIYM+LVDLLA DF  PK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  305   VVEGVFNSASAGILIYMSLVDLLATDFNNPKLQINTKLQLMAYLALFLGAGLMSMLAIWA  364



>ref|XP_006652807.1| PREDICTED: zinc transporter 3-like [Oryza brachyantha]
Length=366

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 234/357 (66%), Gaps = 20/357 (6%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S C C    +G    + ++      ++K +L+AIASIL AGAAGV +P+L R    L 
Sbjct  22    AASACDCANTTDG----TDRQ-----GTMKLKLIAIASILTAGAAGVLVPVLGRSMAVLR  72

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL-KDTNPWAKFPFSGLIALTASI  1161
             P+  IFF +KAFAAGVIL+TG VHILP AF  L SP L K      +FPF+G ++++A++
Sbjct  73    PDGGIFFAVKAFAAGVILATGMVHILPAAFDALASPCLNKSVGDSNRFPFAGFVSMSAAV  132

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
             AT++VD+LA  ++ +    F K + P  + D  +      A+H     A           
Sbjct  133   ATMVVDSLAAGYYHQS--QFSKAR-PVDNIDIHKHAGDEKAEHAQHINAHTHTHTTHAHS  189

Query  1342  SNNELVH-------LSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALS  1500
               + +VH       +++ IR RVVSQVLELGI+VHSVIIG+ LG S    TIRPL+ ALS
Sbjct  190   HGDIVVHGSPEEGSVAESIRHRVVSQVLELGILVHSVIIGVSLGASVRPSTIRPLVGALS  249

Query  1501  FHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQ  1680
             FHQFFEG+GLGGCI QA FK  +T +MA+FFSLT PVGI  GI ISS YN HSSTA I +
Sbjct  250   FHQFFEGVGLGGCIVQANFKVKATVIMAIFFSLTAPVGIVLGIAISSSYNEHSSTAFIVE  309

Query  1681  GVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GV NSASAGILIYM+LVDLLA DF  PK+Q N +LQL  +++L LGAG MS+LA+WA
Sbjct  310   GVFNSASAGILIYMSLVDLLATDFNNPKLQTNTKLQLMAYLALFLGAGLMSMLAIWA  366



>gb|KEH35212.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=343

 Score =   317 bits (813),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 219/303 (72%), Gaps = 10/303 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+LP
Sbjct  38    ALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLP  97

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    QV
Sbjct  98    DAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQV  153

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
              +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+VH
Sbjct  154   ESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIVH  207

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LTT
Sbjct  208   SVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTT  267

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+GIS+VY+ +S TALI +G+ N+ASAGILIYMALVDLLAADFM P++Q N + 
Sbjct  268   PVGIGIGLGISNVYDENSPTALIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNAQS  327

Query  1786  QLG  1794
              LG
Sbjct  328   LLG  330



>gb|KEH35211.1| ZIP zinc/iron transport family protein [Medicago truncatula]
Length=366

 Score =   318 bits (815),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/303 (55%), Positives = 219/303 (72%), Gaps = 10/303 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+Y++ A+ SILVA A GV +PLL +    L PEKDIFF+IKAFAAGVILSTGF+H+LP
Sbjct  61    ALRYKIAALVSILVASAIGVCLPLLGKVIPALSPEKDIFFIIKAFAAGVILSTGFIHVLP  120

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             DAF+ LTSP L + +PW  FPF+G +A+  ++ TLMVDT A ++F+    H+ K    QV
Sbjct  121   DAFENLTSPCLNE-HPWGDFPFTGFVAMCTAMGTLMVDTYATAYFQN---HYSKRAPAQV  176

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
              +      +     H+H H + + A        ++EL      +R RV+SQVLELGI+VH
Sbjct  177   ESQTTPDVENEEHTHVHAHASHSHAHGHISFDQSSEL------LRHRVISQVLELGIIVH  230

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S++ +TIRPL+ AL+FHQFFEGMGLG CI QA FKS+S  +M +FF+LTT
Sbjct  231   SVIIGISLGASESPKTIRPLVAALTFHQFFEGMGLGSCITQANFKSLSITIMGLFFALTT  290

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             PVGI  G+GIS+VY+ +S TALI +G+ N+ASAGILIYMALVDLLAADFM P++Q N + 
Sbjct  291   PVGIGIGLGISNVYDENSPTALIFEGIFNAASAGILIYMALVDLLAADFMNPRMQKNAQS  350

Query  1786  QLG  1794
              LG
Sbjct  351   LLG  353



>ref|XP_011035492.1| PREDICTED: zinc transporter 1-like [Populus euphratica]
Length=353

 Score =   317 bits (811),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 245/369 (66%), Gaps = 27/369 (7%)
 Frame = +1

Query  745   VASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASIL  924
             + + + +I+  P  +S      S+CT          Y S +  ++ ++LKY+L+AI+SIL
Sbjct  10    IFTIFCLILLLPVLVS------SKCTGKA-------YDSHDQNIS-EALKYKLIAISSIL  55

Query  925   VAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKD  1104
              A A G+ +P   +   +L P+++ FF+IKAFAAGVIL TGF+HILPDAF++LTSP L  
Sbjct  56    FASALGICLPFFVKNLSYLHPDREAFFLIKAFAAGVILGTGFIHILPDAFESLTSPCLGQ  115

Query  1105  TNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaa  1284
              +PW KFPF+G +A+ ++I TLM+++ A  + ++      + + PQ              
Sbjct  116   -HPWEKFPFAGFVAMLSAIGTLMMESFATGYHKRL-----ELRKPQ-------PVSGDHE  162

Query  1285  dhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQT  1464
             ++  +    A  V++  P    + ++ SD  R R+VSQVLELGI+VHSVIIGL LG S++
Sbjct  163   ENSDQDDNGAGGVHIRGPAFVLKRINSSDLNRHRIVSQVLELGILVHSVIIGLSLGASKS  222

Query  1465  RETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSV  1644
              +TI+PL+ ALSFHQFFEG+GLGGCI+QAKFK  +  +M +FFSLTTP GIA GI IS+ 
Sbjct  223   SKTIKPLVAALSFHQFFEGVGLGGCISQAKFKLQAKVIMILFFSLTTPTGIAIGIWISTS  282

Query  1645  YNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAG  1824
             YN  S  ALI QG+LNSASAGILIYMALVDLLAADF+   +  +  LQLG +++L LGA 
Sbjct  283   YNEASPMALIIQGILNSASAGILIYMALVDLLAADFINSNMLYSFWLQLGAYLTLFLGAF  342

Query  1825  SMSVLAMWA  1851
             SMS+L +W 
Sbjct  343   SMSLLVIWG  351



>ref|XP_009412061.1| PREDICTED: zinc transporter 3-like [Musa acuminata subsp. malaccensis]
Length=400

 Score =   317 bits (813),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 238/356 (67%), Gaps = 38/356 (11%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C  +VE +             +L+ + VAIASIL AGA GV IP+L R    L PE 
Sbjct  73    DCECTRDVESR---------NATKALRLKFVAIASILTAGAVGVLIPILGRSVSALQPEH  123

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D+FF+IKAFAAGVIL+TG +HILP AFQ+LTSP L + +PW   P +G + +++++ T+M
Sbjct  124   DMFFVIKAFAAGVILATGLIHILPAAFQSLTSPCLAE-HPWHTLPVTGFVVMSSAMWTMM  182

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             +D+ A S++++   HF K +                             V++   PS+  
Sbjct  183   IDSFATSYYKRS--HFSKAR----------------PVEEDEEHGQEGHVHVHTHPSHGH  224

Query  1354  ----------LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSF  1503
                          +S+RIR +V+SQVLELGI+VHSVI+G+ LG SQ   TIRPL+ ALSF
Sbjct  225   AHGSTAAAAEEASVSERIRHQVISQVLELGILVHSVIVGISLGASQRPSTIRPLVGALSF  284

Query  1504  HQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQG  1683
             HQFFEG+GLGGCI QA F++ ST VMAVFFSLT PVGIA GI ISSVY+  SSTALI +G
Sbjct  285   HQFFEGIGLGGCIVQAGFRAKSTVVMAVFFSLTAPVGIALGIAISSVYDDASSTALIVEG  344

Query  1684  VLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             V N+ASAGIL+YMALVDLLAADF  P++Q+N RLQLG H++L+LGAG MS++A+WA
Sbjct  345   VFNAASAGILVYMALVDLLAADFTNPRMQSNGRLQLGAHLALLLGAGLMSLIAIWA  400



>ref|XP_008225896.1| PREDICTED: zinc transporter 5-like [Prunus mume]
Length=353

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 230/351 (66%), Gaps = 27/351 (8%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE-FL  981
             A S CTC      Q    SKE L      +Y+LVAI S+LV+GA GV +P L +     L
Sbjct  26    ASSACTCEKQRNDQ--NKSKEVL------RYKLVAIVSVLVSGALGVCLPFLVKNISSIL  77

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
              P+KD + +IKAFAAGVIL+TGFVH+LPDA ++LTSP L   NPW +FPF+G +A+ ++I
Sbjct  78    HPDKDFYLLIKAFAAGVILATGFVHVLPDAHESLTSPCLSK-NPWGRFPFTGFVAMVSAI  136

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
              TLM++ +A  + ++  +   +           +  + +     H      +A+ L+P  
Sbjct  137   GTLMMEAIATGYHKRSELRKSQP---------VDGDEESDHGAHHAGHVHGSALVLEPSN  187

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S       S+ IR R++SQVLELGIVVHSVIIG+ LG  Q+  TI+PL+ ALSFHQFFEG
Sbjct  188   S-------SELIRHRIISQVLELGIVVHSVIIGISLGACQSPHTIKPLVAALSFHQFFEG  240

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI QAKFK  + A M +FFSLTTP GIA GI IS+ Y   S TALI QG+L SAS
Sbjct  241   MGLGGCIYQAKFKHKTMATMVLFFSLTTPAGIAVGIAISNTYTKSSPTALIVQGLLLSAS  300

Query  1702  AGILIYMALVDLLAADFM-KPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYMALVDLLAADF+   K+  N +LQLG + +L+LGA  MS++A W 
Sbjct  301   AGILIYMALVDLLAADFINNAKMLGNPKLQLGANFTLLLGACFMSLMAKWG  351



>gb|AAP92123.1| iron transporter Fe2 [Oryza sativa]
Length=357

 Score =   315 bits (807),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 169/318 (53%), Positives = 208/318 (65%), Gaps = 10/318 (3%)
 Frame = +1

Query  898   RLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQ  1077
             ++ A  SILV GA G  +P L R    L P+ D+FF++KAFAAGVIL+TGF+HILPDAF 
Sbjct  50    KIAAFFSILVCGALGCGLPSLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFD  109

Query  1078  TLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSade  1257
              LT   L    PW +FPF+G  A+  +I TL+VDTLA  +F + +   D           
Sbjct  110   NLTDDCLPAGGPWKEFPFAGFGAMVGAIGTLVVDTLATGYFTRALSKKDAATAAAHEGQV  169

Query  1258  eeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVII  1437
                  A            AA    D   +          +R RV+SQVLELGIVVHSVII
Sbjct  170   HVHTHATHGHAHGSSALVAAVGEDDKETT----------LRHRVISQVLELGIVVHSVII  219

Query  1438  GLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGI  1617
             G+ LG SQ  ETI+PL+VALSFHQ FEGMGLGGCI QAKFK  S   M +FF LTTPVGI
Sbjct  220   GISLGASQNPETIKPLVVALSFHQMFEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVGI  279

Query  1618  ATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGG  1797
             A G+GISSVYN  S TAL+ +G+LNS +AGILIYMALVDLLA DFM P++Q+  +LQLG 
Sbjct  280   AVGVGISSVYNESSPTALVVEGILNSVAAGILIYMALVDLLAEDFMNPRVQSKGKLQLGI  339

Query  1798  HVSLVLGAGSMSVLAMWA  1851
             +++++ GAG MS+LA WA
Sbjct  340   NLAMLAGAGLMSMLAQWA  357



>gb|ACN93833.1| metal ion transporter ZIP5 [Hordeum vulgare]
Length=350

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 227/322 (70%), Gaps = 13/322 (4%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+ +++AI  ILVA AAG +IP L RK+  L PEKD+FF IKAFAAGVIL+T FVHILP
Sbjct  42    ALRLKIIAIFCILVASAAGCAIPTLGRKFPALSPEKDLFFAIKAFAAGVILATAFVHILP  101

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQV  1245
             +AF+ L SP L D  PW KFPF+GL+ +  +IATL+VDT+A  +F+++        +  +
Sbjct  102   EAFERLGSPCLVD-GPWQKFPFAGLVTMLGAIATLVVDTIATGYFQREHAKNSSAAIGNL  160

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
                + E      +  +    A++         S ++   L   IR RV+SQVLELGI+VH
Sbjct  161   DPADSEQAHGGHSHGVSAIIASS---------SCDDGAKL---IRHRVISQVLELGIIVH  208

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SVIIG+ LG S+   TIRPL+VAL+FHQFFEG+GLGGCI QA+F+  S  +M  FFSLT 
Sbjct  209   SVIIGMSLGASENAGTIRPLVVALTFHQFFEGIGLGGCIVQARFRHKSFLMMTFFFSLTL  268

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             P+G+  GIGI+S Y+ +S  ALI +G+L++A+AGILIYMALVDLLA DFM P++QNN RL
Sbjct  269   PIGVVIGIGIASTYDENSPRALIAEGLLSAAAAGILIYMALVDLLAEDFMNPRVQNNGRL  328

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             Q+  ++SL++G   MS+LA+WA
Sbjct  329   QVIINISLLVGIALMSMLAVWA  350



>ref|NP_001059239.1| Os07g0232800 [Oryza sativa Japonica Group]
 dbj|BAC21508.1| putative zinc transporter protein ZIP1 [Oryza sativa Japonica 
Group]
 dbj|BAD31696.1| putative zinc transporter protein ZIP1 [Oryza sativa Japonica 
Group]
 dbj|BAF21153.1| Os07g0232800 [Oryza sativa Japonica Group]
Length=357

 Score =   315 bits (806),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 169/318 (53%), Positives = 208/318 (65%), Gaps = 10/318 (3%)
 Frame = +1

Query  898   RLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQ  1077
             ++ A  SILV GA G  +P L R    L P+ D+FF++KAFAAGVIL+TGF+HILPDAF 
Sbjct  50    KIAAFFSILVCGALGCGLPSLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFD  109

Query  1078  TLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSade  1257
              LT   L    PW +FPF+G  A+  +I TL+VDTLA  +F + +   D           
Sbjct  110   NLTDDCLPAGGPWKEFPFAGFGAMVGAIGTLVVDTLATGYFTRALSKKDAATAAAHEGQV  169

Query  1258  eeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVII  1437
                  A            AA    D   +          +R RV+SQVLELGIVVHSVII
Sbjct  170   HVHTHATHGHAHGSSALVAAVGEDDKETT----------LRHRVISQVLELGIVVHSVII  219

Query  1438  GLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGI  1617
             G+ LG SQ  ETI+PL+VALSFHQ FEGMGLGGCI QAKFK  S   M +FF LTTPVGI
Sbjct  220   GISLGASQNPETIKPLVVALSFHQMFEGMGLGGCIVQAKFKVRSIVTMVLFFCLTTPVGI  279

Query  1618  ATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGG  1797
             A G+GISSVYN  S TAL+ +G+LNS +AGILIYMALVDLLA DFM P++Q+  +LQLG 
Sbjct  280   AVGVGISSVYNESSPTALVVEGILNSVAAGILIYMALVDLLAEDFMNPRVQSKGKLQLGI  339

