BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78890_g1_i1 len=1923 path=[1901:0-1922]

Length=1923
                                                                      Score     E

ref|XP_006342818.1|  PREDICTED: MATE efflux family protein 5-like       690   0.0      
ref|XP_004229255.1|  PREDICTED: MATE efflux family protein 5            685   0.0      
ref|XP_009613536.1|  PREDICTED: MATE efflux family protein 5            677   0.0      
ref|XP_009786134.1|  PREDICTED: MATE efflux family protein 5            677   0.0      
ref|XP_002516950.1|  multidrug resistance pump, putative                635   0.0      Ricinus communis
ref|XP_002270564.1|  PREDICTED: MATE efflux family protein 5            631   0.0      Vitis vinifera
emb|CAN68577.1|  hypothetical protein VITISV_019282                     628   0.0      Vitis vinifera
emb|CDO98843.1|  unnamed protein product                                622   0.0      
ref|XP_011090997.1|  PREDICTED: MATE efflux family protein 5            619   0.0      
gb|KDO71733.1|  hypothetical protein CISIN_1g045328mg                   603   0.0      
gb|KDP27821.1|  hypothetical protein JCGZ_18901                         600   0.0      
ref|XP_006419528.1|  hypothetical protein CICLE_v10004811mg             600   0.0      
ref|XP_007035636.1|  Multidrug and toxin extrusion protein 1            598   0.0      
ref|XP_011011677.1|  PREDICTED: MATE efflux family protein 5            597   0.0      
ref|XP_002314374.2|  hypothetical protein POPTR_0010s01500g             580   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003547384.1|  PREDICTED: MATE efflux family protein 5-like       567   0.0      
ref|XP_003528633.1|  PREDICTED: MATE efflux family protein 5-like       560   0.0      
ref|XP_008458412.1|  PREDICTED: MATE efflux family protein 5 isof...    560   0.0      
ref|XP_004487832.1|  PREDICTED: MATE efflux family protein 5-like       558   0.0      
ref|XP_003550540.1|  PREDICTED: MATE efflux family protein 5-like       557   0.0      
ref|XP_004296859.1|  PREDICTED: multidrug and toxin extrusion pro...    557   0.0      
gb|KHN20777.1|  MATE efflux family protein DTX1                         554   0.0      
ref|XP_010269642.1|  PREDICTED: MATE efflux family protein 5-like       555   0.0      
ref|XP_004150498.1|  PREDICTED: MATE efflux family protein 7-like       554   0.0      
gb|KHN02952.1|  Multidrug and toxin extrusion protein 1                 553   0.0      
ref|XP_003534841.1|  PREDICTED: MATE efflux family protein 5-like       555   0.0      
ref|XP_008458413.1|  PREDICTED: MATE efflux family protein 5 isof...    553   0.0      
ref|XP_010105142.1|  MATE efflux family protein 9                       553   0.0      
ref|XP_007138932.1|  hypothetical protein PHAVU_009G250100g             552   0.0      
ref|XP_004170014.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    552   0.0      
gb|KHN03347.1|  Multidrug and toxin extrusion protein 1                 549   0.0      
ref|XP_007154295.1|  hypothetical protein PHAVU_003G106500g             550   0.0      
gb|KHN26536.1|  MATE efflux family protein DTX1                         547   0.0      
gb|KEH37206.1|  MATE efflux family protein                              546   0.0      
ref|XP_010679100.1|  PREDICTED: MATE efflux family protein 5            544   0.0      
ref|XP_010024720.1|  PREDICTED: MATE efflux family protein 5            540   0.0      
ref|XP_010259729.1|  PREDICTED: MATE efflux family protein 5            539   0.0      
gb|EPS72185.1|  hypothetical protein M569_02572                         534   0.0      
ref|XP_002863962.1|  predicted protein                                  535   0.0      
ref|XP_008223218.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    534   2e-180   
emb|CDY00039.1|  BnaC09g02620D                                          530   5e-179   
emb|CDX86253.1|  BnaA06g29700D                                          527   6e-178   
ref|NP_199724.1|  MATE efflux family protein                            527   9e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151712.1|  PREDICTED: MATE efflux family protein 5            525   5e-177   
emb|CDY67295.1|  BnaA09g52270D                                          523   2e-176   
ref|XP_009111866.1|  PREDICTED: MATE efflux family protein 5-like...    523   3e-176   
ref|XP_009111865.1|  PREDICTED: MATE efflux family protein 5-like...    522   7e-176   
emb|CDX85394.1|  BnaC07g27050D                                          520   3e-175   
ref|XP_007227723.1|  hypothetical protein PRUPE_ppa004410mg             516   2e-173   
ref|XP_006395092.1|  hypothetical protein EUTSA_v10004047mg             513   4e-172   
ref|XP_009352294.1|  PREDICTED: MATE efflux family protein 5            512   6e-172   
ref|XP_008340791.1|  PREDICTED: MATE efflux family protein 5            507   7e-170   
gb|KCW61189.1|  hypothetical protein EUGRSUZ_H03952                     505   8e-170   
ref|XP_008360270.1|  PREDICTED: MATE efflux family protein 5-like       505   3e-169   
ref|XP_008351187.1|  PREDICTED: MATE efflux family protein 5-like       504   7e-169   
ref|XP_006280346.1|  hypothetical protein CARUB_v10026273mg             498   2e-166   
ref|XP_010440139.1|  PREDICTED: MATE efflux family protein 5-like       497   4e-166   
ref|XP_010547013.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    492   2e-164   
gb|KFK26571.1|  hypothetical protein AALP_AA8G266100                    487   4e-162   
ref|XP_010442364.1|  PREDICTED: MATE efflux family protein 5-like       485   2e-161   
ref|XP_010914483.1|  PREDICTED: MATE efflux family protein 5            475   9e-158   
ref|XP_008775990.1|  PREDICTED: MATE efflux family protein 5            464   2e-153   
ref|XP_009393204.1|  PREDICTED: MATE efflux family protein 5            451   1e-148   
ref|XP_010524719.1|  PREDICTED: MATE efflux family protein 5-like       442   2e-144   
ref|XP_006859201.1|  hypothetical protein AMTR_s00070p00181900          429   1e-139   
ref|XP_001769309.1|  predicted protein                                  426   4e-139   
ref|XP_002985441.1|  hypothetical protein SELMODRAFT_446267             415   4e-134   
ref|XP_002979778.1|  hypothetical protein SELMODRAFT_111626             413   1e-133   
ref|XP_010256297.1|  PREDICTED: MATE efflux family protein 5            413   2e-133   
emb|CDX72839.1|  BnaC06g32870D                                          412   3e-133   
ref|XP_001777255.1|  predicted protein                                  410   1e-132   
ref|XP_010247682.1|  PREDICTED: MATE efflux family protein 5-like       410   3e-132   
ref|XP_010674324.1|  PREDICTED: MATE efflux family protein 5            409   9e-132   
emb|CDY03676.1|  BnaA02g15610D                                          408   2e-131   
ref|XP_008361957.1|  PREDICTED: MATE efflux family protein DTX1-like    404   2e-131   
emb|CDY37931.1|  BnaC02g20800D                                          407   4e-131   
gb|KFK31447.1|  hypothetical protein AALP_AA6G113000                    405   1e-130   
ref|XP_006302154.1|  hypothetical protein CARUB_v10020163mg             405   3e-130   
ref|XP_010415902.1|  PREDICTED: MATE efflux family protein 5-like...    405   3e-130   
ref|XP_010428035.1|  PREDICTED: MATE efflux family protein 5-like       404   5e-130   
gb|KEH26072.1|  MATE efflux family protein                              404   6e-130   
ref|XP_009127878.1|  PREDICTED: MATE efflux family protein 5-like       404   8e-130   
ref|XP_009105850.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    404   2e-129   
ref|XP_006390732.1|  hypothetical protein EUTSA_v10018419mg             402   6e-129   
ref|XP_010939303.1|  PREDICTED: MATE efflux family protein 5-like       402   2e-128   
gb|KEH26071.1|  MATE efflux family protein                              400   3e-128   
ref|NP_177332.1|  MATE efflux family protein                            399   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009620467.1|  PREDICTED: MATE efflux family protein DTX1-like    400   5e-128   
ref|XP_001770051.1|  predicted protein                                  400   8e-128   
ref|XP_002888851.1|  mate efflux family protein                         399   8e-128   
ref|XP_006340580.1|  PREDICTED: MATE efflux family protein 5-like       398   1e-127   
ref|XP_001758960.1|  predicted protein                                  396   1e-126   
ref|XP_004300756.1|  PREDICTED: MATE efflux family protein 8-like       394   3e-126   
ref|XP_010062021.1|  PREDICTED: MATE efflux family protein 5            394   4e-126   
ref|XP_006600090.1|  PREDICTED: multidrug and toxin extrusion pro...    395   4e-126   
ref|XP_010936249.1|  PREDICTED: MATE efflux family protein 5-like       395   6e-126   
ref|XP_004515105.1|  PREDICTED: MATE efflux family protein 5-like       394   7e-126   
ref|XP_009593168.1|  PREDICTED: MATE efflux family protein 5            393   7e-126   
ref|XP_004301437.1|  PREDICTED: multidrug and toxin extrusion pro...    395   8e-126   
ref|XP_010268640.1|  PREDICTED: MATE efflux family protein 5-like       395   8e-126   
gb|KHG30609.1|  MATE efflux family protein 9                            393   1e-125   
ref|XP_011076230.1|  PREDICTED: MATE efflux family protein DTX1         394   1e-125   
ref|XP_010061388.1|  PREDICTED: MATE efflux family protein 5            393   2e-125   
ref|XP_008234289.1|  PREDICTED: MATE efflux family protein LAL5         394   2e-125   
ref|XP_003615399.1|  Multidrug and toxin extrusion protein              394   3e-125   
dbj|BAJ96265.1|  predicted protein                                      391   3e-125   
ref|XP_007220655.1|  hypothetical protein PRUPE_ppa003689mg             393   4e-125   
ref|XP_010035093.1|  PREDICTED: MATE efflux family protein LAL5-like    393   4e-125   
gb|KHN31537.1|  Multidrug and toxin extrusion protein 1                 393   5e-125   
ref|XP_010107396.1|  Multidrug and toxin extrusion protein 2            392   7e-125   
ref|XP_008461457.1|  PREDICTED: MATE efflux family protein 5            390   8e-125   
ref|XP_008785753.1|  PREDICTED: MATE efflux family protein 5-like       392   9e-125   
ref|XP_009792677.1|  PREDICTED: MATE efflux family protein 5            390   1e-124   
ref|XP_007151906.1|  hypothetical protein PHAVU_004G085700g             390   1e-124   
ref|XP_008779545.1|  PREDICTED: MATE efflux family protein 5-like       392   2e-124   
ref|XP_006599450.1|  PREDICTED: MATE efflux family protein 5-like...    389   3e-124   
gb|KDP41539.1|  hypothetical protein JCGZ_15946                         390   4e-124   
ref|XP_002510003.1|  multidrug resistance pump, putative                390   4e-124   Ricinus communis
ref|XP_011030028.1|  PREDICTED: MATE efflux family protein LAL5         390   7e-124   
ref|XP_010695442.1|  PREDICTED: MATE efflux family protein 5            390   1e-123   
ref|XP_006587359.1|  PREDICTED: multidrug and toxin extrusion pro...    387   1e-123   
ref|XP_002322435.2|  hypothetical protein POPTR_0015s13900g             389   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_004513681.1|  PREDICTED: multidrug and toxin extrusion pro...    389   1e-123   
ref|XP_004139701.1|  PREDICTED: multidrug and toxin extrusion pro...    387   2e-123   
ref|XP_004501069.1|  PREDICTED: MATE efflux family protein 5-like       389   2e-123   
ref|XP_004143992.1|  PREDICTED: MATE efflux family protein 6-like       386   2e-123   
emb|CAN77415.1|  hypothetical protein VITISV_000475                     388   2e-123   Vitis vinifera
ref|XP_002283609.2|  PREDICTED: MATE efflux family protein 5            389   3e-123   Vitis vinifera
ref|XP_007152342.1|  hypothetical protein PHAVU_004G121900g             389   3e-123   
ref|XP_006574768.1|  PREDICTED: MATE efflux family protein 5-like...    387   3e-123   
ref|XP_004496604.1|  PREDICTED: multidrug and toxin extrusion pro...    388   3e-123   
ref|XP_011081156.1|  PREDICTED: MATE efflux family protein 5            387   3e-123   
ref|XP_011099184.1|  PREDICTED: MATE efflux family protein 5            386   3e-123   
ref|XP_008444968.1|  PREDICTED: MATE efflux family protein 5            389   3e-123   
emb|CDP09810.1|  unnamed protein product                                387   4e-123   
ref|XP_010933890.1|  PREDICTED: MATE efflux family protein 5-like       388   4e-123   
ref|XP_009798743.1|  PREDICTED: MATE efflux family protein DTX1-like    387   5e-123   
ref|XP_010521129.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    385   5e-123   
ref|XP_010471203.1|  PREDICTED: MATE efflux family protein 5-like       385   7e-123   
gb|KGN50143.1|  hypothetical protein Csa_5G155540                       387   8e-123   
ref|XP_004165956.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    387   9e-123   
gb|KHN40254.1|  Multidrug and toxin extrusion protein 1                 388   9e-123   
ref|XP_010053335.1|  PREDICTED: MATE efflux family protein LAL5-like    385   1e-122   
emb|CBI19327.3|  unnamed protein product                                387   1e-122   
ref|XP_008219166.1|  PREDICTED: MATE efflux family protein 5            387   1e-122   
ref|XP_009341257.1|  PREDICTED: MATE efflux family protein LAL5-l...    386   2e-122   
ref|XP_009344271.1|  PREDICTED: MATE efflux family protein 5-like       385   2e-122   
ref|XP_009796993.1|  PREDICTED: MATE efflux family protein 5-like       385   2e-122   
ref|XP_009341256.1|  PREDICTED: MATE efflux family protein LAL5-l...    387   2e-122   
ref|XP_009623490.1|  PREDICTED: MATE efflux family protein 5-like       385   2e-122   
ref|XP_009377927.1|  PREDICTED: MATE efflux family protein 5-like       385   2e-122   
ref|XP_008238780.1|  PREDICTED: MATE efflux family protein LAL5-like    384   2e-122   
ref|XP_007020248.1|  MATE efflux family protein                         384   3e-122   
gb|KEH17144.1|  MATE efflux family protein                              385   3e-122   
ref|XP_008354220.1|  PREDICTED: MATE efflux family protein LAL5-like    386   3e-122   
ref|XP_008369500.1|  PREDICTED: MATE efflux family protein 5            384   4e-122   
ref|XP_009600301.1|  PREDICTED: MATE efflux family protein 5-like       385   4e-122   
ref|XP_004490498.1|  PREDICTED: MATE efflux family protein 5-like...    385   5e-122   
ref|XP_010548775.1|  PREDICTED: MATE efflux family protein 5-like       384   5e-122   
ref|XP_010061582.1|  PREDICTED: MATE efflux family protein 5            385   5e-122   
ref|XP_006434640.1|  hypothetical protein CICLE_v10000855mg             384   5e-122   
ref|XP_011033802.1|  PREDICTED: MATE efflux family protein LAL5-like    384   6e-122   
gb|KCW46389.1|  hypothetical protein EUGRSUZ_K00224                     381   8e-122   
ref|XP_002303561.2|  hypothetical protein POPTR_0003s12140g             384   1e-121   Populus trichocarpa [western balsam poplar]
ref|XP_002274808.1|  PREDICTED: MATE efflux family protein 6            384   1e-121   Vitis vinifera
ref|XP_004490499.1|  PREDICTED: MATE efflux family protein 5-like...    383   1e-121   
ref|XP_007155701.1|  hypothetical protein PHAVU_003G223900g             384   2e-121   
ref|XP_004238041.1|  PREDICTED: MATE efflux family protein 5            384   2e-121   
ref|XP_007038589.1|  MATE efflux family protein                         384   2e-121   
ref|XP_006473222.1|  PREDICTED: MATE efflux family protein 5-like       382   2e-121   
ref|XP_002318258.2|  hypothetical protein POPTR_0012s13930g             379   3e-121   Populus trichocarpa [western balsam poplar]
ref|XP_010553670.1|  PREDICTED: MATE efflux family protein 5-like       382   4e-121   
gb|KGN62780.1|  hypothetical protein Csa_2G372760                       384   4e-121   
ref|XP_003555370.1|  PREDICTED: MATE efflux family protein 5-like       383   4e-121   
gb|KCW68566.1|  hypothetical protein EUGRSUZ_F02179                     382   5e-121   
ref|XP_006421854.1|  hypothetical protein CICLE_v10007191mg             382   5e-121   
ref|XP_009619046.1|  PREDICTED: MATE efflux family protein LAL5-like    382   5e-121   
ref|XP_011038168.1|  PREDICTED: MATE efflux family protein 5            381   6e-121   
ref|XP_007210853.1|  hypothetical protein PRUPE_ppa015493mg             380   7e-121   
ref|XP_004292491.1|  PREDICTED: MATE efflux family protein 9-like       380   8e-121   
ref|XP_003592313.1|  Multidrug and toxin extrusion protein              382   9e-121   
ref|XP_010536256.1|  PREDICTED: multidrug and toxin extrusion pro...    380   1e-120   
ref|XP_010086543.1|  MATE efflux family protein LAL5                    382   1e-120   
ref|XP_006364986.1|  PREDICTED: MATE efflux family protein 5-like       382   1e-120   
ref|XP_006842445.1|  hypothetical protein AMTR_s00077p00047440          380   1e-120   
ref|XP_009339656.1|  PREDICTED: MATE efflux family protein 5-like       380   2e-120   
ref|XP_009364191.1|  PREDICTED: MATE efflux family protein 5-like       380   2e-120   
ref|XP_009371284.1|  PREDICTED: MATE efflux family protein LAL5-like    381   2e-120   
gb|AES73927.2|  MATE efflux family protein                              381   2e-120   
ref|XP_011041639.1|  PREDICTED: MATE efflux family protein LAL5-like    381   2e-120   
gb|KHN34999.1|  MATE efflux family protein 6                            379   3e-120   
gb|KHN02797.1|  MATE efflux family protein 9                            380   3e-120   
ref|XP_002267095.1|  PREDICTED: MATE efflux family protein 5            379   3e-120   Vitis vinifera
ref|XP_010316145.1|  PREDICTED: multidrug and toxin extrusion pro...    379   4e-120   
ref|XP_004232036.1|  PREDICTED: multidrug and toxin extrusion pro...    379   4e-120   
gb|KDP30286.1|  hypothetical protein JCGZ_17156                         379   4e-120   
ref|XP_009364190.1|  PREDICTED: MATE efflux family protein 5-like       380   5e-120   
ref|XP_007018359.1|  Multidrug and toxin extrusion protein 1            380   5e-120   
ref|NP_001170523.1|  putative MATE efflux family protein                380   6e-120   Zea mays [maize]
ref|XP_003538709.1|  PREDICTED: MATE efflux family protein 6-like       379   8e-120   
ref|XP_008437213.1|  PREDICTED: MATE efflux family protein 5            379   8e-120   
ref|XP_010271543.1|  PREDICTED: MATE efflux family protein 5-like       379   8e-120   
ref|XP_009765487.1|  PREDICTED: MATE efflux family protein 5            379   9e-120   
ref|XP_008376528.1|  PREDICTED: MATE efflux family protein LAL5-like    379   1e-119   
ref|XP_008365847.1|  PREDICTED: MATE efflux family protein 9-like       377   1e-119   
ref|XP_003535626.1|  PREDICTED: MATE efflux family protein 5-like       378   2e-119   
ref|XP_006433714.1|  hypothetical protein CICLE_v10000751mg             379   2e-119   
ref|XP_008663473.1|  PREDICTED: MATE efflux family protein 5-like       379   2e-119   
ref|XP_002509706.1|  multidrug resistance pump, putative                378   2e-119   Ricinus communis
ref|XP_006652664.1|  PREDICTED: MATE efflux family protein 9-like       379   2e-119   
ref|NP_001053606.2|  Os04g0571600                                       378   3e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009400058.1|  PREDICTED: MATE efflux family protein 5-like       378   4e-119   
ref|XP_009628917.1|  PREDICTED: MATE efflux family protein 5-like       377   4e-119   
ref|XP_009786207.1|  PREDICTED: MATE efflux family protein LAL5-like    377   4e-119   
ref|XP_004511602.1|  PREDICTED: MATE efflux family protein 5-like       377   4e-119   
emb|CDP20804.1|  unnamed protein product                                375   4e-119   
ref|XP_003611148.1|  Multidrug and toxin extrusion protein              377   5e-119   
ref|XP_011074913.1|  PREDICTED: MATE efflux family protein 5-like       375   5e-119   
ref|XP_004140853.1|  PREDICTED: multidrug and toxin extrusion pro...    375   7e-119   
ref|XP_006840487.1|  hypothetical protein AMTR_s00045p00191740          375   7e-119   
ref|XP_009387104.1|  PREDICTED: MATE efflux family protein 5-like       376   8e-119   
gb|EAZ31690.1|  hypothetical protein OsJ_15838                          377   9e-119   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65920.1|  hypothetical protein M569_08857                         375   1e-118   
ref|XP_004173805.1|  PREDICTED: multidrug and toxin extrusion pro...    375   1e-118   
ref|XP_009615001.1|  PREDICTED: MATE efflux family protein 5            376   1e-118   
ref|XP_002326006.2|  hypothetical protein POPTR_0019s11600g             374   2e-118   Populus trichocarpa [western balsam poplar]
gb|KHN39984.1|  Multidrug and toxin extrusion protein 1                 376   2e-118   
ref|XP_009389312.1|  PREDICTED: MATE efflux family protein LAL5-like    375   2e-118   
ref|XP_008381014.1|  PREDICTED: MATE efflux family protein 5            374   2e-118   
gb|KCW90739.1|  hypothetical protein EUGRSUZ_A02813                     372   3e-118   
ref|XP_002981285.1|  hypothetical protein SELMODRAFT_53188              372   3e-118   
ref|XP_007040126.1|  MATE efflux family protein                         374   3e-118   
ref|XP_006472377.1|  PREDICTED: MATE efflux family protein 5-like       375   3e-118   
ref|XP_002969674.1|  hypothetical protein SELMODRAFT_63250              372   4e-118   
emb|CAH67053.1|  OSIGBa0127A14.5                                        375   5e-118   Oryza sativa [red rice]
ref|XP_008339010.1|  PREDICTED: MATE efflux family protein 5-like       375   5e-118   
ref|XP_011002496.1|  PREDICTED: MATE efflux family protein 5-like...    373   6e-118   
ref|XP_006353367.1|  PREDICTED: MATE efflux family protein 5-like       374   7e-118   
ref|XP_008439170.1|  PREDICTED: MATE efflux family protein LAL5         374   7e-118   
gb|KGN57343.1|  hypothetical protein Csa_3G180310                       374   8e-118   
ref|XP_009339076.1|  PREDICTED: MATE efflux family protein 5            372   9e-118   
ref|XP_003580355.1|  PREDICTED: MATE efflux family protein 5-like       375   1e-117   
emb|CDP21676.1|  unnamed protein product                                374   1e-117   
ref|XP_009764157.1|  PREDICTED: MATE efflux family protein 5-like       372   2e-117   
ref|XP_008378671.1|  PREDICTED: MATE efflux family protein 5-like       373   2e-117   
ref|XP_009412273.1|  PREDICTED: MATE efflux family protein 5-like       372   3e-117   
gb|EYU36423.1|  hypothetical protein MIMGU_mgv1a019568mg                373   3e-117   
ref|XP_002510841.1|  multidrug resistance pump, putative                373   3e-117   Ricinus communis
ref|XP_004240795.1|  PREDICTED: MATE efflux family protein 5-like       371   5e-117   
ref|XP_011074298.1|  PREDICTED: MATE efflux family protein 5            372   5e-117   
ref|XP_003516689.1|  PREDICTED: MATE efflux family protein 6-like       372   5e-117   
ref|XP_007158465.1|  hypothetical protein PHAVU_002G154600g             371   6e-117   
ref|XP_009357241.1|  PREDICTED: MATE efflux family protein 5-like       372   6e-117   
ref|XP_009603911.1|  PREDICTED: multidrug and toxin extrusion pro...    370   8e-117   
ref|XP_006376322.1|  MATE efflux family protein                         369   9e-117   
gb|EMS68526.1|  MATE efflux family protein 9                            372   1e-116   
ref|XP_002446957.1|  hypothetical protein SORBIDRAFT_06g025870          372   1e-116   Sorghum bicolor [broomcorn]
ref|XP_010444324.1|  PREDICTED: MATE efflux family protein 5-like       370   1e-116   
ref|XP_009401759.1|  PREDICTED: MATE efflux family protein 5            370   2e-116   
ref|XP_009335488.1|  PREDICTED: MATE efflux family protein 5-like       370   2e-116   
ref|XP_004234355.1|  PREDICTED: MATE efflux family protein 5            369   3e-116   
ref|XP_006351175.1|  PREDICTED: MATE efflux family protein 5-like...    368   5e-116   
ref|XP_007013017.1|  Multidrug and toxin extrusion protein 2            369   5e-116   
ref|XP_011016948.1|  PREDICTED: MATE efflux family protein 5            370   6e-116   
ref|XP_010519669.1|  PREDICTED: multidrug and toxin extrusion pro...    368   6e-116   
ref|XP_006358865.1|  PREDICTED: MATE efflux family protein DTX1-like    367   7e-116   
emb|CDY41255.1|  BnaA01g12840D                                          368   7e-116   
ref|XP_007141312.1|  hypothetical protein PHAVU_008G185200g             369   9e-116   
ref|XP_007201117.1|  hypothetical protein PRUPE_ppa021218mg             367   9e-116   
ref|XP_002301101.2|  MATE efflux family protein                         369   1e-115   Populus trichocarpa [western balsam poplar]
gb|EYU23942.1|  hypothetical protein MIMGU_mgv1a005197mg                367   1e-115   
ref|XP_009394090.1|  PREDICTED: MATE efflux family protein LAL5-like    367   1e-115   
ref|XP_009410677.1|  PREDICTED: MATE efflux family protein 5-like       366   2e-115   
ref|XP_002864149.1|  hypothetical protein ARALYDRAFT_495276             367   2e-115   
ref|XP_006477591.1|  PREDICTED: multidrug and toxin extrusion pro...    366   2e-115   
gb|EPS74212.1|  hypothetical protein M569_00540                         365   2e-115   
ref|XP_009411460.1|  PREDICTED: MATE efflux family protein 5-like       368   2e-115   
ref|XP_010278542.1|  PREDICTED: MATE efflux family protein 5-like       368   2e-115   
ref|XP_010312814.1|  PREDICTED: MATE efflux family protein 5            366   2e-115   
ref|XP_002514223.1|  multidrug resistance pump, putative                367   3e-115   
gb|EPS70572.1|  hypothetical protein M569_04188                         365   3e-115   
ref|XP_004976540.1|  PREDICTED: MATE efflux family protein 9-like       368   3e-115   
ref|XP_008783354.1|  PREDICTED: MATE efflux family protein 5            366   3e-115   
ref|XP_006339903.1|  PREDICTED: multidrug and toxin extrusion pro...    366   3e-115   
ref|XP_002454487.1|  hypothetical protein SORBIDRAFT_04g031980          368   4e-115   
ref|XP_008237330.1|  PREDICTED: MATE efflux family protein 5            366   4e-115   
ref|XP_009126384.1|  PREDICTED: multidrug and toxin extrusion pro...    366   4e-115   
ref|XP_010676553.1|  PREDICTED: MATE efflux family protein LAL5-like    366   4e-115   
emb|CDY42287.1|  BnaC02g08930D                                          365   5e-115   
ref|XP_010919223.1|  PREDICTED: MATE efflux family protein 5-like       367   5e-115   
ref|XP_007160282.1|  hypothetical protein PHAVU_002G308300g             365   5e-115   
ref|XP_009774724.1|  PREDICTED: multidrug and toxin extrusion pro...    365   5e-115   
gb|KHN19255.1|  MATE efflux family protein DTX1                         367   5e-115   
ref|XP_009385179.1|  PREDICTED: MATE efflux family protein LAL5-like    366   5e-115   
ref|XP_011043558.1|  PREDICTED: MATE efflux family protein 5-like       366   6e-115   
dbj|BAC42620.2|  putative integral membrane protein                     365   7e-115   
ref|XP_002523569.1|  multidrug resistance pump, putative                365   9e-115   
ref|NP_200018.1|  MATE efflux family protein                            365   9e-115   
gb|KHN25727.1|  MATE efflux family protein 6                            363   1e-114   
gb|KDO63568.1|  hypothetical protein CISIN_1g042512mg                   365   1e-114   
emb|CDY44936.1|  BnaA02g04410D                                          365   1e-114   
ref|XP_010482557.1|  PREDICTED: MATE efflux family protein 5-like       365   1e-114   
emb|CDY53130.1|  BnaC01g41400D                                          365   1e-114   
ref|XP_009136646.1|  PREDICTED: MATE efflux family protein 5            365   1e-114   
ref|XP_006859062.1|  hypothetical protein AMTR_s00068p00197570          364   1e-114   
ref|XP_010104547.1|  MATE efflux family protein 5                       367   1e-114   
ref|XP_010442726.1|  PREDICTED: MATE efflux family protein 5-like...    364   2e-114   
ref|XP_002276226.1|  PREDICTED: MATE efflux family protein 5-like       365   2e-114   
ref|XP_006440531.1|  hypothetical protein CICLE_v10019758mg             364   2e-114   
ref|XP_007155565.1|  hypothetical protein PHAVU_003G212600g             365   3e-114   
ref|XP_004246128.1|  PREDICTED: MATE efflux family protein 6-like       363   4e-114   
ref|XP_006289719.1|  hypothetical protein CARUB_v10003286mg             363   4e-114   
ref|XP_006280325.1|  hypothetical protein CARUB_v10026248mg             363   4e-114   
ref|XP_008242482.1|  PREDICTED: MATE efflux family protein 5            364   4e-114   
ref|XP_009404972.1|  PREDICTED: MATE efflux family protein 5-like       363   4e-114   
ref|XP_009113320.1|  PREDICTED: MATE efflux family protein 5            363   5e-114   
gb|EYU25058.1|  hypothetical protein MIMGU_mgv1a026738mg                361   6e-114   
ref|XP_010442727.1|  PREDICTED: multidrug and toxin extrusion pro...    362   7e-114   
ref|XP_009759894.1|  PREDICTED: MATE efflux family protein 5-like       362   9e-114   
ref|XP_006400532.1|  hypothetical protein EUTSA_v10013302mg             362   1e-113   
ref|XP_007204791.1|  hypothetical protein PRUPE_ppa017241mg             363   1e-113   
ref|XP_008795373.1|  PREDICTED: MATE efflux family protein 5-like       363   1e-113   
ref|XP_008646051.1|  PREDICTED: MATE efflux family protein 9-like       363   1e-113   
ref|XP_008387339.1|  PREDICTED: multidrug and toxin extrusion pro...    362   2e-113   
emb|CDY42050.1|  BnaC09g15370D                                          362   2e-113   
ref|XP_008450787.1|  PREDICTED: MATE efflux family protein 5-like       362   2e-113   
ref|XP_010925990.1|  PREDICTED: MATE efflux family protein 6-like       360   2e-113   
ref|XP_009405972.1|  PREDICTED: MATE efflux family protein 5-like       363   2e-113   
ref|XP_009625852.1|  PREDICTED: multidrug and toxin extrusion pro...    361   3e-113   
ref|XP_009780268.1|  PREDICTED: multidrug and toxin extrusion pro...    362   3e-113   
ref|XP_010688344.1|  PREDICTED: multidrug and toxin extrusion pro...    363   4e-113   
gb|KFK28869.1|  hypothetical protein AALP_AA7G059000                    360   4e-113   
gb|KEH27218.1|  MATE efflux family protein                              360   5e-113   
ref|XP_006358411.1|  PREDICTED: MATE efflux family protein 5-like       360   5e-113   
ref|NP_197471.1|  MATE efflux family protein                            360   5e-113   
emb|CDP03248.1|  unnamed protein product                                361   8e-113   
emb|CDY14218.1|  BnaA08g13490D                                          361   8e-113   
ref|XP_006857900.1|  hypothetical protein AMTR_s00069p00129640          360   9e-113   
ref|XP_011093635.1|  PREDICTED: MATE efflux family protein LAL5-like    361   1e-112   
ref|XP_010910980.1|  PREDICTED: MATE efflux family protein 5            359   1e-112   
ref|XP_003550878.1|  PREDICTED: MATE efflux family protein 5-like       360   2e-112   
ref|XP_009109050.1|  PREDICTED: MATE efflux family protein 5-like       360   2e-112   
ref|NP_001047724.1|  Os02g0676400                                       360   2e-112   
gb|KFK29476.1|  hypothetical protein AALP_AA7G138700                    360   2e-112   
ref|XP_009382944.1|  PREDICTED: MATE efflux family protein 5-like       359   2e-112   
gb|EAY87054.1|  hypothetical protein OsI_08452                          360   2e-112   
ref|XP_010656264.1|  PREDICTED: MATE efflux family protein 5            359   2e-112   
gb|EYU22869.1|  hypothetical protein MIMGU_mgv1a005206mg                358   2e-112   
ref|XP_004288895.1|  PREDICTED: multidrug and toxin extrusion pro...    360   2e-112   
ref|XP_003524407.1|  PREDICTED: multidrug and toxin extrusion pro...    358   2e-112   
ref|XP_006647679.1|  PREDICTED: MATE efflux family protein 9-like       360   3e-112   
ref|XP_009382291.1|  PREDICTED: MATE efflux family protein 5-like       359   3e-112   
emb|CDX91621.1|  BnaC02g15390D                                          358   4e-112   
ref|XP_002310147.2|  hypothetical protein POPTR_0007s11110g             358   4e-112   
ref|NP_194643.1|  putative MATE transport protein ADS1                  359   4e-112   
ref|XP_010493049.1|  PREDICTED: multidrug and toxin extrusion pro...    358   4e-112   
ref|XP_002873960.1|  hypothetical protein ARALYDRAFT_910007             358   5e-112   
ref|XP_010249483.1|  PREDICTED: MATE efflux family protein 5-like       358   6e-112   
ref|XP_003525539.2|  PREDICTED: MATE efflux family protein 5-like       358   7e-112   
ref|XP_009127259.1|  PREDICTED: MATE efflux family protein DTX1-like    357   7e-112   
ref|XP_009352559.1|  PREDICTED: multidrug and toxin extrusion pro...    357   7e-112   
gb|KDP33803.1|  hypothetical protein JCGZ_07374                         358   8e-112   
emb|CDX92508.1|  BnaA10g15470D                                          357   8e-112   
ref|XP_009352558.1|  PREDICTED: multidrug and toxin extrusion pro...    357   1e-111   
ref|XP_006412876.1|  hypothetical protein EUTSA_v10024865mg             358   1e-111   
ref|XP_006475598.1|  PREDICTED: multidrug and toxin extrusion pro...    357   2e-111   
emb|CDY67118.1|  BnaC09g54330D                                          356   2e-111   
ref|XP_010470264.1|  PREDICTED: MATE efflux family protein 7-like       357   3e-111   
ref|XP_004513054.1|  PREDICTED: multidrug and toxin extrusion pro...    355   3e-111   
ref|XP_010454256.1|  PREDICTED: multidrug and toxin extrusion pro...    355   3e-111   
emb|CDY65506.1|  BnaCnng47370D                                          355   3e-111   
gb|KFK40898.1|  hypothetical protein AALP_AA2G057700                    356   4e-111   
ref|XP_004516053.1|  PREDICTED: multidrug and toxin extrusion pro...    355   4e-111   
ref|XP_009120863.1|  PREDICTED: MATE efflux family protein 5            355   4e-111   
ref|XP_006392202.1|  hypothetical protein EUTSA_v10024168mg             356   4e-111   
ref|XP_010420784.1|  PREDICTED: multidrug and toxin extrusion pro...    355   4e-111   
ref|XP_004953434.1|  PREDICTED: MATE efflux family protein 9-like       357   5e-111   
ref|NP_564731.1|  MATE family protein ZRIZ1                             355   7e-111   
ref|XP_010433131.1|  PREDICTED: MATE efflux family protein 5-like       355   8e-111   
ref|XP_010511083.1|  PREDICTED: MATE efflux family protein 7-like       355   8e-111   
dbj|BAD43969.1|  putative protein                                       355   1e-110   
ref|XP_004244600.1|  PREDICTED: MATE efflux family protein 5-like       354   1e-110   
ref|XP_002869450.1|  hypothetical protein ARALYDRAFT_913597             355   1e-110   
ref|XP_006283510.1|  hypothetical protein CARUB_v10004563mg             355   2e-110   
ref|XP_010414741.1|  PREDICTED: MATE efflux family protein 7-like       355   2e-110   
gb|KDO66595.1|  hypothetical protein CISIN_1g009588mg                   354   2e-110   
ref|XP_007047235.1|  Multidrug resistance pump, putative                354   2e-110   
ref|XP_006401870.1|  hypothetical protein EUTSA_v10015455mg             353   2e-110   
ref|XP_008337604.1|  PREDICTED: MATE efflux family protein 6-like       354   2e-110   
ref|XP_003572811.1|  PREDICTED: MATE efflux family protein 9-like       355   3e-110   
ref|XP_006284940.1|  hypothetical protein CARUB_v10006239mg             353   3e-110   
ref|XP_010438335.1|  PREDICTED: MATE efflux family protein 5-like       354   3e-110   
ref|XP_004157307.1|  PREDICTED: multidrug and toxin extrusion pro...    353   5e-110   
gb|EMT29118.1|  Multidrug and toxin extrusion protein 1                 355   5e-110   
ref|XP_010263570.1|  PREDICTED: multidrug and toxin extrusion pro...    352   5e-110   
ref|XP_006413586.1|  hypothetical protein EUTSA_v10024949mg             352   6e-110   
ref|XP_009415321.1|  PREDICTED: MATE efflux family protein 5-like       353   6e-110   
ref|XP_009351404.1|  PREDICTED: multidrug and toxin extrusion pro...    350   6e-110   
ref|XP_002888219.1|  hypothetical protein ARALYDRAFT_893660             353   9e-110   
gb|EAY83460.1|  hypothetical protein OsI_38671                          351   1e-109   
ref|XP_004135806.1|  PREDICTED: multidrug and toxin extrusion pro...    351   1e-109   
ref|XP_008803288.1|  PREDICTED: MATE efflux family protein 5-like       350   2e-109   
ref|XP_008781774.1|  PREDICTED: MATE efflux family protein DTX1-like    352   2e-109   
ref|XP_003527862.1|  PREDICTED: MATE efflux family protein 5-like       352   3e-109   
ref|XP_002466128.1|  hypothetical protein SORBIDRAFT_01g001900          351   3e-109   
gb|KFK26810.1|  hypothetical protein AALP_AA8G296500                    350   4e-109   
ref|XP_003630706.1|  Multidrug and toxin extrusion protein              348   4e-109   
ref|XP_010536483.1|  PREDICTED: MATE efflux family protein 5            350   7e-109   
gb|KDP31922.1|  hypothetical protein JCGZ_12383                         350   7e-109   
ref|XP_010270081.1|  PREDICTED: multidrug and toxin extrusion pro...    349   2e-108   
ref|XP_006451313.1|  hypothetical protein CICLE_v10008296mg             346   3e-108   
ref|XP_003523763.1|  PREDICTED: MATE efflux family protein 5-like       348   4e-108   
ref|XP_007137291.1|  hypothetical protein PHAVU_009G114900g             348   8e-108   
emb|CDP02490.1|  unnamed protein product                                347   8e-108   
ref|XP_010252086.1|  PREDICTED: MATE efflux family protein LAL5-like    347   9e-108   
ref|XP_007011338.1|  MATE efflux family protein isoform 1               347   1e-107   
ref|XP_003532472.1|  PREDICTED: multidrug and toxin extrusion pro...    346   1e-107   
ref|XP_010921552.1|  PREDICTED: MATE efflux family protein LAL5         346   2e-107   
ref|XP_010094848.1|  Multidrug and toxin extrusion protein 1            346   3e-107   
ref|XP_010555652.1|  PREDICTED: MATE efflux family protein 9-like       345   4e-107   
ref|XP_004515891.1|  PREDICTED: MATE efflux family protein 5-like       345   5e-107   
ref|XP_010253821.1|  PREDICTED: MATE efflux family protein 5            345   5e-107   
gb|KHG20829.1|  Multidrug and toxin extrusion 1                         345   7e-107   
ref|XP_002277534.2|  PREDICTED: MATE efflux family protein 5            344   1e-106   
ref|XP_006852723.1|  hypothetical protein AMTR_s00033p00071400          343   2e-106   
ref|XP_007011339.1|  MATE efflux family protein isoform 2               341   2e-106   
ref|XP_009137829.1|  PREDICTED: MATE efflux family protein 5-like       344   2e-106   
ref|XP_008657622.1|  PREDICTED: MATE efflux family protein 5            343   2e-106   
emb|CBI21435.3|  unnamed protein product                                344   3e-106   
ref|XP_010448784.1|  PREDICTED: MATE efflux family protein LAL5-like    343   3e-106   
ref|XP_010529544.1|  PREDICTED: MATE efflux family protein 5            342   5e-106   
ref|NP_194034.1|  MATE efflux family protein                            342   5e-106   
emb|CDY06833.1|  BnaC01g09320D                                          343   5e-106   
ref|XP_010526432.1|  PREDICTED: MATE efflux family protein 5-like       343   8e-106   
ref|XP_010693502.1|  PREDICTED: MATE efflux family protein 9-like       344   8e-106   
ref|XP_010242557.1|  PREDICTED: MATE efflux family protein 6-like       341   1e-105   
ref|XP_010267127.1|  PREDICTED: multidrug and toxin extrusion pro...    342   1e-105   
ref|XP_009128977.1|  PREDICTED: MATE efflux family protein 5-like       342   2e-105   
tpg|DAA46004.1|  TPA: putative MATE efflux family protein               342   2e-105   
gb|KCW88330.1|  hypothetical protein EUGRSUZ_A00719                     339   3e-105   
ref|XP_009132561.1|  PREDICTED: MATE efflux family protein 5            340   3e-105   
emb|CDP05245.1|  unnamed protein product                                340   4e-105   
ref|XP_009402775.1|  PREDICTED: MATE efflux family protein LAL5         339   6e-105   
ref|XP_004305086.1|  PREDICTED: multidrug and toxin extrusion pro...    340   8e-105   
ref|XP_004981115.1|  PREDICTED: MATE efflux family protein 5-like       338   9e-105   
gb|EAY92507.1|  hypothetical protein OsI_14245                          339   1e-104   
gb|AAO41129.1|  putative MATE efflux membrane protein                   338   2e-104   
ref|XP_002532864.1|  multidrug resistance pump, putative                337   2e-104   
emb|CDY38893.1|  BnaA03g12860D                                          338   2e-104   
gb|EYU44392.1|  hypothetical protein MIMGU_mgv1a021539mg                337   2e-104   
emb|CAN77541.1|  hypothetical protein VITISV_021602                     338   2e-104   
gb|KDP25510.1|  hypothetical protein JCGZ_20666                         335   2e-104   
ref|XP_010043120.1|  PREDICTED: MATE efflux family protein 6-like       339   3e-104   
emb|CDY47785.1|  BnaC07g41750D                                          338   4e-104   
ref|XP_004974080.1|  PREDICTED: MATE efflux family protein 5-like       337   7e-104   
gb|EYU35220.1|  hypothetical protein MIMGU_mgv1a023873mg                335   8e-104   
ref|XP_010439241.1|  PREDICTED: MATE efflux family protein LAL5-like    335   2e-103   
dbj|BAK03584.1|  predicted protein                                      336   2e-103   
ref|XP_002275181.2|  PREDICTED: MATE efflux family protein DTX1 i...    333   4e-103   
emb|CDX96356.1|  BnaA07g29670D                                          330   4e-103   
ref|XP_009106804.1|  PREDICTED: multidrug and toxin extrusion pro...    335   4e-103   
ref|XP_010666625.1|  PREDICTED: MATE efflux family protein 5-like       334   1e-102   
ref|XP_010255527.1|  PREDICTED: MATE efflux family protein 9-like       335   1e-102   
ref|XP_006845801.1|  hypothetical protein AMTR_s00019p00255670          334   2e-102   
ref|XP_008794104.1|  PREDICTED: MATE efflux family protein 5-like       334   2e-102   
ref|XP_003605273.1|  Multidrug and toxin extrusion protein              335   3e-102   
ref|XP_008798548.1|  PREDICTED: LOW QUALITY PROTEIN: MATE efflux ...    332   4e-102   
emb|CBI34748.3|  unnamed protein product                                332   4e-102   
ref|XP_011008753.1|  PREDICTED: MATE efflux family protein 6            333   4e-102   
ref|XP_002978667.1|  hypothetical protein SELMODRAFT_109192             332   4e-102   
ref|XP_002323066.2|  MATE efflux family protein                         331   4e-102   
ref|XP_010683521.1|  PREDICTED: MATE efflux family protein 5            332   5e-102   
ref|XP_009398732.1|  PREDICTED: MATE efflux family protein 5-like       332   7e-102   
gb|AES87470.2|  MATE efflux family protein                              335   8e-102   
ref|XP_002984600.1|  hypothetical protein SELMODRAFT_120748             331   8e-102   
ref|XP_002467627.1|  hypothetical protein SORBIDRAFT_01g031150          333   1e-101   
tpg|DAA48363.1|  TPA: putative MATE efflux family protein               331   1e-101   
ref|XP_002869794.1|  predicted protein                                  330   1e-101   
ref|XP_003551612.2|  PREDICTED: MATE efflux family protein 9-like       330   1e-101   
ref|XP_009375700.1|  PREDICTED: multidrug and toxin extrusion pro...    331   2e-101   
ref|XP_010910775.1|  PREDICTED: MATE efflux family protein 6-like       330   3e-101   
emb|CDY30234.1|  BnaA03g49360D                                          330   4e-101   
ref|XP_008338305.1|  PREDICTED: multidrug and toxin extrusion pro...    329   6e-101   
ref|XP_007140094.1|  hypothetical protein PHAVU_008G083800g             329   6e-101   
emb|CBI18048.3|  unnamed protein product                                326   6e-101   
ref|XP_004289222.1|  PREDICTED: uncharacterized transporter C4B3....    330   6e-101   
ref|XP_007152968.1|  hypothetical protein PHAVU_004G175400g             328   7e-101   
ref|XP_009405226.1|  PREDICTED: MATE efflux family protein 6-like       331   7e-101   
ref|XP_008458946.1|  PREDICTED: multidrug and toxin extrusion pro...    329   7e-101   
ref|XP_003533662.2|  PREDICTED: MATE efflux family protein 9-like       330   9e-101   
ref|XP_002267054.1|  PREDICTED: MATE efflux family protein DTX1         328   1e-100   
ref|NP_001168821.1|  uncharacterized protein LOC100382626               327   2e-100   
ref|XP_011084832.1|  PREDICTED: multidrug and toxin extrusion pro...    327   3e-100   
ref|XP_004506446.1|  PREDICTED: MATE efflux family protein DTX1-like    328   7e-100   
ref|XP_009421432.1|  PREDICTED: MATE efflux family protein 5-like       327   1e-99    
emb|CBI25357.3|  unnamed protein product                                322   2e-99    
ref|XP_004157950.1|  PREDICTED: multidrug and toxin extrusion pro...    323   3e-99    
ref|XP_008388882.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    323   4e-99    
ref|XP_006481176.1|  PREDICTED: multidrug and toxin extrusion pro...    323   6e-99    
ref|XP_002444635.1|  hypothetical protein SORBIDRAFT_07g025190          324   7e-99    