Query  1798  HVSLVLGAGSMSVLAMWA  1851
             +++++ GAG MS+LA WA
Sbjct  340   NLAMLAGAGLMSMLAKWA  357



>ref|XP_010484879.1| PREDICTED: zinc transporter 5 [Camelina sativa]
Length=355

 Score =   314 bits (804),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 234/351 (67%), Gaps = 19/351 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+       H   +E     +  KY++ AI S+LVAG  GV  PLL + +  
Sbjct  24    SAGESKCECS-------HEDEEENKAGAN--KYKIAAIPSVLVAGVIGVLFPLLGKFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE  +FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  75    LRPETTLFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +  +HF  +K      ++          H+H HG     V ++  
Sbjct  133   ILTLSVDSFATSYFHR--LHFKTSKRIGDGEEQRGGGGDDLGLHVHAHGHTHGIVGVESG  190

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  +L H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ FE
Sbjct  191   DSEVQL-H-----RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFE  244

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCIAQ  F  +S  VM++FFS+TTPVGIA G+ I S YN  S TALI QGVLN+A
Sbjct  245   GLGLGGCIAQGNFNCMSITVMSIFFSVTTPVGIAVGMAILSSYNESSPTALIVQGVLNAA  304

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVD LAADFM PK+Q+N RLQ+  H+SL++GAG MS+LA WA
Sbjct  305   SAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGIMSLLAKWA  355



>emb|CDY42175.1| BnaC05g40440D [Brassica napus]
Length=353

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/382 (47%), Positives = 253/382 (66%), Gaps = 33/382 (9%)
 Frame = +1

Query  712   QFPFRYSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSL  891
             ++ F +S  N++  + I++I           A S+CT +   +      S+E      +L
Sbjct  3     EYSFCFST-NMLRVYVILVICMH-----VCCASSDCTSHDEHD----VVSQEEAERATTL  52

Query  892   KYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDA  1071
             K  L +IA +LVAG  GVS+PL+ +K   L PE DIFFM+KAFAAGVIL TGFVHILPDA
Sbjct  53    K--LGSIALLLVAGGVGVSLPLIGKKIPALQPENDIFFMVKAFAAGVILCTGFVHILPDA  110

Query  1072  FQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSa  1251
             F+ L+SP L +T    KFPF+G +A+ +++ TLM+DT A ++++++    +K    QVS 
Sbjct  111   FERLSSPCL-ETTAAGKFPFAGFVAMLSAMGTLMIDTFATAYYKRQHSMGNK----QVSV  165

Query  1252  deeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSV  1431
              E+E                   V++    S+      ++ IR+R+VSQVLE+GIVVHSV
Sbjct  166   VEDEEHAGH--------------VHVHTHASHGHSHGSTELIRRRIVSQVLEIGIVVHSV  211

Query  1432  IIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPV  1611
             IIG+ LG SQ+ +TI+PL+ ALSFHQFFEG+GLGGCI+ A+ +S ST +MA FFS+T PV
Sbjct  212   IIGISLGASQSVDTIKPLMAALSFHQFFEGLGLGGCISLAELQSKSTVIMATFFSVTAPV  271

Query  1612  GIATGIGISS--VYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             GI  G+G+SS   Y   S  A++ +G+LN+ASAGILIYM+LVDLLA DF+ P++Q+N+ L
Sbjct  272   GIGIGMGMSSGLGYGRESKEAIMVEGMLNAASAGILIYMSLVDLLAPDFVNPRLQSNLWL  331

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
              L   +SL+LGA SMS+LA+WA
Sbjct  332   HLAAFLSLLLGAASMSLLAIWA  353



>ref|XP_007212363.1| hypothetical protein PRUPE_ppa014732mg [Prunus persica]
 gb|EMJ13562.1| hypothetical protein PRUPE_ppa014732mg [Prunus persica]
Length=353

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 233/350 (67%), Gaps = 27/350 (8%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYE-FL  981
             A S CTC    + Q    SKE L      +Y+LVAI S+LV+GA GV +P L +     L
Sbjct  26    ASSACTCEKQPKDQ--NKSKEVL------RYKLVAIVSVLVSGAIGVCLPFLLKNISSIL  77

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
              P+KD + +IKAFAAGVIL+TGFVH+LPDA ++LTSP L   NPW +FPF+G +A+ ++I
Sbjct  78    HPDKDFYLLIKAFAAGVILATGFVHVLPDAHESLTSPCLSK-NPWGRFPFTGFVAMVSAI  136

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
              TLM++ +A  + ++  +   K   P       +  + +     H      +A+ L+   
Sbjct  137   GTLMMEAIATGYHKRSEL---KKSQP------VDGDEESDHGAHHAGHVHGSALVLE---  184

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
             S+N     S+ IR R++SQVLELGIVVHSVIIG+ LG  Q+  TI+PL+ ALSFHQFFEG
Sbjct  185   SSNS----SELIRHRIISQVLELGIVVHSVIIGISLGACQSPHTIKPLVAALSFHQFFEG  240

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI QAKFK  + A M +FFSLTTP GIA GI IS+ Y   S TALI QG+L SAS
Sbjct  241   MGLGGCIYQAKFKHKTMATMVLFFSLTTPAGIAVGIAISNTYTKSSPTALIVQGLLLSAS  300

Query  1702  AGILIYMALVDLLAADFM-KPKIQNNVRLQLGGHVSLVLGAGSMSVLAMW  1848
             AGILIYMALVDLLAADF+   K+  N +LQLG + +L+LGA  MS++A W
Sbjct  301   AGILIYMALVDLLAADFINNAKMLGNPKLQLGANFTLLLGACFMSLMAKW  350



>ref|XP_008799796.1| PREDICTED: LOW QUALITY PROTEIN: zinc transporter 5-like [Phoenix 
dactylifera]
Length=354

 Score =   313 bits (801),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 227/346 (66%), Gaps = 18/346 (5%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C+         S  E      +   ++ AI +ILV+  AGV IP+  +    L PEK
Sbjct  27    DCECSA--------SEDENRDKAAARPLKIGAIFAILVSSTAGVLIPISGKWVPSLSPEK  78

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D+FF+IKAFAAGVIL+T F+HILP++F+ LTSP L + +PW +FPF+G IA+ ++I TLM
Sbjct  79    DVFFVIKAFAAGVILATAFIHILPESFERLTSPCLNE-HPWQEFPFAGFIAMVSAIGTLM  137

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VD +A  +F +  +    + +      + E   A            AA V  D P     
Sbjct  138   VDAVATGYFSRSSIWKPDSGVSDEGIGDAEQGAARVHAMHGHXHGPAALVVDDGP-----  192

Query  1354  LVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                  + +R R++SQVLELGIVVHSVIIG+ LGTS++  +IRPLL AL FHQFFEG+GLG
Sbjct  193   ----DEALRHRIISQVLELGIVVHSVIIGITLGTSESPSSIRPLLAALCFHQFFEGIGLG  248

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI QA F+  S   M +FF+LTTPVGIA GIGISS Y+ +S TAL  +GVL+SA+AGIL
Sbjct  249   GCIVQANFRVRSMVTMMLFFALTTPVGIAVGIGISSTYDENSPTALTVEGVLDSAAAGIL  308

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYM+LVDLLA DF  P++Q+N RLQL  +VSL++GAG MS+L  WA
Sbjct  309   IYMSLVDLLAEDFRNPRVQSNWRLQLVINVSLLVGAGLMSLLGKWA  354



>ref|XP_006305175.1| hypothetical protein CARUB_v10009542mg [Capsella rubella]
 gb|EOA38073.1| hypothetical protein CARUB_v10009542mg [Capsella rubella]
Length=359

 Score =   313 bits (801),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 234/355 (66%), Gaps = 23/355 (6%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +AAES+C C+   +G+             + KY++ AI S+LVAG  GV  PLL + +  
Sbjct  24    SAAESKCECSHEEDGE---------NKAGATKYKIAAIPSVLVAGVIGVLFPLLGKFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE   FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  75    LRPETTFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTK----LPQVSadeeeakdaaaadhmhrhgaaaaaVY  1326
             I TL VD+ A S+F +  +HF  +K      +   +           H+H HG     V 
Sbjct  133   ILTLSVDSFATSYFHR--LHFKTSKKIGDGEEQGVNGGGGGGDELGLHVHAHGHTHGIVG  190

Query  1327  LDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFH  1506
             ++   S+ +L       R RVV+QVLE+GI+VHSV+IG+ LG SQ  +T + L  AL FH
Sbjct  191   VESGESDVQLH------RTRVVAQVLEVGIIVHSVVIGISLGASQNPDTAKALFAALMFH  244

Query  1507  QFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGV  1686
             Q FEG+GLGGCIAQ KF  +S  +MA+FFS+TTPVGIA G+ IS+ YN  S TALI QGV
Sbjct  245   QCFEGLGLGGCIAQGKFNCMSITIMALFFSVTTPVGIAVGMAISNSYNESSQTALIVQGV  304

Query  1687  LNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LN+ASAGILIYM+LVD LAADFM PK+Q+N  LQ+  H+SL++GAG MS+LA WA
Sbjct  305   LNAASAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  359



>gb|EPS66222.1| zinc transporter protein, partial [Genlisea aurea]
Length=336

 Score =   311 bits (798),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/347 (48%), Positives = 223/347 (64%), Gaps = 28/347 (8%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             ++CTC  +  G ++  S        +LKY++ AI SILVA   GV +P L  +   L P+
Sbjct  18    ADCTCEDSDAGAIYDRSL-------ALKYKIAAIVSILVASLIGVCLPTLGTRVPALSPD  70

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             K+ FF++K+FAAGVIL+TGF+H+LPDAF  LTSP L D NPW  FPF+GLIA+TA+I +L
Sbjct  71    KNFFFVVKSFAAGVILATGFIHVLPDAFSDLTSPCL-DQNPWG-FPFAGLIAMTAAILSL  128

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             M+D+ A ++++++        +   +           A            V+ +P     
Sbjct  129   MIDSYATAYYKRRNSDVKNNDVEAAAEVAVSGLLHGHAHGGA--------VFSEP-----  175

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                   + +R RV+SQVLELGI+VHSVIIG+ LG SQ   TI+PL+ AL+FHQ FEGMGL
Sbjct  176   ------ELLRHRVISQVLELGIIVHSVIIGIALGASQDPLTIKPLIAALTFHQLFEGMGL  229

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             GGCI+Q KFK+ + A MA FF+ TTP GIA GI I+  Y   S TALI QG LNSASAGI
Sbjct  230   GGCISQGKFKARTVATMAAFFATTTPGGIAIGIAITKAYRETSPTALIVQGTLNSASAGI  289

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLL  DFM  ++Q N +L    +++L+ GAG M++LA WA
Sbjct  290   LIYMALVDLLGVDFMSDRLQGNGKLMFVANLALLFGAGCMALLAKWA  336



>ref|XP_010557016.1| PREDICTED: zinc transporter 3-like [Tarenaya hassleriana]
Length=359

 Score =   312 bits (799),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 230/356 (65%), Gaps = 15/356 (4%)
 Frame = +1

Query  784   AISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLA  963
             A++G    E  C C+ + +G+    ++         KY++ AI S+LVAG  GV  PLL 
Sbjct  19    AVAGHGGGEDRCECSHDRDGENKSGAR---------KYKIAAIPSVLVAGIIGVLFPLLG  69

Query  964   RKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLI  1143
               +  L PE   FF+ +AFAAGVILSTGF+H+LP+AF+ LTSP L + +PW +FPF+G I
Sbjct  70    NVFPSLRPETPFFFVTRAFAAGVILSTGFLHVLPEAFEMLTSPCLSE-HPW-EFPFTGFI  127

Query  1144  ALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaV  1323
             A+ A+I TL VD  A S+ +K   HF   ++      +E   +     H   H       
Sbjct  128   AMMAAIFTLSVDAFATSYIQKS--HFKNQRISSEGEGKEGGGELGLHVHARAHSQDGHTA  185

Query  1324  YLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSF  1503
                   S  E    +  +R RV++QVLELGI+VHSV+IG+ LG SQ  +T + L  AL F
Sbjct  186   AESGVGSAVE--SKTQLLRSRVIAQVLELGIIVHSVVIGISLGASQDPDTAKTLFAALMF  243

Query  1504  HQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQG  1683
             HQ FEG+GLGGCI Q KFK ++   MA+ FS+TTP+GIA G+GISS Y+  S TALI QG
Sbjct  244   HQCFEGLGLGGCITQGKFKWMAAMTMAMIFSVTTPIGIAVGMGISSSYDESSPTALIVQG  303

Query  1684  VLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             VLN+AS+GILIYM+LVDLLAADFM PK+Q+N  LQ+  H+SL+LGAG MS+LA WA
Sbjct  304   VLNAASSGILIYMSLVDLLAADFMHPKVQSNSGLQIMAHISLLLGAGIMSLLAKWA  359



>gb|EMS45894.1| Zinc transporter 5 [Triticum urartu]
Length=312

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 166/318 (52%), Positives = 204/318 (64%), Gaps = 49/318 (15%)
 Frame = +1

Query  898   RLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQ  1077
             ++ A  SIL+ GA G S+P+L R    L P+ D+FF++KAFAAGVIL+TGF+HILPDAF+
Sbjct  44    KIAAFFSILICGAMGCSLPVLGRHVPALRPDGDVFFLVKAFAAGVILATGFIHILPDAFE  103

Query  1078  TLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSade  1257
              LTS  L    PW  FPF+GL A+  +I TL+VDTLA  +F +   H +K          
Sbjct  104   NLTSDCLPAAGPWKDFPFAGLGAMVGAIGTLVVDTLATGYFTRA--HLNK----------  151

Query  1258  eeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVII  1437
                                                  DR      + VLELGIVVHSVII
Sbjct  152   -------------------------------------DRAHGSSAAVVLELGIVVHSVII  174

Query  1438  GLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGI  1617
             G+ LG SQ  ETI+PL+VALSFHQ FEGMGLGGCI QAKFK+ S   M +FF LTTPVGI
Sbjct  175   GISLGASQDPETIKPLVVALSFHQMFEGMGLGGCIVQAKFKARSIVTMILFFCLTTPVGI  234

Query  1618  ATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGG  1797
             A G GIS VYN +S TAL+ +G LNS +AGIL+YMALVDLLA DFM PK+Q+  +LQLG 
Sbjct  235   AVGFGISRVYNENSPTALVVEGSLNSVAAGILVYMALVDLLAEDFMNPKVQSRGKLQLGI  294

Query  1798  HVSLVLGAGSMSVLAMWA  1851
             +VS+++GAG MS+LA WA
Sbjct  295   NVSMLVGAGLMSMLAKWA  312



>ref|XP_003566152.1| PREDICTED: zinc transporter 5-like [Brachypodium distachyon]
Length=360

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 169/353 (48%), Positives = 224/353 (63%), Gaps = 15/353 (4%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             A A ++C C  +        ++       +L+ +++AI  IL   A G  IP L R++  
Sbjct  21    ALAVADCDCESDAAATGRDKAR-------ALRLKVIAIVCILAGSAIGAGIPSLGRRFPA  73

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE D+F  +KAFA GVIL+TG VHILP AF+ L SP L    PW +FPF+G++A+ A+
Sbjct  74    LRPETDLFLAVKAFAGGVILATGLVHILPTAFEALGSPCLVGHGPWRRFPFAGMVAMLAA  133

Query  1159  IATLMVDTLAMSFFRKKMMHFDK--TKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLD  1332
             I TL+VDT+A  +FR+         T  P +        +A ++   H   A   +V   
Sbjct  134   IGTLIVDTVATGYFRRTNAKRAAAVTDEPALGGGRAGDLEATSSSDGHHAHAHGMSVLAA  193

Query  1333  PPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQF  1512
             PP   +ELV      R RV+SQVLELG+VVHS+IIG+ LG S    T+RPL+ AL+FHQ 
Sbjct  194   PPDGEDELV------RHRVISQVLELGVVVHSLIIGMSLGASDFPSTVRPLVPALTFHQL  247

Query  1513  FEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLN  1692
             FEG+GLGGCI QAKF+  S   M + FSLTTPVGI  GI ISSVY+  S  AL+ QG+L 
Sbjct  248   FEGIGLGGCIVQAKFRLKSVLAMGLLFSLTTPVGIGVGIAISSVYDETSPKALVVQGLLE  307

Query  1693  SASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             +A+AGIL+YMALVD+LA DF K  +Q+  RLQL  +VSL+LGAG MS+LA+WA
Sbjct  308   AAAAGILVYMALVDILAEDFTKASVQSRARLQLALNVSLLLGAGLMSLLAVWA  360



>emb|CDY66215.1| BnaC05g49110D [Brassica napus]
Length=357

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 228/351 (65%), Gaps = 17/351 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C       LH   +       + KY++ AI S+LVAG  GV  PLL   +  
Sbjct  24    SAGESKCEC-------LHEEDEGN--KAGARKYKIAAIPSVLVAGVIGVLFPLLGNFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W KFPF+G IA+ A+
Sbjct  75    LRPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-KFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +      K                    H+H HG A   V +D  
Sbjct  133   ILTLSVDSFATSYFHRLHNKTSKKIGEGEEQIGGGGGGDELGLHVHAHGHAHGIVSVDSG  192

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  +L H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+  T + L  AL FHQ FE
Sbjct  193   ESEVQL-H-----RTRVVAQVLEVGIIVHSVVIGISLGASQSPHTAKALFAALMFHQCFE  246

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCIAQ KF  +S  +M++FFS+TTP+GIA G+GI+S YN  S TALI QGVLN+A
Sbjct  247   GLGLGGCIAQGKFNCMSITIMSIFFSVTTPIGIAVGMGIASSYNESSQTALIVQGVLNAA  306

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVD LAADFM PK+Q+N  L++  H+SL++GAG MS+LA WA
Sbjct  307   SAGILIYMSLVDFLAADFMHPKMQSNTGLRIMAHISLLIGAGIMSLLAKWA  357



>ref|XP_010922621.1| PREDICTED: zinc transporter 8-like [Elaeis guineensis]
Length=350

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 231/332 (70%), Gaps = 11/332 (3%)
 Frame = +1

Query  856   SSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVI  1035
             +S+E      +   ++ AI +ILV+ A GV IP+L +    L  EKD FF+IKAFAAGVI
Sbjct  30    ASEEDRDKAAARPLKIGAIFAILVSSATGVIIPILGKWVPSLSAEKDTFFVIKAFAAGVI  89

Query  1036  LSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMM  1215
             L+T F+HILP++F+ LTSP L D +PW +FPF+G IA+ ++IATLMVDT+A S+F +  +
Sbjct  90    LATAFIHILPESFERLTSPCL-DEHPWQEFPFAGFIAMVSAIATLMVDTVATSYFGRSSI  148

Query  1216  HFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVS  1395
                K + P +   E+          MH HG    A+ +D     +E+       R RV+S
Sbjct  149   R--KAERPGMGDAEQGGAPHVHVHAMHGHGHGPVALVVDG--GRDEIS------RHRVIS  198

Query  1396  QVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTA  1575
             QVLELGIVVHSVIIG+ LGTS++  +IR LLVAL FHQFFEG+GLGGC+ QA F+  S  
Sbjct  199   QVLELGIVVHSVIIGVTLGTSESPSSIRSLLVALCFHQFFEGIGLGGCVVQANFRVRSMV  258

Query  1576  VMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFM  1755
              M +FF+LTTP+GIA GIGISS YN +S TAL  +GVL+SA+AGIL+YM+LVDLLA DF 
Sbjct  259   TMMLFFALTTPLGIAVGIGISSTYNENSPTALTVEGVLDSAAAGILVYMSLVDLLAEDFK  318

Query  1756  KPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              P++Q+N RLQL    SL++GAG MS+LA WA
Sbjct  319   NPRVQSNWRLQLVLSASLLVGAGLMSLLAKWA  350



>gb|KFK42876.1| hypothetical protein AALP_AA1G050300 [Arabis alpina]
Length=355

 Score =   310 bits (793),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 173/371 (47%), Positives = 233/371 (63%), Gaps = 17/371 (5%)
 Frame = +1

Query  739   NIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIAS  918
              I  +  +++ FF  ++   A A  EC C  + E       ++      + KY++ AI S
Sbjct  2     KITQNVKLLLFFFSISLLLIAVA-GECKCECSHE-------EDEGNKAGARKYKIAAIPS  53

Query  919   ILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL  1098
             +L AG  GV  PLL + +  L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP L
Sbjct  54    VLAAGVIGVLFPLLGKFFPSLRPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCL  113

Query  1099  KDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaa  1278
             K    W +FPF+G IA+ A+I TL VD+ A S+F K  +HF  +K      + +      
Sbjct  114   KGA-AW-EFPFTGFIAMVAAILTLSVDSFATSYFHK--LHFKTSKKIGDGEERDGGGGGE  169

Query  1279  aadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTS  1458
                           +           VH     R RVV+QVLE+GI+VHSV+IG+ LG S
Sbjct  170   ELGLHVHAHGHTHGIVGVESDEAEVQVH-----RTRVVAQVLEVGIIVHSVVIGISLGAS  224

Query  1459  QTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGIS  1638
             Q+ +T + L  AL FHQ FEG+GLGGCIAQ  F  +S  +M++FFS+TTP+GIA G+GI+
Sbjct  225   QSPDTAKALFAALMFHQCFEGLGLGGCIAQGDFNCMSITIMSLFFSVTTPIGIAVGMGIA  284

Query  1639  SVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLG  1818
             S YN  S TALI QGVLN+ASAGILIYM+LVD LAADFM PK+Q+N RLQ+  H+SL++G
Sbjct  285   SSYNESSQTALIVQGVLNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVG  344

Query  1819  AGSMSVLAMWA  1851
             AG MS+LA WA
Sbjct  345   AGIMSLLAKWA  355



>ref|XP_009146590.1| PREDICTED: zinc transporter 1 [Brassica rapa]
 emb|CDY08406.1| BnaA05g26420D [Brassica napus]
Length=353

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 240/351 (68%), Gaps = 27/351 (8%)
 Frame = +1

Query  805   AESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLG  984
             A S+CT +   +      S+E      +LK  L +IA +LVAG  GVS+PL+ +K   L 
Sbjct  28    ASSDCTSHDEHD----VVSQEEAERATTLK--LGSIALLLVAGGVGVSLPLIGKKIPALQ  81

Query  985   PEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
             PE DIFF++KAFAAGVIL TGFVHILPDAF+ L+SP L +T    KFPF+G +A+ +++ 
Sbjct  82    PENDIFFLVKAFAAGVILCTGFVHILPDAFERLSSPCL-ETTAAGKFPFAGFVAMLSAMG  140

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLM+DT A ++++++    +K    QVS  E+E                   V++    S
Sbjct  141   TLMIDTFATAYYKRQHSMGNK----QVSVVEDEEHAGH--------------VHVHTHAS  182

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             +      ++ IR+R+VSQVLE+GIVVHSVIIG+ LG SQ+ +TI+PL+ ALSFHQFFEG+
Sbjct  183   HGHSHGSTELIRRRIVSQVLEIGIVVHSVIIGISLGASQSIDTIKPLMAALSFHQFFEGL  242

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISS--VYNPHSSTALITQGVLNSA  1698
             GLGGCI+ A+ +S ST +MA FFS+T P+GI  G+G+SS   Y   S  A++ +G+LN+A
Sbjct  243   GLGGCISLAELQSKSTVIMAAFFSVTAPLGIGIGMGMSSGLGYGRESKEAIMVEGMLNAA  302

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVDLLA DF+ P++Q+N+ L L   +SL+LGA SMS+LA+WA
Sbjct  303   SAGILIYMSLVDLLAPDFVNPRLQSNLWLHLAAFLSLLLGAASMSLLAIWA  353



>ref|XP_009119168.1| PREDICTED: zinc transporter 5 [Brassica rapa]
Length=356

 Score =   308 bits (790),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 229/351 (65%), Gaps = 17/351 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+           ++      + KY++ AI S+LVAG  GV  PLL   +  
Sbjct  23    SAGESKCECS---------HEEDEGNKAGARKYKIAAIPSVLVAGVIGVLFPLLGNFFPS  73

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  74    LRPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFIAMVAA  131

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +      K                    H+H HG A   V +D  
Sbjct  132   ILTLSVDSFATSYFHRLHNKTSKKIGDGEEQIGGGGGGDVLGLHVHAHGHAHGIVGVDSG  191

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  +L H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ FE
Sbjct  192   ESEVQL-H-----RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFE  245

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCIAQ KF  +S  +M++FFS+TTP+GIA G+GI+S YN  S TALI QGVLN+A
Sbjct  246   GLGLGGCIAQGKFNCMSITIMSIFFSVTTPIGIAVGMGIASSYNESSQTALIVQGVLNAA  305

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVD LAADFM PK+Q+N  L++  H+SL++GAG MS+LA WA
Sbjct  306   SAGILIYMSLVDFLAADFMHPKMQSNTGLRIMAHISLLIGAGIMSLLAKWA  356



>emb|CDY46862.1| BnaA10g03460D [Brassica napus]
Length=357

 Score =   308 bits (790),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 229/351 (65%), Gaps = 17/351 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+           ++      + KY++ AI S+LVAG  GV  PLL   +  
Sbjct  24    SAGESKCECS---------HEEDEGNKAGARKYKIAAIPSVLVAGVIGVLFPLLGNFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  75    LRPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +      K                    H+H HG A   V +D  
Sbjct  133   ILTLSVDSFATSYFHRLHNKTSKKIGDGEEQIGGGGGGDVLGLHVHAHGHAHGIVGVDSG  192

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  +L H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ FE
Sbjct  193   ESEVQL-H-----RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFE  246

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCIAQ KF  +S  +M++FFS+TTP+GIA G+GI+S YN  S TALI QGVLN+A
Sbjct  247   GLGLGGCIAQGKFNCMSITIMSIFFSVTTPIGIAVGMGIASSYNESSQTALIVQGVLNAA  306

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVD LAADFM PK+Q+N  L++  H+SL++GAG MS+LA WA
Sbjct  307   SAGILIYMSLVDFLAADFMHPKMQSNTGLRIMAHISLLIGAGIMSLLAKWA  357



>ref|XP_010457615.1| PREDICTED: zinc transporter 5-like [Camelina sativa]
Length=357

 Score =   308 bits (789),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 232/352 (66%), Gaps = 19/352 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+       H   +E     +  KY++ AI S+LVAG  GV  PLL + +  
Sbjct  24    SAGESKCECS-------HEDEEENKAGAN--KYKIAAIPSVLVAGVIGVLFPLLGKFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE   FF+ KAFAAGVIL+TGF+H+LP+ ++ L SP LK    W +FPF+G IA+ A+
Sbjct  75    LRPETTFFFVTKAFAAGVILATGFMHVLPEGYEKLMSPCLKG-EAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F++  +HF  +K      ++           +H H        +   
Sbjct  133   ILTLSVDSFATSYFQR--LHFKTSKRIGDGEEQRVDGGGGDDLGLHVHAHGHTHGIVGVE  190

Query  1339  PSNNEL-VHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
               ++E+ +H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ F
Sbjct  191   SGDSEVQLH-----RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCF  245

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EG+GLGGCIAQ  F  +S  +M++FFS+TTPVGIA G+ IS+ YN +S TALI QGVLN+
Sbjct  246   EGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISTSYNEYSPTALIVQGVLNA  305

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYM+LVD LAADFM PK+Q+N  LQ+  H+SL++GAG MS+LA WA
Sbjct  306   ASAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  357



>ref|NP_001055818.1| Os05g0472700 [Oryza sativa Japonica Group]
 sp|Q6L8G0.1|ZIP5_ORYSJ RecName: Full=Zinc transporter 5; AltName: Full=ZRT/IRT-like 
protein 5; Short=OsZIP5; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAP33800.1| putative zinc transporter OsZIP2 [Oryza sativa Japonica Group]
 dbj|BAD18965.1| zinc transporter [Oryza sativa Japonica Group]
 gb|AAT94022.1| putative zinc transporter OsZIP2 [Oryza sativa Japonica Group]
 gb|AAU44233.1| putative zinc transporter [Oryza sativa Japonica Group]
 dbj|BAF17732.1| Os05g0472700 [Oryza sativa Japonica Group]
 gb|EAY98395.1| hypothetical protein OsI_20308 [Oryza sativa Indica Group]
 dbj|BAG92180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 173/366 (47%), Positives = 238/366 (65%), Gaps = 22/366 (6%)
 Frame = +1

Query  754   FYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             F ++ +   C +   AAA +EC C  +  G+             +L+ +++AI  IL   
Sbjct  10    FVLLFLVAACYLPAHAAA-AECDCATDTAGR---------DKAQALRLKVIAIFCILAGS  59

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
               G ++P L  ++  + PE D+F  +KAFA GVIL+TG VHILP AF+ L+SP L    P
Sbjct  60    TVGAALPSLGGRFPAIQPETDVFLSVKAFAGGVILATGLVHILPAAFEALSSPCLVG-GP  118

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W +FPF+G++A+ ++I TL+VDT+A  +F +     D  +  + +A  +E  D   A   
Sbjct  119   WKRFPFAGMVAMVSAIGTLIVDTVATGYFHRT----DAKR--KAAAVADEPADDLEASDE  172

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
             H HG A     +   P+  E     D +R RV+SQVLELG+VVHS+IIG+ LG S    T
Sbjct  173   HSHGHAHGMSVMSVAPAGEE-----DLVRHRVISQVLELGVVVHSLIIGMSLGASDFPST  227

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             +RPL+ AL+FHQFFEG+GLGGCI QAKF+  S   MA+FFSLTTP GI  GIGISSVY+ 
Sbjct  228   VRPLVPALTFHQFFEGIGLGGCIVQAKFRVRSVVTMALFFSLTTPAGIVVGIGISSVYDA  287

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             +S TAL+ QG+L +A+AGIL+YMALVD+LA DFMK K+Q   RLQL  +V+L+LGAG MS
Sbjct  288   NSPTALVVQGLLEAAAAGILVYMALVDILAEDFMKTKVQRRGRLQLAMNVALLLGAGLMS  347

Query  1834  VLAMWA  1851
             ++A+WA
Sbjct  348   MIAIWA  353



>ref|XP_011087053.1| PREDICTED: zinc transporter 1-like, partial [Sesamum indicum]
Length=296

 Score =   305 bits (782),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 215/307 (70%), Gaps = 22/307 (7%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             +I++F P      A   ++CTCNG  E Q + S        ++LK++LVAIA+IL AG  
Sbjct  12    LIVVFVP------APVLADCTCNGETE-QRNKS--------EALKFKLVAIAAILGAGGI  56

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GVS+PLL RK++ L PE D+FFMIKAFAAGVIL+TGFVHILPDAF+TLTSP L   NPW 
Sbjct  57    GVSLPLLGRKFKPLRPENDVFFMIKAFAAGVILATGFVHILPDAFETLTSPCLAG-NPWG  115

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+G I++ ASI TL+VDT+A SF+     H +K K  QVS DEE   D  A      
Sbjct  116   KFPFTGFISMMASIGTLVVDTVATSFYESS--HLNKAK--QVSVDEEAGDDERAGQVHMH  171

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
               AA +  +     +      L D +RQR++SQVLELGIVVHSVIIG+ LG S++ ETI+
Sbjct  172   SHAAHSHAHGADVSAQE--TSLPDLVRQRIISQVLELGIVVHSVIIGISLGASKSPETIK  229

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHS  1659
             PLL ALSFHQFFEGMGLGGC++QAKFKS++T +M VFFSLTTP GI  GIGISSVY   S
Sbjct  230   PLLAALSFHQFFEGMGLGGCLSQAKFKSLTTTIMTVFFSLTTPFGIGVGIGISSVYKDSS  289