>ref|XP_006342818.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=495

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/495 (76%), Positives = 426/495 (86%), Gaps = 4/495 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             MAA+Q +KH T+PEV EEL+K+ID  FP++AMGL +Y+KNMILVVCMGRLGSLELAGGAL
Sbjct  1     MAAEQIKKHPTLPEVKEELKKIIDRGFPILAMGLATYLKNMILVVCMGRLGSLELAGGAL  60

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLALGMEP+SSQAFGS+NLT+VSL LQRTI MLL AS+PI  LWFN
Sbjct  61    AIGFTNITGYSVLSGLALGMEPLSSQAFGSRNLTLVSLALQRTIFMLLTASIPIAFLWFN  120

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
              + LML LHQD++IIH+AS+FC+FA+PDL+ANS LHPLRIYLRCKGTTWPLLW T +ATM
Sbjct  121   FESLMLKLHQDSQIIHVASVFCRFAVPDLIANSFLHPLRIYLRCKGTTWPLLWCTSLATM  180

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK--  1040
             LH PI  YLTF+L LGIQGIAISTFV+NF+ L FLLGYI +T +QN +  KPLA N+K  
Sbjct  181   LHFPITVYLTFTLSLGIQGIAISTFVSNFVTLFFLLGYIFFTYDQNGSPSKPLAENVKLL  240

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
              S S+GE+W++LL+LA+PSCLAVCLEWWWYEFMT+LAGYL RP+V LA +AIVIQTTSLM
Sbjct  241   PSISVGEQWIMLLQLAIPSCLAVCLEWWWYEFMTVLAGYLDRPEVPLAASAIVIQTTSLM  300

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YTLPSALS S+SSRVGNELGAGRP KARLAT IAI LAFL S FG +LTTLGRE W ++F
Sbjct  301   YTLPSALSASVSSRVGNELGAGRPAKARLATGIAIGLAFLTSTFGFILTTLGREAWGRVF  360

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D EVLELT TVLPIIGLCELANCPQTTCCGVLRGSARP +GA INFYSFYLMG P+AI
Sbjct  361   TKDREVLELTATVLPIIGLCELANCPQTTCCGVLRGSARPGVGAGINFYSFYLMGTPVAI  420

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPM  320
              +AFVWKL F GLCYGLLAAQVACVISMLIV Y TDWE  S +AK+LVG S E  +ED +
Sbjct  421   TLAFVWKLGFLGLCYGLLAAQVACVISMLIVTYSTDWEGASLKAKELVGRSNELPYEDQL  480

Query  319   IKFKEGEEF--RISF  281
             +KF+EG  F  R SF
Sbjct  481   VKFEEGNGFLKRFSF  495



>ref|XP_004229255.1| PREDICTED: MATE efflux family protein 5 [Solanum lycopersicum]
Length=495

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/495 (75%), Positives = 426/495 (86%), Gaps = 4/495 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             MAA+QTQKH T+PEV EEL+K+ID  FP++AMGL +Y+KNMILV+CMGRLGSLELAGGAL
Sbjct  1     MAAEQTQKHPTLPEVKEELKKIIDRGFPILAMGLATYLKNMILVMCMGRLGSLELAGGAL  60

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLALGMEP+SSQAFGS+NLT+VSL LQRTI MLL AS+PI  LWFN
Sbjct  61    AIGFTNITGYSVLSGLALGMEPLSSQAFGSRNLTLVSLALQRTIFMLLTASIPIAFLWFN  120

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
              + LML LHQD++IIH+AS+FC+FA+PDL+ANS LHPLRIYLRCKGTTWPLLW T +ATM
Sbjct  121   FESLMLKLHQDSQIIHVASVFCRFAVPDLIANSFLHPLRIYLRCKGTTWPLLWCTSLATM  180

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK--  1040
             LH PI  YLTF+L LGIQGIAISTFV+NF+ L FLLGYI +T +Q+ +  KPLA N+K  
Sbjct  181   LHFPITVYLTFTLCLGIQGIAISTFVSNFVTLFFLLGYIFFTYDQDGSPSKPLAENVKLL  240

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
              S S+GE+W++LL+LA+PSCLAVCLEWWWYEFMT+LAGYL RP+V LA +AIVIQTTSLM
Sbjct  241   PSISVGEQWIMLLQLAIPSCLAVCLEWWWYEFMTVLAGYLDRPEVPLAASAIVIQTTSLM  300

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YTLPSALS S+SSRVGNELGAGRP KARLAT IAI LAFL S FG +LTT+GRE W ++F
Sbjct  301   YTLPSALSASVSSRVGNELGAGRPAKARLATGIAIGLAFLTSTFGFILTTIGREAWGRVF  360

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D EVLELT TVLPIIGLCELANCPQTTCCGVLRGSARP +GA INFYSFYLMG P+AI
Sbjct  361   TKDREVLELTATVLPIIGLCELANCPQTTCCGVLRGSARPGVGAGINFYSFYLMGTPVAI  420

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPM  320
             I+AFVWKL F GLCYGLLAAQVACVISMLIV Y TDWE  S +AK LVG + E  +ED +
Sbjct  421   ILAFVWKLGFLGLCYGLLAAQVACVISMLIVTYSTDWEGASLKAKQLVGRTNELPYEDQL  480

Query  319   IKFKEGEEF--RISF  281
             +K +EG  F  R SF
Sbjct  481   VKIEEGNGFLKRFSF  495



>ref|XP_009613536.1| PREDICTED: MATE efflux family protein 5 [Nicotiana tomentosiformis]
 ref|XP_009613537.1| PREDICTED: MATE efflux family protein 5 [Nicotiana tomentosiformis]
Length=505

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/504 (73%), Positives = 417/504 (83%), Gaps = 12/504 (2%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             M  +QT+KH  +PEVMEEL+K++D  FP++AMGL +Y+KNMILVVCMGRLGSLELAGGAL
Sbjct  1     METEQTKKHPALPEVMEELKKIMDRGFPILAMGLATYLKNMILVVCMGRLGSLELAGGAL  60

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLALGMEP+ SQAFGS+NLTIVSL LQRTI ML  AS+PI  LWFN
Sbjct  61    AIGFTNITGYSVLSGLALGMEPLCSQAFGSRNLTIVSLALQRTIFMLFTASIPIAFLWFN  120

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
              +PLML L QD +IIH+AS+FC+FA+PDL+ANS+LHPLRIYLRCKGTTWPLLW T +AT+
Sbjct  121   FEPLMLKLRQDTQIIHVASVFCRFAVPDLIANSLLHPLRIYLRCKGTTWPLLWCTSLATL  180

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigll----------fllgyilYTNEQNEALY  1064
             LH PI  YLTF+  LGIQGIAISTF +NFI L                I +T +QN++L 
Sbjct  181   LHFPITVYLTFTRGLGIQGIAISTFASNFITLFFILGYISFTCLDQKKIFFTYDQNKSLS  240

Query  1063  KPLATNLKS--STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATA  890
             KPLA NLK   S S+GE+W++LL+LA+PSCLAVCLEWWWYEFMT+LAGYL RP+V LA +
Sbjct  241   KPLAENLKPLPSISVGEQWMMLLQLAIPSCLAVCLEWWWYEFMTVLAGYLDRPEVPLAAS  300

Query  889   AIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTT  710
             AIVIQTTSLMYTLPSALS S+SSRVGNELGAGRP KARLAT IAI LAFL S+FG LLTT
Sbjct  301   AIVIQTTSLMYTLPSALSASVSSRVGNELGAGRPAKARLATGIAIGLAFLTSSFGFLLTT  360

Query  709   LGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYS  530
             LGRE W K+FT D EVLELT  VLPIIGLCELANCPQTTCCGVLRGSARP +GA INFYS
Sbjct  361   LGREAWGKVFTKDREVLELTGAVLPIIGLCELANCPQTTCCGVLRGSARPGVGAGINFYS  420

Query  529   FYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
             FYLMG P+AII+AFVWKL F GLCYGLLAAQVACVISMLIV Y TDWE  S +AK+LVG 
Sbjct  421   FYLMGTPVAIILAFVWKLGFLGLCYGLLAAQVACVISMLIVTYGTDWEGASLKAKELVGT  480

Query  349   SRETSFEDPMIKFKEGEEFRISFE  278
             S E  +ED ++KF+EG  F   F 
Sbjct  481   SNELPYEDQLVKFEEGNGFLKGFS  504



>ref|XP_009786134.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
 ref|XP_009786135.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
Length=505

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/504 (73%), Positives = 416/504 (83%), Gaps = 12/504 (2%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             M A+QT+KH + PEVMEEL+K++D  FP++AMGL +Y+KNMILVVCMGRLGSLELAGGAL
Sbjct  1     MEAEQTEKHPSSPEVMEELKKIMDRGFPILAMGLATYLKNMILVVCMGRLGSLELAGGAL  60

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLALGMEP+ SQAFGS+NLTIVSL LQRTI ML  AS+PI  LWFN
Sbjct  61    AIGFTNITGYSVLSGLALGMEPLCSQAFGSRNLTIVSLALQRTIFMLFTASIPIAFLWFN  120

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
              +PLML L QD +IIH+AS+FC+FA+PDL+ANS+LHPLRIYLRCKGTTWPLLW T + T+
Sbjct  121   FEPLMLKLRQDTQIIHVASVFCRFAVPDLIANSLLHPLRIYLRCKGTTWPLLWCTSLGTL  180

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigll----------fllgyilYTNEQNEALY  1064
             LH PI  YLTF+  LGIQGIAISTF +NFI L                I +T +QN +L 
Sbjct  181   LHFPITVYLTFTRGLGIQGIAISTFASNFITLFFILGYISFTCLNQKTIFFTYDQNRSLS  240

Query  1063  KPLATNLKS--STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATA  890
             KPLA NLK   S S+GE+W++LL+LA+PSCLAVCLEWWWYEFMT+LAGYL RP+V LA +
Sbjct  241   KPLAENLKPLPSISVGEQWIMLLQLAIPSCLAVCLEWWWYEFMTVLAGYLDRPEVPLAAS  300

Query  889   AIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTT  710
             AIVIQTTSLMYTLPSALS S+SSRVGNELGAGRP KARLAT IAI LAFL S FG LLTT
Sbjct  301   AIVIQTTSLMYTLPSALSASVSSRVGNELGAGRPAKARLATGIAIGLAFLTSTFGFLLTT  360

Query  709   LGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYS  530
             LGRE W K+FT D EVLELT TVLPIIGLCELANCPQTTCCGVLRGSARP +GA INFYS
Sbjct  361   LGREAWGKVFTKDREVLELTGTVLPIIGLCELANCPQTTCCGVLRGSARPGVGAGINFYS  420

Query  529   FYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
             FYLMG P+AII+AFVWKL F GLCYGLLAAQVACVISMLIV Y TDWE  S +AK+LVG 
Sbjct  421   FYLMGTPVAIILAFVWKLGFLGLCYGLLAAQVACVISMLIVTYGTDWEGASLKAKELVGT  480

Query  349   SRETSFEDPMIKFKEGEEFRISFE  278
             S E  +ED ++KF+EG  F   F 
Sbjct  481   SNELPYEDQLVKFEEGNGFLKGFS  504



>ref|XP_002516950.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF45564.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/492 (68%), Positives = 418/492 (85%), Gaps = 4/492 (1%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             +++QK+ T+PEV++EL++M D  FP+ AM L+ Y+KNMILVVCMGRLGSLELAGGALAIG
Sbjct  5     EKSQKYPTMPEVVDELKRMTDIGFPIAAMSLVGYLKNMILVVCMGRLGSLELAGGALAIG  64

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA GMEP+ SQAFGS+NL++ S TLQRTI MLL+ASLPIGL+W NL+P
Sbjct  65    FTNITGYSVLSGLATGMEPLCSQAFGSRNLSVASQTLQRTILMLLLASLPIGLVWVNLEP  124

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             LML LHQD  I  +ASL+C+F++PDL+ANS+LHPLRIYLR KGTTWPL+W TL++ +LHL
Sbjct  125   LMLTLHQDPDISRLASLYCRFSLPDLIANSLLHPLRIYLRSKGTTWPLMWCTLVSIVLHL  184

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT----NLKS  1037
             PI  +L F+L LG+ GIAISTF++NF  LLFLL YI +T+   E LY PL+        S
Sbjct  185   PITVFLAFTLHLGVPGIAISTFISNFNILLFLLCYIYFTHVPEEPLYAPLSQPQPFTPSS  244

Query  1036  STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMY  857
             + S+G+EW ILLRL++PSC+AVCLEWWWYEFMT+LAGYL +P+V LAT+AIVIQTTSL+Y
Sbjct  245   TPSLGKEWGILLRLSIPSCIAVCLEWWWYEFMTILAGYLSKPRVALATSAIVIQTTSLLY  304

Query  856   TLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFt  677
             TLP+ALS S+S+RVGNELGAGRPGKARLAT +AI LA L+S FG++LTTLGR+ W ++FT
Sbjct  305   TLPTALSASVSTRVGNELGAGRPGKARLATTVAIGLALLSSLFGLILTTLGRQAWGRVFT  364

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
              D EVLELTV VLPIIGLCELANCPQTT CG+LRGSARP IGA INFYSFYL+GAP+A++
Sbjct  365   GDDEVLELTVIVLPIIGLCELANCPQTTSCGILRGSARPGIGAAINFYSFYLVGAPVAVV  424

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMI  317
             +AFVW+L F GLCYGLLAAQ+ACV+S+L  +Y+T+WE+ES++AKDLVG++   +  DP +
Sbjct  425   LAFVWRLGFVGLCYGLLAAQIACVVSILTAVYKTNWERESSKAKDLVGKNDTLAHADPTV  484

Query  316   KFKEGEEFRISF  281
             K +EGEE  + F
Sbjct  485   KCEEGEEIGVGF  496



>ref|XP_002270564.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
 emb|CBI22979.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/491 (70%), Positives = 413/491 (84%), Gaps = 4/491 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +AA+QTQK+ T+PEVMEEL++  D  FP++AM L+ Y+KNMILVVCMGRLGSLELAGGAL
Sbjct  2     VAAEQTQKYPTMPEVMEELKRTADMGFPIVAMSLVGYLKNMILVVCMGRLGSLELAGGAL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEP+ SQAFGS+NL++VSLTLQRTI MLL+ S+PIGLLW N
Sbjct  62    AIGFTNITGYSVLSGLAMGMEPLCSQAFGSRNLSVVSLTLQRTILMLLITSVPIGLLWIN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+ LML LHQ+  I  +ASL+C+FAIPDL ANS+LHPLRIYLR KGTTWPL+W TL+A +
Sbjct  122   LEALMLRLHQNPDITRVASLYCRFAIPDLFANSLLHPLRIYLRSKGTTWPLMWCTLLAIL  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSS  1034
             LHLPI  +L FSL LG+ GIAISTFV NF  + FLLGYI YT    E L  PL++   SS
Sbjct  182   LHLPITIFLAFSLCLGVPGIAISTFVTNFNTVFFLLGYIFYTRAPEEPLCIPLSSQQHSS  241

Query  1033  T--SIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
             T  S+GEEW +LLRLA+PSCLAVCLEWWWYEFMT+LAGYL +P++ LAT+AIVIQTT+LM
Sbjct  242   TASSLGEEWGMLLRLAIPSCLAVCLEWWWYEFMTILAGYLSKPRIALATSAIVIQTTALM  301

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YTLP+ALS S+S+RVGNELGAGRPG+ARLAT ++I LA + S  G+LLTTL +E W ++F
Sbjct  302   YTLPTALSASVSTRVGNELGAGRPGRARLATVVSIGLALVTSILGLLLTTLWKETWGRVF  361

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D++VL+LT+TVLPIIG+CELANCPQTT CGVLRGSARP +GA INFYSFYL+G P+AI
Sbjct  362   TQDSDVLQLTMTVLPIIGVCELANCPQTTSCGVLRGSARPGVGAGINFYSFYLVGTPVAI  421

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED--  326
             ++AFVWKL F G CYGLLAAQ+AC++S+LIVIYRTDWE+ES +AKDLVG S   +  D  
Sbjct  422   VLAFVWKLGFVGFCYGLLAAQIACLVSILIVIYRTDWERESLKAKDLVGRSTVYAHADRA  481

Query  325   PMIKFKEGEEF  293
               +KF EG  F
Sbjct  482   EALKFDEGVGF  492



>emb|CAN68577.1| hypothetical protein VITISV_019282 [Vitis vinifera]
Length=536

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/492 (70%), Positives = 411/492 (84%), Gaps = 2/492 (0%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +AA+QTQK+ T+PEVMEEL++  D  FP++AM L+ Y+KNMILVVCMGRLGSLELAGGAL
Sbjct  2     VAAEQTQKYPTMPEVMEELKRTADMGFPIVAMSLVGYLKNMILVVCMGRLGSLELAGGAL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEP+ SQAFGS+NL++VSLTLQRTI MLL+ S+PIGLLW N
Sbjct  62    AIGFTNITGYSVLSGLAMGMEPLCSQAFGSRNLSVVSLTLQRTILMLLITSVPIGLLWIN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+ LML LHQ+  I  +ASL+C+FAIPDL ANS+LHPLRIYLR KGTTWPL+W TL+A +
Sbjct  122   LEALMLRLHQNPDITRVASLYCRFAIPDLFANSLLHPLRIYLRSKGTTWPLMWCTLLAIL  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSS  1034
             LHLPI  +L FSL LG+ GIAISTFV NF  + FLLGYI YT    E L  PL++   SS
Sbjct  182   LHLPITIFLAFSLCLGVPGIAISTFVTNFNTVFFLLGYIFYTRAPEEPLCIPLSSQQHSS  241

Query  1033  T--SIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
             T  S+GEEW +LLRLA+PSCLAVCLEWWWYEFMT+LAGYL +P++ LAT+AIVIQTT+LM
Sbjct  242   TASSLGEEWGMLLRLAIPSCLAVCLEWWWYEFMTILAGYLSKPRIALATSAIVIQTTALM  301

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YTLP+ALS S+S+RVGNELGAGRPG+ARLAT ++I LA + S  G+LLTTL +E W ++F
Sbjct  302   YTLPTALSASVSTRVGNELGAGRPGRARLATVVSIGLALVTSILGLLLTTLWKETWGRVF  361

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D++VL+LT+TVLPIIG+CELANCPQTT CGVLRGSARP +GA INFYSFYL+G P+AI
Sbjct  362   TQDSDVLQLTMTVLPIIGVCELANCPQTTSCGVLRGSARPGVGAGINFYSFYLVGTPVAI  421

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPM  320
             ++AFVWKL F G CYGLLAAQ+AC++S+LIVIYRTDWE+ES +AKDLVG S   +  D  
Sbjct  422   VLAFVWKLGFVGFCYGLLAAQIACLVSILIVIYRTDWERESLKAKDLVGRSTVYAHADRA  481

Query  319   IKFKEGEEFRIS  284
                K     R+S
Sbjct  482   EALKFARRSRVS  493



>emb|CDO98843.1| unnamed protein product [Coffea canephora]
Length=502

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/501 (69%), Positives = 405/501 (81%), Gaps = 4/501 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             M A+QT+K  T+ EV+EEL+KM D  FP+ A+GL  Y+KNMI V CMGRLGSLELAGGAL
Sbjct  1     MEAEQTKKSPTVSEVIEELKKMKDISFPIFAIGLAGYLKNMISVTCMGRLGSLELAGGAL  60

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I SL L+RTI MLL+ASLPIGLLW N
Sbjct  61    AIGFTNITGYSVLSGLAMGMEPLCSQAFGSRNTSIASLILRRTILMLLVASLPIGLLWIN  120

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             LKPLML LHQD +++ I+S++C+FAIPDL+ANS+LHP+RIY R KG TWPLLW TL+A +
Sbjct  121   LKPLMLRLHQDPEVVDISSIYCRFAIPDLIANSLLHPIRIYSRSKGITWPLLWCTLLAII  180

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVAN-figllfllgyilYTNEQNEALYKPLATNLKS  1037
             LHLPI  +LTF+L LGIQGIAIS  VAN       L   + YT   +EAL KPLA    +
Sbjct  181   LHLPITTFLTFNLHLGIQGIAISISVANFNTLFFLLAYLLYYTYAPSEALSKPLAPK-SN  239

Query  1036  STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMY  857
             STS+GE+W +LLRL+LPSCLAVCLEWWWYE MTLLAGYL RPQV LAT+AIVIQTTSLMY
Sbjct  240   STSLGEDWRMLLRLSLPSCLAVCLEWWWYEIMTLLAGYLERPQVALATSAIVIQTTSLMY  299

Query  856   TLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFt  677
             TLPSALS SIS+RVGNELGAGRP KARLAT + I LAF+ S FG LLTT+GRE W +IFT
Sbjct  300   TLPSALSASISTRVGNELGAGRPYKARLATVVGIGLAFITSVFGFLLTTIGREAWGRIFT  359

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
              DTEVLELT+  LPIIGLCELANCPQTTCCGVLRG+ARP   A INFYSFYLMG P+AI 
Sbjct  360   KDTEVLELTLATLPIIGLCELANCPQTTCCGVLRGTARPCTAAGINFYSFYLMGTPVAIA  419

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMI  317
             +AF W   F GLCYGLLAAQVAC++S+L VI +TDWE+ES +A DLVGE+ E  ++D + 
Sbjct  420   LAFFWGQGFLGLCYGLLAAQVACMVSILTVISKTDWERESQKAVDLVGETCENRYQDEIA  479

Query  316   KFKEGE--EFRISFEEGVNLQ  260
             K +EG   + + SFE+   L+
Sbjct  480   KCEEGHNSQKQNSFEKANGLR  500



>ref|XP_011090997.1| PREDICTED: MATE efflux family protein 5 [Sesamum indicum]
Length=491

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/487 (70%), Positives = 405/487 (83%), Gaps = 3/487 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             MAA  T+K+ TI EVMEEL+ ++D  FP++ MG+ SY+KNMI V C+GRLGSLELAGGAL
Sbjct  1     MAAVSTKKNLTIVEVMEELKNIVDIGFPILIMGIFSYLKNMISVACIGRLGSLELAGGAL  60

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVL GLA+GMEP+ SQAFGSKN T+VSLTLQRTI +LL+AS+PIG+LW  
Sbjct  61    AIGFTNITGYSVLFGLAMGMEPLCSQAFGSKNFTMVSLTLQRTIILLLLASIPIGMLWIY  120

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+PL+LWLHQ+ +++ IASL+C+FA+PDL+ANS+LHPLRIY+R KGTTWPLLW TL+A +
Sbjct  121   LEPLLLWLHQEPQVVRIASLYCRFAVPDLIANSLLHPLRIYIRSKGTTWPLLWCTLLAIL  180

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYK---PLATNL  1043
             LH PI  + TF   LGIQGIAISTF+AN   LLFLLGYI Y +++  +L K   P +  L
Sbjct  181   LHYPITVFFTFHQHLGIQGIAISTFIANLNILLFLLGYINYAHDEKTSLSKSLVPPSNKL  240

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
              S+T++ EEW +LLRLA+PSCL VCLEWWWYE MTLLAGYL +P V LAT+AIVIQTTSL
Sbjct  241   GSTTALWEEWGMLLRLAIPSCLGVCLEWWWYELMTLLAGYLYKPHVALATSAIVIQTTSL  300

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYTLPSALS SIS+RVGNELGAGRP KARLATA+AI LAF  S FG LLTTLGR  W ++
Sbjct  301   MYTLPSALSASISTRVGNELGAGRPQKARLATAVAIALAFSTSIFGFLLTTLGRGAWGRV  360

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D EVLELT+ VLPIIGLCELANCPQTTCCGVLRGSARP+IGA INF SFY+MG P+A
Sbjct  361   FTNDNEVLELTMAVLPIIGLCELANCPQTTCCGVLRGSARPSIGAGINFCSFYMMGTPVA  420