Query  1660  STALITQ  1680
              TALI +
Sbjct  290   PTALIVE  296



>ref|NP_172022.1| zinc transporter 5 [Arabidopsis thaliana]
 sp|O23039.1|ZIP5_ARATH RecName: Full=Zinc transporter 5; AltName: Full=ZRT/IRT-like 
protein 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL38432.1|AF369909_1 putative metal transporter ZIP5 [Arabidopsis thaliana]
 gb|AAB71447.1| Similar to Arabidopsis Fe(II) transport protein (gb|U27590) [Arabidopsis 
thaliana]
 gb|AAT46031.1| At1g05300 [Arabidopsis thaliana]
 dbj|BAD44388.1| putative zinc transporter [Arabidopsis thaliana]
 gb|AEE27820.1| Fe(II) transporter isolog family protein ZIP5 [Arabidopsis thaliana]
Length=360

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 176/355 (50%), Positives = 230/355 (65%), Gaps = 23/355 (6%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+   +      +K         KY++ AI S+L AG  GV  PLL + +  
Sbjct  25    SAGESKCECSHEDDEANKAGAK---------KYKIAAIPSVLAAGVIGVMFPLLGKFFPS  75

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE   FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  76    LKPETTFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFIAMVAA  133

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKL----PQVSadeeeakdaaaadhmhrhgaaaaaVY  1326
             I TL VD+ A S+F K   HF  +K      +  A            H+H HG     V 
Sbjct  134   ILTLSVDSFATSYFHKA--HFKTSKRIGDGEEQDAGGGGGGGDELGLHVHAHGHTHGIVG  191

Query  1327  LDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFH  1506
             ++   S  +L       R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FH
Sbjct  192   VESGESQVQLH------RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFH  245

Query  1507  QFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGV  1686
             Q FEG+GLGGCIAQ  F  +S  +M++FFS+TTPVGIA G+ ISS Y+  S TALI QGV
Sbjct  246   QCFEGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISSSYDDSSPTALIVQGV  305

Query  1687  LNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LN+ASAGILIYM+LVD LAADFM PK+Q+N RLQ+  H+SL++GAG MS+LA WA
Sbjct  306   LNAASAGILIYMSLVDFLAADFMHPKMQSNTRLQIMAHISLLVGAGVMSLLAKWA  360



>ref|XP_002892281.1| hypothetical protein ARALYDRAFT_470527 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68540.1| hypothetical protein ARALYDRAFT_470527 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   307 bits (787),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 228/352 (65%), Gaps = 19/352 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+       H   +      +  KY++ AI S+L AG  GV  PLL + +  
Sbjct  24    SAGESKCECS-------HEDDEANKAGAN--KYKIAAIPSVLTAGVIGVLFPLLGKFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE   FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G +A+ A+
Sbjct  75    LKPETTFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFVAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +  +HF  +K      ++           +H H        +   
Sbjct  133   ILTLSVDSFATSYFHR--LHFKTSKRIGDGEEQGGGGGGGDELGLHVHAHGHTHGIVGVE  190

Query  1339  PSNNEL-VHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
                +E+ +H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ F
Sbjct  191   SGESEVQLH-----RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCF  245

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EG+GLGGCIAQ  F  +S  +M++FFS+TTPVGIA G+ ISS YN  S TALI QGVLN+
Sbjct  246   EGLGLGGCIAQGNFNFMSITIMSIFFSVTTPVGIAVGMAISSSYNESSPTALIVQGVLNA  305

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYM+LVD LAADFM PK+Q N RLQ+  H+SL++GAG MS+LA WA
Sbjct  306   ASAGILIYMSLVDFLAADFMHPKMQKNTRLQIMAHISLLVGAGIMSLLAKWA  357



>ref|NP_001148241.1| ZIP zinc/iron transport family protein precursor [Zea mays]
 gb|ACG30271.1| ZIP zinc/iron transport family protein [Zea mays]
 tpg|DAA60089.1| TPA: ZIP zinc/iron transport family protein [Zea mays]
Length=397

 Score =   308 bits (789),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 178/350 (51%), Positives = 227/350 (65%), Gaps = 30/350 (9%)
 Frame = +1

Query  883   DSLKYRLVAIA---SILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFV  1053
             D  + R + IA   SILV GA G  +P+L R+   L P++D+FF+IKAFAAGVIL+TGF+
Sbjct  51    DRARARALKIAAFFSILVCGALGCCLPVLGRRVPALRPDRDVFFLIKAFAAGVILATGFI  110

Query  1054  HILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHF----  1221
             HILPDAF+ LTS  L    PW  FPF+GL A+  +I TL+VDT+A  +F +  +HF    
Sbjct  111   HILPDAFEKLTSDCLSG-GPWQDFPFAGLGAMVGAIGTLVVDTVATGYFTR--VHFKDSA  167

Query  1222  ----------DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLS-  1368
                       D+ K  Q +A      D A  D     G      +     S+     ++ 
Sbjct  168   AAAVGAAAVGDEEKQQQQAASAPHVDDGADGDGHGHGGHVHMHTHATHGHSHGASALVAA  227

Query  1369  ------DR---IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
                   D+   +R RV++QVLELGIVVHSVIIG+ LG SQ   TI+PL+VALSFHQ FEG
Sbjct  228   VGGAEGDKEHALRHRVIAQVLELGIVVHSVIIGISLGASQDPSTIKPLVVALSFHQMFEG  287

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             MGLGGCI QAKFK  S   M +FF LTTPVGI  G+GISSVY+  S TAL+ +GVLNS +
Sbjct  288   MGLGGCIVQAKFKLRSIVTMVLFFCLTTPVGIVVGVGISSVYDEDSPTALVVEGVLNSVA  347

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGIL+YMALVDLLA DFM P++Q+  +LQLG + S+++GAG MS+LA WA
Sbjct  348   AGILVYMALVDLLAEDFMNPRVQSRGKLQLGINASMLVGAGLMSMLAKWA  397



>dbj|BAJ85179.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   306 bits (783),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/326 (51%), Positives = 217/326 (67%), Gaps = 11/326 (3%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +L+ +++AI  IL   A G  +P L R++  L PE D+F  +KAFA GVIL+T  VHILP
Sbjct  47    ALRLKIIAIFCILAGSAVGAGLPSLGRRFPALRPETDLFLAVKAFAGGVILATALVHILP  106

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFR----KKMMHFDKTK  1233
              AF+ L SP L    PW +FPF+GL+A+ A+IATL+VDT+A  +F     K+        
Sbjct  107   AAFEALRSPCLVG-GPWKRFPFAGLVAMLAAIATLIVDTVATGYFHRTNAKRAAAVTDEP  165

Query  1234  LPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELG  1413
              P       + + A+   H H H  A     L  PP  +ELV      R RV+SQVLELG
Sbjct  166   APDDRPARGDLESASDGHHGHAHAHAHGISVLAGPPDGDELV------RHRVISQVLELG  219

Query  1414  IVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFF  1593
             +VVHS+IIG+ LG S    T+RPL+ AL+FHQ FEG+GLGGCI QAKF+  S   M + F
Sbjct  220   VVVHSLIIGMSLGASDFPSTVRPLVPALTFHQLFEGVGLGGCIVQAKFRLRSVVAMGLLF  279

Query  1594  SLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQN  1773
             S+TTPVGI  GI ISSVY+  S TAL+ QG+L +A+AGIL+YMALVD+LA DF KP++Q+
Sbjct  280   SMTTPVGIGVGIAISSVYDESSPTALVVQGLLEAAAAGILVYMALVDILAEDFSKPRVQS  339

Query  1774  NVRLQLGGHVSLVLGAGSMSVLAMWA  1851
               RLQL  +VSL+LGAG MS+LA+WA
Sbjct  340   RARLQLALNVSLLLGAGLMSLLAIWA  365



>ref|XP_006363198.1| PREDICTED: zinc transporter 5-like [Solanum tuberosum]
Length=354

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 169/349 (48%), Positives = 230/349 (66%), Gaps = 23/349 (7%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             + CTC        H +  +      +L Y+L+AI+SIL + A GV +P+L + ++ L   
Sbjct  25    ANCTCEPQDNKYNHQTKHKA-----ALSYKLIAISSILCSSALGVILPILLKNFKSLQKN  79

Query  991   K--DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIA  1164
                 + F+IKAFAAGVIL+TGF+HILPDAF++LTSP L + N W  FPF+G +A+ ++I 
Sbjct  80    DYSSLQFLIKAFAAGVILATGFIHILPDAFESLTSPCLSE-NLWGSFPFAGFVAMMSAIF  138

Query  1165  TLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             TLM+++ A  + R+  +        + +       D         H A    + L+   S
Sbjct  139   TLMMESFATGYHRRAEL--------RKAQPVNIGDDDEQGQGQDEHIAHGPQILLERSDS  190

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
                    S  +R R++SQVLELGI+VHSVIIG+ LGT++  +TI+PL++ALSFHQFFEGM
Sbjct  191   -------SSLMRHRLISQVLELGILVHSVIIGISLGTTENPKTIKPLIIALSFHQFFEGM  243

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI+QAK+K+ +  +M +FF++TTP GIA G+ IS  YN  SSTALI QGVLNSASA
Sbjct  244   GLGGCISQAKYKARTIIIMVLFFTVTTPSGIAIGMMISKGYNEQSSTALIVQGVLNSASA  303

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYMALVDLLA DFM PK+  + +LQ+  +VSLVLGA  MS+LA W 
Sbjct  304   GILIYMALVDLLATDFMDPKLYTSFKLQISANVSLVLGAACMSLLAKWG  352



>ref|XP_002282425.1| PREDICTED: fe(2+) transport protein 1 [Vitis vinifera]
 emb|CBI20301.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   305 bits (781),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 221/328 (67%), Gaps = 29/328 (9%)
 Frame = +1

Query  886   SLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILP  1065
             +LK +++AI SIL+A   G+S P+L +    L P+  +F +IKAFA+GVIL+TG+VH+LP
Sbjct  50    ALKLKVIAIFSILIASILGISFPILLQGMPLLKPDGKLFVLIKAFASGVILATGYVHVLP  109

Query  1066  DAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMM------HFDK  1227
             D+ ++LTSP L    PW+KFPFS  IA+ A++ TLM+D+ AMS+++K  M      + D 
Sbjct  110   DSIESLTSPCLPQA-PWSKFPFSTFIAMVAAVLTLMMDSFAMSYYKKHGMSGAECEYGDH  168

Query  1228  TKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLE  1407
              +  Q  +                         LD   S          +R ++++QVLE
Sbjct  169   IENDQGHSHGHGHGVGVKK--------------LDDESSK--------LLRYQIIAQVLE  206

Query  1408  LGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAV  1587
             LGIVVHSV+IGL +G S+   TIRPL+ AL FHQFFEGMGLGGCI QA++K+ + A+M  
Sbjct  207   LGIVVHSVVIGLSMGASENASTIRPLIAALCFHQFFEGMGLGGCILQAEYKARTKAIMVF  266

Query  1588  FFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKI  1767
             FFS+TTP+GIA GIG+S VY+  S TALI  GVLN+ SAG+L YMALVDLL ADFM PK+
Sbjct  267   FFSVTTPLGIALGIGLSKVYSDDSPTALIVVGVLNATSAGLLNYMALVDLLGADFMGPKL  326

Query  1768  QNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             Q+N++LQ+  +V+++LG G MSV+A+WA
Sbjct  327   QSNMKLQMWAYVAVILGVGGMSVMAIWA  354



>ref|XP_002273179.1| PREDICTED: probable zinc transporter 10 [Vitis vinifera]
 emb|CAN72233.1| hypothetical protein VITISV_032803 [Vitis vinifera]
 emb|CBI29061.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 172/377 (46%), Positives = 241/377 (64%), Gaps = 35/377 (9%)
 Frame = +1

Query  730   SLFNIVASFYIIIIFF---PCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYR  900
             S   +++SF+I+I  F     A S    +ES+ +CN                   +L  +
Sbjct  4     SPLKLISSFFILISIFISQAVAQSDGCQSESQNSCNNKSA---------------ALPLK  48

Query  901   LVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQT  1080
             L+AIASILV    GV +PL +R    L P++++F ++KAFA+G+IL+TGF+H+LPD+F  
Sbjct  49    LIAIASILVTSMIGVCLPLFSRSIPALAPDRNLFIIVKAFASGIILATGFMHVLPDSFDM  108

Query  1081  LTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadee  1260
             L SP LK+ NPW KFPF+G +A+ ++I TLMVD++A S + KK    +   +P++   + 
Sbjct  109   LWSPCLKE-NPWHKFPFTGFVAMLSAIFTLMVDSIATSLYTKKN---NTGIIPEIEVADM  164

Query  1261  eakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIG  1440
              A +     H H HG                 +  S  +R RVV+ VLELGIVVHS++IG
Sbjct  165   AAGNTGGHFHGHHHGPKIG-------------IEGSQLLRYRVVAMVLELGIVVHSIVIG  211

Query  1441  LCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIA  1620
             L +G S    TI+PL+ AL FHQ FEGMGLGGCI QA++K V  A M  FFS+TTP GIA
Sbjct  212   LSMGASNNTCTIKPLVAALCFHQMFEGMGLGGCILQAEYKFVKKAWMVFFFSVTTPFGIA  271

Query  1621  TGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGH  1800
              GI +S  Y  +S T+LI+ G+LN++SAG+LIYMALVDLL+ADFM PK+Q +++LQ+   
Sbjct  272   LGIALSKTYKENSPTSLISVGLLNASSAGLLIYMALVDLLSADFMGPKLQGSIKLQIKSF  331

Query  1801  VSLVLGAGSMSVLAMWA  1851
             V+++LGAG MSV+A WA
Sbjct  332   VAVLLGAGGMSVMAKWA  348



>ref|XP_006369054.1| zinc transporter protein ZIP1 [Populus trichocarpa]
 gb|ERP65623.1| zinc transporter protein ZIP1 [Populus trichocarpa]
Length=296

 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 213/325 (66%), Gaps = 47/325 (14%)
 Frame = +1

Query  877   TVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVH  1056
             T ++LKY+L+AI+SIL A A G+ +P   +   +L P+++ FF+IKAFAAGVIL TGF+H
Sbjct  17    TSEALKYKLIAISSILFASALGICLPFFVKNLSYLHPDREAFFLIKAFAAGVILGTGFIH  76

Query  1057  ILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKL  1236
             ILPDAF++LTSP L   NPW KFPF+G +A+ ++I TLM+++ A  + ++  +       
Sbjct  77    ILPDAFESLTSPCLGQ-NPWEKFPFAGFVAMLSAIGTLMMESFATGYHKRLELR------  129

Query  1237  PQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGI  1416
                                             P P + +             S+VLE+GI
Sbjct  130   -------------------------------KPQPVSGD---------HEENSKVLEMGI  149

Query  1417  VVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFS  1596
             +VHSVIIGL LG S++ +TI+PL+ ALSFHQFFEG+GLGGCI+QAKFK  +  +M +FFS
Sbjct  150   LVHSVIIGLSLGASKSSKTIKPLVAALSFHQFFEGVGLGGCISQAKFKLRAKVIMILFFS  209

Query  1597  LTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNN  1776
             LTTP GIA GI IS  YN  S  ALI QG+LNSASAGILIYMALVDLLAADF+   +  +
Sbjct  210   LTTPTGIAIGIWISRSYNETSPMALIVQGILNSASAGILIYMALVDLLAADFINSSMLYS  269

Query  1777  VRLQLGGHVSLVLGAGSMSVLAMWA  1851
               LQLG +++L+LGA SMS+LA+W 
Sbjct  270   FWLQLGAYLTLLLGAFSMSLLAIWG  294



>ref|NP_001236499.1| zinc transporter protein ZIP1 precursor [Glycine max]
 gb|AAK37761.1| zinc transporter protein ZIP1 [Glycine max]
Length=354

 Score =   305 bits (780),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 180/347 (52%), Positives = 241/347 (69%), Gaps = 20/347 (6%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E +    SK       +L+Y++ A+ SILVAGA GV IPLL +    L PE
Sbjct  28    AECTCDR--EDEERDKSK-------ALRYKIAALVSILVAGAIGVCIPLLGKVISALSPE  78

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             KD FF+IKAFAAGVILSTGF+H+LPDAF+ LTSP LK+ +PW +FPF+G +A+  ++ TL
Sbjct  79    KDTFFIIKAFAAGVILSTGFIHVLPDAFENLTSPCLKE-HPWGEFPFTGFVAMCTAMGTL  137

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MVDT A ++F+K   H  + +   V  +           H     A          P+++
Sbjct  138   MVDTYATAYFKKH--HHSQDEATDVEKESGHEGHVHLHTHATHGHAHGHV------PTDD  189

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
             +    S+ +R RV+SQVLE+GI+VHS+IIG+ LG S++ +TIRPL+ AL FHQFFEGMGL
Sbjct  190   D--QSSELLRHRVISQVLEVGIIVHSIIIGISLGASESPKTIRPLMAALIFHQFFEGMGL  247

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             G CI QA FK +S  +M + F+LTTP+GI  GIGI+ VY+ +S TALI +G+ N+ASAGI
Sbjct  248   GSCITQANFKKLSITLMGLVFALTTPMGIGIGIGITKVYDENSPTALIVEGIFNAASAGI  307

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++Q +  L+LG ++SL+LGAG MS+LA WA
Sbjct  308   LIYMALVDLLAADFMNPRMQKSGSLRLGANLSLLLGAGCMSLLAKWA  354



>ref|XP_006418042.1| hypothetical protein EUTSA_v10008057mg [Eutrema salsugineum]
 gb|ESQ36395.1| hypothetical protein EUTSA_v10008057mg [Eutrema salsugineum]
Length=352

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 166/354 (47%), Positives = 226/354 (64%), Gaps = 28/354 (8%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A E +C C+       H   +E      + KY++ AI S+L AG  GV  PLL   +  
Sbjct  24    SAGECKCECS-------HEEDEEN--NAGAKKYKIAAIPSVLAAGVMGVLFPLLGNFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  75    LRPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-KAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F++   HF  +K                 +     G     +++   
Sbjct  133   ILTLSVDSFATSYFQRS--HFKTSK------------RIGDGEEQSGGGGDELGLHVHAH  178

Query  1339  PSNNELVHLSDRI---RQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
                + +V +   +   R RVV+QVLE+GI+VHSV+IG+ LG SQ  +T + L  AL FHQ
Sbjct  179   GHTHGIVAVESEVQLHRTRVVAQVLEVGIIVHSVVIGISLGASQNPDTAKALFAALMFHQ  238

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
              FEG+GLGGCIAQ  F  +S  +M++FFS+TTP+GIA G+GI++ Y+  S TALI QGVL
Sbjct  239   CFEGLGLGGCIAQGNFNCMSITIMSIFFSITTPIGIAVGMGIATSYDESSPTALIVQGVL  298

Query  1690  NSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             N+ASAGILIYM+LVD LAADFM PK+Q+N  LQ+  H+SL+ GAG MS+LA WA
Sbjct  299   NAASAGILIYMSLVDFLAADFMHPKMQSNTSLQIMAHISLLAGAGIMSLLAKWA  352



>ref|XP_009759352.1| PREDICTED: zinc transporter 1-like [Nicotiana sylvestris]
Length=351

 Score =   304 bits (779),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 172/348 (49%), Positives = 231/348 (66%), Gaps = 26/348 (7%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             + CTC    + + H  +K       +L Y+LVAIASIL A A GV IP+L   ++ L  +
Sbjct  27    ANCTCEP--QDKDHQKTKHE----AALAYKLVAIASILCASAVGVIIPILLNNFKSLQND  80

Query  991   -KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIAT  1167
                + F+IKAFAAGVIL+TGF+HILPDAFQ+LT+P L +T  +  FPF+G +++ ++I T
Sbjct  81    YSSLNFLIKAFAAGVILATGFIHILPDAFQSLTNPCL-NTEIFGSFPFAGFVSMMSAIFT  139

Query  1168  LMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSN  1347
             LM+++ A  + R+  +   K +   +  D+EE                   +    P   
Sbjct  140   LMMESFATGYHRRAELR--KAQPVNIGDDDEENDG----------------IQTHGPQIL  181

Query  1348  NELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMG  1527
              E  + S  IR R++SQ+LELGI+VHSVIIG+ LGT++  +TI+PL++ALSFHQFFEGMG
Sbjct  182   LERTNSSTLIRHRLISQILELGILVHSVIIGISLGTTENPKTIKPLIIALSFHQFFEGMG  241

Query  1528  LGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAG  1707
             LGGCI+QAK++  + A+M +FF+LTTP GI  G+ IS  YN  SS ALI QGVLNSASAG
Sbjct  242   LGGCISQAKYRGRTIAIMVLFFTLTTPSGIGIGMMISKGYNEQSSAALIVQGVLNSASAG  301

Query  1708  ILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ILIYMALVDLLA DFM P +  N +LQ+  +VSLVLGA  MS+LA W 
Sbjct  302   ILIYMALVDLLAKDFMDPNLHTNFKLQILANVSLVLGASCMSLLAKWG  349



>gb|KDP31427.1| hypothetical protein JCGZ_11803 [Jatropha curcas]
Length=344

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 166/364 (46%), Positives = 231/364 (63%), Gaps = 28/364 (8%)
 Frame = +1

Query  760   IIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAA  939
             I++I    A+   AA +    C    +G+ H  +K       SLK +L++IASILV    
Sbjct  9     ILLIILSFALPALAAEQ----CQSKTQGECHDKAK-------SLKLKLISIASILVTSMI  57

Query  940   GVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWA  1119
             GV +PL +R    L P+K +F ++KAFA+GVIL+TG++H+LPD+F  LTS  L + NPW 
Sbjct  58    GVCLPLFSRAVPALSPDKSLFSIVKAFASGVILATGYMHVLPDSFNCLTSECLPE-NPWR  116

Query  1120  KFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhr  1299
             KFPF+  +A+ +++ TLMVD+ A+S+++K  +  +   +                     
Sbjct  117   KFPFTTFVAMLSALITLMVDSFALSYYKKHELRSEGEGVRD------------DVQEGGN  164

Query  1300  hgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIR  1479
                    V ++  P   +    S  +R RVV+QVLELGIVVHSV+IGL +G S    TIR
Sbjct  165   EDGETVNVKVEESPGGID----SPLLRHRVVAQVLELGIVVHSVVIGLSMGASDNPCTIR  220

Query  1480  PLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHS  1659
             PL+ AL FHQ FEGMGLGGCI QA++     A M  FFS TTP GIA GIG+S+VY+ +S
Sbjct  221   PLIAALCFHQLFEGMGLGGCILQAEYGMKMKATMVFFFSSTTPFGIALGIGLSNVYSENS  280

Query  1660  STALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVL  1839
              TALI  G+LN++SAG+L YMALVDLLAADFM  K+Q NV+LQ+  +++++LGAG MS++
Sbjct  281   PTALIVVGILNASSAGLLNYMALVDLLAADFMGHKLQQNVKLQMLAYIAVLLGAGGMSLM  340

Query  1840  AMWA  1851
             A WA
Sbjct  341   AKWA  344



>ref|XP_004232649.1| PREDICTED: zinc transporter 3-like [Solanum lycopersicum]
Length=352

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 169/354 (48%), Positives = 240/354 (68%), Gaps = 38/354 (11%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             + CTC    + + ++ +K       +L Y+L+AI+SIL + A GV +P+L + ++ L  +
Sbjct  28    ANCTCEPQ-DNKYNHQTKH-----KALSYKLIAISSILCSSALGVILPILLKNFKSL--Q  79

Query  991   KDIF----FMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             K+ +    FMIKAFAAGVIL+TGF+HILPDAF++LTSP L + + W  FPF+G +A+ ++
Sbjct  80    KNDYSPLQFMIKAFAAGVILATGFIHILPDAFESLTSPCLSE-DLWGSFPFAGFVAMMSA  138

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TLM+++ A  + R+  +   K +   +  ++ + +                  ++D  
Sbjct  139   IFTLMMESFASGYHRRAELR--KAQPVNIGDEQGQDE------------------HIDHG  178

Query  1339  PSNNELVHLSDR---IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
             P    L+  SD    +R R++SQVLELGI+VHSVIIG+ LGT++  +TI+PL++ALSFHQ
Sbjct  179   P--QILLERSDSSSLMRHRLISQVLELGILVHSVIIGISLGTTENPKTIKPLIIALSFHQ  236

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
             FFEGMGLGGCI+QAK+K  +  +M +FF++TTP GIA G+ IS  YN  SSTALI QGVL
Sbjct  237   FFEGMGLGGCISQAKYKVRTIIIMVLFFTVTTPSGIAIGMMISKGYNEQSSTALIVQGVL  296

Query  1690  NSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             NSASAGILIYMALVDLLA DFM PK+  + +LQ+  +VSL+LGA  MS+LA W 
Sbjct  297   NSASAGILIYMALVDLLATDFMNPKLYTSFKLQIVANVSLILGACCMSLLAKWG  350



>ref|XP_010475216.1| PREDICTED: zinc transporter 5-like [Camelina sativa]
Length=359

 Score =   304 bits (778),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 230/352 (65%), Gaps = 17/352 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+       H   +E     +  KY++ AI S+LVAG  GV  PLL R +  
Sbjct  24    SAGESKCECS-------HEDEEENKAGAN--KYKIAAIPSVLVAGVIGVLFPLLGRFFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE    F+ KAFAAGVIL+TGF+H+LP+ ++ LTSP LK    W +FPF+G IA+ A+
Sbjct  75    LRPETTFSFVTKAFAAGVILATGFMHVLPEGYEKLTSPCLKG-EAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVY-LDP  1335
             I TL VD+ A ++F +  +HF  +K      ++         + +  H  A    + +  
Sbjct  133   ILTLSVDSFATAYFHR--LHFKTSKKIGDGEEQRVDGGGGGGEDLGLHVHAHGHTHGIVG  190

Query  1336  PPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFF  1515
               S +  V L    R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ F
Sbjct  191   VESGDSEVQLH---RTRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCF  247

Query  1516  EGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNS  1695
             EG+GLGGCIAQ  F  +S  +M++FFS+TTPVGIA G+ IS+ YN  S TALI QGVLN+
Sbjct  248   EGLGLGGCIAQGNFNCMSITIMSIFFSVTTPVGIAVGMAISNSYNESSPTALIVQGVLNA  307

Query  1696  ASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             ASAGILIYM+LVD LAADFM PK+Q+N  LQ+  H+SL++GAG MS+LA WA
Sbjct  308   ASAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  359



>ref|XP_004145454.1| PREDICTED: probable zinc transporter 10-like [Cucumis sativus]
 gb|KGN66895.1| hypothetical protein Csa_1G707110 [Cucumis sativus]
Length=350

 Score =   303 bits (776),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 171/382 (45%), Positives = 238/382 (62%), Gaps = 45/382 (12%)
 Frame = +1

Query  745   VASF---YIIIIFFPCAISGTAAAES-ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAI  912
             +ASF   + I +F  C  S  A ++S EC    N     H           +L+ +++AI
Sbjct  1     MASFTKPFSIFLFLICFFSIQAVSQSDECETTANSCTNKH----------KALRLKIIAI  50

Query  913   ASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSP  1092
              SIL+A   GV  PL+ R    L P++++F ++KAFAAG+IL+TGF+H+LPD+F  L S 
Sbjct  51    FSILIASVIGVGSPLVTRSIPMLHPDRNMFVILKAFAAGIILATGFMHVLPDSFDMLWSN  110

Query  1093  LLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHF---------DKTKLPQV  1245
              LK+ NPW KFPFSG +A+ ++I TLMVD++A S + KK             D  +LP V
Sbjct  111   CLKE-NPWHKFPFSGFVAMMSAIVTLMVDSMATSLYTKKHNEVMPENSPRGGDDHELPVV  169

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
             S                         ++D   +N      S  +R RVV+ VLELGIVVH
Sbjct  170   SGGHFHGH-----------------HHMDTKETNAG----SQLLRYRVVAMVLELGIVVH  208

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SV+IGL LG +    TI+ L+ AL FHQ FEGMGLGGCI QA++K +  A+M  FFS+TT
Sbjct  209   SVVIGLSLGATNDTCTIKGLVAALCFHQMFEGMGLGGCILQAEYKWMKKAIMVFFFSVTT  268

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             P GIA GIG+S  Y  +S  AL+T G+LN++SAG+LIYMALVDLL+ADFM PK+Q +++L
Sbjct  269   PFGIALGIGLSKTYKENSPVALVTVGLLNASSAGLLIYMALVDLLSADFMGPKLQGSIKL  328

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             Q+  +++++LGAG+MS++A WA
Sbjct  329   QVKSYIAVLLGAGAMSLMAKWA  350



>ref|XP_009141213.1| PREDICTED: zinc transporter 3-like [Brassica rapa]
Length=342

 Score =   303 bits (775),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/349 (48%), Positives = 220/349 (63%), Gaps = 47/349 (13%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C C+       H   +E      + KY++ A+ S+L+AG  GV  PLL + +  L PE 
Sbjct  38    KCECS-------HDHDQEN--KAGAQKYKIAAVPSVLIAGVIGVLFPLLGKVFPSLRPET  88

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
               FF+ KAFAAGVILSTGF+H+LP+A++ L SP L  +  W  FPF+G IA+ A+I TL 
Sbjct  89    PFFFVTKAFAAGVILSTGFMHVLPEAYEMLNSPCLT-SEAW-DFPFTGFIAMVAAILTLS  146

Query  1174  VDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNE  1353
             VDT A S F K   +  KT                                  P   + E
Sbjct  147   VDTFATSSFNKSHCNASKTI---------------------------------PDGESGE  173

Query  1354  LVHLSDRI---RQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             LV  S ++   R RV++QVLELGI+VHSV+IG+ LG SQ+ E  + L +AL FHQ FEG+
Sbjct  174   LVVDSAKVQMLRTRVIAQVLELGIIVHSVVIGISLGASQSPEAAKALFIALMFHQCFEGL  233

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCIAQ KFK +S  +M+ FF++TTP+GI  G+ I++ Y+  S TALI QGVLN+ASA
Sbjct  234   GLGGCIAQGKFKCLSVTIMSTFFAITTPLGIVVGMEIANTYDESSPTALIVQGVLNAASA  293

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             GILIYM+LVDLLAADFM PK+Q+N  LQ+  H++L+LGAG MS+LA WA
Sbjct  294   GILIYMSLVDLLAADFMHPKMQSNTGLQIMAHIALLLGAGLMSILAKWA  342



>ref|XP_009143963.1| PREDICTED: zinc transporter 3 [Brassica rapa]
Length=342

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 165/350 (47%), Positives = 222/350 (63%), Gaps = 41/350 (12%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             + + +C C+ + + +    ++         KY++ AI ++L+AG  GV  PLL + +  L
Sbjct  34    SGKPQCECSHDDDHENKAGAR---------KYKIAAIPTVLLAGVIGVLFPLLGKVFPSL  84

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
              PE   FF+ KAFAAGVILSTGF+H+LP+A+  L SP L  +  W +FPF+G IA+ A+I
Sbjct  85    RPETSFFFVTKAFAAGVILSTGFMHVLPEAYVMLNSPCLT-SEAW-EFPFTGFIAMVAAI  142

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
              TL VDT A S F K      KT +   S                             P 
Sbjct  143   LTLSVDTFATSSFYKSHCKASKTIIDGES---------------------------GEPS  175