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDP  323
             + +AF W+L F GLCYGLLAAQVACV+S+L VI++TDWE ES +AKDL+G S E    D 
Sbjct  421   VALAFYWELGFVGLCYGLLAAQVACVLSILKVIHKTDWENESLQAKDLIGISNEYVHADL  480

Query  322   MIKFKEG  302
             ++K +EG
Sbjct  481   LVKCEEG  487



>gb|KDO71733.1| hypothetical protein CISIN_1g045328mg [Citrus sinensis]
Length=501

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/509 (65%), Positives = 404/509 (79%), Gaps = 21/509 (4%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             A++ +QK+ T+PEV++EL++M D  FP+ AM L++Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  3     ASQNSQKYPTMPEVLDELKRMTDIGFPIAAMSLVNYLKNMVLVVCMGRLGSLELAGGALA  62

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+  Q FGS+NL++VSLTLQRTI MLL+AS+PI LLWF L
Sbjct  63    IGFTNITGYSVLSGLAMGMEPLCGQGFGSRNLSLVSLTLQRTILMLLIASIPIALLWFKL  122

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML LHQ   I  +A ++C++AIPDLVANS LHPLRIYLR KGTTWPL+WSTLI+   
Sbjct  123   EPLMLSLHQTPDIARVAGVYCRYAIPDLVANSFLHPLRIYLRSKGTTWPLMWSTLISIAF  182

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSST  1031
             H P++ YLTF L LG+ GIAIS F+ NF  L FLL Y+  T   +E    PL+T LK+S 
Sbjct  183   HFPLIIYLTFYLSLGVPGIAISNFITNFNSLFFLLCYMFVTRASDE----PLSTPLKTSQ  238

Query  1030  SI-----------GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
             ++           G EW IL+RLA+PSC+AVCLEWWWYEFMT+LAGYL  PQ  LAT+A+
Sbjct  239   TLPTSSLTNSSSLGHEWGILIRLAIPSCMAVCLEWWWYEFMTILAGYLRNPQAALATSAL  298

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             VIQTTSLMYTLP ALS+S+S+RVGNELGAGRP KARLAT +AI LA L S FG+L TTLG
Sbjct  299   VIQTTSLMYTLPMALSSSVSTRVGNELGAGRPVKARLATVVAIGLALLVSLFGLLGTTLG  358

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             RE W ++FT D +VLELT TVLPIIGLCELANCPQTT CG+LRGSARP IGA INFYSFY
Sbjct  359   REAWGRVFTNDVQVLELTKTVLPIIGLCELANCPQTTSCGILRGSARPGIGATINFYSFY  418

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESR  344
             L+GAPLAI++AFVWKL F GLCYGLL AQ+ACV+S+L V+++TDWE+E+ +A +LVG+S 
Sbjct  419   LVGAPLAIVLAFVWKLGFVGLCYGLLGAQIACVVSILTVVFKTDWERETFKAANLVGKSN  478

Query  343   ETSFEDPMIKFKEGEEFRISFEEGVNLQK  257
                 +D  +K    EE  I F +    +K
Sbjct  479   ----DDQTVKCD--EEALIGFVKEAAFEK  501



>gb|KDP27821.1| hypothetical protein JCGZ_18901 [Jatropha curcas]
Length=506

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/472 (70%), Positives = 403/472 (85%), Gaps = 3/472 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +  ++ +K  T+PEV++EL+KM D  FP++AM L+ Y+KNMILVVCMGRLGSLELAGGAL
Sbjct  2     LTTEKPRKCPTMPEVIDELKKMTDIGFPIVAMSLVGYLKNMILVVCMGRLGSLELAGGAL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEPI SQAFGS+NL++ S TLQRTI MLL+ASLPIGL+W N
Sbjct  62    AIGFTNITGYSVLSGLAMGMEPICSQAFGSRNLSVASQTLQRTIVMLLLASLPIGLIWVN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+PLML +HQ+  I  +AS++C+F+IPDL+ANS+LHPLR+YLR KGTTWPL+W TLI+ +
Sbjct  122   LEPLMLSIHQEPDITKLASIYCRFSIPDLIANSLLHPLRVYLRSKGTTWPLMWCTLISVV  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN--EQNEALYKPLA-TNL  1043
             LHLPI  +LTF L LG+ GIAISTF++NF  LLF+L Y+ +T   +  E+LY PL+ T L
Sbjct  182   LHLPITIFLTFYLHLGVPGIAISTFISNFNTLLFILCYMYFTRVPKDGESLYVPLSPTPL  241

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
              S+ SIGEEW ILLRLA+PSCL VCLEWWWYEFMT+LAGYL  P+V LAT+AIVIQTTSL
Sbjct  242   SSTPSIGEEWGILLRLAIPSCLGVCLEWWWYEFMTILAGYLSEPRVALATSAIVIQTTSL  301

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYTLP+ALS S+S+RVGNELGAGRP KARLATA+A+  A ++S FG+LLTTLGRE W ++
Sbjct  302   MYTLPTALSASVSTRVGNELGAGRPEKARLATAVAVGSALVSSLFGLLLTTLGREAWARV  361

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D  VL+LT+ VLP+IGLCELANCPQTT CG+LRGSARP IGA INFYSFYL+GAP+A
Sbjct  362   FTEDERVLKLTMVVLPVIGLCELANCPQTTSCGILRGSARPGIGAGINFYSFYLVGAPVA  421

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             I++ FVWK+ F GLCYGLLAAQV CV+S+L V+Y+TDWE+E  +AKDLVG+S
Sbjct  422   ILLGFVWKIGFVGLCYGLLAAQVTCVVSILTVVYKTDWERELLKAKDLVGKS  473



>ref|XP_006419528.1| hypothetical protein CICLE_v10004811mg [Citrus clementina]
 ref|XP_006489047.1| PREDICTED: MATE efflux family protein 5-like [Citrus sinensis]
 gb|ESR32768.1| hypothetical protein CICLE_v10004811mg [Citrus clementina]
Length=501

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/509 (65%), Positives = 403/509 (79%), Gaps = 21/509 (4%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             A++ +QK+ T+PEV++EL++M D  FP+ AM L++Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  3     ASQNSQKYPTMPEVLDELKRMTDIGFPIAAMSLVNYLKNMVLVVCMGRLGSLELAGGALA  62

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+  Q FGS+NL++VSLTLQRTI MLL+AS+PI LLWF L
Sbjct  63    IGFTNITGYSVLSGLAMGMEPLCGQGFGSRNLSLVSLTLQRTILMLLIASIPIALLWFKL  122

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML LHQ   I  +A ++C++AIPDLVANS LHPLRIYLR KGTTWPL+WSTLI+   
Sbjct  123   EPLMLSLHQTPDIARVAGVYCRYAIPDLVANSFLHPLRIYLRSKGTTWPLMWSTLISIAF  182

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSST  1031
             H P++ YLTF L LG+ GIAIS F+ NF  L FLL Y+  T   +E    PL+T LK+S 
Sbjct  183   HFPLIIYLTFYLSLGVPGIAISNFITNFNSLFFLLCYMFVTRASDE----PLSTPLKTSQ  238

Query  1030  SI-----------GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
             ++           G EW IL+RLA+PSC+AVCLEWWWYEFMT+LAGYL  PQ  LAT+A+
Sbjct  239   TLPTSSLTNSSSLGHEWGILIRLAIPSCMAVCLEWWWYEFMTILAGYLRNPQAALATSAL  298

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             VIQTTSLMYTLP ALS+S+S+RVGNELGAGRP KARLAT +AI LA L S FG+L TTLG
Sbjct  299   VIQTTSLMYTLPMALSSSVSTRVGNELGAGRPVKARLATVVAIGLALLVSLFGLLGTTLG  358

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             RE W ++FT D +VLELT TVLPIIGLCELANCPQTT CG+LRGSARP IGA INF SFY
Sbjct  359   REAWGRVFTNDVQVLELTKTVLPIIGLCELANCPQTTSCGILRGSARPGIGATINFCSFY  418

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESR  344
             L+GAPLAI++AFVWKL F GLCYGLL AQ+ACV+S+L V+++TDWE+E+ +A +LVG+S 
Sbjct  419   LVGAPLAIVLAFVWKLGFVGLCYGLLGAQIACVVSILTVVFKTDWERETFKAANLVGKSN  478

Query  343   ETSFEDPMIKFKEGEEFRISFEEGVNLQK  257
                 +D  +K    EE  I F +    +K
Sbjct  479   ----DDQTVKCD--EEALIGFVKEAAFEK  501



>ref|XP_007035636.1| Multidrug and toxin extrusion protein 1 [Theobroma cacao]
 gb|EOY06562.1| Multidrug and toxin extrusion protein 1 [Theobroma cacao]
Length=507

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/508 (65%), Positives = 403/508 (79%), Gaps = 14/508 (3%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             A +  QK  T+PEVMEEL+++ D  FP+ AM L+ Y++NMILVVCMGRLGSLELAGG+LA
Sbjct  4     AMESHQKCPTMPEVMEELKRITDIGFPIAAMSLVGYLRNMILVVCMGRLGSLELAGGSLA  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNI+GYSVLSGLA GME + SQAFGS+NLT+ SLTLQRTI MLL+ S+PIGL+WFNL
Sbjct  64    IGFTNISGYSVLSGLATGMESLCSQAFGSRNLTVASLTLQRTILMLLLTSIPIGLIWFNL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML ++Q+  I  +ASL+C++AIPDL+ANS+LHPLRIYLR KGTTWPL+WSTL +T+ 
Sbjct  124   EPLMLSINQNPDITKVASLYCRYAIPDLIANSLLHPLRIYLRSKGTTWPLMWSTLFSTIC  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigl------lfllgyilYTNEQNEALYKPLAT  1049
             HLPI   L+F+L+LG+ GIAISTF+ NF  L      +F       T E+N +L  PL+ 
Sbjct  184   HLPITILLSFTLRLGVPGIAISTFITNFNTLFFLLCYMFYTRSSTRTPEENSSLRTPLSP  243

Query  1048  NLKSSTSIG----EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                   S      EEW +LLRLA+PSC+AVCLEWWWYEFMT+LAGYL  P+V LAT+AIV
Sbjct  244   PPLFPPSSAALLWEEWGVLLRLAIPSCIAVCLEWWWYEFMTILAGYLSNPRVALATSAIV  303

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYTLP+ALS S S+RVGNELGAGRP +ARLAT +AI LA L S FG+LLT LGR
Sbjct  304   IQTTSLMYTLPTALSASASTRVGNELGAGRPSRARLATVVAIGLALLTSFFGLLLTILGR  363

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             E W +IFTTD EVLELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA INFYSFYL
Sbjct  364   EAWGRIFTTDNEVLELTMIVLPIIGLCELANCPQTTSCGILRGSARPGIGATINFYSFYL  423

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAPLAI++ F W L F GLCYGLLAAQ+ACV+S+L V+++TDWE+ES +AKDLVG+   
Sbjct  424   VGAPLAIVLGFAWGLGFVGLCYGLLAAQIACVVSILTVVFKTDWERESLKAKDLVGKCNH  483

Query  340   TSFEDPMIKFKEGEEFRISFEEGVNLQK  257
                 D  +K +EG    ++F +G++ +K
Sbjct  484   FPHADQTVKCEEG----VAFLKGMDPEK  507



>ref|XP_011011677.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
Length=538

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/501 (66%), Positives = 407/501 (81%), Gaps = 13/501 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQ-TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             Q+  KM  ++ + K+ T+PEV+EEL++M D  FP+ A+ L+ Y+KNMILVVCMGRLGSLE
Sbjct  35    QKVAKMVTEEKSHKYPTMPEVVEELKRMTDIGFPIAALSLVGYLKNMILVVCMGRLGSLE  94

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGGALAIGFTNI+GYSVLSGLA+GMEP+ SQAFGS+NL + S TL+RTI MLL+AS+PI
Sbjct  95    LAGGALAIGFTNISGYSVLSGLAMGMEPLCSQAFGSRNLLVASHTLRRTILMLLLASIPI  154

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
             GLLW NL+PL+L LHQD  I  IASL+C+F+IPDL+ANS+LHPLRIYLR KGTTWPL+W 
Sbjct  155   GLLWVNLEPLLLSLHQDPDITRIASLYCRFSIPDLIANSLLHPLRIYLRSKGTTWPLMWC  214

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
             TL++ +LH+P+  +L F+L LG+ GIAISTF+ NF  LLFL+ Y+   +   E   +P +
Sbjct  215   TLVSIVLHVPVTIFLAFTLCLGVPGIAISTFITNFNTLLFLVCYMYLFSRATEE--EPSS  272

Query  1051  TNL--------KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
             T L          STS+ +EW +LLRLA+PSC+AVCLEWWWYEFMT+LAGYL  PQ  LA
Sbjct  273   TPLIRQQPFLSSPSTSLRKEWGLLLRLAIPSCIAVCLEWWWYEFMTILAGYLHNPQAALA  332

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
             T+AI+IQTTSLMYTLP++LS S+S+RVGNELGAGRP KARLAT +AI LA L+S FG+L 
Sbjct  333   TSAIIIQTTSLMYTLPTSLSASVSTRVGNELGAGRPQKARLATVVAIGLALLSSLFGLLW  392

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
             TTLGRE W K+FT D EVLELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA INF
Sbjct  393   TTLGREAWGKVFTKDDEVLELTMVVLPIIGLCELANCPQTTSCGILRGSARPGIGAGINF  452

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLV  356
             YSFY++GAP+AI +AFVWKL F GLCYGLLAAQV CV+S+L V+Y+TDW++ES +AK+LV
Sbjct  453   YSFYMVGAPVAIGLAFVWKLGFVGLCYGLLAAQVVCVVSILTVVYKTDWDRESLKAKELV  512

Query  355   GESRETSFE--DPMIKFKEGE  299
             G +   + E  D + K +EGE
Sbjct  513   GNTGALAHEHADHIAKCEEGE  533



>ref|XP_002314374.2| hypothetical protein POPTR_0010s01500g [Populus trichocarpa]
 gb|EEF00545.2| hypothetical protein POPTR_0010s01500g [Populus trichocarpa]
Length=499

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 402/492 (82%), Gaps = 12/492 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             +++ K+ T+PEV+EEL++M D  FP+ A+ L+ Y+KNMILVVCMGRLGSLELAGGALAIG
Sbjct  5     EKSHKYPTMPEVVEELKRMTDIGFPIAALSLVGYLKNMILVVCMGRLGSLELAGGALAIG  64

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNI+GYSVLSGLA+GMEP+ SQAFGS+NL + S TL+RTI MLL+AS+PIGLLW NL+P
Sbjct  65    FTNISGYSVLSGLAMGMEPLCSQAFGSRNLLVASHTLRRTILMLLLASIPIGLLWVNLEP  124

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             L+L LHQD  I  IASL+C+F+IPDL+ANS+LHPLRIYLR KGTTWPL+W TL++ +LH+
Sbjct  125   LLLSLHQDPDITRIASLYCRFSIPDLIANSLLHPLRIYLRSKGTTWPLMWCTLVSVVLHV  184

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL------  1043
             P+  +L F+L LG+ GIAISTF+ NF  LLFL+ Y+   +   E   +P +T L      
Sbjct  185   PVTIFLAFTLCLGVPGIAISTFITNFNTLLFLVCYMYLFSRATEE--EPSSTPLIRQQPF  242

Query  1042  --KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                 STS+ +EW ILLRLA+PSC+AVCLEWWWYEFMT+LAGYL  PQ  LAT+AI+IQTT
Sbjct  243   LSSPSTSLRKEWGILLRLAIPSCIAVCLEWWWYEFMTILAGYLHNPQAALATSAIIIQTT  302

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             SLMYTLP++LS S+S+RVGNELGAGRP KARLAT +AI LA L+S  G+L T LGRE W 
Sbjct  303   SLMYTLPTSLSASVSTRVGNELGAGRPQKARLATVVAIGLALLSSLLGLLWTILGREAWG  362

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
             K+FT D EVLELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA INFYSFY++GAP
Sbjct  363   KVFTKDDEVLELTMVVLPIIGLCELANCPQTTSCGILRGSARPGIGAGINFYSFYMVGAP  422

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFE  329
             +AI +AFVWKL F GLCYGLLAAQV CV+S+L V+Y+TDW++ES +AK+LVG++   + E
Sbjct  423   VAIGLAFVWKLGFVGLCYGLLAAQVVCVVSILTVVYKTDWDRESLKAKELVGKTGALAHE  482

Query  328   --DPMIKFKEGE  299
               D + K +EGE
Sbjct  483   HADHIAKCEEGE  494



>ref|XP_003547384.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=516

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/510 (62%), Positives = 402/510 (79%), Gaps = 23/510 (5%)
 Frame = -3

Query  1753  MAAKQTQK-HSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
             +A +++QK +    EV++EL++M D   P+ AM L+ Y+KNM+LVVCMGRLGSLELAGGA
Sbjct  2     VAEEKSQKTYPPTAEVVDELKRMGDIGVPIAAMSLVGYIKNMVLVVCMGRLGSLELAGGA  61

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             LAIGFTNITG+SVLSGLA+GMEP+ +QAFGS+N ++VSLTLQRTI MLL+ASLPI LLW 
Sbjct  62    LAIGFTNITGFSVLSGLAMGMEPLCTQAFGSRNFSLVSLTLQRTIIMLLVASLPISLLWL  121

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
              L+PLMLWLHQ+ +I  +AS++C F+IPDL+ANS+LHP+RIYLR KGTTWPLLW TL++ 
Sbjct  122   KLEPLMLWLHQNPEITKVASVYCFFSIPDLIANSLLHPIRIYLRSKGTTWPLLWCTLLSI  181

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA-----  1052
             ++H+PIV +LTF L LG+ GIA+S FVANF  L FLL Y+LY      +L  PL      
Sbjct  182   LIHIPIVAFLTFKLHLGVPGIAMSAFVANFNTLFFLLSYMLYMRVSKGSLSMPLLISSRP  241

Query  1051  -------------TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRP  911
                          T+LK++T++G+EW +L+R ++ SCL VCLEWWWYEFMT+LAGYL  P
Sbjct  242   LSSSPRQHHHQDQTSLKTTTTLGKEWGMLIRFSIQSCLGVCLEWWWYEFMTILAGYLHNP  301

Query  910   QVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASA  731
             +V LATA IVIQTTSLMYTLP+ALS S+S+RVGNELGAG+P +ARL+T +AI ++  +S 
Sbjct  302   RVALATAGIVIQTTSLMYTLPTALSASVSTRVGNELGAGQPERARLSTIVAIGMSLASSI  361

Query  730   FGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIG  551
              G+L TT+GR  W ++FT+D+EVLELT++VLPIIG+CELANCPQTT CG+LRGSARP +G
Sbjct  362   LGLLWTTIGRNRWGRVFTSDSEVLELTMSVLPIIGVCELANCPQTTSCGILRGSARPGVG  421

Query  550   ACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESAR  371
             A INFYSFYL+GAP+AI+MAFVWKL   GLCYGLLAAQ+AC +S+L+V+Y TDWE+ES +
Sbjct  422   AGINFYSFYLVGAPVAIVMAFVWKLGLVGLCYGLLAAQIACAVSILVVVYNTDWERESLK  481

Query  370   AKDLVG----ESRETSFEDPMIKFKEGEEF  293
             AK LVG       +    D  +K +EG  F
Sbjct  482   AKSLVGIYKSSCDDQHHGDQTVKCEEGVVF  511



>ref|XP_003528633.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=506

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/501 (62%), Positives = 393/501 (78%), Gaps = 11/501 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             K    + T+ EV+EE ++M D  FP+ AM L+ Y+KNM LVVCMGRLGSLELAGG+LAIG
Sbjct  6     KSQNTYPTVTEVLEEAKRMTDIGFPIAAMSLVGYLKNMTLVVCMGRLGSLELAGGSLAIG  65

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA+GMEP+ +QAFGS+N +++SLTLQRTI MLL+ SLPI LLW NL+ 
Sbjct  66    FTNITGYSVLSGLAMGMEPLCTQAFGSRNFSLLSLTLQRTILMLLLFSLPISLLWLNLES  125

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             LML L Q+  I  +A+L+C FAIPDL+AN  LHPLRIYLR KGTTWPLLW TL++ +LHL
Sbjct  126   LMLCLRQNPDITRVATLYCCFAIPDLIANCFLHPLRIYLRSKGTTWPLLWCTLLSILLHL  185

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL---------A  1052
             P + +LTF L LG+ GIAIS+FVANF  L FLL Y+ YT  + E+L+ PL          
Sbjct  186   PTLTFLTFKLNLGVPGIAISSFVANFSNLFFLLLYMFYTRVRKESLHVPLLMPRHMSHNV  245

Query  1051  TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             T   S+++I +EW +L++ ++ SCLAVCLEWWWYE MT+ AGYL  P+V+LATA IVIQT
Sbjct  246   TTCSSTSTIAKEWGVLMKFSIQSCLAVCLEWWWYELMTISAGYLHNPRVSLATAGIVIQT  305

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             TSLMYTLP+ALS S+S+RVGNELGAG+  +ARL+T +AI LA ++S FG+L TT+GRE W
Sbjct  306   TSLMYTLPTALSASVSTRVGNELGAGQGERARLSTVVAIGLALVSSIFGLLWTTMGRERW  365

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
              ++FT+D+EVL+LT+ VLPIIGLCELANCPQTT CG+LRGSARP +GA INF SFYL+GA
Sbjct  366   GRVFTSDSEVLQLTMAVLPIIGLCELANCPQTTSCGILRGSARPGVGAVINFCSFYLVGA  425

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSF  332
             P+AI++AF WKL   GLCYGLLAAQ+ACV+S+ +V+Y+TDWE+ES +A  LVG+S   +F
Sbjct  426   PVAIVLAFYWKLGMVGLCYGLLAAQIACVVSIFVVVYKTDWERESLKATCLVGKSSCGTF  485

Query  331   --EDPMIKFKEGEEFRISFEE  275
               ED      EG  F  + E+
Sbjct  486   AYEDQTAVKCEGVVFLHNSEK  506



>ref|XP_008458412.1| PREDICTED: MATE efflux family protein 5 isoform X1 [Cucumis melo]
Length=543

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/509 (60%), Positives = 396/509 (78%), Gaps = 7/509 (1%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             R K  +    + +  +A +++QK+ T+PEV++EL++M D  FP+ AMGL+ Y+KNMI V+
Sbjct  24    RGKKKQQGVKEGKNMLAEEKSQKYPTMPEVLDELKQMADIGFPVFAMGLVGYLKNMISVI  83

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
             CMGRLG+L LA G+LAIGFTNITGYSVLSGLA+GMEP+ SQAFGS N +I  LTLQRT+ 
Sbjct  84    CMGRLGTLHLAAGSLAIGFTNITGYSVLSGLAMGMEPLCSQAFGSHNSSIAFLTLQRTVL  143

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL A++PIG LW NL+PLML L+Q+ +I  IA+++C+FA+PDL+ NS+LHPLRIYLR K
Sbjct  144   ILLFATIPIGFLWLNLEPLMLVLNQNQEITRIAAVYCRFAVPDLILNSLLHPLRIYLRNK  203

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgy----ilY  1091
             GTTW ++W  L+A +LH+PI  +LTF L LGI GIAIS F+ANF  L FLL Y       
Sbjct  204   GTTWLVMWCNLLAIILHVPITIFLTFPLDLGISGIAISNFLANFNTLFFLLLYLIFTTRS  263

Query  1090  TNEQNEALYKPL-ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVR  914
             ++ +   L+ PL ++ + S+ ++GEEW +L++LA+PSCL VCLEWWWYEFMT+L GYL  
Sbjct  264   SSSKEANLFVPLKSSTVVSTVTVGEEWGMLIKLAIPSCLGVCLEWWWYEFMTILTGYLYN  323

Query  913   PQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLAS  734
             P++ LAT+ IVIQTTSLMYTLP ALS ++S+RVG+ELGAGRP KARLA  +AI LA + S
Sbjct  324   PRIALATSGIVIQTTSLMYTLPMALSAAVSTRVGHELGAGRPKKARLAAVVAIGLALVGS  383

Query  733   AFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNI  554
               G+ LTT+GR  W ++FT D E+LELT+ VLPIIGLCELANCPQTT CG+LRGSARP I
Sbjct  384   LMGLALTTVGRRTWGRVFTKDEEILELTMAVLPIIGLCELANCPQTTSCGILRGSARPVI  443

Query  553   GACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESA  374
             GA INF SFY++GAP+A++ AFVW   F GLCYGLLAAQ+ACV+S+LIV++ TDWE ES 
Sbjct  444   GAGINFCSFYMVGAPVAVLSAFVWMFGFLGLCYGLLAAQMACVVSILIVVFNTDWEMESI  503

Query  373   RAKDLVGESRETSFEDPMIKF--KEGEEF  293
             +A+DLVG++   +F   +     +EG EF
Sbjct  504   KAEDLVGKNTNNNFAHAIHTAIREEGPEF  532



>ref|XP_004487832.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=510

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/500 (61%), Positives = 387/500 (77%), Gaps = 16/500 (3%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             K  + + T  EV +E+++M+D  FP++AM L+ Y+KNMILVVCMG+LGSLELA GALAIG
Sbjct  6     KSQKTYPTTAEVFDEVKRMVDIGFPIVAMSLVGYLKNMILVVCMGKLGSLELASGALAIG  65

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA+GMEP+ +QAFGS+N +++SL L+RTI MLL+ SLPI LLW NL+P
Sbjct  66    FTNITGYSVLSGLAMGMEPLCTQAFGSQNFSLLSLILRRTILMLLLVSLPISLLWLNLEP  125

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             +ML LHQ+  I  IASL+C+ +IPDL+ANS LHP+RIYLR KGTTWPLLW TL++ ++H 
Sbjct  126   IMLSLHQNQDITRIASLYCRLSIPDLIANSFLHPIRIYLRSKGTTWPLLWCTLLSILIHT  185

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             PI+ ++TF L LG+QGIAIS F ANF  L FLL Y+ Y +    ++  PL T+ +   S 
Sbjct  186   PIIIFVTFKLNLGVQGIAISAFAANFNTLFFLLSYMFYMHVTKVSISMPLLTSPRPCPST  245

Query  1024  -----------GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
                         +EW +L+R ++ SCL VCLEWWWYEFMT+LAGYL  P+V LATA IVI
Sbjct  246   PPLLSSQEEKTRKEWSMLIRFSIQSCLGVCLEWWWYEFMTILAGYLYNPRVALATAGIVI  305

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSLMYTLP++LS S+S+RVGNELGAG+P +A L+T +AI +A  +S  G+L TTLGRE
Sbjct  306   QTTSLMYTLPTSLSASVSTRVGNELGAGQPRRASLSTMVAIGMALASSTLGLLWTTLGRE  365

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT D EVLELT+ VLPIIG+CELANCPQTT CG+LRGSARP IGA INFYSFYL+
Sbjct  366   KWGRVFTNDKEVLELTMVVLPIIGVCELANCPQTTSCGILRGSARPGIGAGINFYSFYLV  425

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE-SRE  341
             GAP+ I++ FVW+L   G CYGLLAAQ+ACV+S+L+V+Y TDWEKES +AK LVG+ S +
Sbjct  426   GAPIGIVLGFVWRLGLVGFCYGLLAAQIACVVSILVVVYNTDWEKESLKAKSLVGKGSCD  485

Query  340   TSF----EDPMIKFKEGEEF  293
             T F    +D  +K  +G  F
Sbjct  486   TLFAHVLDDQTLKCDQGIVF  505



>ref|XP_003550540.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=507

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/511 (62%), Positives = 401/511 (78%), Gaps = 17/511 (3%)
 Frame = -3

Query  1753  MAAKQTQK-HSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
             +A ++ QK + T+ EV+EE+R+M D  FP+ AM L+ Y+KNM LVVCMGRLGSLELAGG+
Sbjct  2     LAEQKFQKTYPTVTEVLEEVRRMTDIGFPIAAMSLVGYLKNMTLVVCMGRLGSLELAGGS  61

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             LAIG TNITGYSVLSGLA+GMEP+ +QAFGS+NL+++SLTLQRTI MLL+ SLPI LLW 
Sbjct  62    LAIGLTNITGYSVLSGLAMGMEPLCTQAFGSRNLSLLSLTLQRTILMLLLFSLPISLLWL  121

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
             NL+ LML L Q+  I  +A+L+C+FAIPDL+ANS LHPLRI+LR KGTTWPLLW TL++ 
Sbjct  122   NLESLMLCLRQNPDITRVATLYCRFAIPDLIANSFLHPLRIFLRSKGTTWPLLWCTLLSI  181

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL---ATN  1046
             +LHLP + +LTF L LG+ GIAIS+FVANF  L FLL Y+ YT    E+L+  L     N
Sbjct  182   LLHLPTLTFLTFKLNLGVPGIAISSFVANFSNLFFLLLYMFYTRVPKESLHVSLLMSHNN  241

Query  1045  L-----KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             L      S+++I +EW +L++ ++ SCLAVCLEWWWYE MT+ AGYL  P+V LATA IV
Sbjct  242   LIITCSSSTSTIAKEWGMLMKFSIQSCLAVCLEWWWYELMTISAGYLDNPRVALATAGIV  301

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYTLP+ALS S+S+RVGNELGAG+  +A L+T +AI LA ++S FG+L TT+GR
Sbjct  302   IQTTSLMYTLPTALSASVSTRVGNELGAGQGERANLSTVVAIGLALVSSIFGLLWTTMGR  361

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             E W ++FT+D+EVL+LTV VLPIIGLCELANCPQTT CG+LRGSARP IGA INF SFYL
Sbjct  362   ERWGRVFTSDSEVLQLTVAVLPIIGLCELANCPQTTSCGILRGSARPGIGAVINFCSFYL  421

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+AI++AF WKL   GLCYGLLAAQ+ACV+S+  V+Y+TDWE+ES +A+ LVG++  
Sbjct  422   VGAPVAIVLAFYWKLGMVGLCYGLLAAQIACVVSIFGVVYKTDWERESLKARCLVGKASC  481

Query  340   TSFEDPMIKFKEGEEFRISFEEGV---NLQK  257
              +F      + E +   +  EEGV   N QK
Sbjct  482   GTF-----AYDEDQTDALKCEEGVVFLNSQK  507



>ref|XP_004296859.1| PREDICTED: multidrug and toxin extrusion protein 1-like [Fragaria 
vesca subsp. vesca]
Length=537

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/519 (61%), Positives = 385/519 (74%), Gaps = 46/519 (9%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             A +Q  K+ T+PEV+EEL +M D  FP+ AM L+ Y+KNM LVVCMGRLGSLELAGGALA
Sbjct  5     AGEQRPKYPTMPEVVEELHRMTDIGFPIAAMSLVGYLKNMALVVCMGRLGSLELAGGALA  64

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS N ++  LTLQRTI +LL+ASLPI LLW NL
Sbjct  65    IGFTNITGYSVLSGLAMGMEPLCSQAFGSHNFSMAFLTLQRTILLLLVASLPISLLWVNL  124

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML LHQ+  I  IA L+C+FAIPDL+ANS+LHPLRI+LR +  TWPL+W TL+AT+L
Sbjct  125   EPLMLILHQNPDITRIAGLYCRFAIPDLIANSLLHPLRIFLRSQSITWPLMWCTLLATIL  184

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfl------------------lgyilYTN  1085
             HLP+ F+LTF+L LG++GIAISTF++NFI L FL                  +     T 
Sbjct  185   HLPLTFFLTFTLSLGVKGIAISTFLSNFITLFFLLGYILYTYTTKARLSCWLMDESEPTT  244

Query  1084  EQNEALY----------------------------KPLATNLKSSTSIGEEWVILLRLAL  989
                 ALY                            KPL      S  + +E  +L+RL++
Sbjct  245   NSERALYYDTRNKPELISSSTTKSEPAPILSPLLSKPLVPLSLKSPLLRDELGMLIRLSI  304

Query  988   PSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGN  809
              SCLAVCLEWWWYEFMT+LAGYL +P + LAT+AIVIQTTSLMYTLP+ALS S+S+RVGN
Sbjct  305   QSCLAVCLEWWWYEFMTILAGYLDKPHIALATSAIVIQTTSLMYTLPAALSASVSTRVGN  364

Query  808   ELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPII  629
             ELGAGRP KARLA  +A+ +A + S  G+ LTTLGRE W +IFTTD EVL+LTV VLPII
Sbjct  365   ELGAGRPEKARLAAVVAVGMALVISFSGLSLTTLGRETWARIFTTDNEVLQLTVAVLPII  424

Query  628   GLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGL  449
             GLCELANCPQTT CG+LRGSARP IGA INF+SFY++GAP+AI+M FVW+L FKGLCYGL
Sbjct  425   GLCELANCPQTTSCGILRGSARPGIGAWINFFSFYVVGAPVAIVMGFVWRLGFKGLCYGL  484

Query  448   LAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSF  332
             L+AQ+ CV+S+L V+++TDWEKE  +AKD VG +    F
Sbjct  485   LSAQITCVVSILTVVHKTDWEKEWRKAKDSVGITGRDGF  523



>gb|KHN20777.1| MATE efflux family protein DTX1 [Glycine soja]
Length=493

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/488 (63%), Positives = 386/488 (79%), Gaps = 22/488 (5%)
 Frame = -3

Query  1690  MIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGME  1511
             M D   P+ AM L+ Y+KNM+LVVCMGRLGSLELAGGALAIGFTNITG+SVLSGLA+GME
Sbjct  1     MGDIGVPIAAMSLVGYIKNMVLVVCMGRLGSLELAGGALAIGFTNITGFSVLSGLAMGME  60

Query  1510  PISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLF  1331
             P+ +QAFGS+N ++VSLTLQRTI MLL+ASLPI LLW  L+PLMLWLHQ+ +I  +AS++
Sbjct  61    PLCTQAFGSRNFSLVSLTLQRTIIMLLVASLPISLLWLKLEPLMLWLHQNPEITKVASVY  120

Query  1330  CQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIA  1151
             C F+IPDL+ANS+LHP+RIYLR KGTTWPLLW TL++ ++H+PIV +LTF L LG+ GIA
Sbjct  121   CFFSIPDLIANSLLHPIRIYLRSKGTTWPLLWCTLLSILIHIPIVAFLTFKLHLGVPGIA  180

Query  1150  ISTFVANfigllfllgyilYTNEQNEALYKPLA------------------TNLKSSTSI  1025
             +S FVANF  L FLL Y+LY      +L  PL                   T+LK++T++
Sbjct  181   MSAFVANFNTLFFLLSYMLYMRVSKGSLSMPLLISSRPLSSSPRQHHHQDQTSLKTTTTL  240

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
             G+EW +L+R ++ SCL VCLEWWWYEFMT+LAGYL  P+V LATA IVIQTTSLMYTLP+
Sbjct  241   GKEWGMLIRFSIQSCLGVCLEWWWYEFMTILAGYLHNPRVALATAGIVIQTTSLMYTLPT  300

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             ALS S+S+RVGNELGAG+P +ARL+T +AI ++  +S  G+L TT+GR  W ++FT+D+E
Sbjct  301   ALSASVSTRVGNELGAGQPERARLSTIVAIGMSLASSILGLLWTTIGRNRWGRVFTSDSE  360

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             VLELT++VLPIIG+CELANCPQTT CG+LRGSARP +GA INFYSFYL+GAP+AI+MAFV
Sbjct  361   VLELTMSVLPIIGVCELANCPQTTSCGILRGSARPGVGAGINFYSFYLVGAPVAIVMAFV  420

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG----ESRETSFEDPMI  317
             WKL   GLCYGLLAAQ+AC +S+L+V+Y TDWE+ES +AK LVG       +    D  +
Sbjct  421   WKLGLVGLCYGLLAAQIACAVSILVVVYNTDWERESLKAKSLVGIYKSSCDDQHHGDQTV  480