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
              ++  V +   +R R+++QVLELGI+VHSV+IG+ LG SQ+ E  + L +AL FHQ FEG
Sbjct  176   VDSAKVQI---LRTRIIAQVLELGIIVHSVVIGISLGASQSPEAAKALFIALMFHQCFEG  232

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             +GLGGCIAQ KFK +S  +M+ FF++TTP+GI  G+GIS  Y+  S TALI QGVLN+AS
Sbjct  233   LGLGGCIAQGKFKCLSVTIMSTFFAVTTPIGIVVGMGISDTYDESSPTALIVQGVLNAAS  292

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYM+LVDLLAADFM PK+Q+N  LQ+  H+SL+LGAG MS+LA WA
Sbjct  293   AGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHISLLLGAGLMSLLAKWA  342



>ref|XP_008678193.1| PREDICTED: zinc transporter 4-like [Zea mays]
 gb|AFW61001.1| hypothetical protein ZEAMMB73_424669 [Zea mays]
Length=386

 Score =   304 bits (778),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 224/354 (63%), Gaps = 17/354 (5%)
 Frame = +1

Query  817   CTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKD  996
             C C G     +            +L+ +LVA+ASIL +GAAGV +PLL R    L P+ D
Sbjct  41    CDCGGGEAAAIKEEDAR-----GALRLKLVAVASILASGAAGVLVPLLGRSASALRPDGD  95

Query  997   IFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMV  1176
             +FF +KAFAAGVIL+TG VHILP AF  L  P          FP++GL+A+ +++AT+MV
Sbjct  96    VFFAVKAFAAGVILATGMVHILPAAFDALAPPCGGGAR-AGGFPYAGLVAMCSAMATMMV  154

Query  1177  DTLAMSFFRKKMMH---------FDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYL  1329
             D+ A  ++++  +           D  +     ADEE A    A        A     + 
Sbjct  155   DSAAAGYYQRAHIRKARPVDDDAVDGGQGRAAPADEEGAAAEPAGHVHAHTHAHGGHGHA  214

Query  1330  DPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
                P +   V +S  IR RV+SQVLELGI+VHSVIIG+ LG S    TIRPL+ ALSFHQ
Sbjct  215   GASPQDASAVAVS--IRHRVISQVLELGILVHSVIIGVSLGASLRPSTIRPLVGALSFHQ  272

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
             FFEG+GLGGCI QA+FK+ +  VMA FFSLT P GIA GI I+S Y+ H +TAL+ +GV 
Sbjct  273   FFEGIGLGGCIVQAEFKARAAVVMAAFFSLTAPAGIALGIAIASGYSRHGATALVVEGVF  332

Query  1690  NSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             N+A+AGIL+YM+LVDLLAADF  P++Q N +LQL  +V+L LGAG MS+LA WA
Sbjct  333   NAAAAGILVYMSLVDLLAADFSNPRLQTNAKLQLAAYVALFLGAGLMSLLAKWA  386



>ref|XP_002514554.1| zinc/iron transporter, putative [Ricinus communis]
 gb|EEF47660.1| zinc/iron transporter, putative [Ricinus communis]
Length=351

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 173/371 (47%), Positives = 238/371 (64%), Gaps = 29/371 (8%)
 Frame = +1

Query  739   NIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIAS  918
              +V S  II+ F   A     A E E   +G   G  H  +K       SLK +L+AIAS
Sbjct  10    KMVVSLLIILSFALTAF----AEECESKSDGGGRG-CHDKAK-------SLKLKLIAIAS  57

Query  919   ILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLL  1098
             IL+    GV +PL +R    L P++D+F ++KAFA+GVIL+TG++H+LPD+F  L S  L
Sbjct  58    ILITSMIGVCLPLFSRAVPALMPDRDLFAIVKAFASGVILATGYMHVLPDSFDCLRSECL  117

Query  1099  KDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaa  1278
              + NPW KFPF+  +A+ +++ TLMVD+ AMS+++K  +    T        +   +   
Sbjct  118   PE-NPWRKFPFTTFVAMLSALFTLMVDSFAMSYYKKWGIDNGATGGGHHHHIKGAEELGN  176

Query  1279  aadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTS  1458
              A   +               +N+E++     +R RVV+QVLELGIVVHSV+IGL +G S
Sbjct  177   LAVEDNT-----------DGKANSEVL-----LRHRVVAQVLELGIVVHSVVIGLSMGAS  220

Query  1459  QTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGIS  1638
                 TIRPL+ AL FHQ FEGMGLGGCI QA++     A+M  FFS TTP+GIA GIG+S
Sbjct  221   DNPCTIRPLIAALCFHQLFEGMGLGGCILQAEYGMKIKAMMVFFFSATTPLGIALGIGLS  280

Query  1639  SVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLG  1818
             +VY+ +S TALI  G+LN++SAG+L YMALVDLLAADFM PK+Q N++LQ+  +VS++LG
Sbjct  281   NVYSDNSPTALIVVGLLNASSAGLLNYMALVDLLAADFMGPKLQQNLKLQILAYVSVLLG  340

Query  1819  AGSMSVLAMWA  1851
             AG MS++A WA
Sbjct  341   AGGMSLMAKWA  351



>ref|XP_004157744.1| PREDICTED: probable zinc transporter 10-like [Cucumis sativus]
Length=350

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 171/382 (45%), Positives = 241/382 (63%), Gaps = 45/382 (12%)
 Frame = +1

Query  745   VASF---YIIIIFFPCAISGTAAAES-ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAI  912
             +ASF   + I +F  C  S  A ++S EC    N       ++K+      +L+ +++AI
Sbjct  1     MASFTKPFSIFLFLICFFSIQAVSQSDECETTAN-----SCTNKD-----KALRLKIIAI  50

Query  913   ASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSP  1092
              SIL+A   GV  PL+ R    L P++++F ++KAFAAG+IL+TGF+H+LPD+F  L S 
Sbjct  51    FSILIASVIGVGSPLVTRSIPMLHPDRNMFVILKAFAAGIILATGFMHVLPDSFDMLWSN  110

Query  1093  LLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHF---------DKTKLPQV  1245
              LK+ NPW KFPFSG +A+ ++I TLMVD++A S + KK             D  +LP V
Sbjct  111   CLKE-NPWHKFPFSGFVAMMSAIVTLMVDSMATSLYTKKHNEVMPENSPRGGDDHELPVV  169

Query  1246  SadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVH  1425
             S                         ++D   +N      S  +R RVV+ VLELGIVVH
Sbjct  170   SGGHFHGH-----------------HHMDTKETNAG----SQLLRYRVVAMVLELGIVVH  208

Query  1426  SVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTT  1605
             SV+IGL LG +    TI+ L+ AL FHQ FEGMGLGGCI QA++K +  A+M  FFS+TT
Sbjct  209   SVVIGLSLGATNDTCTIKGLVAALCFHQMFEGMGLGGCILQAEYKWMKKAIMVFFFSVTT  268

Query  1606  PVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRL  1785
             P GIA GIG+S  Y  +S  AL+T G+LN++SAG+LIYMALVDLL+ADFM PK+Q +++L
Sbjct  269   PFGIALGIGLSKTYKENSPVALVTVGLLNASSAGLLIYMALVDLLSADFMGPKLQGSIKL  328

Query  1786  QLGGHVSLVLGAGSMSVLAMWA  1851
             Q+  +++++LGAG+MS++A WA
Sbjct  329   QVKSYIAVLLGAGAMSLMAKWA  350



>ref|XP_003571530.1| PREDICTED: zinc transporter 4-like [Brachypodium distachyon]
Length=416

 Score =   305 bits (780),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 174/365 (48%), Positives = 223/365 (61%), Gaps = 33/365 (9%)
 Frame = +1

Query  814   ECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEK  993
             +C  N           + T     +L+ +  AIASIL +GAAGV +P+L R +  L  + 
Sbjct  66    DCGANNAGAELAGEEEEGTAAAAAALRLKFTAIASILASGAAGVLVPVLGRSWALLRADG  125

Query  994   DIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLM  1173
             D+FF +KAFAAGVIL+TG VHILP AF  L S         ++FPF+GL+A+ A++ T++
Sbjct  126   DVFFAVKAFAAGVILATGMVHILPAAFDALASA--------SRFPFAGLVAMAAAMLTMV  177

Query  1174  VDTLAMSFFRKKMMHFDKTK-------------------LPQVSadeeeakdaaaadhmh  1296
             VD+LA  ++R+   HF K +                                     H H
Sbjct  178   VDSLAAGYYRRS--HFRKPRPVDDDGRAAAGAGAGEDEEERHAGHLHVHTHATHGHAHGH  235

Query  1297  rhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETI  1476
              H         D P    E    ++ IR RVVSQVLELGI+VHSVIIG+ LG S    TI
Sbjct  236   VHSHGHGHGGADSP----EEASAAETIRHRVVSQVLELGILVHSVIIGVSLGASLRPTTI  291

Query  1477  RPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPH  1656
             RPL+ ALSFHQFFEG+GLGGCI QAKFK+ +T +MA FFS T P+GIA GI I+S Y+ H
Sbjct  292   RPLVGALSFHQFFEGIGLGGCIVQAKFKAKATVLMATFFSFTAPIGIALGIAITSSYSKH  351

Query  1657  SSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSV  1836
             SSTAL+ +GV NSA+AGILIYM+LVDLLAADF  PK+Q N +LQL  +++L LGAG MS+
Sbjct  352   SSTALVVEGVFNSAAAGILIYMSLVDLLAADFNNPKLQTNTKLQLATYLALFLGAGLMSL  411

Query  1837  LAMWA  1851
             LA WA
Sbjct  412   LAKWA  416



>gb|ADI24871.1| zinc transporter [Zea mays]
Length=386

 Score =   303 bits (775),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 172/354 (49%), Positives = 223/354 (63%), Gaps = 17/354 (5%)
 Frame = +1

Query  817   CTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKD  996
             C C G     +            +L+ +LVA ASIL +GAAGV +PLL R    L P+ D
Sbjct  41    CDCGGGEAAAIKEEDAR-----GALRLKLVAAASILASGAAGVLVPLLGRSASALRPDGD  95

Query  997   IFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMV  1176
             +FF +KAFAAGVIL+TG VHILP AF  L  P          FP++GL+A+ +++AT+MV
Sbjct  96    VFFAVKAFAAGVILATGMVHILPAAFDALAPPCGGGAR-AGGFPYAGLVAMCSAMATMMV  154

Query  1177  DTLAMSFFRKKMMH---------FDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYL  1329
             D+ A  ++++  +           D  +     ADEE A    A        A     + 
Sbjct  155   DSAAAGYYQRAHIRKARPVDDDAVDGGQGRAAPADEEGAAAEPAGHVHAHTHAHGGHGHA  214

Query  1330  DPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQ  1509
                P +   V +S  IR RV+SQVLELGI+VHSVIIG+ LG S    TIRPL+ ALSFHQ
Sbjct  215   GASPQDASAVAVS--IRHRVISQVLELGILVHSVIIGVSLGASLRPSTIRPLVGALSFHQ  272

Query  1510  FFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVL  1689
             FFEG+GLGGCI QA+FK+ +  VMA FFSLT P GIA GI I+S Y+ H +TAL+ +GV 
Sbjct  273   FFEGIGLGGCIVQAEFKARAAVVMAAFFSLTAPAGIALGIAIASGYSRHGATALVVEGVF  332

Query  1690  NSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             N+A+AGIL+YM+LVDLLAADF  P++Q N +LQL  +V+L LGAG MS+LA WA
Sbjct  333   NAAAAGILVYMSLVDLLAADFSNPRLQTNAKLQLAAYVALFLGAGLMSLLAKWA  386



>ref|XP_009377533.1| PREDICTED: fe(2+) transport protein 1-like [Pyrus x bretschneideri]
Length=354

 Score =   301 bits (771),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 239/366 (65%), Gaps = 18/366 (5%)
 Frame = +1

Query  757   YIIIIF-FPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAG  933
             Y++ IF F  +I+G AAA     C    +G+ H  ++       SLK +L+AI+SILV  
Sbjct  6     YVLTIFIFLISIAGNAAAAESQQCASKSKGECHDKAQ-------SLKLKLIAISSILVTS  58

Query  934   AAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNP  1113
               G+ +P+L+RK   L P+KD+F ++KAFA+GVIL+TG++H+LPD+F  L S  L ++ P
Sbjct  59    MIGICLPILSRKVSALQPDKDLFVVVKAFASGVILATGYMHVLPDSFDCLRSECLPES-P  117

Query  1114  WAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhm  1293
             W KFPF+  +A+ +++  +MVD+ +MS+ RK  +     +      ++EE+   +     
Sbjct  118   WRKFPFTTFVAMLSALLAMMVDSFSMSYSRKSFL-----RRAAAREEDEESAKNSRCPDQ  172

Query  1294  hrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRET  1473
               H      +  +   +  +    S  ++ RVV+QVLELGIVVHSV+IGL +G S    T
Sbjct  173   LEHFGHGHGIKTEDGLNGKD----SQLLKHRVVAQVLELGIVVHSVVIGLSMGASDNPCT  228

Query  1474  IRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNP  1653
             +RPL+ A+ FHQFFEGMGLGGCI Q ++ S   AVM  FFS TTP GIA GI +S+VY+ 
Sbjct  229   MRPLIAAICFHQFFEGMGLGGCILQTEYGSKIKAVMVFFFSTTTPFGIALGIALSNVYSD  288

Query  1654  HSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMS  1833
             HS TALI  G+L++ASAG+L YMALVDLLAADFM  K+Q NV+LQ   +++++LG G MS
Sbjct  289   HSPTALIVVGLLDAASAGLLNYMALVDLLAADFMGRKLQANVKLQTWSYIAVLLGIGGMS  348

Query  1834  VLAMWA  1851
             ++A WA
Sbjct  349   LMAKWA  354



>emb|CDY48278.1| BnaA05g10760D [Brassica napus]
Length=342

 Score =   301 bits (770),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 219/350 (63%), Gaps = 41/350 (12%)
 Frame = +1

Query  802   AAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFL  981
             + + +C C+       H    E      + KY++ AI ++L+AG  GV  PLL +    L
Sbjct  34    SGKPQCECS-------HDDDHEN--KAGARKYKIAAIPAVLLAGVIGVLFPLLGKVIPSL  84

Query  982   GPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASI  1161
              PE   FF+ KAFAAGVILSTGF+H+LP+A+  L SP L  +  W +FPF+G IA+ A+I
Sbjct  85    RPETSFFFVTKAFAAGVILSTGFMHVLPEAYVMLNSPCLT-SEAW-EFPFTGFIAMVAAI  142

Query  1162  ATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPP  1341
              TL VDT A S F K      KT +   S                             P 
Sbjct  143   LTLSVDTFATSSFYKSHCKASKTIIDGES---------------------------GEPS  175

Query  1342  SNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEG  1521
              ++  V +   +R R+++QVLELGI+VHSV+IG+ LG SQ+ E  + L +AL FHQ FEG
Sbjct  176   VDSAKVQI---LRTRIIAQVLELGIIVHSVVIGISLGASQSPEAAKALFIALMFHQCFEG  232

Query  1522  MGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSAS  1701
             +GLGGCIAQ KFK +S  +M+ FF++TTP+GI  G+GIS  Y+  S TALI QGVLN+AS
Sbjct  233   LGLGGCIAQGKFKCLSVTIMSTFFAVTTPIGIVVGMGISDTYDESSPTALIVQGVLNAAS  292

Query  1702  AGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             AGILIYM+LVDLLAADFM PK+Q+N  LQ+  H+SL+LGAG MS+LA WA
Sbjct  293   AGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHISLLLGAGLMSLLAKWA  342



>ref|XP_006658416.1| PREDICTED: zinc transporter 8-like [Oryza brachyantha]
Length=307

 Score =   300 bits (767),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 158/312 (51%), Positives = 208/312 (67%), Gaps = 11/312 (4%)
 Frame = +1