Query  316   KFKEGEEF  293
             K +EG  F
Sbjct  481   KCEEGVVF  488



>ref|XP_010269642.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=531

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/498 (62%), Positives = 386/498 (78%), Gaps = 11/498 (2%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +A  QTQK  T+PEV+EEL+ + D  FP+ AM L+ Y++NMI VVCMGRLG+LELAGGAL
Sbjct  2     LAEDQTQKKPTLPEVLEELKSIKDIAFPIAAMSLVGYLRNMISVVCMGRLGALELAGGAL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYS+LSGLA+GMEPI SQAFGS+NL++++LTL RTI MLL+AS+PIGLLW N
Sbjct  62    AIGFTNITGYSILSGLAMGMEPICSQAFGSRNLSLIALTLLRTILMLLVASIPIGLLWVN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+ +ML LHQD  II +ASL+C FA+PDL+ NS LHPLRIYLR KGTTWPL+W  L A +
Sbjct  122   LEAIMLRLHQDPDIIQVASLYCHFALPDLILNSFLHPLRIYLRSKGTTWPLMWCALPAIL  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE----QNEALYKPL---  1055
             LHLPI  +L F+L+LG+ GIA +T + NF  L+FL+ YIL T      +   +Y PL   
Sbjct  182   LHLPITMFLAFTLRLGVAGIAGATVITNFNALVFLVSYILCTRTSGSIKEPIMYTPLFQP  241

Query  1054  --ATNLKSS--TSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
                   KSS   ++G EW  L+RL+LPSCLAVCLEWWWYE MT+LAGYL  P+VTLAT+A
Sbjct  242   PPPPPPKSSLQGAVGGEWGKLIRLSLPSCLAVCLEWWWYELMTILAGYLYNPRVTLATSA  301

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             IVIQTTSLMYTLP+ALS S S+RVGNELGAGR  KARLAT +++ LA + S    +  ++
Sbjct  302   IVIQTTSLMYTLPTALSASASTRVGNELGAGRASKARLATMVSMGLAVVFSTVSFVWCSV  361

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
             GRE W ++FT D +VLELTV VLPIIGLCEL NCPQTT CGVLRGSARP IGA INFY+F
Sbjct  362   GREAWGRVFTQDGKVLELTVVVLPIIGLCELGNCPQTTGCGVLRGSARPIIGAAINFYAF  421

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             YL+G P+A++  FV ++ F GLCYGLLAAQ AC +S++ VI +TDW++ES++A+DLVG  
Sbjct  422   YLVGLPVAMVFGFVLEIGFVGLCYGLLAAQFACALSIVAVICKTDWDRESSKARDLVGMD  481

Query  346   RETSFEDPMIKFKEGEEF  293
                + +DP  K ++  EF
Sbjct  482   AACAQQDPTAKSQDEVEF  499



>ref|XP_004150498.1| PREDICTED: MATE efflux family protein 7-like [Cucumis sativus]
 gb|KGN47426.1| hypothetical protein Csa_6G319720 [Cucumis sativus]
Length=510

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/498 (60%), Positives = 391/498 (79%), Gaps = 11/498 (2%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +A +++QK+ T+PEV++EL++M D  FP++AMGL+ Y+KNMI V+CMGRLG+L LA G+L
Sbjct  2     LAEEKSQKYPTMPEVLDELKQMADIGFPVLAMGLVGYLKNMISVICMGRLGTLHLAAGSL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEP+ SQAFGS N +I  LTLQRT+ +LL A++PIG LW N
Sbjct  62    AIGFTNITGYSVLSGLAMGMEPLCSQAFGSHNSSIAFLTLQRTVLILLFATIPIGFLWLN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+PLML L+Q+ +I  IA+++C+FA+PDL+ NS+LHPLRIYLR KGTTW ++W  L+A +
Sbjct  122   LEPLMLVLNQNQEITRIAAVYCRFAVPDLILNSLLHPLRIYLRNKGTTWLVMWCNLLAIL  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllf--------llgyilYTNEQNEALYKP  1058
             LH+PI  + TF L LGI+GIAIS F+ANF  L F            I  ++ +   L  P
Sbjct  182   LHVPIAIFFTFPLDLGIRGIAISNFLANFNTLFFLLLYLIFTTRSRIFSSSSKEANLLMP  241

Query  1057  L-ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             L ++ + S+ ++GEEW +L++LA+PSCL VCLEWWWYEFMT+L GYL  P++ LAT+ IV
Sbjct  242   LKSSTVVSTVTVGEEWGMLIKLAIPSCLGVCLEWWWYEFMTILTGYLYNPRIALATSGIV  301

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYTLP ALS ++S+RVG+ELGAGRP KARLA  +AI LA + S  G+ LTT+GR
Sbjct  302   IQTTSLMYTLPMALSAAVSTRVGHELGAGRPRKARLAAVVAIGLALVGSLMGLSLTTVGR  361

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
               W ++FT D E+LELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA INF SFY+
Sbjct  362   RAWGRVFTKDEEILELTMAVLPIIGLCELANCPQTTSCGILRGSARPVIGAGINFCSFYM  421

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A++ AFVWK  F+GLCYGLLAAQ+ACV+S+LIV++ TDWE ES +A+DLVG++  
Sbjct  422   VGAPVAVLSAFVWKFGFQGLCYGLLAAQMACVVSILIVVFNTDWEMESIKAEDLVGKNTN  481

Query  340   TSFEDPMIKF--KEGEEF  293
              +F   +     +EG EF
Sbjct  482   NNFAHAIHTAIREEGPEF  499



>gb|KHN02952.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=492

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/491 (63%), Positives = 389/491 (79%), Gaps = 11/491 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +V+EE ++M D  FP+ AM L+ Y+KNM LVVCMGRLGSLELAGG+LAIGFTNITGYSVL
Sbjct  2     QVLEEAKRMTDIGFPIAAMSLVGYLKNMTLVVCMGRLGSLELAGGSLAIGFTNITGYSVL  61

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEP+ +QAFGS+N +++SLTLQRTI MLL+ SLPI LLW NL+ LML L Q+  
Sbjct  62    SGLAMGMEPLCTQAFGSRNFSLLSLTLQRTILMLLLFSLPISLLWLNLESLMLCLRQNPD  121

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A+L+C FAIPDL+AN  LHPLRIYLR KGTTWPLLW TL++ +LHLP + +LTF L
Sbjct  122   ITRVATLYCCFAIPDLIANCFLHPLRIYLRSKGTTWPLLWCTLLSILLHLPTLTFLTFKL  181

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL---------ATNLKSSTSIG  1022
              LG+ GIAIS+FVANF  L FLL Y+ YT  + E+L+ PL          T   S+++I 
Sbjct  182   NLGVPGIAISSFVANFSNLFFLLLYMFYTRVRKESLHVPLLMPRHMSHNVTTCSSTSTIA  241

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             +EW +L++ ++ SCLAVCLEWWWYE MT+ AGYL  P+V+LATA IVIQTTSLMYTLP+A
Sbjct  242   KEWGVLMKFSIQSCLAVCLEWWWYELMTISAGYLHNPRVSLATAGIVIQTTSLMYTLPTA  301

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS S+S+RVGNELGAG+  +ARL+T +AI LA ++S FG+L TT+GRE W ++FT+D+EV
Sbjct  302   LSASVSTRVGNELGAGQGERARLSTVVAIGLALVSSIFGLLWTTMGRERWGRVFTSDSEV  361

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             L+LT+ VLPIIGLCELANCPQTT CG+LRGSARP +GA INF SFYL+GAP+AI++AF W
Sbjct  362   LQLTMAVLPIIGLCELANCPQTTSCGILRGSARPGVGAVINFCSFYLVGAPVAIVLAFYW  421

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSF--EDPMIKFK  308
             KL   GLCYGLLAAQ+ACV+S+ +V+Y+TDWE+ES +A  LVG+S   +F  ED      
Sbjct  422   KLGMVGLCYGLLAAQIACVVSIFVVVYKTDWERESLKATCLVGKSSCGTFAYEDQTAVKC  481

Query  307   EGEEFRISFEE  275
             EG  F  + E+
Sbjct  482   EGVVFLHNSEK  492



>ref|XP_003534841.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=528

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/511 (61%), Positives = 394/511 (77%), Gaps = 30/511 (6%)
 Frame = -3

Query  1747  AKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalai  1568
              K  + + T  EV+EEL++M D   P+ AM L  Y+KNM+LVVCMGRLGSLELAGGALAI
Sbjct  5     GKSQKPYPTAAEVVEELKRMGDIGVPIAAMSLAGYIKNMVLVVCMGRLGSLELAGGALAI  64

Query  1567  GFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLK  1388
             GFTNITG+SVLSGLA+GMEP+ +QAFGS+N ++VSLTLQRTI MLL ASLPI LLW  L+
Sbjct  65    GFTNITGFSVLSGLAMGMEPLCTQAFGSRNFSLVSLTLQRTILMLLAASLPISLLWLKLE  124

Query  1387  PLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLH  1208
             PLMLWLHQ+ +I  +AS++C F+IPDL+ANS LHP+RIYLR KGTTWPLLW TL++ ++H
Sbjct  125   PLMLWLHQNPEITKVASVYCFFSIPDLIANSFLHPIRIYLRSKGTTWPLLWCTLLSILIH  184

Query  1207  LPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEA------------LY  1064
             +PIV + TF L LG+ GIA+S FVANF  L FLL Y+LY      +            L 
Sbjct  185   IPIVAFFTFKLHLGVPGIAMSAFVANFNTLFFLLSYMLYMRVSKGSLSMPLLLSSTCQLP  244

Query  1063  KP------------LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYL  920
              P              T+LK++T +G+EW +L+R ++ SCL VCLEWWWYEFMT+LAGYL
Sbjct  245   SPSPQQQQQQHHHQDQTSLKTTT-LGKEWGMLIRFSIQSCLGVCLEWWWYEFMTILAGYL  303

Query  919   VRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFL  740
               P+V LATA IVIQTTSLMYTLP+ALS S+S+RVGNELGAG+P +A+L+T +AI L+  
Sbjct  304   YNPRVALATAGIVIQTTSLMYTLPTALSASVSTRVGNELGAGQPERAKLSTIVAIGLSLA  363

Query  739   ASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARP  560
             +S  G+L TT+GRE W ++FT+D+EVLELT++VLPIIG+CELANCPQTT CG+LRGSARP
Sbjct  364   SSILGLLWTTIGRERWGRVFTSDSEVLELTMSVLPIIGVCELANCPQTTSCGILRGSARP  423

Query  559   NIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKE  380
              +GA INFYSFYL+GAP+AI++AFVWKL   GLCYGLLAAQ+ACV+S+L+V+Y TDWE+E
Sbjct  424   GVGAGINFYSFYLVGAPVAIVIAFVWKLGLVGLCYGLLAAQIACVVSILVVVYNTDWERE  483

Query  379   SARAKDLVGE-----SRETSFEDPMIKFKEG  302
             S +AK LVG        +  + D  +K +EG
Sbjct  484   SMKAKSLVGIFKSSCDHDHHYGDQTVKCEEG  514



>ref|XP_008458413.1| PREDICTED: MATE efflux family protein 5 isoform X2 [Cucumis melo]
Length=506

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/494 (61%), Positives = 391/494 (79%), Gaps = 7/494 (1%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +A +++QK+ T+PEV++EL++M D  FP+ AMGL+ Y+KNMI V+CMGRLG+L LA G+L
Sbjct  2     LAEEKSQKYPTMPEVLDELKQMADIGFPVFAMGLVGYLKNMISVICMGRLGTLHLAAGSL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEP+ SQAFGS N +I  LTLQRT+ +LL A++PIG LW N
Sbjct  62    AIGFTNITGYSVLSGLAMGMEPLCSQAFGSHNSSIAFLTLQRTVLILLFATIPIGFLWLN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+PLML L+Q+ +I  IA+++C+FA+PDL+ NS+LHPLRIYLR KGTTW ++W  L+A +
Sbjct  122   LEPLMLVLNQNQEITRIAAVYCRFAVPDLILNSLLHPLRIYLRNKGTTWLVMWCNLLAII  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgy----ilYTNEQNEALYKPL-AT  1049
             LH+PI  +LTF L LGI GIAIS F+ANF  L FLL Y       ++ +   L+ PL ++
Sbjct  182   LHVPITIFLTFPLDLGISGIAISNFLANFNTLFFLLLYLIFTTRSSSSKEANLFVPLKSS  241

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
              + S+ ++GEEW +L++LA+PSCL VCLEWWWYEFMT+L GYL  P++ LAT+ IVIQTT
Sbjct  242   TVVSTVTVGEEWGMLIKLAIPSCLGVCLEWWWYEFMTILTGYLYNPRIALATSGIVIQTT  301

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             SLMYTLP ALS ++S+RVG+ELGAGRP KARLA  +AI LA + S  G+ LTT+GR  W 
Sbjct  302   SLMYTLPMALSAAVSTRVGHELGAGRPKKARLAAVVAIGLALVGSLMGLALTTVGRRTWG  361

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
             ++FT D E+LELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA INF SFY++GAP
Sbjct  362   RVFTKDEEILELTMAVLPIIGLCELANCPQTTSCGILRGSARPVIGAGINFCSFYMVGAP  421

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFE  329
             +A++ AFVW   F GLCYGLLAAQ+ACV+S+LIV++ TDWE ES +A+DLVG++   +F 
Sbjct  422   VAVLSAFVWMFGFLGLCYGLLAAQMACVVSILIVVFNTDWEMESIKAEDLVGKNTNNNFA  481

Query  328   DPMIKF--KEGEEF  293
               +     +EG EF
Sbjct  482   HAIHTAIREEGPEF  495



>ref|XP_010105142.1| MATE efflux family protein 9 [Morus notabilis]
 gb|EXC03950.1| MATE efflux family protein 9 [Morus notabilis]
Length=523

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/489 (62%), Positives = 380/489 (78%), Gaps = 18/489 (4%)
 Frame = -3

Query  1756  KMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
              +  ++ QK+ T+ EV+EEL+   D  FP  AM L++Y++NM++VVCMGR+GSLELAGGA
Sbjct  4     DVGEEKFQKYRTMAEVVEELKTTADIGFPTAAMSLVNYLRNMVMVVCMGRMGSLELAGGA  63

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             LA+GFTNITGYSVLSGLA+GMEP+ SQAFGS+N  +  LTLQRT+ +LL AS PI LLWF
Sbjct  64    LAVGFTNITGYSVLSGLAMGMEPLCSQAFGSQNYAVAFLTLQRTVLILLFASFPIALLWF  123

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
             NL+PLML L Q+  I  IASL+C+FAIPDLVANS+L PLRI+LR KGTTWPL+WS L+A 
Sbjct  124   NLEPLMLILRQNQDITRIASLYCRFAIPDLVANSLLPPLRIFLRSKGTTWPLMWSNLLAM  183

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYT----NEQNEA-------  1070
               H+PI  +LTF L LG+QGIAISTF+ NFI L FLL Y+ ++     EQ +        
Sbjct  184   FFHIPITIFLTFKLSLGVQGIAISTFLTNFITLFFLLFYLYFSSYTPKEQEDYSCNNNNN  243

Query  1069  -------LYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRP  911
                      K       ++ +I E W +L+RLA+ SCLAVCLEWWWYEFMT+LAGYL  P
Sbjct  244   WMINTPFFPKSWPNIFLTTATIWENWGVLIRLAIQSCLAVCLEWWWYEFMTILAGYLPNP  303

Query  910   QVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASA  731
             +V LAT+AIVIQTT+LMYTLP +LS S+S+R+GNELGAGRP KARLA  +A+ LA + S 
Sbjct  304   KVALATSAIVIQTTALMYTLPFSLSASVSTRIGNELGAGRPNKARLAAIVAVGLALITSL  363

Query  730   FGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIG  551
              G+L TTLGR+ W ++FT D EVLELT  VLPIIG+CELANCPQTT CG+LRG+ARP IG
Sbjct  364   VGLLWTTLGRKPWGRVFTQDHEVLELTTLVLPIIGVCELANCPQTTSCGILRGTARPGIG  423

Query  550   ACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESAR  371
             A INFY+FYL+GAP+A+++ FVWKL F GLCYGLLAAQ+ACV+S+L V+Y+TDWE+ESA+
Sbjct  424   AAINFYAFYLVGAPVAVVLGFVWKLGFVGLCYGLLAAQIACVVSILTVVYKTDWERESAK  483

Query  370   AKDLVGESR  344
             AK+LV   R
Sbjct  484   AKELVARGR  492



>ref|XP_007138932.1| hypothetical protein PHAVU_009G250100g [Phaseolus vulgaris]
 gb|ESW10926.1| hypothetical protein PHAVU_009G250100g [Phaseolus vulgaris]
Length=514

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/503 (62%), Positives = 392/503 (78%), Gaps = 15/503 (3%)
 Frame = -3

Query  1756  KMAA--KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             KM A  K  + + T  +V++EL++M D   P+ AM L+ Y+KNM+LVVCMGRLGSLELAG
Sbjct  3     KMVAEEKPQKTYPTTAQVVDELKRMGDIGVPIAAMSLVGYIKNMVLVVCMGRLGSLELAG  62

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             GALAIGFTNITG+SVLSGLA+GMEP+ +QAFGS+N  ++SLTLQRTI MLL ASLPI LL
Sbjct  63    GALAIGFTNITGFSVLSGLAMGMEPLCTQAFGSRNFCLLSLTLQRTIFMLLAASLPISLL  122

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W  L+PLMLWLHQ+ +I  +ASL+C+F+IPDL+ANS LHP+RIYLR KGTTWPLLW TL+
Sbjct  123   WLKLEPLMLWLHQNPEITTVASLYCRFSIPDLIANSFLHPIRIYLRSKGTTWPLLWCTLL  182

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN-  1046
             + ++H+P+V + TF L LG+ GIA+S FVANF  L FLL Y+LY      +L  PL  + 
Sbjct  183   SILIHIPVVTFFTFKLHLGVPGIAMSAFVANFNTLFFLLSYMLYMQVSKGSLSMPLLISR  242

Query  1045  ------------LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
                           ++T+    W IL+R ++ SCL VCLEWWWYEFMT+LAGYL  P+V 
Sbjct  243   TSAISATTTTTATATATTATTSWGILIRFSIQSCLGVCLEWWWYEFMTILAGYLHNPRVA  302

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             LATA IVIQTTSLMYTLP+ALS S+S+RVGNELGAG+P +ARL++ +AI +A  +S  G+
Sbjct  303   LATAGIVIQTTSLMYTLPTALSGSVSTRVGNELGAGQPERARLSSIVAIGMALSSSILGL  362

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
             L TTLGRE W ++FT+D+EVLELT++VLPIIG+CELANCPQTT CG+LRGSARP +GA I
Sbjct  363   LGTTLGRERWGRVFTSDSEVLELTMSVLPIIGVCELANCPQTTSCGILRGSARPGVGAGI  422

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             NFYSFYL+GAP+AI+MAFVW+L   GLCYGLLAAQ+ACV+S+L+V+Y TDWE+ES +AK 
Sbjct  423   NFYSFYLVGAPVAIVMAFVWRLGLVGLCYGLLAAQIACVVSILVVVYNTDWERESLKAKT  482

Query  361   LVGESRETSFEDPMIKFKEGEEF  293
             LV        +  ++K +EG  F
Sbjct  483   LVSCHTMEHGDQTLVKCEEGLVF  505



>ref|XP_004170014.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 7-like 
[Cucumis sativus]
Length=510

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/498 (60%), Positives = 390/498 (78%), Gaps = 11/498 (2%)
 Frame = -3

Query  1753  MAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggal  1574
             +A +++QK+ T+PEV++EL++M D  FP++AMGL+ Y+ NMI V+CMGRLG+L LA G+L
Sbjct  2     LAEEKSQKYPTMPEVLDELKQMADIGFPVLAMGLVGYLXNMISVICMGRLGTLHLAAGSL  61

Query  1573  aiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFN  1394
             AIGFTNITGYSVLSGLA+GMEP+ SQAFGS N +I  LTLQRT+ +LL A++PIG LW N
Sbjct  62    AIGFTNITGYSVLSGLAMGMEPLCSQAFGSHNSSIAFLTLQRTVLILLFATIPIGFLWLN  121

Query  1393  LKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATM  1214
             L+PLML L+Q+ +I  IA+++C+FA+PDL+ NS+LHPLRIYLR KGTTW ++W  L+A +
Sbjct  122   LEPLMLVLNQNQEITRIAAVYCRFAVPDLILNSLLHPLRIYLRNKGTTWLVMWCNLLAIL  181

Query  1213  LHLPIVFYLTFSLKLGIQGIAISTFVANfigllf--------llgyilYTNEQNEALYKP  1058
             LH+PI  + TF L LGI+GIAIS F+ANF  L F            I  ++ +   L  P
Sbjct  182   LHVPIAIFFTFPLDLGIRGIAISNFLANFNTLFFLLLYLIFTTRSRIFSSSSKEANLLMP  241

Query  1057  L-ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             L ++ + S+ ++GEEW +L++LA+PSCL VCLEWWWYEFMT+L GYL  P++ LAT+ IV
Sbjct  242   LKSSTVVSTVTVGEEWGMLIKLAIPSCLGVCLEWWWYEFMTILTGYLYNPRIALATSGIV  301

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYTLP ALS ++S+RVG+ELGAGRP KARLA  +AI LA + S  G+ LTT+GR
Sbjct  302   IQTTSLMYTLPMALSAAVSTRVGHELGAGRPRKARLAAVVAIGLALVGSLMGLSLTTVGR  361

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
               W ++FT D E+LELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA INF SFY+
Sbjct  362   RAWGRVFTKDEEILELTMAVLPIIGLCELANCPQTTSCGILRGSARPVIGAGINFCSFYM  421

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A++ AFVWK  F+GLCYGLLAAQ+ACV+S+LIV++ TDWE ES +A+DLVG++  
Sbjct  422   VGAPVAVLSAFVWKFGFQGLCYGLLAAQMACVVSILIVVFNTDWEMESIKAEDLVGKNTN  481

Query  340   TSFEDPMIKF--KEGEEF  293
              +F   +     +EG EF
Sbjct  482   NNFAHAIHTAIREEGPEF  499



>gb|KHN03347.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=493

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/497 (63%), Positives = 392/497 (79%), Gaps = 16/497 (3%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +V+EE+R+M D  FP+ AM L+ Y+KNM LVVCMGRLGSLELAGG+LAIG TNITGYSVL
Sbjct  2     QVLEEVRRMTDIGFPIAAMSLVGYLKNMTLVVCMGRLGSLELAGGSLAIGLTNITGYSVL  61

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEP+ +QAFGS+NL+++SLTLQRTI MLL+ SLPI LLW NL+ LML L Q+  
Sbjct  62    SGLAMGMEPLCTQAFGSRNLSLLSLTLQRTILMLLLFSLPISLLWLNLESLMLCLRQNPD  121

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A+L+C+FAIPDL+ANS LHPLRI+LR KGTTWPLLW TL++ +LHLP + +LTF L
Sbjct  122   ITRVATLYCRFAIPDLIANSFLHPLRIFLRSKGTTWPLLWCTLLSILLHLPTLTFLTFKL  181

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL---ATNL-----KSSTSIGE  1019
              LG+ GIAIS+FVANF  L FLL Y+ YT    E+L+  L     NL      S+++I +
Sbjct  182   NLGVPGIAISSFVANFSNLFFLLLYMFYTRVPKESLHVSLLMSHNNLIITCSSSTSTIAK  241

Query  1018  EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSAL  839
             EW +L++ ++ SCLAVCLEWWWYE MT+ AGYL  P+V LATA IVIQTTSLMYTLP+AL
Sbjct  242   EWGMLMKFSIQSCLAVCLEWWWYELMTISAGYLDNPRVALATAGIVIQTTSLMYTLPTAL  301

Query  838   SNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevl  659
             S S+S+RVGNELGAG+  +A L+T +AI LA ++S FG+L TT+GRE W ++FT+D+EVL
Sbjct  302   SASVSTRVGNELGAGQGERANLSTVVAIGLALVSSIFGLLWTTMGRERWGRVFTSDSEVL  361

Query  658   eltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWK  479
             +LTV VLPIIGLCELANCPQTT CG+LRGSARP IGA INF SFYL+GAP+AI++AF WK
Sbjct  362   QLTVAVLPIIGLCELANCPQTTSCGILRGSARPGIGAVINFCSFYLVGAPVAIVLAFYWK  421

Query  478   LEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGE  299
             L   GLCYGLLAAQ+ACV+S+  V+Y+TDWE+ES +A+ LVG++   +F      + E +
Sbjct  422   LGMVGLCYGLLAAQIACVVSIFGVVYKTDWERESLKARCLVGKASCGTF-----AYDEDQ  476

Query  298   EFRISFEEGV---NLQK  257
                +  EEGV   N QK
Sbjct  477   TDALKCEEGVVFLNSQK  493



>ref|XP_007154295.1| hypothetical protein PHAVU_003G106500g [Phaseolus vulgaris]
 gb|ESW26289.1| hypothetical protein PHAVU_003G106500g [Phaseolus vulgaris]
Length=512

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 387/497 (78%), Gaps = 13/497 (3%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             K  + + T+P+V+EE+++M D  FP+ AM L+ Y+KN+ LVVCMGRLGSLELAGG+LAIG
Sbjct  6     KSPKTYPTLPQVLEEVKRMSDIGFPISAMSLVGYLKNLTLVVCMGRLGSLELAGGSLAIG  65

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA+GMEP+ +QAFGS+N +++SLTLQRTI MLL+ SLPI LLW NL+ 
Sbjct  66    FTNITGYSVLSGLAMGMEPLCTQAFGSRNFSLLSLTLQRTILMLLLFSLPISLLWLNLES  125

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             LML+L Q+  I  +A+L+C+FAIPDL+ NS LHPLRIYLR KGTTWPLLW TL++ +LHL
Sbjct  126   LMLFLRQNPDITRVATLYCRFAIPDLIVNSFLHPLRIYLRSKGTTWPLLWCTLLSILLHL  185

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL----------  1055
             P + +LTF L LG+ GIA+S+FVANF  L FLL Y+ YT    E+L+ PL          
Sbjct  186   PTIAFLTFKLHLGVPGIAVSSFVANFNNLFFLLLYMFYTRVPKESLHVPLLLSRTISHNN  245

Query  1054  -ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
               T   S +S+  EW +LL+ ++ SCLAVCLEWWWYE MT+ AGYL  P+V LATA IVI
Sbjct  246   LMTCRSSCSSLAMEWGVLLKFSIQSCLAVCLEWWWYELMTISAGYLQNPRVALATAGIVI  305

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSL+YTLP++LS S+S+RVGNELGAG+  +A LAT +AI L+  +S FG+L TT+GRE
Sbjct  306   QTTSLLYTLPTSLSASVSTRVGNELGAGQAERASLATVVAIGLSLASSIFGLLWTTMGRE  365

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT+D EVL+L++ VLPIIGLCELANCPQTT CG+LRGSARP +GA INF SFYL+
Sbjct  366   RWGRVFTSDGEVLQLSMAVLPIIGLCELANCPQTTSCGILRGSARPGVGAVINFCSFYLV  425

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES--R  344
             GAP+A+++AFVWKL   GLCYGLLAAQ+ACV+S+ IV+Y+TDWE+ES +A+ LVG+    
Sbjct  426   GAPVALVLAFVWKLGMVGLCYGLLAAQIACVVSIFIVVYKTDWERESLKARSLVGKGLCG  485

Query  343   ETSFEDPMIKFKEGEEF  293
               +F    I  K  E  
Sbjct  486   TFAFHQDQITIKCEEHL  502



>gb|KHN26536.1| MATE efflux family protein DTX1, partial [Glycine soja]
Length=510

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/497 (62%), Positives = 390/497 (78%), Gaps = 28/497 (6%)
 Frame = -3

Query  1711  VMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLS  1532
             V+EEL++M +   P+ AM L  Y+KNM+LVVCMGRLGSLELAGGALAIGFTNITG+SVLS
Sbjct  1     VVEELKRMGNIGVPIAAMSLAGYIKNMVLVVCMGRLGSLELAGGALAIGFTNITGFSVLS  60

Query  1531  GLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKI  1352
             GLA+GMEP+ +QAFGS+N ++VSLTLQRTI MLL ASLPI LLW  L+PLMLWLHQ+ +I
Sbjct  61    GLAMGMEPLCTQAFGSRNFSLVSLTLQRTILMLLAASLPISLLWLKLEPLMLWLHQNPEI  120

Query  1351  IHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLK  1172
               +AS++C F+IPDL+ANS LHP+RIYLR KGTTWPLLW TL++ ++H+PIV + TF L 
Sbjct  121   TKVASVYCFFSIPDLIANSFLHPIRIYLRSKGTTWPLLWCTLLSILIHIPIVAFFTFKLH  180

Query  1171  LGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA--------------------  1052
             LG+ GIA+S FVANF  L FLL Y+LY      +L  PL                     
Sbjct  181   LGVPGIAMSAFVANFNTLFFLLSYMLYMRVSKGSLSMPLLLSSTCQLSSPSPQQQQHHHQ  240

Query  1051  --TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
               T+LK +T++G+EW +L+R ++ SCL VCLEWWWYEFMT+LAGYL  P+V LATA IVI
Sbjct  241   DQTSLK-TTTLGKEWGMLIRFSIQSCLGVCLEWWWYEFMTILAGYLYNPRVALATAGIVI  299

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSLMYTLP+ALS S+S+RVGNELGAG+P +A+L+T +AI L+  +S  G+L TT+GRE
Sbjct  300   QTTSLMYTLPTALSASVSTRVGNELGAGQPERAKLSTIVAIGLSLASSILGLLWTTIGRE  359

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT+D+EVLELT++VLPIIG+CELANCPQTT CG+LRGSARP +GA INFYSFYL+
Sbjct  360   RWGRVFTSDSEVLELTMSVLPIIGVCELANCPQTTSCGILRGSARPGVGAGINFYSFYLV  419

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE----  350
             GAP+AI++AFVWKL   GLCYGLLAAQ+ACV+S+L+V+Y TDWE+ES +AK LVG     
Sbjct  420   GAPVAIVIAFVWKLGLVGLCYGLLAAQIACVVSILVVVYNTDWERESMKAKSLVGIFKSS  479

Query  349   -SRETSFEDPMIKFKEG  302
                +  + D  +K +EG
Sbjct  480   CDHDHHYGDQTVKCEEG  496



>gb|KEH37206.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/501 (62%), Positives = 396/501 (79%), Gaps = 14/501 (3%)
 Frame = -3

Query  1753  MAAKQTQK-HSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
             +A +++QK + T  EV++EL++M+D  FP+ AM ++ Y+KNMILVVCMG+LGSLELA GA
Sbjct  2     VAQEKSQKTYPTTAEVVDELKRMMDIGFPIAAMSIVGYLKNMILVVCMGKLGSLELASGA  61

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             LAIGFTN+TGYSVLSGLA+GMEP+ +QA GS+N ++VSL L+RTI MLL+ASLPI LLW 
Sbjct  62    LAIGFTNVTGYSVLSGLAMGMEPLCTQAIGSQNFSLVSLILRRTILMLLVASLPISLLWL  121

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
             NL+P ML LHQ+  I  IASL+C+ +IPDL+ANS LHP+RIYLR KGTTWPLLW T ++ 
Sbjct  122   NLEPFMLSLHQNQDITRIASLYCRLSIPDLIANSFLHPIRIYLRSKGTTWPLLWCTSLSV  181

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP------L  1055
             ++H+PI+ +LTF L LG+QGIAIS FVANF  L FLL Y+ Y +  + ++  P      L
Sbjct  182   IIHIPIIIFLTFKLHLGVQGIAISAFVANFNTLFFLLSYMFYMHISHVSISIPNPSPPLL  241

Query  1054  ATNLKSSTSI---GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
             ++  +  +S+   G+EW +L+R ++ SCL VCLEWWWYEFMT+LAGYL  P+V LATA I
Sbjct  242   SSQQQKPSSVKTLGKEWGMLIRFSIQSCLGVCLEWWWYEFMTILAGYLYNPRVALATAGI  301

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             VIQTTSLMYTLP+ALS S+S+RVGN LGAG+P KA L+T +AI ++  +S  G+L TTLG
Sbjct  302   VIQTTSLMYTLPTALSASVSTRVGNALGAGQPSKANLSTMVAIGMSLASSTLGLLWTTLG  361

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             RE W K+FT D EVLELT+ VLPIIG+CELANCPQTT CG+LRGSARP IGA INFYSFY
Sbjct  362   REKWGKVFTNDKEVLELTMAVLPIIGVCELANCPQTTSCGILRGSARPGIGAGINFYSFY  421

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG-ES  347
             L+GAP+ I++ FV KL   G CYGLLAAQ+ACV+S+L+V+Y TDWE+ES +AK LVG ++
Sbjct  422   LVGAPIGIVLGFVLKLGLVGFCYGLLAAQIACVVSILVVVYNTDWERESLKAKSLVGSDT  481

Query  346   RETSF---EDPMIKFKEGEEF  293
              +T F   ED +IK ++G  F
Sbjct  482   CDTLFAHVEDQIIKCEQGIVF  502



>ref|XP_010679100.1| PREDICTED: MATE efflux family protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=496

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/472 (65%), Positives = 379/472 (80%), Gaps = 4/472 (1%)
 Frame = -3

Query  1756  KMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
             K  +   Q  +T  EV+EEL+KM D   P++AMGL+ Y++NMILVVCMGRLGSLELAGGA
Sbjct  3     KSCSSTNQAEAT--EVVEELKKMSDIGLPIVAMGLVGYLRNMILVVCMGRLGSLELAGGA  60

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             LAIGFTNI+GYSVLSGLA+GMEP+ SQAFGS N++++++TL+RTI +LL ASLPIG+LWF
Sbjct  61    LAIGFTNISGYSVLSGLAMGMEPLCSQAFGSCNVSVLNITLRRTIILLLTASLPIGILWF  120

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
             NL+P M  LHQD  I  +ASL+C++AIPDL+A S LHPLRIYLR KGTTWPL+W TL+  
Sbjct  121   NLEPFMNKLHQDKDITCVASLYCRYAIPDLIAISFLHPLRIYLRSKGTTWPLMWCTLLPV  180

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN--L  1043
             ML++PI   L+F L LG++G+A++TF+ +F  +  LLGYI YTN + E +  PL +    
Sbjct  181   MLNIPIAILLSFKLHLGVRGLAVATFITDFNAVFLLLGYIFYTNSKKEPIGVPLLSQHTT  240

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
              S  S+G+EW  LL+L++PSCL VCLEWWWYE MTLLAGYL  PQVTLAT+AIVIQTTSL
Sbjct  241   DSKPSLGKEWRTLLQLSIPSCLGVCLEWWWYELMTLLAGYLEEPQVTLATSAIVIQTTSL  300

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYTLP+ALS S+S+RVG+ELGAG P KA L T +AI L   +S FG+LLTT GR VW  +
Sbjct  301   MYTLPTALSASVSTRVGHELGAGHPKKACLTTKLAIGLGLFSSLFGLLLTTFGRRVWGSV  360

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D  VL+LT  VLPIIGLCELANCPQTT CGVLRGSARP+IGA INFY+FY++G P+A
Sbjct  361   FTEDNAVLKLTAAVLPIIGLCELANCPQTTACGVLRGSARPSIGAGINFYAFYMVGTPVA  420

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             I++ FV KL + GLCYGLLAAQ+AC +S+L+VIY+T+WE ES +A DLVG +
Sbjct  421   IVLGFVLKLGYVGLCYGLLAAQIACAVSILVVIYKTNWETESLKAMDLVGRA  472



>ref|XP_010024720.1| PREDICTED: MATE efflux family protein 5 [Eucalyptus grandis]
Length=497

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 383/480 (80%), Gaps = 14/480 (3%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             ++ Q + T+PE +EEL++M D   P++A+ +++Y+KNM+ V  +GRLGSLELAGGALAIG
Sbjct  5     QRFQSYPTVPEAVEELKRMADIGIPILAVSIVNYLKNMVSVASIGRLGSLELAGGALAIG  64