Query  916   SILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPL  1095
              +L A +AG+ +P+L R+   L P+ D+FF++KAFAAGVIL+TGFVHILPDAF++L+S  
Sbjct  7     GVLSARSAGIDVPVLGRRVPALRPDGDVFFLVKAFAAGVILATGFVHILPDAFESLSSDC  66

Query  1096  LKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakda  1275
             L    PW +FPF+G  A+  +I TL+VDTLA  +F +   HF K      + +       
Sbjct  67    LAG-GPWKRFPFAGFGAMVGAIGTLVVDTLATGYFTRA--HFKKGTAAAAAHEGHVHVHT  123

Query  1276  aaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGT  1455
              +        +A  A   +              +R RV+SQVLELGIVVHSVIIG+ LG 
Sbjct  124   HSTHGHAHGSSALVAAVGEDDKEQT--------LRHRVISQVLELGIVVHSVIIGISLGA  175

Query  1456  SQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGI  1635
             SQ+ +TI+PL+VALSFHQ FEGMGLGGCI QAKFK+ S   M +FF LTTP GIA G GI
Sbjct  176   SQSPDTIKPLVVALSFHQMFEGMGLGGCIVQAKFKARSVVTMVLFFCLTTPAGIAVGAGI  235

Query  1636  SSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVL  1815
             SS Y+  S  AL+ +G+LNS +AGIL+YMALVDLLA DF  P++Q   R+QL  +V++++
Sbjct  236   SSAYDESSPAALVVEGLLNSVAAGILLYMALVDLLAEDFTDPRVQGRPRMQLAVNVAMLV  295

Query  1816  GAGSMSVLAMWA  1851
             GA  MS+LA WA
Sbjct  296   GAALMSMLAGWA  307



>ref|XP_006295925.1| hypothetical protein CARUB_v10025062mg [Capsella rubella]
 gb|EOA28823.1| hypothetical protein CARUB_v10025062mg [Capsella rubella]
Length=340

 Score =   300 bits (769),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 166/356 (47%), Positives = 223/356 (63%), Gaps = 41/356 (12%)
 Frame = +1

Query  784   AISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLA  963
             A  G +    +C C+       H   +E      + KY++ AI S+LVAG  GV  PLL 
Sbjct  26    AAEGHSHGGPQCECS-------HKDDEEN--KAGARKYKIAAIPSVLVAGVLGVLFPLLG  76

Query  964   RKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLI  1143
             + +  L PE   FF+ KAFAAGVIL+TGF+H+LP+A+  L SP L  +  W +FPF+G I
Sbjct  77    KVFPSLRPETSFFFLTKAFAAGVILATGFMHVLPEAYTMLNSPCLT-SEAW-EFPFTGFI  134

Query  1144  ALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaV  1323
             A+ ++I TL VDT A S F K      KT +   S                         
Sbjct  135   AMISAILTLSVDTFATSSFYKSHCKASKTIIDGES-------------------------  169

Query  1324  YLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSF  1503
                 P  ++  V +   +R R+++QVLELGI+VHSV+IG+ LG SQ+ +  + L +AL F
Sbjct  170   --GEPSVDSVKVQV---LRTRIIAQVLELGIIVHSVVIGISLGASQSPDAAKALFIALMF  224

Query  1504  HQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQG  1683
             HQ FEG+GLGGCIAQ KFK +S  +M+ FF++TTP+GI  G+GI++ Y+  S TALI QG
Sbjct  225   HQCFEGLGLGGCIAQGKFKCLSVTIMSTFFAITTPIGIVVGMGIANSYDESSPTALIVQG  284

Query  1684  VLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             VLN+ASAGILIYM+LVDLLAADFM PK+Q+N  LQ+  H++L+LGAG MS+LA WA
Sbjct  285   VLNAASAGILIYMSLVDLLAADFMHPKMQSNTGLQIMAHIALLLGAGLMSLLAKWA  340



>emb|CDP08261.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   302 bits (774),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 221/346 (64%), Gaps = 31/346 (9%)
 Frame = +1

Query  898   RLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQ  1077
             ++VAIA+IL AGA G++IPL+ RK  FLG + ++F  +KAFAAGVIL+TGFVHILPDA  
Sbjct  60    KMVAIAAILFAGACGIAIPLVGRKRRFLGTDSNLFVAVKAFAAGVILATGFVHILPDATL  119

Query  1078  TLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSade  1257
             +LT P L +  PW  FPFSG IA+ A++ TL+++ +   ++ +K     ++K+ QV + +
Sbjct  120   SLTDPSLPEV-PWHAFPFSGFIAMMAALVTLLIEFVGTQYYERKQE--KESKIAQVDSVD  176

Query  1258  eeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDR---------------------  1374
                   A        G     V +    + +   H  D+                     
Sbjct  177   VLESGTAPKVFGEEGGGGMPIVGIHAHAAQHRHSHPQDQEACSGNKRVHPHGHSHSLDIY  236

Query  1375  -------IRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLG  1533
                    +R  VVSQVLELGIV HSVIIGL LG S+   TI PL+ ALSFHQFFEG  LG
Sbjct  237   DGNEESVMRHVVVSQVLELGIVSHSVIIGLSLGVSENACTITPLIAALSFHQFFEGFALG  296

Query  1534  GCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGIL  1713
             GCI+QA+F SV  ++MA FF++TTP+GIA G GIS++Y+P S  ALI +G+ +S SAGIL
Sbjct  297   GCISQAQFNSVHASIMACFFAITTPLGIAVGTGISTIYDPESPNALIVEGIFDSVSAGIL  356

Query  1714  IYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             IYMALVDL+AADF+  ++  N RLQ+  +VSL LGAG MS+LA+WA
Sbjct  357   IYMALVDLIAADFLSKRLSCNTRLQVTSYVSLFLGAGLMSLLALWA  402



>emb|CAI77926.2| hypothetical protein [Noccaea caerulescens]
Length=352

 Score =   301 bits (770),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 170/351 (48%), Positives = 229/351 (65%), Gaps = 19/351 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+       H   +E      + KY++ AI  +L +G  GV  PL  + +  
Sbjct  21    SAGESKCECS-------HEGDEEN--KAGARKYKIAAIPCVLASGVIGVLFPLSGKYFPS  71

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP L +   W +FPF+G IA+ A+
Sbjct  72    LKPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCL-EGGAW-EFPFTGFIAMVAA  129

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +  +HF  +K      +           H+H HG A   V +D  
Sbjct  130   ILTLSVDSFATSYFYR--LHFKPSKKIGDGEERSGGGGDELGLHVHAHGHAHGIVGVDSG  187

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  +  H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ FE
Sbjct  188   GSEVQ-TH-----RSRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFE  241

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCIAQ  F   S  +M++ FS+TTP+GIA G+GI++ Y+  S TALI QGVLNSA
Sbjct  242   GLGLGGCIAQGNFNCTSITIMSILFSVTTPIGIAVGMGIANSYDESSPTALIMQGVLNSA  301

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVD LAADFM PK+Q+N  LQ+  H+SL++GAG MS+LA WA
Sbjct  302   SAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  352



>ref|XP_006303204.1| hypothetical protein CARUB_v10011177mg [Capsella rubella]
 gb|EOA36102.1| hypothetical protein CARUB_v10011177mg [Capsella rubella]
Length=353

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/375 (45%), Positives = 241/375 (64%), Gaps = 26/375 (7%)
 Frame = +1

Query  727   YSLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLV  906
             + ++ ++A   ++I F    ++  A   S   C    +  L +++KE      S K +++
Sbjct  5     HQMYKLMAIAILLISFTLTTLAENAELSSVTQCKSGPQASLCHNNKE------SKKLKII  58

Query  907   AIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLT  1086
             AI SILVA   GVS+PL  +    LGP++D+F ++KA A+GVIL+TG++H+LPD+F  L 
Sbjct  59    AIFSILVASIIGVSLPLFTQGVPALGPDRDLFVIVKALASGVILATGYMHVLPDSFNNLN  118

Query  1087  SPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeea  1266
             SP L   NPW KFPF+  IA+ +++ TLMVD+ AMS+ +K++  F K++   V   E  +
Sbjct  119   SPCLPR-NPWKKFPFTTFIAMLSALMTLMVDSYAMSWHKKRI--FLKSQENVVETLENGS  175

Query  1267  kdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLC  1446
             K+    +                  +N +L      IR +V++QVLELGIVVHSV+IGL 
Sbjct  176   KELERENGTIV-----------EEDANTQL------IRHQVIAQVLELGIVVHSVVIGLA  218

Query  1447  LGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATG  1626
             +G S  + TIR L+ AL FHQ FEGMGLGGCI QA++   +  +M VFFS+TTP+GI  G
Sbjct  219   MGASDNKCTIRSLIAALCFHQLFEGMGLGGCILQAQYGKKTNWIMVVFFSVTTPLGIVLG  278

Query  1627  IGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVS  1806
             + + +VY+P S TALI  GVLN+ SAG+L YMALVDLLAADF+ PK+Q N++LQ   +V+
Sbjct  279   MLLQTVYSPASPTALIVVGVLNACSAGLLNYMALVDLLAADFLGPKLQGNMKLQTLAYVA  338

Query  1807  LVLGAGSMSVLAMWA  1851
             + LGAG MS++A WA
Sbjct  339   VFLGAGGMSLMAKWA  353



>ref|XP_004293827.1| PREDICTED: zinc transporter 8-like isoform 1 [Fragaria vesca 
subsp. vesca]
Length=343

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/361 (48%), Positives = 230/361 (64%), Gaps = 39/361 (11%)
 Frame = +1

Query  766   IIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGV  945
             +I  P  +S T      CTC    +   + S +  L+T     Y+LVAI S+LV+GA GV
Sbjct  14    LILLPVLVSST------CTCTRKQDEDRNQSKQ--LIT-----YKLVAIVSVLVSGALGV  60

Query  946   SIPLLAR-KYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAK  1122
              +P L +    FL P+ D + +IKAFAAGVIL+T FVH+LPDA ++LTSP L    PW K
Sbjct  61    CLPFLVKVNIPFLHPDNDFYLLIKAFAAGVILATSFVHVLPDAQESLTSPCLSQ-KPWGK  119

Query  1123  FPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrh  1302
             FPF+G +A+ ++I TLM++ LA  + ++  +       PQ                   +
Sbjct  120   FPFTGFVAMVSAIGTLMMEALATGYNKRSAL-----SKPQ-----------PIDGDEETN  163

Query  1303  gaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRP  1482
                 +A+ L+P  S       SD IR R++SQVLELGI+VHSVIIG+ LG  Q   TI+P
Sbjct  164   QVHGSALVLEPSNS-------SDTIRNRIISQVLELGIIVHSVIIGVSLGACQKLHTIKP  216

Query  1483  LLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSS  1662
             L+ ALSFHQFFEG+GLGGCI QAKF   + AVM  FFSLT+P GI  GI IS+ YN +S 
Sbjct  217   LVAALSFHQFFEGIGLGGCIYQAKFSHKTMAVMVGFFSLTSPCGIGVGIAISNSYNENSP  276

Query  1663  TALITQGVLNSASAGILIYMALVDLLAADFM-KPKIQNNVRLQLGGHVSLVLGAGSMSVL  1839
             T+L+ +G+L SASAGILIYMALVDLLAADF+   K+  N +LQLG + +L+LGAG MS+L
Sbjct  277   TSLVVEGLLLSASAGILIYMALVDLLAADFINNAKMLTNPKLQLGANFTLLLGAGFMSLL  336

Query  1840  A  1842
             A
Sbjct  337   A  337



>gb|AAT01414.1| iron regulated transporter [Cucumis sativus]
Length=350

 Score =   300 bits (767),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 162/349 (46%), Positives = 226/349 (65%), Gaps = 35/349 (10%)
 Frame = +1

Query  832   NVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMI  1011
             NV+ Q H  + +      +L+ +++AI SIL+A   GV  PL+ R    L P++++F ++
Sbjct  28    NVKPQPHSCTNKD----KALRLKIIAIFSILIASVIGVGSPLVTRSIPMLHPDRNMFVIL  83

Query  1012  KAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAM  1191
             KAFAAG+IL+TGF+H+LPD+F  L S  LK+ NPW KFPFSG +A+ ++I TLMVD++A 
Sbjct  84    KAFAAGIILATGFMHVLPDSFDMLWSNCLKE-NPWHKFPFSGFVAMMSAIVTLMVDSMAT  142

Query  1192  SFFRKKMMHF---------DKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPS  1344
             S + KK             D  +LP VS                         ++D   +
Sbjct  143   SLYTKKHNEVMPENSPRGGDDHELPVVSGGHFHGH-----------------HHMDTKET  185

Query  1345  NNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGM  1524
             N      S  +R RVV+ VLELGIVVHSV+IGL LG +    TI+ L+ AL FHQ FEGM
Sbjct  186   NAG----SQLLRYRVVAMVLELGIVVHSVVIGLSLGATNDTCTIKGLVAALCFHQMFEGM  241

Query  1525  GLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASA  1704
             GLGGCI QA++K +  A+M  FFS+TTP GIA GIG+S  Y  +S  AL+T G+LN++SA
Sbjct  242   GLGGCILQAEYKWMKKAIMVFFFSVTTPFGIALGIGLSKTYKENSPVALVTVGLLNASSA  301

Query  1705  GILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             G+LIYMALVDLL+ADFM PK+Q +++LQ+  +++++LGAG MS++A WA
Sbjct  302   GLLIYMALVDLLSADFMGPKLQGSIKLQVKSYIAVLLGAGGMSLMAKWA  350



>ref|NP_001240277.1| uncharacterized protein LOC100795511 precursor [Glycine max]
 ref|XP_006605353.1| PREDICTED: uncharacterized protein LOC100795511 isoform X1 [Glycine 
max]
 gb|ACU23042.1| unknown [Glycine max]
Length=358

 Score =   300 bits (767),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 236/374 (63%), Gaps = 21/374 (6%)
 Frame = +1

Query  730   SLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVA  909
             +LF     F+II        +    AES+ +CN          +KE      +L  +++A
Sbjct  6     TLFKTTFVFFIIFTLLTHQATADCEAESKNSCN----------NKE-----KALPLKIIA  50

Query  910   IASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTS  1089
             I +IL +   G+++PL+ R    L PE D+F ++K FAAG+IL TGF+H+LPD+F  L S
Sbjct  51    IFTILASSIIGITLPLVTRSVPALSPENDLFIIVKCFAAGIILGTGFMHVLPDSFAMLWS  110

Query  1090  PLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeak  1269
               LK+  PW +FPFSGL+A+ ++I T+MVD+LA S + KK     +  +P  S+ E   +
Sbjct  111   DCLKE-KPWHEFPFSGLVAMFSAIITMMVDSLATSVYTKKCRTTSEV-VPGESSLEGGEE  168

Query  1270  daaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCL  1449
             +         H       + +      E    S  +R RVV+ VLELGI+VHSV+IGL +
Sbjct  169   NLEMGAVNLGHFHGHHHAHHETKMDGKE----SQLLRYRVVAMVLELGIIVHSVVIGLGM  224

Query  1450  GTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGI  1629
             G S    TIR L+ A+ FHQ FEGMGLGGCI QA++K +  A+M VFFS+TTP GIA GI
Sbjct  225   GASNNTCTIRGLIAAMCFHQMFEGMGLGGCILQAEYKFLKKAIMVVFFSITTPFGIALGI  284

Query  1630  GISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSL  1809
              +S+ Y  +S +ALIT G+LN++SAG+LIYMALVDLL+ADFM P++Q +++LQL  +V++
Sbjct  285   AMSTTYKENSPSALITVGLLNASSAGLLIYMALVDLLSADFMSPRLQGSIKLQLKSYVAV  344