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA+GMEP+ SQAFGS NL +V  TL+RTI MLL+AS+PIG LW NL+ 
Sbjct  65    FTNITGYSVLSGLAMGMEPLCSQAFGSNNLYLVHSTLRRTILMLLLASIPIGFLWVNLES  124

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             +ML L+Q   I  +A LFC+FA+PDLVANS+LHP RIYLR KGTTWPL+W +L+A ++H+
Sbjct  125   IMLILNQSPDIAQVAGLFCRFALPDLVANSLLHPSRIYLRSKGTTWPLMWCSLLAILVHI  184

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ----NE---------ALY  1064
             P+  +L F+L LGI GIAIS F  NF  LLFLL ++LY   +    NE          L 
Sbjct  185   PLTIFLAFTLDLGIPGIAISNFATNFNILLFLLLFMLYARTRAIAPNEEEIDMKVLLTLS  244

Query  1063  KPLATNLKS-STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
              P   +L + + S+ EEW  LL LA+PSCLAVCLEWWWYEFMT+LAGYL  P+V LATAA
Sbjct  245   HPWPVSLGAPNASLKEEWKQLLSLAIPSCLAVCLEWWWYEFMTILAGYLPHPRVALATAA  304

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             IVIQTTSL+Y+LP+ALS S+SSRVGNELGAGR  +ARLAT  A+ LA +AS FG+L TTL
Sbjct  305   IVIQTTSLLYSLPTALSASVSSRVGNELGAGRAYRARLATITALGLALVASLFGLLWTTL  364

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
             GR  W ++FT+D++VLELT+ VLP+IGLCELANCPQTT CGVLRGSARP++GA INF +F
Sbjct  365   GRRAWGRVFTSDSDVLELTMVVLPLIGLCELANCPQTTSCGVLRGSARPSVGAAINFCAF  424

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             YL+GAP+A+++AFV+ L F GLCYGLLAAQ+ACV SML+VIYRTDWE+ES +A DLVGE+
Sbjct  425   YLVGAPVALVLAFVYGLGFLGLCYGLLAAQIACVGSMLLVIYRTDWERESMKALDLVGEA  484



>ref|XP_010259729.1| PREDICTED: MATE efflux family protein 5 [Nelumbo nucifera]
Length=482

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/478 (62%), Positives = 366/478 (77%), Gaps = 9/478 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             EV+EEL++  D   P+ A+ L+ Y+KNMI VVCMGRLG+LE+AGGALAIGFTNITGYS+L
Sbjct  3     EVIEELKRTKDIALPIAAIALVGYLKNMISVVCMGRLGALEMAGGALAIGFTNITGYSIL  62

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEPI SQ FGS NL++V +TL RTI MLL AS+PIG LW NL+P+ML LHQ+ +
Sbjct  63    SGLAMGMEPICSQGFGSHNLSLVVITLLRTILMLLCASIPIGFLWVNLEPIMLKLHQNPE  122

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A L+C FA+PDL+ NS LHPLRIYLR KGTTWPL+W TL A +LH PI  +L F+L
Sbjct  123   ISQVAGLYCHFALPDLILNSFLHPLRIYLRSKGTTWPLMWCTLPAVLLHPPITIFLAFNL  182

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSS----TSIGEEWVI  1007
              LG+ GIAI+T + NF  LL L+ Y+  T   +E LY PL +   S     + +G EW  
Sbjct  183   GLGVSGIAIATIITNFNTLLLLVCYMFCTRTSDEPLYAPLLSPAASPPPTISLVGGEWGK  242

Query  1006  LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSI  827
             LLRL+LPSCLAVCLEWWWYEFMTL+AGYL  P+V+LAT+AIVIQTTSLMYTLP+A+  S 
Sbjct  243   LLRLSLPSCLAVCLEWWWYEFMTLVAGYLYNPRVSLATSAIVIQTTSLMYTLPTAVGASA  302

Query  826   SSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltv  647
             S+RVGNELGAGR  KARLAT +++ LA   S  G L  +LGRE W ++FT D +VLELT+
Sbjct  303   STRVGNELGAGRANKARLATIVSMALAVAVSVVGFLWCSLGREAWGRVFTQDAQVLELTM  362

Query  646   tvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFK  467
               LPIIGLCEL NCPQTT CGVLRGSARP +GA INFY+FYL+G P+A+++ FV ++ F 
Sbjct  363   VALPIIGLCELGNCPQTTGCGVLRGSARPTVGAAINFYAFYLVGTPVALVLTFVLEMGFT  422

Query  466   GLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEF  293
             GLCYGLLAAQ+ C +S++ VI RTDW++ES+ A+DLVG     + ED     +E + F
Sbjct  423   GLCYGLLAAQIVCALSIVTVICRTDWDRESSNARDLVG-----THEDQTTTSREQDAF  475



>gb|EPS72185.1| hypothetical protein M569_02572, partial [Genlisea aurea]
Length=457

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/457 (65%), Positives = 374/457 (82%), Gaps = 1/457 (0%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +V EEL+ + D  FP++ MG+++Y+KNMI V CMGRLGSLELAGGALAIGFTNITGYSVL
Sbjct  1     QVTEELKSIADIGFPVLVMGILNYLKNMISVACMGRLGSLELAGGALAIGFTNITGYSVL  60

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEP+ SQAFGSKN ++V+++LQRTI +LL AS+PIG++W  L+P+ML LHQ+ +
Sbjct  61    SGLAMGMEPLCSQAFGSKNYSMVTVSLQRTIILLLFASIPIGIIWIYLEPIMLLLHQEPQ  120

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I+  ASL+C+FA+PDLVANS+LHPLRIY+R KGTTWPLLWS+L++T+LH PI  + TF  
Sbjct  121   IVRAASLYCRFAVPDLVANSLLHPLRIYIRNKGTTWPLLWSSLLSTLLHGPITIFFTFHQ  180

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL-ATNLKSSTSIGEEWVILLR  998
              LGI+GIA+STF++N   L FL+  I ++N++N  L KPL     K ++S   EW +L+R
Sbjct  181   HLGIRGIAVSTFISNINFLFFLICCIHHSNDENLPLSKPLLMPPNKLTSSCWNEWGLLVR  240

Query  997   LALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSR  818
             +A PSCL VCLEWWWYE MTL++GYL  PQV L+T+AIVIQTTSLMYTLPSALS SIS+R
Sbjct  241   MAGPSCLGVCLEWWWYELMTLMSGYLDNPQVALSTSAIVIQTTSLMYTLPSALSASISTR  300

Query  817   VGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvL  638
             VGNELGAGRP KA+LATA+AI LAF +S  G LLTT+GR  W ++FT   +VL+LT  VL
Sbjct  301   VGNELGAGRPKKAKLATAVAIALAFSSSIVGFLLTTIGRRAWAEVFTNQNKVLQLTTAVL  360

Query  637   PIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLC  458
             P+IGLCELANCPQTT CGVLRGSARP+IGA I F+SFY++GAP+A++ AF  KL F GLC
Sbjct  361   PVIGLCELANCPQTTGCGVLRGSARPSIGAVIIFFSFYMLGAPVALVFAFFLKLGFLGLC  420

Query  457   YGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             YGLLAAQ+AC+IS+L V+ +TDW  ES RA  L+ ES
Sbjct  421   YGLLAAQIACLISILAVLLKTDWHNESLRATKLMSES  457



>ref|XP_002863962.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40221.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/496 (60%), Positives = 379/496 (76%), Gaps = 7/496 (1%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q + + T+PEV+EE++++ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINLQHKYNPTMPEVVEEMKRIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPSLASLTLKRTIFLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLNLTPLMLMLRQQQDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE-------A  1070
             L++ +LHLPI  + TF + LG+ G+AIS+F+ NFI L  LL YI   N  N+        
Sbjct  184   LVSVLLHLPITAFFTFYISLGVAGVAISSFLTNFISLSLLLCYIYLENNNNDKTSSKSLC  243

Query  1069  LYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATA  890
             L  PL  +    + + E W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA A
Sbjct  244   LDTPLMLSGSRDSGVDEVWSTLVKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPKVALAAA  303

Query  889   AIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTT  710
             AIVIQTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A A+A+  A   S FG++ TT
Sbjct  304   AIVIQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAAAVAVGAAMAVSVFGLVGTT  363

Query  709   LGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYS  530
             LGRE W K+FT D  VLELT  VLP+IG CELANCPQT  CG+LRGSARP IGA INFY+
Sbjct  364   LGREAWGKVFTADGVVLELTAAVLPVIGACELANCPQTISCGILRGSARPGIGAKINFYA  423

Query  529   FYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
             FY++GAP+A+++AFVW L F GLCYGLL AQ+AC IS+LIV+Y TDW KES +A DLVG+
Sbjct  424   FYVVGAPVAVVLAFVWGLGFMGLCYGLLGAQLACAISILIVVYNTDWNKESLKAHDLVGK  483

Query  349   SRETSFEDPMIKFKEG  302
             +  +  +  ++K +EG
Sbjct  484   NVISHVDQIIVKCEEG  499



>ref|XP_008223218.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 5 
[Prunus mume]
Length=511

 Score =   534 bits (1375),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 318/504 (63%), Positives = 404/504 (80%), Gaps = 21/504 (4%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             AA+Q++K+ T+PEV+EEL++M D  FP+ AM L+ Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  4     AAEQSRKYPTMPEVVEELKRMTDIGFPIAAMSLVGYLKNMVLVVCMGRLGSLELAGGALA  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I  LTL+RTI +LL+ SLPI LLW NL
Sbjct  64    IGFTNITGYSVLSGLAMGMEPLCSQAFGSQNFSIAFLTLKRTILLLLLTSLPIALLWANL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML LHQ+  I  IASL+CQFAIPDL+ANS+LHP+RI+LR + TTWPL+W TL+A +L
Sbjct  124   EPLMLLLHQNPDITRIASLYCQFAIPDLIANSLLHPIRIFLRSQSTTWPLMWCTLLAIVL  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY-----------  1064
             HLP+  +LTF+L LG++GIAIS+ ++NFI L F LGY++Y +   E  Y           
Sbjct  184   HLPLTIFLTFTLSLGVKGIAISSSLSNFITLFFFLGYMVYAHVLKERKYCWLLSTTNSEP  243

Query  1063  -----KP-LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
                  +P L  NL  +    ++W +L+RL++ SCLAVCLEWWWYEFMTLLAGYL +P + 
Sbjct  244   APILSQPILPKNLVPTELGADQWRMLIRLSIQSCLAVCLEWWWYEFMTLLAGYLHKPHIA  303

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             LAT+AIVIQTTSLMYTLP++LS S+S+RVGNELGAG+P KARLA  +A+ +A ++S  G+
Sbjct  304   LATSAIVIQTTSLMYTLPTSLSASVSTRVGNELGAGQPKKARLAAVVAVGMALVSSLLGL  363

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
              LTTLGRE W +IFT D EVLELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA I
Sbjct  364   SLTTLGRETWGRIFTKDGEVLELTMAVLPIIGLCELANCPQTTSCGILRGSARPGIGAWI  423

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             NFYSFY++GAP+AI+MAFVW+L F+GLCYGLLAAQ+ CVIS+L V+++TDWE+E  ++++
Sbjct  424   NFYSFYMVGAPVAIVMAFVWRLGFQGLCYGLLAAQITCVISILTVVHKTDWEREWLKSRE  483

Query  361   LVG--ESRETSF--EDPMIKFKEG  302
              VG  +SR  +F   D  +K +EG
Sbjct  484   FVGRSKSRVAAFPHADETVKCEEG  507



>emb|CDY00039.1| BnaC09g02620D [Brassica napus]
Length=498

 Score =   530 bits (1365),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 294/494 (60%), Positives = 379/494 (77%), Gaps = 6/494 (1%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q +   T+PEV+EE++K+ +  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINLQHKYKQTMPEVVEEMKKIWNISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN  + SLTL+RTI +L++ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPQLASLTLKRTIFLLILASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKG TWPL+W T
Sbjct  124   LLWLNLQPLMLILRQQQDITRVASLYCSFSLPDLIANSFLHPLRIYLRCKGNTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYT--NEQNEALYKPL  1055
             L++ +LHLP+  + TF + LG+ G+A+S+F+ NFI L  LL YI +   N     L  PL
Sbjct  184   LVSVLLHLPVTAFFTFYISLGVAGVAVSSFLTNFISLSLLLCYIYFDEHNRDETTLSTPL  243

Query  1054  ATNLKSSTSIG--EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                +  S+  G  E W  L++LA+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AAIV
Sbjct  244   VL-ISGSSDFGNDEVWSTLVKLAVPSCIAVCLEWWWYEFMTILAGYLPEPKVALAVAAIV  302

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYTLP+ALS ++S+RV NELGAGRP KA+ A A+AI  A   S FG++ TT+GR
Sbjct  303   IQTTSLMYTLPTALSAAVSTRVSNELGAGRPEKAKTAAAVAIGAAVAVSVFGLVGTTMGR  362

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             + W ++FT+D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+FY+
Sbjct  363   KAWGRVFTSDGVVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKINFYAFYV  422

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A+++AF+W L+F GLCYGLL AQ+ C IS+L V+Y+TDW KES +A DLVG++  
Sbjct  423   VGAPVAVVLAFMWGLDFMGLCYGLLGAQIVCAISILTVVYKTDWNKESLKAHDLVGKNVI  482

Query  340   TSFEDPMI-KFKEG  302
                 D +I K +EG
Sbjct  483   LPDVDQVIVKCEEG  496



>emb|CDX86253.1| BnaA06g29700D [Brassica napus]
Length=499

 Score =   527 bits (1358),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 293/505 (58%), Positives = 379/505 (75%), Gaps = 13/505 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +Q+  +   Q +   T+PEV+EE++K+ D  FP+ AM L++Y+KNM  V CMGRLGSLEL
Sbjct  4     EQDSSLTNLQHKYSPTMPEVVEEMKKIWDISFPVAAMSLLNYLKNMTSVACMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPSLASLTLKRTIFLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW +L+PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLSLQPLMLILRQQEDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfll----gyilYTNEQNEALYK  1061
             L++ +LHLPI  + TF + LG+ G+A+S+F+ NFI LL LL         +++ +  L  
Sbjct  184   LVSVLLHLPITAFFTFYISLGVAGVAVSSFLTNFISLLLLLCYIYFEEHKSDKTSSCLKT  243

Query  1060  PLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             PL  +    +   E W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AAIV
Sbjct  244   PLLLSSSRDSCNDEVWSTLIKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPRVALAAAAIV  303

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A A+A+V A   S FG++ TT+GR
Sbjct  304   IQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAAAVAVVAAVAVSVFGLVGTTVGR  363

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             + W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+FY+
Sbjct  364   KAWGRVFTADGVVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKINFYAFYV  423

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A+I+AFVW L F GLCYGLL AQ+ C IS+L V+Y+TDW KES +A DLVG++  
Sbjct  424   VGAPVAVILAFVWGLNFMGLCYGLLGAQIVCAISILTVVYKTDWNKESLKAHDLVGKN--  481

Query  340   TSFEDPMIKFKEGEEFRISFEEGVN  266
                    +   + ++  +  EEG++
Sbjct  482   -------VILPDIDQIIVKCEEGIH  499



>ref|NP_199724.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAO85438.1|AF488694_1 putative transporter NIC3 [Arabidopsis thaliana]
 dbj|BAB10095.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95774.1| MATE efflux family protein [Arabidopsis thaliana]
Length=502

 Score =   527 bits (1357),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 296/497 (60%), Positives = 375/497 (75%), Gaps = 8/497 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q + + T+PEV+EEL+++ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINLQHKYNPTMPEVVEELKRIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALAIGFTNITGYSVLSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAIGFTNITGYSVLSGLATGMEPLCGQAIGSKNPSLASLTLKRTIFLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLNLAPLMLMLRQQHDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE-------A  1070
             L++ +LHLPI  + TF + LG+ G+A+S+F+ NFI L  LL YI   N  N+        
Sbjct  184   LVSVLLHLPITAFFTFYISLGVPGVAVSSFLTNFISLSLLLCYIYLENNNNDKTTSKSLC  243

Query  1069  LYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATA  890
             L  PL       +   + W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA A
Sbjct  244   LDTPLMLYGSRDSGENDVWSTLVKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPKVALAAA  303

Query  889   AIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTT  710
             AIVIQTTSLMYT+P+ALS ++S+RV NELGAGRP KA+ A  +A+  A   S FG++ TT
Sbjct  304   AIVIQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKAKTAATVAVGAAVAVSVFGLVGTT  363

Query  709   LGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYS  530
             +GRE W K+FT D  VLELT  V+P+IG CELANCPQT  CG+LRGSARP IGA INFY+
Sbjct  364   VGREAWGKVFTADKVVLELTAAVIPVIGACELANCPQTISCGILRGSARPGIGAKINFYA  423

Query  529   FYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
             FY++GAP+A+++AFVW L F GLCYGLL AQ+AC IS+L V+Y TDW KES +A DLVG+
Sbjct  424   FYVVGAPVAVVLAFVWGLGFMGLCYGLLGAQLACAISILTVVYNTDWNKESLKAHDLVGK  483

Query  349   SRETSFEDPMI-KFKEG  302
             +  +   D +I K +EG
Sbjct  484   NVISPNVDQIIVKCEEG  500



>ref|XP_009151712.1| PREDICTED: MATE efflux family protein 5 [Brassica rapa]
Length=501

 Score =   525 bits (1352),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 295/507 (58%), Positives = 381/507 (75%), Gaps = 15/507 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++  +   Q +   T+PEV+EE++K+ D  FP+ AM L++Y+KNM  V CMGRLGSLEL
Sbjct  4     EEDSSLTNLQHKYSPTMPEVVEEMKKIWDISFPVAAMSLLNYLKNMTSVACMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPSLASLTLKRTIFLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW +L+PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLSLQPLMLILRQQEDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEA------L  1067
             LI+ +LHLPI  + TF + LG+ G+A+S+F+ NFI LL LL YI     +++       L
Sbjct  184   LISVLLHLPITAFFTFYISLGVAGVAVSSFLTNFISLLLLLCYIYLEEHKSDKTSSSLCL  243

Query  1066  YKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
               PL  +   ++   E W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AA
Sbjct  244   KMPLLQSSSRNSCNDEVWSTLIKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPRVALAAAA  303

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             IVIQTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A A+A+V A   S FG++ TT+
Sbjct  304   IVIQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAAAVAVVAAVAVSVFGLVGTTV  363

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
             GR+ W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+F
Sbjct  364   GRKAWGRVFTADGFVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKINFYAF  423

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             Y++GAP+A+I+AFVW L F GLCYGLL AQ+ C IS+L V+Y+TDW KES +A DLVG++
Sbjct  424   YVVGAPVAVILAFVWGLNFMGLCYGLLGAQIVCAISILTVVYKTDWNKESLKAHDLVGKN  483

Query  346   RETSFEDPMIKFKEGEEFRISFEEGVN  266
                      +   + ++  +  EEG++
Sbjct  484   ---------VILPDIDQIIVKCEEGIH  501



>emb|CDY67295.1| BnaA09g52270D [Brassica napus]
Length=498

 Score =   523 bits (1348),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 294/494 (60%), Positives = 378/494 (77%), Gaps = 6/494 (1%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q +   T+PEV+EE++K+ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLKNLQHKYKQTMPEVVEEMKKIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN  + SLTL+RTI +L++ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPQLASLTLKRTIFLLILASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKG TWPL+W T
Sbjct  124   LLWLNLQPLMLILRQQQDITRVASLYCSFSLPDLIANSFLHPLRIYLRCKGNTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE--ALYKPL  1055
             L++ +LHLP+  + TF + LG+ G+A+S+F+ NFI L  LL YI +    N+  +L  PL
Sbjct  184   LVSVLLHLPVTAFFTFYISLGVAGVAVSSFLTNFIALSLLLCYIYFEEHNNDETSLKTPL  243

Query  1054  ATNLKSSTSIG--EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                +  S+  G  E W  L++LA+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AAIV
Sbjct  244   VL-MSGSSDFGNDEVWSTLVKLAVPSCIAVCLEWWWYEFMTILAGYLPEPKVALAAAAIV  302

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYT+P+ALS ++S+RV NELGAGRP KA+ A A+AI  A   S FG++ TT+GR
Sbjct  303   IQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKAKTAAAVAIGAAVAVSVFGLVATTMGR  362

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             + W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+FY+
Sbjct  363   KAWGRVFTADEVVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKINFYAFYV  422

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A+++AF W L+F GLCYGLL AQ+ C IS+L V+Y TDW KES +A DLVG++  
Sbjct  423   VGAPVAVVLAFRWGLDFMGLCYGLLGAQIVCTISILTVVYTTDWNKESLKAHDLVGKNVI  482

Query  340   TSFEDPMI-KFKEG  302
                 D +I K +EG
Sbjct  483   LPDVDQVIVKCEEG  496



>ref|XP_009111866.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Brassica 
rapa]
Length=498

 Score =   523 bits (1346),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 293/494 (59%), Positives = 378/494 (77%), Gaps = 6/494 (1%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q +   T+PEV+EE++K+ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINLQHKYKQTMPEVVEEMKKIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN  + SLTL+RTI +L++ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPQLASLTLKRTIFLLILASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+PLML L Q   I  +ASL+  F++PDL+ANS LHPLRIYLRCKG TWPL+W T
Sbjct  124   LLWLNLQPLMLILRQQQDITRVASLYSSFSLPDLIANSFLHPLRIYLRCKGNTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE--ALYKPL  1055
             L++ +LHLP+  + TF + LG+ G+A+S+F+ NFI L  LL YI +    N+  +L  PL
Sbjct  184   LVSVLLHLPVTAFFTFYISLGVAGVAVSSFLTNFIALSLLLCYIYFEEHNNDETSLKTPL  243

Query  1054  ATNLKSSTSIG--EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                +  S+  G  E W  L++LA+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AAIV
Sbjct  244   VL-MSGSSDFGNDEVWSTLVKLAVPSCIAVCLEWWWYEFMTILAGYLPEPKVALAAAAIV  302

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYT+P+ALS ++S+RV NELGAGRP KA+ A A+AI  A   S FG++ TT+GR
Sbjct  303   IQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKAKTAAAVAIGAAVAVSVFGLVATTMGR  362

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             + W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+FY+
Sbjct  363   KAWGRVFTADEVVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKINFYAFYV  422

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A+++AF W L+F GLCYGLL AQ+ C IS+L V+Y+TDW KES +A DLVG++  
Sbjct  423   VGAPVAVVLAFRWGLDFMGLCYGLLGAQIVCAISILTVVYKTDWNKESLKAHDLVGKNVI  482

Query  340   TSFEDP-MIKFKEG  302
                 D  +IK +EG
Sbjct  483   LPVVDQVIIKCEEG  496



>ref|XP_009111865.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Brassica 
rapa]
Length=507

 Score =   522 bits (1344),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 293/494 (59%), Positives = 378/494 (77%), Gaps = 6/494 (1%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q +   T+PEV+EE++K+ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINLQHKYKQTMPEVVEEMKKIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN  + SLTL+RTI +L++ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPQLASLTLKRTIFLLILASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+PLML L Q   I  +ASL+  F++PDL+ANS LHPLRIYLRCKG TWPL+W T
Sbjct  124   LLWLNLQPLMLILRQQQDITRVASLYSSFSLPDLIANSFLHPLRIYLRCKGNTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE--ALYKPL  1055
             L++ +LHLP+  + TF + LG+ G+A+S+F+ NFI L  LL YI +    N+  +L  PL
Sbjct  184   LVSVLLHLPVTAFFTFYISLGVAGVAVSSFLTNFIALSLLLCYIYFEEHNNDETSLKTPL  243

Query  1054  ATNLKSSTSIG--EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                +  S+  G  E W  L++LA+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AAIV
Sbjct  244   VL-MSGSSDFGNDEVWSTLVKLAVPSCIAVCLEWWWYEFMTILAGYLPEPKVALAAAAIV  302

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYT+P+ALS ++S+RV NELGAGRP KA+ A A+AI  A   S FG++ TT+GR
Sbjct  303   IQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKAKTAAAVAIGAAVAVSVFGLVATTMGR  362

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             + W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+FY+
Sbjct  363   KAWGRVFTADEVVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKINFYAFYV  422

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+A+++AF W L+F GLCYGLL AQ+ C IS+L V+Y+TDW KES +A DLVG++  
Sbjct  423   VGAPVAVVLAFRWGLDFMGLCYGLLGAQIVCAISILTVVYKTDWNKESLKAHDLVGKNVI  482

Query  340   TSFEDP-MIKFKEG  302
                 D  +IK +EG
Sbjct  483   LPVVDQVIIKCEEG  496



>emb|CDX85394.1| BnaC07g27050D [Brassica napus]
Length=501

 Score =   520 bits (1340),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 293/507 (58%), Positives = 377/507 (74%), Gaps = 15/507 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++  +   Q     T+PEV+EE++K+ D  FP+ AM L++Y+KNM  V CMGRLGSLEL
Sbjct  4     EEDSSLTNLQHNYSPTMPEVVEEMKKIWDISFPVAAMSLLNYLKNMTSVACMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQALGSKNPSLASLTLKRTIFLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW +L+PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLSLQPLMLILRQQEDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEA------L  1067
             L + +LH PI  + TF + LG+ G+A+S+F+ NFI LL LL YI     +++       L
Sbjct  184   LASVLLHFPITAFFTFYISLGVTGVAVSSFLTNFISLLLLLCYIYLEEHKSDKTSSSLCL  243

Query  1066  YKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
               PL  +    +   E W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AA
Sbjct  244   KMPLLLSSSRDSCNDEVWSTLIKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPRVALAAAA  303

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             IVIQTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A A+A+V A   S FG++ TT+
Sbjct  304   IVIQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAAAVAVVAAVAVSVFGLVGTTV  363

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
             GR+ W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA INFY+F
Sbjct  364   GRKAWGRVFTADGVVLELTAAVLPVIGACELANCPQTTGCGILRGSARPRVGAKINFYAF  423

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             Y++GAP+A+I+AFVW L F GLCYGLL AQ+ C IS+L V+Y+TDW KES +A DLVG++
Sbjct  424   YVVGAPVAVILAFVWGLNFMGLCYGLLGAQIVCAISILTVVYKTDWNKESLKAHDLVGKN  483

Query  346   RETSFEDPMIKFKEGEEFRISFEEGVN  266
                      +   + ++  +  EEG++
Sbjct  484   ---------VILPDIDQIIVQCEEGIH  501



>ref|XP_007227723.1| hypothetical protein PRUPE_ppa004410mg [Prunus persica]
 gb|EMJ28922.1| hypothetical protein PRUPE_ppa004410mg [Prunus persica]
Length=511

 Score =   516 bits (1328),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 317/504 (63%), Positives = 404/504 (80%), Gaps = 21/504 (4%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             AA+Q++K+ T+PEV+EEL++M D  FP+ AM L+ Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  4     AAEQSRKYPTMPEVVEELKRMTDIGFPIAAMSLVGYLKNMVLVVCMGRLGSLELAGGALA  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I  LTL+RTI +LL+ SLPI LLW NL
Sbjct  64    IGFTNITGYSVLSGLAMGMEPLCSQAFGSQNFSIAFLTLKRTILLLLLTSLPIALLWANL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML LHQ+  I  IASL+CQFAIPDL+ANS+LHP+RI+LR + TTWPL+W TL+A +L
Sbjct  124   EPLMLLLHQNPDITRIASLYCQFAIPDLLANSLLHPIRIFLRSQSTTWPLMWCTLLAIVL  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY-----------  1064
             HLP+  +LTF+L LG++GIAIS+ ++NFI L F LGY++Y +   E  Y           
Sbjct  184   HLPLTIFLTFTLSLGVKGIAISSSLSNFITLFFFLGYMVYDHVLKERKYCWLLSTTNSEP  243

Query  1063  -----KPLATNLKSSTSIG-EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
                  +PL       T +G ++W +L+RL++ SCLAVCLEWWWYEFMTLLAGYL +P + 
Sbjct  244   APILSQPLLPKNLVPTELGADQWRMLIRLSIQSCLAVCLEWWWYEFMTLLAGYLHKPHIA  303

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             LAT+AIVIQTTSLMYTLP++LS S+S+RVGNELGAG+P KARLA  +A+ +A ++S  G+
Sbjct  304   LATSAIVIQTTSLMYTLPTSLSASVSTRVGNELGAGQPKKARLAAVVAVGVALVSSLLGL  363

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
              LTTLGRE W +IFT D EVLELT+ VLPIIGLCELANCPQTT CG+LRGSARP IGA I
Sbjct  364   SLTTLGRETWGRIFTEDGEVLELTMAVLPIIGLCELANCPQTTSCGILRGSARPGIGAWI  423

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             NFYSFY++GAP+A++MAFVW+L F+GLCYGLLAAQ+ CVIS+L V+++TDWE+E  ++++
Sbjct  424   NFYSFYMVGAPVAVVMAFVWRLGFQGLCYGLLAAQITCVISILTVVHKTDWEREWLKSRE  483

Query  361   LVGES--RETSF--EDPMIKFKEG  302
              VG+S  R  +F   D  +K +EG
Sbjct  484   FVGKSNNRVAAFPHADETVKCEEG  507



>ref|XP_006395092.1| hypothetical protein EUTSA_v10004047mg [Eutrema salsugineum]
 gb|ESQ32378.1| hypothetical protein EUTSA_v10004047mg [Eutrema salsugineum]
Length=506

 Score =   513 bits (1320),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 287/501 (57%), Positives = 371/501 (74%), Gaps = 12/501 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             ++  ++   Q + + T+PEV+EE++K+ D  FP+ AM +++Y+KNM  VV MGRLGSLEL
Sbjct  4     EENSRLINLQHKYNPTMPEVVEEMKKIWDISFPVAAMSILNYLKNMTSVVFMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN ++ S TL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPSLASSTLKRTIFLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLNLQPLMLILRQQQDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigll----------fllgyilYTNEQ  1079
             L++ +LHLPI  + TF + LG+ G+AIS+F+ NFI L                       
Sbjct  184   LVSVLLHLPITAFFTFYVSLGVAGVAISSFLTNFISLSLLLCYIYLEDNKNNNNNDKTSS  243

Query  1078  NEALYKPLATNLKSSTSIGEE-WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
             +  L  PL  +    +S  +E W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P V 
Sbjct  244   SLCLKTPLMLSGSRDSSCDDEVWSTLVKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPTVA  303

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             LA AAIVIQTTSL+YT+P+ALS ++S+RV NELGAGRP KAR A  +A+  A   S  G+
Sbjct  304   LAAAAIVIQTTSLLYTIPTALSAAVSTRVSNELGAGRPEKARTAAVVAVGAAVAVSVLGL  363

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
             + TT+GR+ W ++FT D  VLELT  VLP+IG CELANCPQTT CG+LRGSARP +GA I
Sbjct  364   VGTTVGRKAWGRVFTADGVVLELTAAVLPVIGACELANCPQTTSCGILRGSARPRVGAKI  423

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             NFY+FY++GAP+A+++AFVW L F GLCYGLL AQ+AC +S+L V+Y+TDW KES++A D
Sbjct  424   NFYAFYVVGAPVAVVLAFVWGLGFMGLCYGLLGAQLACAVSILTVVYKTDWNKESSKAHD  483

Query  361   LVGESRETSFEDPMI-KFKEG  302
             LVG++  +   D +I K +EG
Sbjct  484   LVGKNVISPDTDQIIVKCEEG  504



>ref|XP_009352294.1| PREDICTED: MATE efflux family protein 5 [Pyrus x bretschneideri]
Length=518

 Score =   512 bits (1319),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 315/519 (61%), Positives = 396/519 (76%), Gaps = 31/519 (6%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             AA+Q+QK+ T+ EV+EEL +M    FP+ AM L+ Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  4     AAEQSQKYPTMAEVVEELHRMTHIGFPIAAMSLVGYLKNMVLVVCMGRLGSLELAGGALA  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I   TLQRTI +LL+ SL I LLW NL
Sbjct  64    IGFTNITGYSVLSGLAMGMEPLCSQAFGSQNFSIAFHTLQRTILLLLLTSLLIALLWSNL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PL+  LHQ+  I  IASL+CQFAIPDLV NS+LHP+RI+LR + TTWPL+WSTL+A +L
Sbjct  124   EPLLFLLHQNQDITRIASLYCQFAIPDLVTNSLLHPIRIFLRSQSTTWPLMWSTLLAIIL  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN------------------  1085
             H+P+  +LTF+L LG++GIAIST + NFI L FL+GY++Y +                  
Sbjct  184   HIPLTIFLTFNLSLGVKGIAISTSLTNFITLFFLVGYMVYAHITKKPFYCLVADQCEPTT  243

Query  1084  --EQNEALYKPLATNLKSSTSI-----GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAG  926
               + ++ LY+PL        S+      +EW +L+RLAL SCL VCLEWWWYEFMT+LAG
Sbjct  244   KYDTSQTLYQPLLPKKVVPLSLRKVLGDDEWRMLIRLALQSCLGVCLEWWWYEFMTILAG  303

Query  925   YLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLA  746
             YL +P + LAT+AIVIQTTSLMYTLP+ LS S+S+RVGNELGAGRP KARLA  +A+ +A
Sbjct  304   YLHKPHIALATSAIVIQTTSLMYTLPTTLSASVSTRVGNELGAGRPKKARLAAVVAVGMA  363

Query  745   FLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSA  566
              ++S  G+LLTTLGRE W +IFT D EVLELT+ VLPI+GLCE+ANC QTT CG+LRGSA
Sbjct  364   LMSSLLGLLLTTLGREAWGRIFTDDNEVLELTMGVLPIVGLCEIANCSQTTSCGILRGSA  423

Query  565   RPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWE  386
             RP IGA INFYSFY++GAP+AI++ FVW+L FKGLCYGLLAAQV CV+S+L V+++TDWE
Sbjct  424   RPGIGAWINFYSFYMVGAPVAIVLTFVWRLGFKGLCYGLLAAQVTCVVSILTVVHKTDWE  483

Query  385   KESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEGV  269
             KE  + K+ VG++        M  F   +E  +  EEGV
Sbjct  484   KEWLKTKEFVGKNNHG-----MAAFAHADE-TVKCEEGV  516



>ref|XP_008340791.1| PREDICTED: MATE efflux family protein 5 [Malus domestica]
Length=519

 Score =   507 bits (1306),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 312/519 (60%), Positives = 396/519 (76%), Gaps = 32/519 (6%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             AA+ + K  T+PEV+EEL +M +  FP+ AM L+ Y+KNM+LVVCMGRLGSLELAGGAL 
Sbjct  4     AAEPSHKCPTMPEVVEELHRMXNIGFPIAAMSLVGYLKNMVLVVCMGRLGSLELAGGALG  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I   TLQRTI +LL+ SLPI LLW NL
Sbjct  64    IGFTNITGYSVLSGLAMGMEPLCSQAFGSQNFSIAFHTLQRTILLLLLTSLPIXLLWANL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PLML LHQ+  I  IASL+CQFAIPDL+ANS+LHP+RI+ R + TTWPL+WSTL+A +L
Sbjct  124   EPLMLLLHQNQDITKIASLYCQFAIPDLLANSLLHPIRIFFRSQSTTWPLMWSTLLAXIL  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY-----------  1064
             H+P+  +LTF+L LGI+GIAIST + NFI L FLLGY++Y +   +++Y           
Sbjct  184   HIPLTIFLTFNLSLGIKGIAISTSLTNFITLFFLLGYVVYAHVTKKSIYCLVTDQCEPTT  243

Query  1063  ---------KPL------ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLA  929
                      +PL        +L+ +    +EW IL+RLA  SCL VCLEWWWYEFMT+L 
Sbjct  244   KYETTQLLSQPLLPKKIXPLSLRKTLVGADEWRILIRLAFQSCLGVCLEWWWYEFMTILT  303

Query  928   GYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVL  749
             GYL +P + LA +AIVIQTTSLMYTLP+ALS S+S+RVGNELGAG+P KA LA  +A+ +
Sbjct  304   GYLQKPHIALAASAIVIQTTSLMYTLPAALSASVSTRVGNELGAGQPKKAHLAAVVAVGM  363

Query  748   AFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGS  569
             A ++S  G+ LTTLGR VW +IFT D+EVLELT++VLPIIGLCE+ANCPQTT CG+LRGS
Sbjct  364   ALVSSLLGLSLTTLGRGVWGRIFTNDSEVLELTMSVLPIIGLCEIANCPQTTSCGILRGS  423

Query  568   ARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDW  389
             ARP IGA INFYSFY++G P+AI++ FVW+L FKGLCYGLLAAQ+ CV+S+L V+++TDW
Sbjct  424   ARPGIGAWINFYSFYMVGTPVAIVLTFVWRLGFKGLCYGLLAAQITCVVSILTVVHKTDW  483

Query  388   EKESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEG  272
             E+E  + K+LVG++      D M  F   +E  +  EEG
Sbjct  484   ERECLKTKELVGKNN-----DRMAAFAHADE-TVKCEEG  516



>gb|KCW61189.1| hypothetical protein EUGRSUZ_H03952 [Eucalyptus grandis]
Length=456

 Score =   505 bits (1300),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 274/420 (65%), Positives = 335/420 (80%), Gaps = 14/420 (3%)
 Frame = -3

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA+GMEP+ SQAFGS NL +V  TL+RTI MLL+AS+PIG LW NL+ 
Sbjct  24    FTNITGYSVLSGLAMGMEPLCSQAFGSNNLYLVHSTLRRTILMLLLASIPIGFLWVNLES  83

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             +ML L+Q   I  +A LFC+FA+PDLVANS+LHP RIYLR KGTTWPL+W +L+A ++H+
Sbjct  84    IMLILNQSPDIAQVAGLFCRFALPDLVANSLLHPSRIYLRSKGTTWPLMWCSLLAILVHI  143

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ----NE---------ALY  1064
             P+  +L F+L LGI GIAIS F  NF  LLFLL ++LY   +    NE          L 
Sbjct  144   PLTIFLAFTLDLGIPGIAISNFATNFNILLFLLLFMLYARTRAIAPNEEEIDMKVLLTLS  203

Query  1063  KPLATNLKS-STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
              P   +L + + S+ EEW  LL LA+PSCLAVCLEWWWYEFMT+LAGYL  P+V LATAA
Sbjct  204   HPWPVSLGAPNASLKEEWKQLLSLAIPSCLAVCLEWWWYEFMTILAGYLPHPRVALATAA  263

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             IVIQTTSL+Y+LP+ALS S+SSRVGNELGAGR  +ARLAT  A+ LA +AS FG+L TTL
Sbjct  264   IVIQTTSLLYSLPTALSASVSSRVGNELGAGRAYRARLATITALGLALVASLFGLLWTTL  323

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
             GR  W ++FT+D++VLELT+ VLP+IGLCELANCPQTT CGVLRGSARP++GA INF +F
Sbjct  324   GRRAWGRVFTSDSDVLELTMVVLPLIGLCELANCPQTTSCGVLRGSARPSVGAAINFCAF  383

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             YL+GAP+A+++AFV+ L F GLCYGLLAAQ+ACV SML+VIYRTDWE+ES +A DLVGE+
Sbjct  384   YLVGAPVALVLAFVYGLGFLGLCYGLLAAQIACVGSMLLVIYRTDWERESMKALDLVGEA  443



>ref|XP_008360270.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=518

 Score =   505 bits (1301),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 316/519 (61%), Positives = 395/519 (76%), Gaps = 31/519 (6%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             AA+Q+QK+ T+ EV+EEL +M    FP+ A  L  Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  4     AAEQSQKYPTMAEVVEELHRMTHIGFPIAAXXLAGYLKNMVLVVCMGRLGSLELAGGALA  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I   TLQRTI +LL+ SL I LLW NL
Sbjct  64    IGFTNITGYSVLSGLAMGMEPLCSQAFGSQNFSIAFHTLQRTILLLLLTSLLIALLWSNL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PL+L LHQ+  I  IASL+CQFAIPDLV NS LHP+RI+LR + TTWPL+WSTL+A +L
Sbjct  124   EPLLLLLHQNQDITRIASLYCQFAIPDLVTNSFLHPIRIFLRSQSTTWPLMWSTLLAIIL  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN------------------  1085
             H+P+  +LTF+L LG++GIAIST + NFI L FL+GY++Y +                  
Sbjct  184   HIPLTIFLTFTLTLGVKGIAISTSLTNFITLFFLVGYMVYDHIXXKSFYXLVTDRCEPTT  243

Query  1084  --EQNEALYKPLATNLKSSTSI-----GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAG  926
               + ++ LY+PL        S+      +EW +L+RLAL SCL VCLEWWWYEFMT+LAG
Sbjct  244   KYDTSQTLYQPLLPKKVVPLSLRKVLGDDEWRMLIRLALQSCLGVCLEWWWYEFMTILAG  303

Query  925   YLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLA  746
             YL +P + LAT+AIVIQTTSLMYTLP+ LS S+S+RVGNELGAG+P KARLA  +A+ +A
Sbjct  304   YLHKPHIALATSAIVIQTTSLMYTLPTTLSASVSTRVGNELGAGQPKKARLAAVVAVGMA  363

Query  745   FLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSA  566
              ++S  G+LLTTLGRE W +IFT D EVLELT+ VLPI+GLCE+ANCPQTT CG+LRGSA
Sbjct  364   LVSSLLGLLLTTLGREAWGRIFTDDNEVLELTMGVLPIVGLCEIANCPQTTSCGILRGSA  423

Query  565   RPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWE  386
             RP IGA INFYSFY++GAP AI++ FVW+L FKGLCYGLLAAQV CV+S+L V+++TDWE
Sbjct  424   RPGIGAWINFYSFYMVGAPXAIVLTFVWRLGFKGLCYGLLAAQVTCVVSILTVVHKTDWE  483

Query  385   KESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEGV  269
             KE  + K+ VG++      D M  F   +E  +  EEGV
Sbjct  484   KEWLKTKEFVGKNN-----DGMAAFAHADE-TVXCEEGV  516



>ref|XP_008351187.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=507

 Score =   504 bits (1298),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 311/508 (61%), Positives = 390/508 (77%), Gaps = 20/508 (4%)
 Frame = -3

Query  1750  AAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             AA+Q+QK+ T+ EV+EEL +M    FP+ A+ L  Y+KNM+LVVCMGRLGSLELAGGALA
Sbjct  4     AAEQSQKYPTMAEVVEELHRMTHIGFPIAAINLAGYLKNMVLVVCMGRLGSLELAGGALA  63

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             IGFTNITGYSVLSGLA+GMEP+ SQAFGS+N +I   TLQRTI +LL+ SL I LLW NL
Sbjct  64    IGFTNITGYSVLSGLAMGMEPLCSQAFGSQNFSIAFHTLQRTILLLLLTSLLIALLWSNL  123

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             +PL+L LHQ+  I  IASL+CQFAIPDLV NS L P+RI+LR + TTWPL+WSTL+A +L
Sbjct  124   EPLLLLLHQNQDITRIASLYCQFAIPDLVTNSFLXPIRIFLRSQSTTWPLMWSTLLAIIL  183

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ---------NEALYKP  1058
             H+P+  +LTF+L L ++GIAIST + NFI L FL  +     ++         ++ LY+P
Sbjct  184   HIPLTIFLTFTLTLXVKGIAISTSLTNFITLFFLWSFYYLVTDRCEPTTKYDTSQTLYQP  243

Query  1057  LATNLKSSTSI-----GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLAT  893
             L        S+      +EW +L+RLAL SCL VCLEWWWYEFMT+LAGYL +P + LAT
Sbjct  244   LLPKKVVPLSLRKVLGDDEWRMLIRLALQSCLGVCLEWWWYEFMTILAGYLHKPHIALAT  303

Query  892   AAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLT  713
             +AIVIQTTSLMYTLP+ LS S+S+RVGNELGAG+P KARLA  +A+ +A ++S  G+LLT
Sbjct  304   SAIVIQTTSLMYTLPTTLSASVSTRVGNELGAGQPKKARLAAVVAVGMALVSSLLGLLLT  363

Query  712   TLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFY  533
             TLGRE W +IFT D EVLELT+ VLPI+GLCE+ANCPQTT CG+LRGSARP IGA INFY
Sbjct  364   TLGREAWGRIFTDDNEVLELTMGVLPIVGLCEIANCPQTTSCGILRGSARPGIGAWINFY  423

Query  532   SFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             SFY++GAP+AI++ FVW+L FKGLCYGLLAAQV CV+S+L V+++TDWEKE  + K+ VG
Sbjct  424   SFYMVGAPIAIVLTFVWRLGFKGLCYGLLAAQVTCVVSILTVVHKTDWEKEWLKTKEFVG  483

Query  352   ESRETSFEDPMIKFKEGEEFRISFEEGV  269
             ++      D M  F   +E  +  EEGV
Sbjct  484   KNN-----DGMAAFAHADE-TVKCEEGV  505



>ref|XP_006280346.1| hypothetical protein CARUB_v10026273mg [Capsella rubella]
 gb|EOA13244.1| hypothetical protein CARUB_v10026273mg [Capsella rubella]
Length=500

 Score =   498 bits (1281),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 298/496 (60%), Positives = 379/496 (76%), Gaps = 9/496 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +Q+ ++   Q + + T+PEV+EE++++ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EQDSRLINLQHKYNPTMPEVVEEMKRIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQAIGSKNPSLASLTLKRTILLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL PLML L Q   I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLNLTPLMLMLRQQHDITRVASLYCSFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEA----LYK  1061
             L++ +LHLPI  + TF + LG+ G+A+S+F+ NFI L  LL YI   N++  +    L  
Sbjct  184   LVSVLLHLPITAFFTFYISLGVAGVAVSSFLTNFISLSLLLCYIYLNNDKTSSKSLCLDT  243

Query  1060  PLATNLKSSTSIGEE--WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
             PL   L  S   GE+  W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA AA
Sbjct  244   PLI--LSGSRDSGEDQVWKTLIKFAVPSCMAVCLEWWWYEFMTVLAGYLPEPKVALAAAA  301

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             IVIQTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A  +A+  A   S FG++ TT+
Sbjct  302   IVIQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAATVAVGAAVAVSVFGLVGTTV  361

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
             GRE W ++FT D  VLELT  VLP+IG CELANCPQT  CG+LRGSARP +GA INFY+F
Sbjct  362   GREAWGRVFTADGVVLELTAAVLPVIGACELANCPQTISCGILRGSARPRVGAKINFYAF  421

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             Y++GAP+A+++AFVW L F GLCYGLL AQ+AC IS+L V+Y TDW KES +A DLVG++
Sbjct  422   YVVGAPVAVVLAFVWGLGFMGLCYGLLGAQLACAISILTVVYNTDWNKESLKAHDLVGKN  481

Query  346   RETSFEDPMI-KFKEG  302
               +   D +I K +EG
Sbjct  482   VNSPDVDQIIVKCEEG  497



>ref|XP_010440139.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=506

 Score =   497 bits (1280),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 293/500 (59%), Positives = 379/500 (76%), Gaps = 11/500 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q + + T+PEV+EE++++ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINLQHKYNPTMPEVVEEMKRIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALA+GFTNITGYSVLSGLA GMEP+  Q+ GSKN ++ SLTL+RTI +LL+ASLPI 
Sbjct  64    AGGALAVGFTNITGYSVLSGLATGMEPLCGQSIGSKNPSLASLTLKRTILLLLLASLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL PLML L Q   I  +ASL+C F++PDL+ANS LHPL IYLRCKGTTWPL+W T
Sbjct  124   LLWLNLTPLMLMLRQQHDITRVASLYCSFSLPDLLANSFLHPLCIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
             L++ +LHLPI  + TF + LG+ G+A+S+F++NFI L  LL YI   N  +    K  + 
Sbjct  184   LVSVLLHLPITAFFTFYISLGVAGVAVSSFLSNFISLSLLLCYIYLGNNNDNENDKTSSK  243

Query  1048  NLKSSTSI--------GEE--WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
             +L   T +        GE+  W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V L
Sbjct  244   SLCLDTPLMLSGLRDPGEDEVWTTLVKFAVPSCMAVCLEWWWYEFMTVLAGYLPEPKVAL  303

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             ATAAIVIQTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A  +A+  A   S FG++
Sbjct  304   ATAAIVIQTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAATVAVGAALAVSIFGLV  363

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              TT+GR+ W ++FT D  VLELT  VLP+IG CELANCPQT  CG+LRGSARP +GA IN
Sbjct  364   GTTVGRDAWGRVFTADGVVLELTAAVLPVIGACELANCPQTISCGILRGSARPRVGAKIN  423

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             FY+FY++GAP+A+++AFVW L F GLCYGLL AQ+AC IS+L V+Y TDW KES +A DL
Sbjct  424   FYAFYVVGAPVAVVLAFVWGLGFMGLCYGLLGAQLACAISILTVVYNTDWNKESLKAHDL  483

Query  358   VGESRETSFEDPMI-KFKEG  302
             VG++  +   D +I K +EG
Sbjct  484   VGKNVVSPDVDQIIVKCEEG  503



>ref|XP_010547013.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 5 
[Tarenaya hassleriana]
Length=500

 Score =   492 bits (1267),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 367/515 (71%), Gaps = 40/515 (8%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKH---STIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgr  1607
              T   EE      +Q H   +T+ E +EE++++ D  FP+ AM L++Y KNM  VV MGR
Sbjct  3     GTTTHEESRILNPSQNHGYTTTMLEAVEEVKRISDISFPITAMSLLNYFKNMASVVSMGR  62

Query  1606  lgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLM  1427
             LGSLELAGGALA+GFTNITGYSVLSGLA GMEPI  QA GSKNL++ SLTL+RTI +LL+
Sbjct  63    LGSLELAGGALAVGFTNITGYSVLSGLASGMEPICGQAIGSKNLSLASLTLKRTIFLLLL  122

Query  1426  ASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTW  1247
             ASLPI LLW NL+PLML L Q+ +I +IASL+C+FA+PDLVANS LHP+RIYLR KGTTW
Sbjct  123   ASLPISLLWLNLQPLMLVLRQNPRITNIASLYCRFALPDLVANSALHPIRIYLRSKGTTW  182

Query  1246  PLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEAL  1067
             PL+W TL++ + H+PI +  TF L LG+ G+A+S+FV NF+ L FLL Y+     + ++ 
Sbjct  183   PLMWCTLVSVVFHVPITWLFTFYLSLGVAGVAVSSFVTNFVSLFFLLCYMYTCANEMDSD  242

Query  1066  Y--KPLAT---------------NLKSSTSIGEE-WVILLRLALPSCLAVCLEWWWYEFM  941
             Y  KP  T               +L  ST+   E W  L+ LA+PSC+AVCLEWWWYEFM
Sbjct  243   YDDKPTRTATTTSSCLKTPLMLMSLSGSTTRDREIWSSLVGLAVPSCVAVCLEWWWYEFM  302

Query  940   TLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAI  761
             T+LAGYL  P+  LA AAIVIQTTSLMYT+P+ALS + S+RV NE    R G      A+
Sbjct  303   TILAGYLPEPETALAAAAIVIQTTSLMYTVPTALSAAASTRVSNE----REG------AV  352

Query  760   AIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGV  581
             ++V        G + TT GRE W ++FT+D  V+EL   VLP++G+CE+ANCPQTT CG+
Sbjct  353   SVV--------GRVGTTAGREAWGRVFTSDRAVVELAAAVLPVVGVCEMANCPQTTSCGI  404

Query  580   LRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIY  401
             LRGSARP +GA INFY+FY++GAPLA+ + F W+L F GLCYGLL AQ+ C +S+L V+Y
Sbjct  405   LRGSARPRVGAKINFYAFYVVGAPLAVGLGFGWRLGFIGLCYGLLGAQIVCAMSILTVVY  464

Query  400   RTDWEKESARAKDLVGESRETSFEDP-MIKFKEGE  299
              TDWE+ES +A+D VG S  +  +D  ++K +EG 
Sbjct  465   YTDWERESLKARDFVGRSGISLDDDSGLVKCEEGR  499



>gb|KFK26571.1| hypothetical protein AALP_AA8G266100 [Arabis alpina]
Length=499

 Score =   487 bits (1253),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 289/492 (59%), Positives = 374/492 (76%), Gaps = 3/492 (1%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ ++   Q + + T+ EV+EE++++ D  FP+ AM +++Y+KNM  VVCMGRLGSLEL
Sbjct  4     EEDSRLINHQQKYNPTMSEVVEEMKRLWDISFPVAAMSILNYLKNMTSVVCMGRLGSLEL  63

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGALAIGFTNITGYS+LSGLA G+EP+  QA GS+N ++ SLTL+RTI +LL+ SLPI 
Sbjct  64    AGGALAIGFTNITGYSILSGLATGLEPLCGQAIGSRNPSLASLTLKRTILLLLLVSLPIS  123

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+PLM  L Q   II +ASL+C  ++PDL+ANS LHPLRIYLRCKGTTWPL+W T
Sbjct  124   LLWLNLQPLMRILRQQQDIIRVASLYCSLSLPDLLANSFLHPLRIYLRCKGTTWPLMWCT  183

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEA---LYKP  1058
             L++  +HLPI  + TF + LG+ G+A+S+F++NFI L  LL YI + N++  +   L  P
Sbjct  184   LVSVFIHLPITAFFTFYISLGVAGVAVSSFLSNFISLSLLLCYIYFQNDKTSSSLCLETP  243

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
             L  +   + S    W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P V LA AAIVI
Sbjct  244   LMISGSRNDSGDAVWSTLVKFAVPSCIAVCLEWWWYEFMTVLAGYLPEPTVALAAAAIVI  303

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSLMYT+P+ALS ++S+RV NELGAGRP KAR A A+AI  A + S FG++ TT+GRE
Sbjct  304   QTTSLMYTIPTALSAAVSTRVSNELGAGRPEKARTAAAVAIGAAMVVSVFGLVATTVGRE  363

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT D  VLELT  +LP+IG CELANCPQTT CG+LRGSARP IGA INFY+FY++
Sbjct  364   AWGRVFTVDGVVLELTAAILPVIGACELANCPQTTSCGILRGSARPRIGAKINFYAFYVV  423

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRET  338
             GAP+A+++AF W L F GLCYGLL AQ+AC IS+L V+Y TDW KES +A DLVG++   
Sbjct  424   GAPVAVVLAFGWGLGFMGLCYGLLGAQLACAISILTVVYNTDWNKESLKAHDLVGKNVIL  483

Query  337   SFEDPMIKFKEG  302
                D +I   EG
Sbjct  484   PDVDQIIVKCEG  495



>ref|XP_010442364.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=497

 Score =   485 bits (1248),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 287/483 (59%), Positives = 362/483 (75%), Gaps = 11/483 (2%)
 Frame = -3

Query  1717  PEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSV  1538
             PEV+EE++++ D  FP+ AM +++Y+KNM  VVCMGRLGSLELAGGALA+GFTNITGYSV
Sbjct  12    PEVVEEMKRIWDISFPVAAMSILNYLKNMTSVVCMGRLGSLELAGGALAVGFTNITGYSV  71

Query  1537  LSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDA  1358
             LSGLA GMEP+  QA GSKN ++ SLTL+RTI +LL+ASLPI LLW NL PLML L Q  
Sbjct  72    LSGLATGMEPLCGQAIGSKNPSLASLTLKRTILLLLLASLPISLLWLNLTPLMLMLRQQH  131

Query  1357  KIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFS  1178
              I  +ASL+C F++PDL+ANS LHPLRIYLRCKGTTWPL+W TL++ +LHLPI  + TF 
Sbjct  132   DITRVASLYCTFSLPDLLANSFLHPLRIYLRCKGTTWPLMWCTLVSVLLHLPITAFFTFY  191

Query  1177  LKLGIQGIAISTFVANfigll----------fllgyilYTNEQNEALYKPLATNLKSSTS  1028
             + LG+ G+A+S+F+ NFI L                   T+ ++  L  PL  +      
Sbjct  192   VSLGVAGVAVSSFLTNFISLSLLLCYIYLENNNDNENDKTSSKSLCLDTPLMLSGLRDPG  251

Query  1027  IGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
               E W  L++ A+PSC+AVCLEWWWYEFMT+LAGYL  P+V LATAAIVIQTTSLMYT+P
Sbjct  252   EDEVWTTLVKFAVPSCMAVCLEWWWYEFMTVLAGYLPEPKVALATAAIVIQTTSLMYTIP  311

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdt  668
             +ALS ++S+RV NELGAGRP KAR A  +A+  A   S FG++ TT+GR+ W ++FT D 
Sbjct  312   TALSAAVSTRVSNELGAGRPEKARTAATVAVGAALAVSVFGLVGTTVGRDAWGRVFTADG  371

Query  667   evleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAF  488
              VLELT  VLP+IG CELANCPQT  CG+LRGSARP +GA INFY+FY++GAP+A+++AF
Sbjct  372   VVLELTAAVLPVIGACELANCPQTISCGILRGSARPRVGAKINFYAFYVVGAPVAVVLAF  431

Query  487   VWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMI-KF  311
             V  L F GLCYGLL AQ+AC IS+L V+Y TDW KES +A DLVG++  +   D +I K 
Sbjct  432   VSGLGFMGLCYGLLGAQLACAISILTVVYNTDWNKESLKAHDLVGKNVVSPDVDQIIVKC  491

Query  310   KEG  302
             +EG
Sbjct  492   EEG  494



>ref|XP_010914483.1| PREDICTED: MATE efflux family protein 5 [Elaeis guineensis]
Length=493

 Score =   475 bits (1223),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 289/482 (60%), Positives = 360/482 (75%), Gaps = 5/482 (1%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
              Q QK+ T+ EV+EEL++M     P+ A+ L+ Y+K M+ V  MGRLG LELAGGALA+G
Sbjct  5     NQIQKYLTMAEVLEELKRMKAIGLPISAINLMGYLKGMVSVAFMGRLGRLELAGGALAVG  64

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
              TNITGYSVL+GLA+GMEPI SQAFGS+NL + + TL+RTI MLL AS+PI +LW NL+P
Sbjct  65    LTNITGYSVLAGLAMGMEPICSQAFGSRNLPLAARTLRRTILMLLAASVPIAILWINLQP  124

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             LML LHQD  I  +A+ +C+FA+PDL ANS+LHP+RIYLR KG   PL+W   +A  LH+
Sbjct  125   LMLALHQDPDIARVAARYCRFALPDLAANSLLHPVRIYLRSKGMPSPLMWCLSLAFALHV  184

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEAL-YKPLATNLKSS-T  1031
             P+   L  S  LG+ G+AI+TF+ NF  ++FLL Y+ Y    +E   Y PL  +  S+ T
Sbjct  185   PLTAVL--SSALGVAGVAIATFITNFDTIIFLLSYVAYAGVPDETTDYAPLPPSPTSAPT  242

Query  1030  SIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTL  851
                 EW  LLRLALPSCL VCLEWWWYE MT+ +GYL +P+VTLAT+AIVIQTTSLMYTL
Sbjct  243   KPMAEWASLLRLALPSCLGVCLEWWWYELMTMASGYLSKPRVTLATSAIVIQTTSLMYTL  302

Query  850   PSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttd  671
             P  LS+S+S+RVGNELGAGRP +AR A A+A+ LA   S  G+L T  GRE W ++FT D
Sbjct  303   PVTLSSSVSARVGNELGAGRPWRARAAAAVAMGLAVFGSCLGLLGTIWGREAWGRVFTKD  362

Query  670   tevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMA  491
              EVLELT TVLP+IGLCELANCPQTT CGVLRGSARP +GA IN YSFYL+GAP+A+++A
Sbjct  363   VEVLELTKTVLPVIGLCELANCPQTTGCGVLRGSARPAVGAAINLYSFYLVGAPVAMVLA  422

Query  490   FVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKF  311
             F   L F GLC GLLAAQV C IS++ V Y TDWE+E+++A  LVG+  E   EDP+   
Sbjct  423   FGLDLGFVGLCLGLLAAQVVCAISVIAVTYNTDWEREASKAVALVGKG-ELLLEDPIDMA  481

Query  310   KE  305
             +E
Sbjct  482   QE  483



>ref|XP_008775990.1| PREDICTED: MATE efflux family protein 5 [Phoenix dactylifera]
Length=500

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 286/492 (58%), Positives = 363/492 (74%), Gaps = 5/492 (1%)
 Frame = -3

Query  1774  TNQQEEKMAAK-QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
             + +++++M A+ Q Q++ T+ EV+EEL++M     P+IA+ L+ Y+K M+ VV MGRLG 
Sbjct  2     SKERKKRMVAENQIQEYLTMAEVLEELKRMKAIGLPIIAINLVGYLKGMVSVVFMGRLGR  61

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
             LELAGGALA+GFTNITGYSVL+GLA+GMEPI SQAFGS+NL + + TL+RTI MLL AS+
Sbjct  62    LELAGGALAVGFTNITGYSVLAGLAMGMEPICSQAFGSRNLPLAARTLRRTILMLLAASV  121

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI +LW NL+ +ML LHQD  +  +A+ +C+FA+PDL ANS+LHP+RIYLR KG   PL+
Sbjct  122   PIAMLWINLQAVMLALHQDPDVARVAARYCRFALPDLAANSLLHPVRIYLRSKGMPRPLM  181

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
             W   +A  LH+P+   L  S  LG+ G+AI+TF+ NF  ++FLL Y+ Y    ++ +Y P
Sbjct  182   WCLSLAFALHVPLTAVL--SSALGVAGVAIATFITNFDTIIFLLAYVTYAGIPDDPIYAP  239

Query  1057  LATNLKSSTSI-GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             L     S+ S    EW  LLRLALPSCL VCLEWWWYE MT+ +GYL +P VTLAT+AIV
Sbjct  240   LPPLPTSAPSKPTAEWASLLRLALPSCLGVCLEWWWYELMTMASGYLSKPHVTLATSAIV  299

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYTLP  LS S+S+RVGNELGAGRP +AR A A A+ LA   S   +L T LGR
Sbjct  300   IQTTSLMYTLPVTLSASVSARVGNELGAGRPRRARAAAAAAMGLAVFGSCLALLWTILGR  359

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             E W ++FT D EVLELT TVLP+IGLCELANCPQTT CGVLRGSARP +GA IN YSFYL
Sbjct  360   EAWGRVFTEDVEVLELTKTVLPVIGLCELANCPQTTGCGVLRGSARPAVGAVINLYSFYL  419

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +GAP+AI++AF     F GLC GLLAAQV C IS+  V + TDW+ E+++A  LVG + E
Sbjct  420   VGAPVAIVLAFGLDWGFVGLCLGLLAAQVVCAISVTSVAFHTDWDSEASKALHLVG-TGE  478

Query  340   TSFEDPMIKFKE  305
                E P    +E
Sbjct  479   VLLEGPKDMAQE  490



>ref|XP_009393204.1| PREDICTED: MATE efflux family protein 5 [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   451 bits (1161),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 266/488 (55%), Positives = 354/488 (73%), Gaps = 8/488 (2%)
 Frame = -3

Query  1747  AKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalai  1568
               Q  K  TI EV EEL++M D   P+  + L+SY+K M  V CMGRLG LELAGGALA+
Sbjct  4     GDQIHKCLTISEVSEELKRMKDIGLPITVINLVSYIKGMASVACMGRLGRLELAGGALAV  63

Query  1567  GFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLK  1388
             GFTN+TGYSVL+GLA+GMEPI SQAFGS+NL++ S  L+RTI +LL+ SLPI LLW NL+
Sbjct  64    GFTNVTGYSVLAGLAMGMEPICSQAFGSRNLSLASRALRRTILLLLLVSLPIALLWINLR  123

Query  1387  PLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLH  1208
             P+M  + QD+ +  +A+ +C+FA+PDL+ANS+L PLR+Y RCKG   PL+W   +A ++H
Sbjct  124   PIMRVVRQDSDVARVAACYCRFALPDLLANSLLQPLRVYFRCKGAPCPLMWCMSLAVVIH  183

Query  1207  LPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE-QNEALYKPLATNLKSST  1031
             +P+   L  S  +G+ G+AI+T + +F  LL LL   + ++   +EA Y P+ ++  + +
Sbjct  184   VPLTASL--SSAIGVPGVAIATCLTDFNTLLLLLLACVISSRTADEAAYLPIPSSPTTCS  241

Query  1030  SIG--EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMY  857
             S     EW  L+RLALPSCLAVCLEWWWYE MT+ +GYL  P+V+LATAAIVIQTTSLMY
Sbjct  242   SYKPWSEWSSLIRLALPSCLAVCLEWWWYELMTVASGYLSNPRVSLATAAIVIQTTSLMY  301

Query  856   TLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFt  677
             TLP+ LS S+S+RVGNELGAG+P +A+ A A+ + LA   S   +L  T+GRE W ++FT
Sbjct  302   TLPTTLSTSVSARVGNELGAGQPRRAQTAAAVGMGLAVAGSCISLLWATVGREAWGRVFT  361

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
              D EVLELT  VLP+IGLCELANCPQTT CGVLRGSARP++ A IN Y+FYL+GAP+A++
Sbjct  362   GDGEVLELTKAVLPVIGLCELANCPQTTGCGVLRGSARPSVAAAINLYAFYLVGAPVALL  421

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLV---GESRETSFED  326
             +AF   L F GL  GLL AQVAC + ++ ++   DWE+E+++A DLV   G + E  +E+
Sbjct  422   LAFRLDLGFLGLSLGLLTAQVACALPVVHLVRSMDWEREASKAVDLVGSGGRALEGEYEE  481

Query  325   PMIKFKEG  302
                   EG
Sbjct  482   KATLKGEG  489



>ref|XP_010524719.1| PREDICTED: MATE efflux family protein 5-like [Tarenaya hassleriana]
Length=515

 Score =   442 bits (1136),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 286/499 (57%), Positives = 371/499 (74%), Gaps = 21/499 (4%)
 Frame = -3

Query  1741  QTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             Q  +H+T + EV+EE++++ D  FP+ AMGL++Y+KNM  VV MGRLGSLELAGGALA+G
Sbjct  21    QNHRHTTTMHEVVEEMKRLSDISFPITAMGLLNYLKNMTSVVSMGRLGSLELAGGALAVG  80

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             FTNITGYSVLSGLA GMEP+  QAFGSKN ++ SLTL+RTI +LL+ASLPI LLW NL P
Sbjct  81    FTNITGYSVLSGLASGMEPLCGQAFGSKNFSLASLTLKRTILLLLLASLPISLLWLNLHP  140

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             LML L Q+  II+IASL+C+FA+PDL+ANS+LHP+RIYLR +GTTWPL+W TL++ + H+
Sbjct  141   LMLVLRQNPPIINIASLYCRFALPDLLANSVLHPIRIYLRSRGTTWPLMWCTLLSVIFHV  200

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ--------------NEAL  1067
             PI +  TF L LG+ G+A+S+ V+NFI L FLL Y+    ++                 L
Sbjct  201   PITWLFTFYLSLGVAGVAVSSVVSNFISLFFLLCYMCTCTDEIDIDDNDSTTRTATRSCL  260

Query  1066  YKPL-ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATA  890
               PL   +L  ST   E W  L+RLA+PSC+AVCLEWWWYEFMT+LAGYL  P+V LA A
Sbjct  261   KTPLMMMSLSGSTKDREIWSSLVRLAVPSCVAVCLEWWWYEFMTILAGYLPEPEVALAAA  320

Query  889   AIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTT  710
             AIVIQTTSL+YT+P+ALS + S+RV  ELGAGRP +AR A   A      AS  G++ T 
Sbjct  321   AIVIQTTSLLYTIPTALSAAASTRVSKELGAGRPERARTAAGGAAA----ASVVGLVGTI  376

Query  709   LGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYS  530
             +GRE W +IFT +T V+EL   VLP++GLCE+ NCPQTT CG+LRGSARP +GA INFY+
Sbjct  377   VGREAWGRIFTANTAVIELAAAVLPVVGLCEVGNCPQTTSCGILRGSARPGVGAKINFYA  436

Query  529   FYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
             FY++GAPLA+++ FV++L F GLCYGLL AQ+ C +++L V+Y T WE ES +A+DLVG+
Sbjct  437   FYMVGAPLAVVLGFVFRLGFLGLCYGLLGAQIVCAMTILTVVYNTVWEIESLKARDLVGK  496

Query  349   SRETSFEDP-MIKFKEGEE  296
                   +D  ++K +EG  
Sbjct  497   IGILRADDSVLVKCEEGRH  515



>ref|XP_006859201.1| hypothetical protein AMTR_s00070p00181900 [Amborella trichopoda]
 gb|ERN20668.1| hypothetical protein AMTR_s00070p00181900 [Amborella trichopoda]
Length=508

 Score =   429 bits (1104),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 249/465 (54%), Positives = 325/465 (70%), Gaps = 17/465 (4%)
 Frame = -3

Query  1732  KHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNI  1553
             K  +  +VMEEL+++     P+ AM  + Y++ M+ V+C+GRLGSLELAGGAL+IGFTNI
Sbjct  11    KPPSATQVMEELKELGSMTIPIAAMNCVVYIRAMVSVLCLGRLGSLELAGGALSIGFTNI  70

Query  1552  TGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLW  1373
             TGYSVL GLA GMEPI SQAFGSKN T++  +LQRTI +LL A +PI LLW NL  +M+W
Sbjct  71    TGYSVLFGLASGMEPICSQAFGSKNWTLMGHSLQRTILILLSACVPICLLWLNLNRIMVW  130

Query  1372  LHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVF  1193
               QD +I  +AS +C F++PDL+ NS L PLR+YLR +G T P+++ + +A +LH+P+  
Sbjct  131   SGQDLQITAMASTYCMFSLPDLLTNSFLQPLRVYLRSQGITKPMMYCSALAVLLHIPLNI  190

Query  1192  YLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKS-----STS  1028
              L F L  G+ G+AIS  + N    LFLL            LY  ++ + K      S  
Sbjct  191   LLVFVLGFGVPGVAISAVLTNLNMALFLL------------LYMYISGSCKKTWSGWSKE  238

Query  1027  IGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
                +W  LL LALPSCLA+CLEWWWYE MTLLAGYL  P+V++AT AI+IQTTSLMYT+P
Sbjct  239   ALTQWCPLLALALPSCLAICLEWWWYELMTLLAGYLPNPRVSVATTAILIQTTSLMYTVP  298

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdt  668
              AL   +S+RVGNELGAG+P +ARLAT +A+  AF    F +  TT  R  W ++FT D 
Sbjct  299   MALGACVSTRVGNELGAGKPCRARLATLVALGCAFAVGLFNVAWTTALRHEWAQVFTRDE  358

Query  667   evleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAF  488
              V  +   VLP++GLCEL NCPQTT CGVLRGSARP+IGA IN  SFY +G P+A+ +AF
Sbjct  359   GVAAMAAAVLPLMGLCELGNCPQTTGCGVLRGSARPSIGARINLGSFYFLGTPVALGLAF  418

Query  487   VWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
               K+ F GL YGLL+AQV+C +S+L V++RTDW  E+AR++ L G
Sbjct  419   WLKVGFGGLWYGLLSAQVSCAVSILYVVFRTDWAIEAARSRVLAG  463



>ref|XP_001769309.1| predicted protein [Physcomitrella patens]
 gb|EDQ65863.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   426 bits (1094),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 242/454 (53%), Positives = 326/454 (72%), Gaps = 7/454 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             ++ EEL+K+++   P+ A+  + Y++ M+ V+C+GRLG L+LAGGAL+IGFTNITGYSVL
Sbjct  1     QIFEELKKLLEIAGPLAALNCVVYVRAMVSVLCLGRLGGLQLAGGALSIGFTNITGYSVL  60