Query  1810  VLGAGSMSVLAMWA  1851
              LGAG MS++A WA
Sbjct  345   FLGAGGMSLMAKWA  358



>emb|CAI77925.2| putative Zn transporter [Noccaea caerulescens]
Length=355

 Score =   299 bits (766),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 169/351 (48%), Positives = 230/351 (66%), Gaps = 19/351 (5%)
 Frame = +1

Query  799   AAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEF  978
             +A ES+C C+       H   ++      + KY++ AI  +L +G  GV  PLL + +  
Sbjct  24    SAGESKCKCS-------HEGDQKN--KAGARKYKIAAIPCVLASGVIGVLFPLLGKYFPS  74

Query  979   LGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTAS  1158
             L PE + FF+ KAFAAGVIL+TGF+H+LP+ ++ LTSP L +   W +FPF+G IA+ A+
Sbjct  75    LKPETNFFFVTKAFAAGVILATGFMHVLPEGYEKLTSPCL-EGGAW-EFPFTGFIAMVAA  132

Query  1159  IATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPP  1338
             I TL VD+ A S+F +  +H   +K      +           H+H HG A   V +D  
Sbjct  133   ILTLSVDSFATSYFYR--LHLKPSKKISDGEERSGGGGDELGLHVHAHGHAHGIVGVDSG  190

Query  1339  PSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFE  1518
              S  +  H     R RVV+QVLE+GI+VHSV+IG+ LG SQ+ +T + L  AL FHQ FE
Sbjct  191   GSEVQ-TH-----RSRVVAQVLEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFE  244

Query  1519  GMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSA  1698
             G+GLGGCIAQ  F  +   +M++ FS+TTP+GIA G+GI++ Y+  SSTALI QGVLNSA
Sbjct  245   GLGLGGCIAQGNFNRMWITIMSILFSVTTPIGIAVGMGIANSYDSSSSTALIMQGVLNSA  304

Query  1699  SAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             SAGILIYM+LVD LAADFM PK+Q+N  LQ+  H+SL++GAG MS+LA WA
Sbjct  305   SAGILIYMSLVDFLAADFMHPKMQSNTGLQIMAHISLLVGAGIMSLLAKWA  355



>ref|XP_009622108.1| PREDICTED: fe(2+) transport protein 1-like [Nicotiana tomentosiformis]
Length=358

 Score =   299 bits (765),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 221/331 (67%), Gaps = 30/331 (9%)
 Frame = +1

Query  883   DSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHIL  1062
             ++LK +LVAIASILV    GV +PL++R    L P+K++F ++KAFA+GVIL+TG++H++
Sbjct  50    EALKLKLVAIASILVTSMIGVCLPLVSRTVPALQPDKNLFLLVKAFASGVILATGYMHVM  109

Query  1063  PDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQ  1242
             PD+F  LTS  L D NPW KFPF+  +A+ ++I TL VD+ AMS+F+K  +         
Sbjct  110   PDSFDCLTSDCLPD-NPWKKFPFTTFVAMLSAILTLSVDSYAMSYFKKYKLE--------  160

Query  1243  VSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVH----LSDR----IRQRVVSQ  1398
                                H     +  +D    NN  +H    + D+    +R RVV+Q
Sbjct  161   ---------SGVGNGRDFVHNGKMESQIID----NNSHIHGEAKVDDKAAQLLRYRVVAQ  207

Query  1399  VLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAV  1578
             VLELGIVVHSV+IGL +G S    TIRPL+ A+ FHQ FEGMGLGGCI QA++     ++
Sbjct  208   VLELGIVVHSVVIGLSMGASDNPCTIRPLVAAICFHQLFEGMGLGGCILQAEYGMKLKSI  267

Query  1579  MAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMK  1758
             M  FFSLTTP GIA GIG+S VY+ +S TALI  G+LN+ SAG+L YMALVDLLAADFM 
Sbjct  268   MVFFFSLTTPFGIALGIGLSKVYSENSPTALIVVGLLNACSAGLLNYMALVDLLAADFMG  327

Query  1759  PKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
              K+QN+++LQ   +V+++LGAG MSV+A+WA
Sbjct  328   TKLQNSMKLQSWAYVAVLLGAGGMSVMAIWA  358



>ref|XP_010510059.1| PREDICTED: zinc transporter 3-like [Camelina sativa]
Length=339

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 235/367 (64%), Gaps = 41/367 (11%)
 Frame = +1

Query  751   SFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVA  930
             S  +++I    A  G +  + +C C+ + +    + +KE      + KY++ AI S+L+A
Sbjct  14    SISVLLIAVVNAAEGHSHGKPQCECSHDDD----HDNKE-----GARKYKIAAIPSVLIA  64

Query  931   GAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTN  1110
             G  GV  PLL + +  L PE   FF+ KAFAAGVIL+TGF+H+LP+A+  L SP L  + 
Sbjct  65    GVIGVLFPLLGKVFPPLRPETPFFFVTKAFAAGVILATGFMHVLPEAYTMLNSPCLT-SE  123

Query  1111  PWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadh  1290
              W +FPF+G IA+ A+I TL VDT A S F K   H   +K  Q++  E           
Sbjct  124   AW-EFPFTGFIAMVAAILTLSVDTFATSSFYKS--HCKASK--QINDGESAE--------  170

Query  1291  mhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRE  1470
                            P  ++  V +   +R R+++QVLELGI+VHSV+IG+ LG SQ+ E
Sbjct  171   ---------------PSVDSAQVQV---LRTRIIAQVLELGILVHSVVIGISLGASQSPE  212

Query  1471  TIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYN  1650
               + L +AL FHQ FEG+GLGGCIAQ KFK +S  +M+ FF++TTP+GI  G+GI++ Y+
Sbjct  213   AAKALFIALMFHQCFEGLGLGGCIAQGKFKCLSVTLMSTFFAITTPIGIVVGMGIANSYD  272

Query  1651  PHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSM  1830
               S TALI QGVLN+ASAGILIYM+LVDLLAADFM PK+Q+N  LQ+  H++L++GAG M
Sbjct  273   ESSPTALIVQGVLNAASAGILIYMSLVDLLAADFMPPKMQSNTGLQIMAHIALLIGAGLM  332

Query  1831  SVLAMWA  1851
             S+LA WA
Sbjct  333   SLLAKWA  339



>ref|XP_003542170.1| PREDICTED: zinc transporter 8-like isoform X1 [Glycine max]
Length=347

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 179/347 (52%), Positives = 238/347 (69%), Gaps = 22/347 (6%)
 Frame = +1

Query  811   SECTCNGNVEGQLHYSSKETLVTVDSLKYRLVAIASILVAGAAGVSIPLLARKYEFLGPE  990
             +ECTC+   E Q    SK       +L+Y++ A+ SILVA A GV IPLL +    L PE
Sbjct  23    AECTCDE--EDQERDKSK-------ALRYKIAALISILVASAIGVCIPLLGKVIPALSPE  73

Query  991   KDIFFMIKAFAAGVILSTGFVHILPDAFQTLTSPLLKDTNPWAKFPFSGLIALTASIATL  1170
             K+IFF+IKAFAAGVIL+TGF+HILPDAF+ LTSP L +  PW  FPF+G +A+  ++ TL
Sbjct  74    KNIFFIIKAFAAGVILATGFIHILPDAFENLTSPCL-NKYPWDAFPFTGFVAMCTAMGTL  132

Query  1171  MVDTLAMSFFRKKMMHFDKTKLPQVSadeeeakdaaaadhmhrhgaaaaaVYLDPPPSNN  1350
             MV+T A ++F+K   H  + +   V  +E                           PS++
Sbjct  133   MVETYATAYFKKH--HHSQVQTTYVEKEESGDVHLHTHATHGHAHGHL--------PSHD  182

Query  1351  ELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCLGTSQTRETIRPLLVALSFHQFFEGMGL  1530
                  S  +R RV+SQVLELGI+VHS+IIG+ +G S++ +TIRPL+ AL+FHQFFEGMGL
Sbjct  183   H--QSSALLRHRVISQVLELGIIVHSIIIGISMGASESPKTIRPLVAALTFHQFFEGMGL  240

Query  1531  GGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGIGISSVYNPHSSTALITQGVLNSASAGI  1710
             G CI QA F+ +S  +M +FF+LTTPVGI  GIGI++VY+ +S TALI +G+ N+ASAGI
Sbjct  241   GSCIIQANFQRLSITIMGLFFALTTPVGIGIGIGITNVYDENSPTALIVEGIFNAASAGI  300

Query  1711  LIYMALVDLLAADFMKPKIQNNVRLQLGGHVSLVLGAGSMSVLAMWA  1851
             LIYMALVDLLAADFM P++Q +  L+LG ++SL+LGAG MS+LA WA
Sbjct  301   LIYMALVDLLAADFMNPRMQKSGSLRLGANLSLLLGAGCMSLLAKWA  347



>ref|XP_007163951.1| hypothetical protein PHAVU_L002700g [Phaseolus vulgaris]
 gb|ESW35945.1| hypothetical protein PHAVU_L002700g [Phaseolus vulgaris]
Length=356

 Score =   299 bits (765),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 234/374 (63%), Gaps = 24/374 (6%)
 Frame = +1

Query  730   SLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVA  909
             +LF ++  F+I+             AES   CN   +               +L  +L+A
Sbjct  7     TLFKMIFVFFILFTLLTPQAVADCEAESANPCNNKKK---------------ALPLKLIA  51

Query  910   IASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTS  1089
             I +ILV+   GV++PL+ R    L PE D+F ++K FAAG+IL TGF+H+LPD+F  L S
Sbjct  52    IFTILVSSIIGVTLPLVTRSVPALSPENDLFIIVKCFAAGIILGTGFMHVLPDSFDMLWS  111

Query  1090  PLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeak  1269
               LK+  PW +FPFSGL+A+ +++ T+MVD+LA SF+ KK     +T++    +  E   
Sbjct  112   DCLKE-KPWHEFPFSGLVAMFSALITMMVDSLATSFYTKK----SRTEIIPAESSPEGGG  166

Query  1270  daaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCL  1449
             D      ++         + +  P   E    S  +R RVV+ VLELGIVVHSV+IGL L
Sbjct  167   DREMGSAVNFGHFHGHHHHSENKPEGQE----SQLLRYRVVAMVLELGIVVHSVVIGLGL  222

Query  1450  GTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGI  1629
             G S    TI+ L+ AL FHQ FEGMGLGGCI QA++K +  A+M  FFS+TTP GIA GI
Sbjct  223   GGSNNTCTIKGLIAALCFHQLFEGMGLGGCILQAQYKFLKKAIMVFFFSVTTPFGIALGI  282

Query  1630  GISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSL  1809
              +S+ Y  +S +ALIT G+LN++SAG+LIYMALVDLL+ADFM P++Q ++ LQL  ++++
Sbjct  283   ALSTTYKENSPSALITVGLLNASSAGLLIYMALVDLLSADFMSPRLQGSITLQLKSYLAV  342

Query  1810  VLGAGSMSVLAMWA  1851
              LGAG MS++A WA
Sbjct  343   FLGAGGMSLMAKWA  356



>gb|ACU22900.1| unknown [Glycine max]
Length=358

 Score =   298 bits (764),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 236/374 (63%), Gaps = 21/374 (6%)
 Frame = +1

Query  730   SLFNIVASFYIIIIFFPCAISGTAAAESECTCNGNVEGQLHYSSKETLVTVDSLKYRLVA  909
             +LF     F+II        +    AES+ +CN          +KE      +L  +++A
Sbjct  6     TLFKTTFVFFIIFTLLTHQATADCEAESKNSCN----------NKE-----KALPLKIIA  50

Query  910   IASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQTLTS  1089
             I +IL +   G+++PL+ R    L PE D+F ++K FAAG+IL TGF+H+LPD+F  L S
Sbjct  51    IFTILASSIIGITLPLVTRSVPALSPENDLFIIVKCFAAGIILGTGFMHVLPDSFAMLWS  110

Query  1090  PLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFFRKKMMHFDKTKLPQVSadeeeak  1269
               LK+  PW +FPFSGL+A+ ++I T+MVD+LA S + KK     +  +P  S+ E   +
Sbjct  111   DCLKE-KPWHEFPFSGLVAMFSAIITMMVDSLATSVYTKKCRTTSEV-VPGESSLEGGEE  168

Query  1270  daaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRIRQRVVSQVLELGIVVHSVIIGLCL  1449
             +         H       + +      E    S  +R RVV+ VLELGI+VHSV+IGL +
Sbjct  169   NLEMGAVNLGHFHGHHHAHHETKMDGKE----SQLLRYRVVAMVLELGIIVHSVVIGLGM  224

Query  1450  GTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPVGIATGI  1629
             G S    TIR L+ A+ FHQ FEGMGLGGCI QA++K +  A+M VFFS+TTP GIA GI
Sbjct  225   GASNNTCTIRGLIAAMCFHQMFEGMGLGGCILQAEYKFLKKAIMVVFFSITTPFGIALGI  284

Query  1630  GISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQLGGHVSL  1809
              +S+ Y  +S +ALIT G+LN++SAG+LIYMALVDLL+ADFM P++Q +++LQL  +V++
Sbjct  285   AMSTTYKENSPSALITVGLLNASSAGLLIYMALVDLLSADFMIPRLQGSIKLQLKSYVAV  344

Query  1810  VLGAGSMSVLAMWA  1851
              LGAG MS++A WA
Sbjct  345   FLGAGGMSLMAKWA  358



>ref|XP_010922625.1| PREDICTED: zinc transporter 8-like [Elaeis guineensis]
Length=349

 Score =   298 bits (763),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 169/320 (53%), Positives = 210/320 (66%), Gaps = 15/320 (5%)
 Frame = +1

Query  898   RLVAIASILVAGAAGVSIPLLARKYEFLGPEKDIFFMIKAFAAGVILSTGFVHILPDAFQ  1077
             ++ A  SILV GA GV +P+L++    L  E DIFF IKAFAA VIL+TGF+HILPDAF+
Sbjct  43    KIAAFFSILVCGAIGVCLPILSKSIPALSLENDIFFAIKAFAAVVILATGFIHILPDAFE  102

Query  1078  TLTSPLLKDTNPWAKFPFSGLIALTASIATLMVDTLAMSFF-RKKMMHFDKTKLPQVSad  1254
              LTS  L D NPW  FPF+G  A+  ++ TLMVDTLA S+F R      D+      +  
Sbjct  103   NLTSLCLND-NPWGNFPFAGFGAMLGALGTLMVDTLATSYFTRSARAVGDENNKGDAAMG  161

Query  1255  eeeakdaaaadhmhrhgaaaaaVYLDPPPSNNELVHLSDRI-RQRVVSQVLELGIVVHSV  1431
                                   V+     ++   V++SD++ R RV+S  LELGIVVHSV
Sbjct  162   GSAGDHHVVH------------VHATRGHAHGPTVYVSDKLERNRVISLELELGIVVHSV  209

Query  1432  IIGLCLGTSQTRETIRPLLVALSFHQFFEGMGLGGCIAQAKFKSVSTAVMAVFFSLTTPV  1611
             IIG+ LG S +  TI PL+ ALSFHQFFEGMGLGGCIAQAKFK  S A+M +FFSLTTPV
Sbjct  210   IIGISLGASDSPSTISPLVAALSFHQFFEGMGLGGCIAQAKFKIKSMAMMILFFSLTTPV  269

Query  1612  GIATGIGISSVYNPHSSTALITQGVLNSASAGILIYMALVDLLAADFMKPKIQNNVRLQL  1791
             G+A G GISSVYN +S   LI +G LNS + GILIYMALVDLL  +FM PK+Q+  +LQ 
Sbjct  270   GMAIGFGISSVYNKNSPITLIIKGCLNSVAIGILIYMALVDLLVEEFMNPKVQSKGKLQF  329

Query  1792  GGHVSLVLGAGSMSVLAMWA  1851
               +VSL++G   MS+LA WA
Sbjct  330   EINVSLLIGVYLMSLLAKWA  349



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6080211471996