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             +GLA GM+PI SQA+G +N  ++ L LQRTI +LL A LPI +LW+NL+ ++L L QD +
Sbjct  61    AGLASGMDPICSQAYGCENYNLIGLALQRTILILLSACLPISVLWYNLESILLALRQDPE  120

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +AS+FC +++PDL+ANS L PLRIYL+ +G   P+ W + +A +LH+P+   L F L
Sbjct  121   ITAVASMFCLYSLPDLLANSFLQPLRIYLKSQGLAAPMFWCSALAVLLHVPLNILLVFVL  180

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
             +LG+ G+AI+    NF  + F+L Y+LY+            T +  ST     W  LL L
Sbjct  181   ELGVPGVAIAAVCTNFNMVFFILVYLLYSGVLK-------GTWVPWSTECLRGWGPLLTL  233

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             ALPSCLA+CLEWWWYE +TLLAGYL  PQV +AT  ++IQTT+LMYT P ALS+S+S+RV
Sbjct  234   ALPSCLALCLEWWWYEIVTLLAGYLPNPQVAVATTGVIIQTTALMYTFPQALSSSVSTRV  293

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
             GNELGAG+P +AR+AT +A+  A + +   +  TT  R VW  +FT D  VL LT  VLP
Sbjct  294   GNELGAGKPARARIATFVALCCALVVAIVSLTWTTALRSVWGHVFTEDENVLALTAAVLP  353

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             ++GLCEL NCPQTT  GVLRGSARP +GA IN  SFY +G P+A+ +AF +K+ F GL Y
Sbjct  354   LVGLCELGNCPQTTGVGVLRGSARPAVGARINLGSFYAVGTPVAVALAFWFKIGFGGLWY  413

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             GLLAAQ+AC  S+L V+ RTDW  E+ RA+DL G
Sbjct  414   GLLAAQIACAASILFVVLRTDWAAEAKRARDLTG  447



>ref|XP_002985441.1| hypothetical protein SELMODRAFT_446267 [Selaginella moellendorffii]
 gb|EFJ13571.1| hypothetical protein SELMODRAFT_446267 [Selaginella moellendorffii]
Length=513

 Score =   415 bits (1067),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 247/475 (52%), Positives = 331/475 (70%), Gaps = 8/475 (2%)
 Frame = -3

Query  1759  EKMAAKQTQK--HSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             +K+A  + +      + +++EELR++     P+ AM  + Y++ M+ V+C+GRLG  ELA
Sbjct  9     QKVAGDEEKGGGQEKLSKILEELRELGRIAVPITAMNCVVYLRAMVSVLCLGRLGGRELA  68

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GGAL+IGFTNITGYSVL GLA GM+PI +QAFGSKN  ++ L+L+RTI +LL A +PI L
Sbjct  69    GGALSIGFTNITGYSVLFGLASGMDPICAQAFGSKNWKLIGLSLRRTILVLLTACVPISL  128

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW NL  ++L+L QD  I  +AS +C F++PDL+ANSIL PLR+YLR +G T P++W + 
Sbjct  129   LWINLHRILLFLAQDPSITAVASTYCLFSLPDLLANSILQPLRVYLRSQGITTPMMWCSA  188

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             +A  LH+P+   L F L+LG+ G+A++    NF  +  LL Y+  +      +Y+    +
Sbjct  189   VAVALHVPLSLALAFGLRLGVPGVAMAAVFTNFFMIALLLLYLRISG-----VYRRTWGD  243

Query  1045  LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
               S   +  EW  LL LALPSC A+CLEWWWYE MTLLAGYL  P+V +AT AI+IQTTS
Sbjct  244   GWSMDCL-REWRPLLALALPSCFAICLEWWWYEIMTLLAGYLPNPEVAVATTAILIQTTS  302

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             LMYT+P ALS S+S+RVGNELGA RP +AR A  +A+  A + +  G+  TT  R  W +
Sbjct  303   LMYTIPLALSASVSTRVGNELGARRPDRARRAAYVALGCALVVATAGLTWTTALRHQWGR  362

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
             +FT D  VL LT  V+P+IGLCEL NCPQTT CGVLRG+ARP IGA IN  SFY +G P+
Sbjct  363   VFTRDASVLALTAAVMPLIGLCELGNCPQTTACGVLRGTARPAIGARINLGSFYFLGTPV  422

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             A+ +AF +K+ F GL YGLLAAQ AC  S+L+V++RTDW  E+ RA+ L G   E
Sbjct  423   AVALAFWFKVGFGGLWYGLLAAQAACAFSILLVVWRTDWVVEAERARRLTGTELE  477



>ref|XP_002979778.1| hypothetical protein SELMODRAFT_111626, partial [Selaginella 
moellendorffii]
 gb|EFJ19180.1| hypothetical protein SELMODRAFT_111626, partial [Selaginella 
moellendorffii]
Length=488

 Score =   413 bits (1062),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 324/458 (71%), Gaps = 6/458 (1%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +++EELR++     P+ AM  + Y++ M+ V+C+GRLG  ELAGGAL+IGFTNITGYSVL
Sbjct  1     QILEELRELGRIAVPITAMNCVVYLRAMVSVLCLGRLGGRELAGGALSIGFTNITGYSVL  60

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
              GLA GM+PI +QAFGSKN  ++ L+L+RTI +LL A +PI LLW NL  ++L+L QD  
Sbjct  61    FGLASGMDPICAQAFGSKNWKLIGLSLRRTILVLLTACVPISLLWINLHRILLFLAQDPS  120

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +AS +C F++PDL+ANSIL PLR+YLR +G T P++W + +A  LH+P+   L F L
Sbjct  121   ITAVASTYCLFSLPDLLANSILQPLRVYLRSQGITTPMMWCSAVAVALHVPLSLALAFGL  180

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
             +LG+ G+A++    NF  +  LL Y+  +      +Y+    +  S   +  EW  LL L
Sbjct  181   RLGVPGVAMAAVFTNFFMIALLLLYLRISG-----VYRRTWGDGWSIDCL-REWRPLLAL  234

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             ALPSC A+CLEWWWYE MTLLAGYL  P+V +AT AI+IQTTSLMYT+P ALS S+S+RV
Sbjct  235   ALPSCFAICLEWWWYEIMTLLAGYLPNPEVAVATTAILIQTTSLMYTIPLALSASVSTRV  294

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
             GNELGA RP +AR A  +A+  A + +  G+  TT  R  W ++FT D  VL LT  V+P
Sbjct  295   GNELGARRPDRARRAAYVALGCALVVATAGLTWTTALRHQWGRVFTRDASVLALTAAVMP  354

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             +IGLCEL NCPQTT CGVLRG+ARP IGA IN  SFY +G P+A+ +AF +K+ F GL Y
Sbjct  355   LIGLCELGNCPQTTACGVLRGTARPAIGARINLGSFYFLGTPVAVALAFWFKVGFGGLWY  414

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             GLLAAQ AC  S+L+V++RTDW  E+ RA+ L G   E
Sbjct  415   GLLAAQAACAFSILLVVWRTDWAVEAERARRLTGTELE  452



>ref|XP_010256297.1| PREDICTED: MATE efflux family protein 5 [Nelumbo nucifera]
 ref|XP_010256298.1| PREDICTED: MATE efflux family protein 5 [Nelumbo nucifera]
 ref|XP_010256299.1| PREDICTED: MATE efflux family protein 5 [Nelumbo nucifera]
Length=500

 Score =   413 bits (1062),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 342/510 (67%), Gaps = 26/510 (5%)
 Frame = -3

Query  1780  ANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlg  1601
              +T++  +K      +K  +  +V++EL+++     P+ AM  + Y++ M+ V+ +GRLG
Sbjct  4     GHTSKMADKEPDYSPKKAPSATKVIDELKELWSMALPITAMNCVVYIRAMVSVLFLGRLG  63

Query  1600  slelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMAS  1421
             SLELAGGAL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQRT+ +LL+AS
Sbjct  64    SLELAGGALSIGFTNITGYSVLFGLASGLEPVCSQAYGSKNWELISLSLQRTVLILLIAS  123

Query  1420  LPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPL  1241
             +PI  LW NL+ +M+++ QD  I  +A+ +C +++PDL+ N++L PLR+YLR +G T P+
Sbjct  124   IPISFLWMNLEGIMIFMGQDRDITAMAATYCIYSLPDLLTNTLLQPLRVYLRSQGVTKPM  183

Query  1240  LWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYK  1061
             ++ +LIA + H+P+   L   +KLG+ G+A+++ + N   +L               +Y 
Sbjct  184   MYCSLIAVLFHVPLNILLVVVMKLGVPGVAMASVLTNLNMVLL----------MTAYVYV  233

Query  1060  PLATNLKSSTSIGEEWVI------LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
                  L+ +  IG   V+      LLRLA+PSCL +CLEWWWYE MT+LAGYL +P + +
Sbjct  234   SGVCELRWTAGIG---VVCGGLGPLLRLAVPSCLGICLEWWWYEIMTVLAGYLSKPTLAV  290

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A  AI+IQTTSLMYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     + 
Sbjct  291   AATAILIQTTSLMYTVPMALAACVSTRVGNELGAGKPYKAKLAALVALGCAFVIGTINVT  350

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              T + RE W  +FT D EV  L   V+PI+GLCEL NCPQTT CG+LRG+ARP +GA IN
Sbjct  351   WTAILRERWAGLFTKDVEVGYLVAAVMPIMGLCELGNCPQTTGCGILRGTARPAVGARIN  410

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKD  362
               SFY +G P+A+ +AF +K+ F GL YGLL+AQ AC +S+L +V+ RTDWE E+ RAK 
Sbjct  411   LGSFYCIGTPVAVGLAFWFKVGFSGLWYGLLSAQAACAVSILFVVLMRTDWEAEALRAKK  470

Query  361   LVGESRETSFEDPMIKFKEGEEFRISFEEG  272
             L      TS E    +   G+E R  F  G
Sbjct  471   L------TSMEMSGCEKANGDEERKGFLVG  494



>emb|CDX72839.1| BnaC06g32870D [Brassica napus]
Length=492

 Score =   412 bits (1059),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 339/503 (67%), Gaps = 23/503 (5%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ +     + KH T+P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLEL
Sbjct  2     EEKNQTDDFSSHKHPTLPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  +++L+LQR + +LL+AS+PI 
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWDLLTLSLQRMVVILLIASVPIS  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML++ QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWVNLGPIMLFMGQDPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
             L A   H+P+ ++L    + G+ G+AI++ V N I +  L+GY+  + +  +  +  L  
Sbjct  182   LAAVAFHVPLNYWLVMVKRWGVPGVAIASVVTNLIMVGLLVGYVWASGKLQKRFFGGLGP  241

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                           L+R+A+PSCL +CLEWWWYE +T++ GYL  P++ +A   I+IQTT
Sbjct  242   --------------LMRVAVPSCLGICLEWWWYEIVTIMGGYLENPKLAVAATGILIQTT  287

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             SLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  +  T + +E W 
Sbjct  288   SLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGALNVAWTVILKERWA  347

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY +G P
Sbjct  348   GLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFVGTP  407

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL-------VG  353
             +A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE ES RA  L       VG
Sbjct  408   VAVGLAFWLKIGFSGLWFGLLSAQAACAVSILYAVLARTDWEGESVRAMRLTSLEMGKVG  467

Query  352   ESRETSFEDPMIKFKEGEEFRIS  284
             +  E+S    ++  + G + ++S
Sbjct  468   KDEESS-SLLLVDDRNGSDEKLS  489



>ref|XP_001777255.1| predicted protein [Physcomitrella patens]
 gb|EDQ57910.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   410 bits (1055),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 238/445 (53%), Positives = 315/445 (71%), Gaps = 7/445 (2%)
 Frame = -3

Query  1711  VMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLS  1532
             + EEL+ +++   P+ A+  + Y++ M+ V+C+GRLG L+LAGGAL++GFTNITGYSVLS
Sbjct  15    IFEELKNLLEIAGPLAALNCVLYVRAMVSVLCLGRLGGLQLAGGALSLGFTNITGYSVLS  74

Query  1531  GLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKI  1352
             GLA GM+PI SQ  GS+N  ++ L LQRTI +LL A LPI LLW+NL+ ++L L QD +I
Sbjct  75    GLATGMDPICSQGIGSENYRLIGLALQRTILILLTACLPISLLWYNLESILLALRQDPEI  134

Query  1351  IHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLK  1172
               +ASL+C F IPDL+ANSI+HPL+IYL+  G   P+ W + +A +LH+P+     F L 
Sbjct  135   TAMASLYCFFTIPDLLANSIMHPLKIYLKSVGLAAPMFWCSALAVVLHVPLNILFVFILD  194

Query  1171  LGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLA  992
             LG+ G+AI+    NF  + F LGY+ Y++   +  + P       ST     W  +L LA
Sbjct  195   LGVPGVAIAVVCTNFNMVFFNLGYLKYSDVLKDR-WVPW------STECLRGWGPILTLA  247

Query  991   LPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVG  812
             LPSCLAVCLEWWWYE +TLLAGYL  PQV +AT  ++IQTT+LMYT P ALS+S+S+RVG
Sbjct  248   LPSCLAVCLEWWWYEIVTLLAGYLPNPQVAVATTGVIIQTTALMYTFPQALSSSVSTRVG  307

Query  811   NELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPI  632
              ELGAG P +AR+AT +A+  A + +   +  TT+ R +W  +FT D  VL LT  VLP+
Sbjct  308   KELGAGNPARARIATFVALSCALIVAVVSLTWTTVLRGIWGHVFTKDENVLALTAAVLPL  367

Query  631   IGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYG  452
             IGLCEL NCPQTT  GVLRGSARP  GA IN  SFYL+G P+A+ +AF +++ F GL YG
Sbjct  368   IGLCELGNCPQTTGVGVLRGSARPWTGASINLGSFYLVGTPVAVALAFWFRIGFGGLWYG  427

Query  451   LLAAQVACVISMLIVIYRTDWEKES  377
             LLAAQ+AC  S+L V+ RTDWE E 
Sbjct  428   LLAAQIACAASILFVVLRTDWEDEG  452



>ref|XP_010247682.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
 ref|XP_010247684.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=493

 Score =   410 bits (1053),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 234/475 (49%), Positives = 334/475 (70%), Gaps = 20/475 (4%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             ++K +    +K  +  +V+EEL+++    FP+ AM  + Y++ M+ V+ +GRLGSLELAG
Sbjct  2     DDKESDYSLKKPPSATQVIEELKELWSMAFPITAMNCVVYIRAMVSVLFLGRLGSLELAG  61

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             GAL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQRTI +LL+AS+PI  L
Sbjct  62    GALSIGFTNITGYSVLFGLASGLEPVCSQAYGSKNRDLISLSLQRTILILLIASIPISFL  121

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W NL+ +M+++ QD +I  +A+ +C +++PDL+ N+ L PLR+YLR +G T P+++ +LI
Sbjct  122   WMNLEAIMVFMGQDREITAMAATYCLYSLPDLITNTFLQPLRVYLRSQGVTKPMMYCSLI  181

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             A + H+P+   L   +KLG+ G+A+++ + N   LL + GY+  T               
Sbjct  182   AVLFHVPLNIVLVVVMKLGVPGVAMASVLTNMNMLLLITGYVYVTG----------VCET  231

Query  1042  KSSTSIGEEWVI------LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             + +  IG   V+      LLRLA+PSCL +CLEWWWYE MT+L+GYL  P++ +A+ AI+
Sbjct  232   RWTAGIG---VVCGGLGPLLRLAVPSCLGICLEWWWYEIMTVLSGYLPNPRLAVASTAIL  288

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSLMYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T + R
Sbjct  289   IQTTSLMYTVPMALAACVSTRVGNELGAGKPYKAKLAALVALGCAFVIGMINVTWTAILR  348

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             E+W  +FTTD  V  L   V+PI+GLCEL NCPQTT CG+LRG+ARP  GA IN  SFY 
Sbjct  349   EIWASLFTTDGAVRLLVSAVMPIMGLCELGNCPQTTGCGILRGTARPATGARINLGSFYC  408

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
             +G P+A+ +AF +K+ F GL YGLL+AQ AC +S+L +V+ RTDWE E+ RAK L
Sbjct  409   IGTPVAVALAFWFKVGFSGLWYGLLSAQAACAVSILFVVLIRTDWEAEALRAKKL  463



>ref|XP_010674324.1| PREDICTED: MATE efflux family protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=509

 Score =   409 bits (1051),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 233/498 (47%), Positives = 339/498 (68%), Gaps = 6/498 (1%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + KH +  +++EELR++    FP+ AM L+ Y++ ++ V+ +GRLGSLELAGG
Sbjct  3     EKNPDFSSHKHPSSSQIVEELRELWKMAFPITAMNLLVYIRAVVSVLFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GS+N  ++SL+L R I +L +A +PI  LW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSQNWDLLSLSLHRMIFILFLAIIPISFLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL P+M++L QD ++  +A+++C F++PDL+ N+ L PLR+YLR +  T P++W TLIA
Sbjct  123   VNLGPIMIFLGQDMEVTAMAAMYCIFSLPDLLTNTFLQPLRVYLRSQQVTKPMMWCTLIA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              M H+P+ ++L   L+ G++G+A+++ V N    + L GY+     +     K  +  LK
Sbjct  183   VMFHVPLNYWLVMVLEWGVKGVAVASVVTNLNMAVMLAGYVYVKEREKWKKVKWWSWGLK  242

Query  1039  SSTSIGEEWVI-LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
                 +G E +  L++LA+PSCL +CLEWWWYE +T+L+GYL  P+V +A   I+IQTTSL
Sbjct  243   G---VGIEGIKPLMKLAVPSCLGICLEWWWYEIVTVLSGYLPNPKVAVAATGIMIQTTSL  299

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYT+P AL+  +S+RVGNELGAG+P KARLA  +A+  AF+     ++ T + RE W ++
Sbjct  300   MYTVPMALAGCVSARVGNELGAGKPYKARLAAMVALGCAFVIGIINVIWTVIFRESWGEL  359

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D+ V  L  +V+PI+GLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A
Sbjct  360   FTPDSSVTVLVASVMPIMGLCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVA  419

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDLV-GESRETSFE  329
             + +AF  K+ F GL +GLL+AQVAC + +L  V+  TDWE E+ +A     GE    + +
Sbjct  420   VGLAFWLKVGFSGLWFGLLSAQVACAVWILYAVLGSTDWEGEALKAMKFTQGEEMSKTCK  479

Query  328   DPMIKFKEGEEFRISFEE  275
                 K  + EE +   E 
Sbjct  480   SNNEKIGDEEENKAFLEN  497



>emb|CDY03676.1| BnaA02g15610D [Brassica napus]
Length=509

 Score =   408 bits (1049),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 231/497 (46%), Positives = 338/497 (68%), Gaps = 14/497 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ +     + KH T P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLEL
Sbjct  2     EEQNQPDDFSSHKHPTFPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+L R + +LL AS+PIG
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWELLSLSLHRMVMILLFASVPIG  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML+L QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWINLGPIMLFLGQDPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN--EQNEALYKPL  1055
             L A   H+P+ ++L    + G+ G+A ++ V N I ++ L+GY+  +   ++++ +   +
Sbjct  182   LAAVTFHVPLNYWLVMVKRWGVPGVATASVVTNLIMVMLLVGYVSLSGKMQKSQGVSGSM  241

Query  1054  ATNLKSSTSIGE---EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
                + + +S+ E       L+R+A+PSCL +CLEWWWYE + ++ GYL  P++ +A   I
Sbjct  242   VATVAAQSSVVELVGGLGPLMRVAVPSCLGICLEWWWYEIVIVMGGYLENPKLAVAATGI  301

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  +  T + 
Sbjct  302   LIQTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGASNVAWTVVL  361

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             +E W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY
Sbjct  362   KERWAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPTVGAHVNLGSFY  421

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDLVGES  347
              +G P+A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE E+ RA       
Sbjct  422   FVGTPVAVGLAFWLKVGFSGLWFGLLSAQAACAVSILYAVLARTDWEGEAMRAM------  475

Query  346   RETSFEDPMIKFKEGEE  296
             R TS E  M K  + EE
Sbjct  476   RMTSLE--MRKVGKDEE  490



>ref|XP_008361957.1| PREDICTED: MATE efflux family protein DTX1-like [Malus domestica]
Length=393

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 227/396 (57%), Positives = 294/396 (74%), Gaps = 32/396 (8%)
 Frame = -3

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             ML LHQ+  I  IASL+CQFAIPDL+ANS+LHP+RI+ R + TTWPL+WSTL+A +LH+P
Sbjct  1     MLLLHQNQDITKIASLYCQFAIPDLLANSLLHPIRIFFRSQSTTWPLMWSTLLAIILHIP  60

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY--------------  1064
             +  +LTF+L LGI+GIAIST + NFI L FLLGY++Y +   +++Y              
Sbjct  61    LTIFLTFNLSLGIKGIAISTSLTNFITLFFLLGYVVYAHVTKKSIYCLVTDQCEPTTKYE  120

Query  1063  ------KPL------ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYL  920
                   +PL        +L+ +    +EW IL+RLA  SCL VCLEWWWYEFMT+L GYL
Sbjct  121   TTQLLSQPLLPKKIXPLSLRKTLVGADEWRILIRLAFQSCLGVCLEWWWYEFMTILTGYL  180

Query  919   VRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFL  740
              +P + LA +AIVIQTTSLMYTLP+ALS S+S+RVGNELGAG+P KA LA  +A+ +A +
Sbjct  181   QKPHIALAASAIVIQTTSLMYTLPAALSASVSTRVGNELGAGQPKKAHLAAVVAVGMALV  240

Query  739   ASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARP  560
             +S  G+ LTTLGR VW +IFT D+EVLELT++VLPIIGLCE+ANCPQTT CG+LRGSARP
Sbjct  241   SSLLGLSLTTLGRGVWGRIFTNDSEVLELTMSVLPIIGLCEIANCPQTTSCGILRGSARP  300

Query  559   NIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKE  380
              IGA INFYSFY++G P+AI++ FVW+L FKGLCYGLLAAQ+ CV+S+L V+++TDWE+E
Sbjct  301   GIGAWINFYSFYMVGTPVAIVLTFVWRLGFKGLCYGLLAAQITCVVSILTVVHKTDWERE  360

Query  379   SARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEG  272
               + K+LVG++      D M  F   +E  +  EEG
Sbjct  361   CLKTKELVGKN-----NDRMAAFAHADE-TVKCEEG  390



>emb|CDY37931.1| BnaC02g20800D [Brassica napus]
Length=502

 Score =   407 bits (1046),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 233/494 (47%), Positives = 336/494 (68%), Gaps = 15/494 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ +     + KH T P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLEL
Sbjct  2     EEQNQPDNFSSYKHPTFPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+L R + +LL+AS+PIG
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWELLSLSLHRMVMILLIASVPIG  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML+L QD  I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWINLGPIMLFLGQDPGITATAAEYCHYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA-  1052
             L A   H+P+ ++L    + G+ G+A ++ V N I ++ L+GY+  + +  + +   +A 
Sbjct  182   LAAVAFHVPLNYWLVMVKRWGVPGVATASVVTNLIMVMLLVGYVWVSGKLQKRVSGSMAA  241

Query  1051  -TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
              T ++    +G     L+R+A+PSCL +CLEWWWYE + ++ GYL  P++ +A   I+IQ
Sbjct  242   ATVVELVGGLGP----LMRVAVPSCLGICLEWWWYEIVIVMGGYLENPKLAVAATGILIQ  297

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  +  T + +E 
Sbjct  298   TTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGASNVAWTVVLKER  357

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP IGA +N  SFY +G
Sbjct  358   WAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPTIGAHVNLGSFYFVG  417

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDLVGESRET  338
              P+A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE E+ RA       R T
Sbjct  418   TPVAVGLAFWLKVGFSGLWFGLLSAQAACAVSILYAVLARTDWEGEAMRAM------RMT  471

Query  337   SFEDPMIKFKEGEE  296
             S E  M K  + EE
Sbjct  472   SLE--MRKVGKDEE  483



>gb|KFK31447.1| hypothetical protein AALP_AA6G113000 [Arabis alpina]
Length=505

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 228/490 (47%), Positives = 337/490 (69%), Gaps = 16/490 (3%)
 Frame = -3

Query  1762  EEKMAAKQ--TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             E+K  +    + K+ T+P+V+EEL+++     P+ AM  + Y++  + V+ +GRLGSLEL
Sbjct  2     EDKTQSDDFSSHKNPTLPQVIEELKELWAMVLPITAMNCLVYVRAAVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSV+ GLA G+EPI SQA+GSKN  +++L+L R + +LL+AS+PI 
Sbjct  62    AGGALSIGFTNITGYSVMVGLASGLEPICSQAYGSKNWDLLTLSLHRMVVILLIASVPIS  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML++ Q+  I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWINLGPIMLFMGQNPDITATAAQYCLYALPDLLTNTLLQPLRVYLRSQQVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
             L A   H+P+ ++L    + G+ G+A+++ V N I +  L+GY+ ++   ++ +     +
Sbjct  182   LAAVAFHVPLNYWLVMVKQWGVPGVAMASVVTNLIMVGLLVGYVWFSGMLHKGVS---GS  238

Query  1048  NLKSSTSIGE---EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
             N+ +  ++ E       L+R+A+PSCL +CLEWWWYE +T+L GYL  P++ +A   I+I
Sbjct  239   NVVAQGTVVEFIGGLGPLMRVAVPSCLGICLEWWWYEIVTVLGGYLENPKLAVAATGILI  298

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  +  T + +E
Sbjct  299   QTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVVGALNVAWTVVLKE  358

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY +
Sbjct  359   RWAGLFTNYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFV  418

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL------  359
             G P+A+ +AF WK+ F GL +GLL+AQ ACV+S+L  V+ RTDWE E+ RA  L      
Sbjct  419   GTPVAVGLAFWWKIGFSGLWFGLLSAQAACVVSILYAVLARTDWEGEAVRAMKLTSLEMG  478

Query  358   -VGESRETSF  332
              VG+  E+S 
Sbjct  479   EVGKDEESSL  488



>ref|XP_006302154.1| hypothetical protein CARUB_v10020163mg [Capsella rubella]
 gb|EOA35052.1| hypothetical protein CARUB_v10020163mg [Capsella rubella]
Length=511

 Score =   405 bits (1041),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 231/493 (47%), Positives = 337/493 (68%), Gaps = 24/493 (5%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + KH T+P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  12    SHKHPTVPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLELAGGALSIGFT  71

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+GSKN  +++L+L R + +LL+ASLPI LLW NL P+M
Sbjct  72    NITGYSVLVGLASGLEPVCSQAYGSKNWDLLTLSLHRMVVILLVASLPISLLWINLGPIM  131

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             L++ QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W TL A   H+P+
Sbjct  132   LFMGQDPEITATAAEYCLYALPDLLINTLLQPLRVYLRSQRVTKPMMWCTLAAVAFHVPL  191

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG-  1022
              ++L      G+ G+A ++ V N I +  L+GY+  + +    L++ +  +   ST++  
Sbjct  192   NYWLVMMKGWGVPGVATASVVTNLIMVGLLVGYVWMSGK----LHRKVGDDSGGSTTMAV  247

Query  1021  ------EEWV----ILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
                    E+V     L+R+A+PSCL +CLEWWWYE +T++ GYL  P++ +A   I+IQT
Sbjct  248   AQSSSVMEFVGGLGPLMRVAVPSCLGICLEWWWYEIVTVMGGYLENPKLAVAATGILIQT  307

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             TSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  ++ T + +E W
Sbjct  308   TSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGALNVVWTVVLKERW  367

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
               +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY +G 
Sbjct  368   AGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFVGT  427

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDLVGESRETS  335
             P+A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE E+ARA        ++S
Sbjct  428   PVAVGLAFWLKIGFSGLWFGLLSAQAACAVSILYAVLARTDWEGEAARAMS------QSS  481

Query  334   FEDPMIKFKEGEE  296
              E  M K  + EE
Sbjct  482   LE--MSKVDKDEE  492



>ref|XP_010415902.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Camelina 
sativa]
 ref|XP_010415903.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Camelina 
sativa]
Length=510

 Score =   405 bits (1040),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 228/486 (47%), Positives = 332/486 (68%), Gaps = 21/486 (4%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + KH T+P+V++EL+++     P+ AM  + Y++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  12    SHKHPTLPQVIDELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLELAGGALSIGFT  71

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+GSKN  +++L+L R + +LL+AS+PI LLW NL P+M
Sbjct  72    NITGYSVLVGLASGLEPVCSQAYGSKNWDLLTLSLHRMVVILLVASVPISLLWINLGPIM  131

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             L++ QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W TL A   H+P+
Sbjct  132   LFMGQDPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCTLAAVAFHVPL  191

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
              ++L      G+ G+AI++ V N I +  L+GY+  + +    L+K +     S T++ +
Sbjct  192   NYWLVMVKLWGVPGVAIASVVTNLIMVGLLVGYVWLSGK----LHKRVNEGGGSITAVAQ  247

Query  1018  EWVI---------LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
                +         L+R+A+PSCL +CLEWWWYE +T+L GYL  P++ +A   I+IQTTS
Sbjct  248   SSSVMELVGGLGPLMRVAVPSCLGICLEWWWYEIVTVLGGYLDNPKLAVAATGILIQTTS  307

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             LMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  ++ T + +E W  
Sbjct  308   LMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGALNVVWTVVLKERWAG  367

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
             +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY +G P+
Sbjct  368   LFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFVGTPV  427

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL-------VGE  350
             A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE E+ RA  L       VG 
Sbjct  428   AVGLAFWLKIGFSGLWFGLLSAQAACAVSILYAVLSRTDWEGEAVRAMSLTSLEMGKVGN  487

Query  349   SRETSF  332
               E+S 
Sbjct  488   DEESSL  493



>ref|XP_010428035.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=512

 Score =   404 bits (1039),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 229/482 (48%), Positives = 332/482 (69%), Gaps = 14/482 (3%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + KH T+P+V++EL+++     P+ AM  + Y++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  12    SHKHPTLPQVIDELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLELAGGALSIGFT  71

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+GSKN  +++L+L R + +LL+AS+PI LLW NL P+M
Sbjct  72    NITGYSVLVGLASGLEPVCSQAYGSKNWDLLTLSLHRMVVILLVASVPISLLWINLGPIM  131

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             L++ QD  I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W TL A   H+P+
Sbjct  132   LFMGQDPDITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCTLAAVAFHVPL  191

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA--TNLKSSTSI  1025
              ++L      G+ G+AI++ V N I +  L+GY+  +   ++ + +     T +  S+S 
Sbjct  192   NYWLVMVKLWGVPGVAIASVVTNLIMVGLLVGYVWMSGRLHKRVNEGGGSITAVAQSSSS  251

Query  1024  GEEWV----ILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMY  857
               E+V     L+R+A+PSCL +CLEWWWYE +T+L GYL  P++ +A   I+IQTTSLMY
Sbjct  252   VMEFVGGLGPLMRVAVPSCLGICLEWWWYEIVTVLGGYLDNPKLAVAATGILIQTTSLMY  311

Query  856   TLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFt  677
             T+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  ++ T + +E W  +FT
Sbjct  312   TVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGALNVVWTVVLKERWAGLFT  371

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
                 +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY +G P+A+ 
Sbjct  372   GYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFVGTPVAVG  431

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL-------VGESRE  341
             +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE E+ RA  L       VG   E
Sbjct  432   LAFWLKIGFSGLWFGLLSAQAACAVSILYAVLARTDWEGEAVRAMSLTSLEMGKVGNDEE  491

Query  340   TS  335
             +S
Sbjct  492   SS  493



>gb|KEH26072.1| MATE efflux family protein [Medicago truncatula]
Length=515

 Score =   404 bits (1039),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 233/506 (46%), Positives = 347/506 (69%), Gaps = 17/506 (3%)
 Frame = -3

Query  1792  KHTRANTNQQEE-KMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             K+T  +TN +E+ K     + K  T  +V+EEL+++     P+ AM ++ +++ ++ V+ 
Sbjct  3     KNTYLSTNMREDDKDHDFFSHKFPTTSQVVEELKELWSMALPLTAMNMLVFVRAVVSVLF  62

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +GRLGSLELAGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+LQR + +
Sbjct  63    LGRLGSLELAGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWELLSLSLQRMVLI  122

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LLMA +PI LLW NL+ +ML++ QD KI  +A+++C +++PDL+ N++L PLR++LR + 
Sbjct  123   LLMAIVPISLLWLNLEKIMLFMGQDGKITEMAAIYCFYSLPDLLTNTLLQPLRVFLRSQK  182

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T P+++ +LIA + H+P+ ++L   ++ G+ G+A+++ + N   ++ + GY+    ++ 
Sbjct  183   VTKPMMYCSLIAVLFHVPLNYFLVMVMQFGVPGVAMASVLTNMNMVVLMAGYVGLFRKKE  242

Query  1075  EALYKPLATN-----LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRP  911
               L  P         +  S  +GE    L++LA+PSCL +CLEWWWYE +T+LAGYL  P
Sbjct  243   MMLKWPGCGGGGGGMMVVSEGLGE----LMKLAVPSCLMICLEWWWYEIVTVLAGYLENP  298

Query  910   QVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASA  731
              + +A   I+IQTTS+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+   
Sbjct  299   TLAVAATGILIQTTSMMYTVPMALAACVSARVGNELGAGKPYKAKLAAMVALACAFVMGF  358

Query  730   FGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIG  551
               +  T + R  W  +FT D  V  L  +V+PI+GLCEL NCPQTT CG+LRG+ARP IG
Sbjct  359   INVTWTVILRYGWAGLFTNDEPVKALVASVMPIMGLCELGNCPQTTGCGILRGTARPVIG  418

Query  550   ACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESA  374
             A IN  SFY +G P+A+ +AF +K+ F GL +GLL+AQVAC +S+L +VI +TDWE E+ 
Sbjct  419   ANINLGSFYFVGTPVAVGLAFWFKIGFSGLWFGLLSAQVACALSILYVVIIKTDWEAEAL  478

Query  373   RAKDLVGESRETSFEDPMIKFKEGEE  296
             +A+ L      T  E  M K K+  E
Sbjct  479   KAEKL------TMVEMVMNKDKKKNE  498



>ref|XP_009127878.1| PREDICTED: MATE efflux family protein 5-like [Brassica rapa]
Length=516

 Score =   404 bits (1038),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 229/504 (45%), Positives = 335/504 (66%), Gaps = 21/504 (4%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ +     + KH T P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLEL
Sbjct  2     EEQNQPDDFSSHKHPTFPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+L R + +LL AS+PIG
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWELLSLSLHRMVMILLFASVPIG  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML+L QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWINLGPIMLFLGQDPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilY---------TNEQN  1076
             L A   H+P+ ++L    + G+ G+A ++ V N I ++  L  ++            +++
Sbjct  182   LAAVTFHVPLNYWLVMVKRWGVPGVATASVVTNLIMVVTNLIMVMLLVGYVSLSGKMQKS  241

Query  1075  EALYKPLATNLKSSTSIGE---EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQV  905
             + +   +   + + +S+ E       L+R+A+PSCL +CLEWWWYE + ++ GYL  P++
Sbjct  242   QGVSGSMVATVAAQSSVVELVGGLGPLMRVAVPSCLGICLEWWWYEIVIVMGGYLENPKL  301

Query  904   TLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFG  725
              +A   I+IQTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  
Sbjct  302   AVAATGILIQTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGASN  361

Query  724   ILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGAC  545
             +  T + +E W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA 
Sbjct  362   VAWTVVLKERWAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPTVGAH  421

Query  544   INFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARA  368
             +N  SFY +G P+A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE E+ RA
Sbjct  422   VNLGSFYFVGTPVAVGLAFWLKVGFSGLWFGLLSAQAACAVSILYAVLARTDWEGEAMRA  481

Query  367   KDLVGESRETSFEDPMIKFKEGEE  296
                    R TS E  M K  + EE
Sbjct  482   M------RMTSLE--MRKVGKDEE  497



>ref|XP_009105850.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 5 
[Brassica rapa]
Length=521

 Score =   404 bits (1037),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 227/517 (44%), Positives = 337/517 (65%), Gaps = 22/517 (4%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +++ +     + KH T+P+V+EEL+++     P+ AM  + Y+  ++ V+ +GRLGSLEL
Sbjct  2     EEKNQTDDFSSHKHPTLPQVIEELKELWAMVLPITAMNCLVYVSAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  +++L+L R + +LL+AS+PI 
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWDLLTLSLHRMVVILLIASVPIS  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LW NL P+ML++ QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   FLWVNLGPIMLFMGQDPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE-------A  1070
             L A   H+P+ ++L    + G+ G+AI++ V N I +  L+GY+  + +  +       A
Sbjct  182   LAAVAFHVPLNYWLVMVKRWGVPGVAIASVVTNLIMVGLLVGYVWASGKLQKRVSGSTVA  241

Query  1069  LYKPLATNLKSSTSIGEEWVI--------LLRLALPSCLAVCLEWWWYEFMTLLAGYLVR  914
             +         S+ ++     +        L+R+A+PSCL +C EWWWYE +T++ GYL  
Sbjct  242   VQSSGGGGFLSTVAVQSSSAVEFFGGLGPLMRVAVPSCLGICFEWWWYEIVTIMGGYLEN  301

Query  913   PQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLAS  734
             P++ +A   I+IQTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  
Sbjct  302   PKLAVAATGILIQTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIG  361

Query  733   AFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNI  554
             A  +  T + +E W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +
Sbjct  362   ALNVAWTVILKERWAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAV  421

Query  553   GACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKES  377
             GA +N  SFY +G P+A+ +AF  K+ F GL +GLL+AQ AC +S+L  V+ RTDWE ES
Sbjct  422   GAHVNLGSFYFVGTPVAVGLAFWLKIGFSGLWFGLLSAQAACAVSILYAVVARTDWEGES  481

Query  376   ARAKDLVG------ESRETSFEDPMIKFKEGEEFRIS  284
              RA  L        E  E S    ++  + G + ++S
Sbjct  482   VRAMRLTSLEMGKVEKDEESSSLLLVDDRNGSDDKLS  518



>ref|XP_006390732.1| hypothetical protein EUTSA_v10018419mg [Eutrema salsugineum]
 gb|ESQ28018.1| hypothetical protein EUTSA_v10018419mg [Eutrema salsugineum]
Length=508

 Score =   402 bits (1032),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 227/490 (46%), Positives = 331/490 (68%), Gaps = 13/490 (3%)
 Frame = -3

Query  1762  EEKMAAKQ--TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             E+K  +    + K+ T  +V EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLEL
Sbjct  2     EDKTQSDDFSSHKNPTFTQVTEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+L R + +LL+AS+PI 
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWHLLSLSLHRMVVILLIASVPIS  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML++ QD +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWINLGPIMLFMGQDPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
             L A   H+P+ ++L    + G+ G+A ++ V N I +  L+GY+  +    + +   +  
Sbjct  182   LAAVAFHVPLNYWLVMVKRWGVPGVATASVVTNLIMVGLLVGYVWASGRLQKKVSGSMVV  241

Query  1048  NLKSSTSIGE---EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
                 S+S+ E       L+R+A+PSCL +CLEWWWYE + ++ GYL  P++ +A   I+I
Sbjct  242   GNNQSSSVVELVGGLGPLMRVAVPSCLGICLEWWWYEIVIVMGGYLENPKLAVAATGILI  301

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  ++ T + +E
Sbjct  302   QTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVIGALNVVWTVVLKE  361

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  SFY +
Sbjct  362   RWAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFV  421

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL------  359
             G P+A+ +AF  K+ F GL +GLL+AQ ACV+S+L  V+ +TDWE E+ RA  L      
Sbjct  422   GTPVAVGLAFWLKIGFSGLWFGLLSAQAACVVSILYAVLAKTDWEGEAVRAMRLTSLEMR  481

Query  358   -VGESRETSF  332
              VG+  E+S 
Sbjct  482   KVGKDEESSL  491



>ref|XP_010939303.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=546

 Score =   402 bits (1032),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 238/476 (50%), Positives = 313/476 (66%), Gaps = 7/476 (1%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
              ++ + +  Q+  T+ EV+EE+R +     P    GL+ Y + MI ++ +G LG LELAG
Sbjct  24    HKEHSEEDLQRWPTLSEVVEEMRAIGRISIPTALTGLVLYSRAMISMLFLGYLGELELAG  83

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             G+L+IGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ LTLQRTI +LL ASLPI  L
Sbjct  84    GSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGLTLQRTILLLLSASLPISFL  143

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             WFN+K ++LW  QD +I   A  F  FA+PDLV  S+LHPLRIYLR +  T P+ + + I
Sbjct  144   WFNMKRILLWCGQDEQISSTAHTFITFAVPDLVFLSLLHPLRIYLRSQNITMPVTYCSFI  203

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             + +LH+P+ + L    K+GI G+A++    N   LL LL +IL +     +   P    L
Sbjct  204   SVILHVPLNYLLVVRFKMGIAGVALAMVWTNLNLLLCLLLFILVSGVHEVSWVSPSVDCL  263

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
             K        W  LLRLA+P+C +VCLEWWWYEFM +L G LV P+ T+A+  I+IQTTSL
Sbjct  264   KG-------WSALLRLAIPTCASVCLEWWWYEFMIMLCGLLVNPKTTVASMGILIQTTSL  316

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             +Y  PSALS  +S+RVGNELGA RP  AR AT +++  A +     +  TT  R  W ++
Sbjct  317   VYVFPSALSLGVSTRVGNELGADRPANARKATIVSLACAVVVGLMAMAFTTSMRHRWGRL  376

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT+D E+LELT   LPI GLCEL NCPQTT CGVLRGSARPN GA IN  SFYL+G P+A
Sbjct  377   FTSDAEILELTAVALPISGLCELGNCPQTTGCGVLRGSARPNTGANINLGSFYLVGMPVA  436

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETS  335
             I+M F   + F GL  GLLAAQ +C   M  V+  TDW  E+ RA++L   S+ +S
Sbjct  437   ILMGFAAGMGFAGLWLGLLAAQASCATLMAYVVVTTDWAVEAKRAQELTKASKSSS  492



>gb|KEH26071.1| MATE efflux family protein [Medicago truncatula]
Length=505

 Score =   400 bits (1027),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 228/497 (46%), Positives = 342/497 (69%), Gaps = 16/497 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             ++++K     + K  T  +V+EEL+++     P+ AM ++ +++ ++ V+ +GRLGSLEL
Sbjct  2     REDDKDHDFFSHKFPTTSQVVEELKELWSMALPLTAMNMLVFVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+LQR + +LLMA +PI 
Sbjct  62    AGGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWELLSLSLQRMVLILLMAIVPIS  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL+ +ML++ QD KI  +A+++C +++PDL+ N++L PLR++LR +  T P+++ +
Sbjct  122   LLWLNLEKIMLFMGQDGKITEMAAIYCFYSLPDLLTNTLLQPLRVFLRSQKVTKPMMYCS  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
             LIA + H+P+ ++L   ++ G+ G+A+++ + N   ++ + GY+    ++   L  P   
Sbjct  182   LIAVLFHVPLNYFLVMVMQFGVPGVAMASVLTNMNMVVLMAGYVGLFRKKEMMLKWPGCG  241

Query  1048  N-----LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
                   +  S  +GE    L++LA+PSCL +CLEWWWYE +T+LAGYL  P + +A   I
Sbjct  242   GGGGGMMVVSEGLGE----LMKLAVPSCLMICLEWWWYEIVTVLAGYLENPTLAVAATGI  297

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTS+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T + 
Sbjct  298   LIQTTSMMYTVPMALAACVSARVGNELGAGKPYKAKLAAMVALACAFVMGFINVTWTVIL  357

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             R  W  +FT D  V  L  +V+PI+GLCEL NCPQTT CG+LRG+ARP IGA IN  SFY
Sbjct  358   RYGWAGLFTNDEPVKALVASVMPIMGLCELGNCPQTTGCGILRGTARPVIGANINLGSFY  417

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVGES  347
              +G P+A+ +AF +K+ F GL +GLL+AQVAC +S+L +VI +TDWE E+ +A+ L    
Sbjct  418   FVGTPVAVGLAFWFKIGFSGLWFGLLSAQVACALSILYVVIIKTDWEAEALKAEKL----  473

Query  346   RETSFEDPMIKFKEGEE  296
               T  E  M K K+  E
Sbjct  474   --TMVEMVMNKDKKKNE  488



>ref|NP_177332.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAF43240.1|AC012654_24 Contains similarity to the ZF14 mRNA from Arabidopsis thaliana 
gb|AB028198; It is a member of the uncharacterized membrane 
protein family PF|01554 [Arabidopsis thaliana]
 gb|AAG52224.1|AC021665_7 hypothetical protein; 7233-4794 [Arabidopsis thaliana]
 gb|AAO85439.1| NIC2 [Arabidopsis thaliana]
 gb|AEE35246.1| MATE efflux family protein [Arabidopsis thaliana]
Length=510

 Score =   399 bits (1026),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 224/497 (45%), Positives = 330/497 (66%), Gaps = 20/497 (4%)
 Frame = -3

Query  1762  EEKMAAKQ--TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             E+K+ +    + K+ T+P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLEL
Sbjct  2     EDKIQSDDFTSHKNPTLPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLGSLEL  61

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGGAL+IGFTNITGYSV+ GLA G+EP+ SQA+GSKN  +++L+L R + +LLMASLPI 
Sbjct  62    AGGALSIGFTNITGYSVMVGLASGLEPVCSQAYGSKNWDLLTLSLHRMVVILLMASLPIS  121

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             LLW NL P+ML++ Q+ +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P++W T
Sbjct  122   LLWINLGPIMLFMGQNPEITATAAEYCLYALPDLLTNTLLQPLRVYLRSQRVTKPMMWCT  181

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigll-------fllgyilYTNEQNEA  1070
             L A   H+P+ ++L      G+ G+AI++ V N I ++                +   + 
Sbjct  182   LAAVAFHVPLNYWLVMVKHWGVPGVAIASVVTNLIMVVLLVGYVWVSGMLQKRVSGDGDG  241

Query  1069  LYKPLATNLKSSTSIGE---EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
                 +   +  S+S+ E       L+R+A+PSCL +CLEWWWYE + ++ GYL  P++ +
Sbjct  242   GSTTMVAVVAQSSSVMELVGGLGPLMRVAVPSCLGICLEWWWYEIVIVMGGYLENPKLAV  301

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A   I+IQTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  + 
Sbjct  302   AATGILIQTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVVGALNVA  361

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              T + +E W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N
Sbjct  362   WTVILKERWAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVN  421

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKD  362
               SFY +G P+A+ +AF  K+ F GL +GLL+AQ ACV+S+L  V+ RTDWE E+ +A  
Sbjct  422   LGSFYFVGTPVAVGLAFWLKIGFSGLWFGLLSAQAACVVSILYAVLARTDWEGEAVKAMR  481

Query  361   L-------VGESRETSF  332
             L       VG+  E+S 
Sbjct  482   LTSLEMRKVGQDEESSL  498



>ref|XP_009620467.1| PREDICTED: MATE efflux family protein DTX1-like [Nicotiana tomentosiformis]
Length=529

 Score =   400 bits (1027),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 348/537 (65%), Gaps = 27/537 (5%)
 Frame = -3

Query  1873  VDCLCMEVKLHE*KNTHNQLYLLC*RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELR  1694
             + C C   + HE     N   LL  +    + +     +K  + +T   S    V +E +
Sbjct  9     LSCKCNSNEPHE----TNMFTLLIPKCPTNKLHDKNNLDKTISYKTTHFSL---VFKEAQ  61

Query  1693  KMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGM  1514
              + +  FPMI  GL+ Y +++I ++ +GR+G L LAGG+LA+GF NITGYS+LSGLA+GM
Sbjct  62    SIANIAFPMILTGLLLYSRSLISMLFLGRVGGLALAGGSLAVGFANITGYSILSGLAMGM  121

Query  1513  EPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASL  1334
             EPI  QAFG+K   ++ L+LQRTI +L++ S PI LLW N+K ++L+  QD  I   A  
Sbjct  122   EPICGQAFGAKKYNLLGLSLQRTILLLILTSFPIALLWVNMKTILLYCGQDENIATEAQS  181

Query  1333  FCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGI  1154
             +  ++IPDL A S+LHPLRIYLR +  T PL +  ++A +LH+PI F L   L LG++G+
Sbjct  182   YLFYSIPDLFAQSLLHPLRIYLRTQSITLPLTFCAVLAILLHIPINFLLVTKLNLGVKGV  241

Query  1153  AISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLA  974
             A+S    NF  +  L+ YIL +      +YK    NL  ST   + W  LL LA+PSC++
Sbjct  242   ALSAVWTNFNLVASLIVYILIS-----GVYKKTWENL--STECLKGWKKLLNLAIPSCIS  294

Query  973   VCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAG  794
             VCLEWWWYE M LL G L+ P+ T+A+  I+IQTTSL+Y  PS+LS S+S+RVGNELGA 
Sbjct  295   VCLEWWWYEIMILLCGVLLNPKATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNELGAR  354

Query  793   RPGKARLATAI----AIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIG  626
              P KA+LA  +    +I+L F A  F + +    R+VW K+FT D E+L LT  VLPIIG
Sbjct  355   NPNKAKLAAIVGLAGSIILGFSALFFAVTV----RKVWAKMFTQDNEILALTSLVLPIIG  410

Query  625   LCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLL  446
             LCEL NCPQTT CGVLRG+ARP +GA IN   FY++G P+A+ ++F    +F+GL  GLL
Sbjct  411   LCELGNCPQTTGCGVLRGTARPKVGANINLGCFYIVGMPVAVGLSFYVGFDFEGLWLGLL  470

Query  445   AAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEE  275
             AAQV+C+++ML+V+ RTDW+ E+ RAKDL  E+  +  +D     ++ EE++    E
Sbjct  471   AAQVSCMVTMLVVLLRTDWDFEAERAKDLT-ETIVSVVDDN----EDIEEYKQHIPE  522



>ref|XP_001770051.1| predicted protein [Physcomitrella patens]
 gb|EDQ65227.1| predicted protein [Physcomitrella patens]
Length=547

 Score =   400 bits (1028),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 238/512 (46%), Positives = 330/512 (64%), Gaps = 19/512 (4%)
 Frame = -3

Query  1789  HTRANTNQQEE-KMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCM  1613
             H  +N+  +    M     Q      +V+EEL++ +    P+     I+Y + M+ V+C+
Sbjct  11    HPASNSGDESNLDMQECSLQSWPAPQQVVEELKESMRIAGPLAVANGIAYARLMVSVLCL  70

Query  1612  grlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISML  1433
             GRLG LELAGGAL+IGFTNITGYSVL GLA GM+PI SQA GSKN  +V LTLQRT+ +L
Sbjct  71    GRLGGLELAGGALSIGFTNITGYSVLYGLASGMDPICSQAVGSKNWHVVGLTLQRTVLIL  130

Query  1432  LMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGT  1253
             L A LPIG+LW NL P+ML+L QD  I  +AS++C +++PDLVAN +L PLR Y RC+G 
Sbjct  131   LAACLPIGMLWTNLGPIMLFLGQDPAITAVASVYCWYSLPDLVANCLLQPLRNYYRCQGF  190

Query  1252  TWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNE  1073
               P+++   +  +LH+P+    TF  +LG+ G+AI+  + N   ++ +L           
Sbjct  191   QSPMMYCAALGVVLHIPLSIVFTFVFRLGVPGVAIAASMTNINVVILML-----------  239

Query  1072  ALYKPLATNLKS-----STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQ  908
              LY   +   K      S +   EW  +L LALPSCL +CLEWWWYE MT+LAGYL  PQ
Sbjct  240   -LYVKFSGAFKKTWGGVSPACVREWWPVLSLALPSCLQICLEWWWYEIMTILAGYLPNPQ  298

Query  907   VTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAF  728
             V +A  AI+IQTT+LMYT+P +L +++S+RVGNELGA RP +AR A+ +++ +AFL +  
Sbjct  299   VAVAATAILIQTTALMYTIPMSLGSAVSTRVGNELGANRPERARNASLVSLGVAFLVAIV  358

Query  727   GILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGA  548
              ++ TT+ R+ W  ++T D  VL LT   LP+IGLCEL NCPQT  CG+LRGSARP I A
Sbjct  359   SVIWTTVFRKQWGTLYTVDASVLALTAAALPLIGLCELGNCPQTAGCGILRGSARPTITA  418

Query  547   CINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARA  368
              I F SFYL+G P+A+I AF  ++ F+GL YGLLAAQ+ C  ++L +  R +W +E ARA
Sbjct  419   SIMFGSFYLVGTPVAVISAFWLRIGFQGLWYGLLAAQICCACAILFITLRINWIEECARA  478

Query  367   KDLVGESRETSFE-DPMIKFKEGEEFRISFEE  275
               L     +++ E   ++  K G       +E
Sbjct  479   NKLTRSEVDSASEMSKLVNHKIGPILGADSDE  510



>ref|XP_002888851.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65110.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=509

 Score =   399 bits (1024),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 229/511 (45%), Positives = 344/511 (67%), Gaps = 18/511 (4%)
 Frame = -3

Query  1780  ANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlg  1601
             A+  Q ++ +    + K+ T+P+V+EEL+++     P+ AM  + Y++ ++ V+ +GRLG
Sbjct  2     ADKTQSDDFI----SHKNPTLPQVIEELKELWAMVLPITAMNCLVYVRAVVSVLFLGRLG  57

Query  1600  slelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMAS  1421
             SLELAGGAL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  +++L+L R + +LL+AS
Sbjct  58    SLELAGGALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLTLSLHRMVVILLIAS  117

Query  1420  LPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPL  1241
             +PI LLW NL P+ML++ Q+ +I   A+ +C +A+PDL+ N++L PLR+YLR +  T P+
Sbjct  118   VPISLLWINLGPIMLFMGQNPEITATAAEYCLYALPDLLNNTLLQPLRVYLRSQRVTKPM  177

Query  1240  LWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE-QNEALY  1064
             +W TL A   H+P+ ++L    + G+ G+AI++ V N I ++ L+GY+ ++   Q     
Sbjct  178   MWCTLAAVAFHVPLNYWLVMVKRWGVPGVAIASVVTNLIMVVLLVGYVWFSGMLQKTVSG  237

Query  1063  KPLATNLKSSTSIGE---EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLAT  893
                   +  S+S+ E       L+R+A+PSCL +CLEWWWYE + ++ GYL  P++ +A 
Sbjct  238   GSTVVAVAQSSSVLELVGGLGPLMRVAVPSCLGICLEWWWYEIVIVMGGYLENPKLAVAA  297

Query  892   AAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLT  713
               I+IQTTSLMYT+P AL+  +S+RVGNELGAGRP KARLA  +A+  AF+  A  +  T
Sbjct  298   TGILIQTTSLMYTVPMALAGCVSARVGNELGAGRPYKARLAANVALACAFVVGALNVAWT  357

Query  712   TLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFY  533
              + +E W  +FT    +  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA +N  
Sbjct  358   VVLKERWAGLFTGYEPLKVLVASVMPIVGLCELGNCPQTTGCGILRGTGRPAVGAHVNLG  417

Query  532   SFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL-  359
             SFY +G P+A+ +AF  K+ F GL +GLL+AQ ACV+S+L  V+ RTDWE E+ RA  L 
Sbjct  418   SFYFVGTPVAVGLAFWLKIGFSGLWFGLLSAQAACVVSILYAVLARTDWEGEAVRAMRLT  477

Query  358   ------VGESRETSFEDPMIKFKEGEEFRIS  284
                   VG+  E+S    ++  + G + ++ 
Sbjct  478   SLEMRKVGKDEESSLL--LLDDRNGNDEKLD  506



>ref|XP_006340580.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=499

 Score =   398 bits (1022),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 228/469 (49%), Positives = 321/469 (68%), Gaps = 9/469 (2%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
              K+   +   H T+  +  E + + +  FPMI  GL+ Y +++I ++ +G+LG L LAGG
Sbjct  12    NKLHDHKNNTHFTL--IFIEAKSIANIAFPMILTGLLLYSRSLISMLFLGQLGGLALAGG  69

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             +LA+GF NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +L++ S PI LLW
Sbjct  70    SLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYNLLGLTLQRTILLLILISFPIALLW  129

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              N+K ++L+  QD  I   A  +  ++IPDL A S+LHPLRIYLR +  T PL +  +++
Sbjct  130   INMKNILLYCGQDEDIATEAQSYLIYSIPDLFAQSLLHPLRIYLRTQSITLPLTFCAILS  189

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
               LH+PI + L   L LG++GIA+S+   NF  ++ L+ YI+ T      +YK    NL 
Sbjct  190   VSLHVPINYLLVTKLNLGVKGIALSSVWTNFNLVISLIIYIIIT-----GVYKKTWENL-  243

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
              ST   + W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQTTSL+
Sbjct  244   -STECFKGWKKLLNLAIPSCISVCLEWWWYEIMILLCGLLINPRATVASMGILIQTTSLI  302

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             Y  PS+LS S+S+RVGNELGA +P KA++A  + +  +F+     +      R++W K+F
Sbjct  303   YIFPSSLSFSVSTRVGNELGARQPNKAKIAAIVGLAGSFILGFSALFFAVTVRKIWAKMF  362

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D ++L LT  VLPIIGLCE+ NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+
Sbjct  363   TNDQDILTLTSLVLPIIGLCEIGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVAV  422

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
              ++F    +F+GL  GLLAAQ +C+++ML+V+ RTDW+ E+ RAKDL G
Sbjct  423   GLSFYAGFDFEGLWLGLLAAQASCMVTMLLVLLRTDWDLEAERAKDLTG  471



>ref|XP_001758960.1| predicted protein [Physcomitrella patens]
 gb|EDQ76466.1| predicted protein [Physcomitrella patens]
Length=520

 Score =   396 bits (1017),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 317/474 (67%), Gaps = 17/474 (4%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +V+ E ++ +    P+     I+Y + M+ V+C+GRLG LELAGGAL+IGFTNITGYSVL
Sbjct  11    QVVLEFKESMRIAGPLAVANGIAYARLMVSVLCLGRLGGLELAGGALSIGFTNITGYSVL  70

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
              GLA GM+PI SQA GSKN  +V LTLQRT+++LL A LPIG+LW NL+P+ML+L QDA 
Sbjct  71    YGLASGMDPICSQAVGSKNWHLVGLTLQRTVAILLTACLPIGMLWVNLEPIMLFLGQDAG  130

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +AS++C +++PDLVAN  L PLR Y RC G   P+++ + +  +LH+P+    TF  
Sbjct  131   ITSVASVYCWYSLPDLVANCFLQPLRNYFRCHGFQTPMMYCSALGVVLHIPLSIVFTFVF  190

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKS-----STSIGEEWV  1010
              LG+ G+AI+  + N   ++F+L            LY   +   K+     S +   EW 
Sbjct  191   HLGVPGVAIAASMTNINVVVFML------------LYVKFSGAFKNTWGGVSPACVREWW  238

Query  1009  ILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNS  830
              +L LALPSCL +CLEWWWYE MT+LAGYL  PQV +A  AI+IQTT+LMYT+P +L ++
Sbjct  239   PVLSLALPSCLQICLEWWWYEIMTILAGYLSNPQVAVAATAILIQTTALMYTIPMSLGSA  298

Query  829   ISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevlelt  650
             +S+RVGNELGA RP +AR A+ +A+  AFL +   ++ T++    W  ++T DT VL LT
Sbjct  299   VSTRVGNELGANRPQQARNASLVALATAFLVAIVSVIWTSVFNNQWGTLYTADTSVLALT  358

Query  649   vtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEF  470
                LP++G+CEL NCPQT  CG+LRGSARP I A I F SFY++G P+A+I AF  K+ F
Sbjct  359   AAALPLVGICELGNCPQTAGCGILRGSARPTITAIIMFISFYMVGTPVAVISAFWLKIGF  418

Query  469   KGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFK  308
             +GL YGLLAAQ+ C  ++L +  R +W +E +RAK L G          ++  K
Sbjct  419   QGLWYGLLAAQICCACAILFITLRINWIEECSRAKKLTGSENSAGEMSKLVSHK  472



>ref|XP_004300756.1| PREDICTED: MATE efflux family protein 8-like [Fragaria vesca 
subsp. vesca]
Length=500

 Score =   394 bits (1013),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 227/488 (47%), Positives = 320/488 (66%), Gaps = 7/488 (1%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
              Q  + + +   + E + +    FPM+  GL+ Y ++MI ++ +G LG L LAGG+LAIG
Sbjct  10    NQRPQKTHLSLALNEAKSIASIAFPMVLTGLLLYSRSMISMLFLGHLGELALAGGSLAIG  69

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSVLSGLA+GMEPI  QAFG+K   ++  TLQRT+ +LL+ S+PI  LWFN+K 
Sbjct  70    FANITGYSVLSGLAMGMEPICGQAFGAKRFKVLGHTLQRTVILLLLTSIPISFLWFNMKR  129

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++L+  Q  +I + A  +  +++PDL+A S+LHPLRIYLR +  T PL     +A +LH+
Sbjct  130   ILLFCGQQDEIANEAQSYILYSLPDLIAQSLLHPLRIYLRTQSITVPLTCCATLAILLHI  189

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             PI + L   L LGI+G+A+S    N   +  L+ Y+  +      +YK       S+   
Sbjct  190   PINYLLVSVLGLGIKGVALSGVWTNVNLVGSLIVYMAVS-----GVYKKTWGGF-STQYF  243

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
              + W  LL LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT+L+Y  PS
Sbjct  244   FKGWKSLLNLAVPSCISVCLEWWWYEIMILLCGLLLDPQATVASMGILIQTTALIYIFPS  303

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS  +S+RVGNELGA RP +A+LA  I +  +F+     +L   + R +W  +FT D+ 
Sbjct  304   SLSFGVSTRVGNELGANRPERAKLAAIIGLAYSFVFGLSALLFAVMVRNIWASMFTEDSH  363

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             ++ LT  VLPIIGLCEL NCPQTT CGVLRGSARP +GA IN   FYL+G P+A+ + F 
Sbjct  364   IIALTAMVLPIIGLCELGNCPQTTGCGVLRGSARPKLGANINLGCFYLVGMPVAVWLGFF  423

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKE  305
                +F+GL  GLLAAQ +CV++ML V+ +T+WE ++ RAK+L  ES  T+ +D  + F E
Sbjct  424   AGFDFRGLWLGLLAAQGSCVVTMLFVLAKTNWELQAKRAKELTAESY-TTVDDGSLNFDE  482

Query  304   GEEFRISF  281
              +    SF
Sbjct  483   ADACLSSF  490



>ref|XP_010062021.1| PREDICTED: MATE efflux family protein 5 [Eucalyptus grandis]
 gb|KCW69085.1| hypothetical protein EUGRSUZ_F02633 [Eucalyptus grandis]
Length=495

 Score =   394 bits (1011),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 217/473 (46%), Positives = 327/473 (69%), Gaps = 18/473 (4%)
 Frame = -3

Query  1753  MAAKQT----QKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             MAAK       K  +  +V+EEL++++   FP+ AM L+++++ ++ V+ +GRLGSLELA
Sbjct  1     MAAKDADFSPHKLPSPSQVVEELKELLGMVFPITAMNLLAFVRQVVSVLFLGRLGSLELA  60

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GGAL+IGFTNITGYSVL+GLA G+EP+ +QA+GSKN  +++L+LQR + +LL+A +PIGL
Sbjct  61    GGALSIGFTNITGYSVLAGLASGLEPVCAQAYGSKNWDLLALSLQRMVLILLIAIVPIGL  120

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW NL+P+M+++ QD  I  +A+ +C F++PDL+ N++L PLR++LR +G   P+++ +L
Sbjct  121   LWVNLEPIMVFMGQDRHITSMAATYCMFSLPDLLTNTLLQPLRVFLRSQGIAKPMMYCSL  180

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN---EALYKPL  1055
              A  LH+P+ + L     +G+ G+A+++ + N   ++ +  Y+  +  +     A ++ +
Sbjct  181   AAVALHVPLNYVLVVGAGMGVPGVAVASVLTNVNMVVLMAAYVYVSGRREIRWTAGFRRV  240

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
                L            L+RLA+PSCL +CLEWWWYE +T+L+GYL  P V +A   ++IQ
Sbjct  241   CDGLGP----------LMRLAVPSCLGICLEWWWYEILTVLSGYLPNPTVAVAATGVLIQ  290

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTS+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T L R+ 
Sbjct  291   TTSMMYTVPMALAGCVSARVGNELGAGKPYKAKLAALVALGCAFIMGIVNVTWTILLRKK  350

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W   FT D  +  L  +V+PI+GLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G
Sbjct  351   WASFFTKDELLKALVASVMPIMGLCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVG  410

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL  359
              P+A+ +AF  K+ F GL +GLL+AQ  C +S+L  V+ RTDWE E+ +AK L
Sbjct  411   TPVAVGLAFWLKVGFSGLWFGLLSAQAVCAVSILYNVLGRTDWEGEALKAKKL  463



>ref|XP_006600090.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Glycine 
max]
Length=522

 Score =   395 bits (1014),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 234/496 (47%), Positives = 322/496 (65%), Gaps = 17/496 (3%)
 Frame = -3

Query  1720  IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYS  1541
             +PE ++E+  +     PMI  GL+ Y ++MI ++ +G LG L LAGG+LAIGF NITGYS
Sbjct  35    VPEAIKEVFSISKIVIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAIGFANITGYS  94

Query  1540  VLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQD  1361
             +LSGLA+GMEPI  QAFG+K  T++ L LQRTI +LL  SLPI LLW  +K ++L   QD
Sbjct  95    ILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPISLLWLYMKQILLLCGQD  154

Query  1360  AKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTF  1181
               I   A  +  ++IPDL+A S LHPLRIYLR +  T PL      + +LH+PI ++L  
Sbjct  155   VAIATQAQSYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLVA  214

Query  1180  SLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILL  1001
              LKLGI+G+A+   + NF  +  L+ YI+++    +       T    S     +W  LL
Sbjct  215   HLKLGIKGVALGGVLTNFNLVASLILYIVFSGTHKK-------TWGGFSFECFTQWKSLL  267

Query  1000  RLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISS  821
              LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTTSL+Y  PS+LS S+S+
Sbjct  268   NLAIPSCVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVST  327

Query  820   RVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtv  641
             RVGN+LGA +P KARL+  + +  +F++    ++   + R  W  +FT D +++ LT  V
Sbjct  328   RVGNKLGAQKPSKARLSAIVGLSCSFMSGVLALVFALMVRNTWASMFTKDKDIITLTSMV  387

Query  640   LPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGL  461
             LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P++I +AF    +F+GL
Sbjct  388   LPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQGL  447

Query  460   CYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG---------ESRETSFEDPMIKFK  308
               GLLAAQ +C ++ML+V+ RTDWE E+ RAK L G         +SRE   E P+ K +
Sbjct  448   WLGLLAAQGSCAVTMLVVLCRTDWEFEAQRAKKLTGMGGAASGVDQSREVDPEKPL-KHE  506

Query  307   EGEEFRISFEEGVNLQ  260
               E+  +  +   N Q
Sbjct  507   SNEDSLLLADSDENEQ  522



>ref|XP_010936249.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=544

 Score =   395 bits (1015),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 239/506 (47%), Positives = 319/506 (63%), Gaps = 11/506 (2%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
              TN    + + +  Q+  T+ EV+EE+R +     P  A GL+ Y + MI ++ +G LG 
Sbjct  16    KTNLLMHEHSEEDLQRWPTLREVVEEMRAIGKISIPTAATGLVLYSRAMISMLFLGYLGD  75

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
             LELAGG+L+IGF NITGYSVL+GLA+GMEPI  QA+G+K   ++ LTLQRTI +LL ASL
Sbjct  76    LELAGGSLSIGFANITGYSVLAGLAMGMEPICGQAYGAKQRKLLGLTLQRTILLLLSASL  135

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI  LW N+K ++LW  QD KI   A  F  FA+PDL+  S LHPLRIYLR +  T P+ 
Sbjct  136   PISFLWLNMKRILLWCGQDEKISSTAHTFIIFAVPDLILLSFLHPLRIYLRSQNITLPVT  195

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
             + + I+   H+P+ + L   L++GI G+A++    N    L LL +IL +    ++   P
Sbjct  196   YCSFISVFFHVPLNYLLVVHLRMGIAGVALAMVWTNLNLFLCLLLFILVSGVYRDSWVSP  255

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
              A  LK        W  LLRLA+P+C++VCLEWWWYEFM +L G LV P+ T+A+  I+I
Sbjct  256   SADCLKG-------WSALLRLAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATVASMGILI  308

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTT+L+Y  PSALS  +S+RVGNELGA RP  A+ AT +++  A +     +  TT  R 
Sbjct  309   QTTALVYVFPSALSLGVSTRVGNELGANRPANAQRATIVSLACALVLGLMAMAFTTSMRH  368

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT D  +LELT   LPI GLCEL NCPQTT CGVLRGSARP  GA IN  SFYL+
Sbjct  369   RWGRLFTKDENILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLV  428

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRET  338
             G P+AI+M FV  + F GL  GLLAAQ +C   M   +  TDW+ E  RAK+L   S  +
Sbjct  429   GMPVAILMGFVAGMGFAGLWLGLLAAQASCATLMAYALIMTDWKVEVERAKELTKASNSS  488

Query  337   SFED-PMIKFKEGEEFRI---SFEEG  272
             S    P+     G    I   ++++G
Sbjct  489   STATLPITNDSNGNGIAIPASNYQDG  514



>ref|XP_004515105.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=507

 Score =   394 bits (1011),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 225/498 (45%), Positives = 344/498 (69%), Gaps = 14/498 (3%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             ++ K     + K  T  +V+EEL+++     P+ AM ++ +++ ++ V+ +GRLGSLELA
Sbjct  2     EDNKDHDFFSHKFPTTSQVVEELKELWGMALPITAMNMLVFVRAVVSVLFLGRLGSLELA  61

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GGAL+IGFTNITGYSVL GLA G+EP+ SQAFGSKN  ++SL+LQR + +LLMA +PI L
Sbjct  62    GGALSIGFTNITGYSVLVGLASGLEPVCSQAFGSKNWELLSLSLQRMVLILLMAIVPISL  121

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW NL+ +ML++ QD+ I  +AS++C +++PDL+ N++L PLR++LR +  T P+++ +L
Sbjct  122   LWINLERIMLFMGQDSSITEMASIYCFYSLPDLLTNTLLQPLRVFLRSQKVTKPMMYCSL  181

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             +A + H+P+ + L   ++LG+ G+A+++ + N   ++ + GY+     +NE + +    N
Sbjct  182   VAVVFHVPLNYLLVVVMELGVPGVAMASVLTNMNMVVLMAGYVCIF-RKNEMMLRWGCGN  240

Query  1045  ---LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
                +     +G+    L++LA+PSCL +CLEWWWYE +T++AGYL  P + +A   I+IQ
Sbjct  241   GGLMIVYDGLGQ----LMKLAVPSCLMICLEWWWYEIVTVMAGYLPNPTLAVAATGILIQ  296

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTS+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T + R  
Sbjct  297   TTSMMYTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVMGFINVAWTVILRYG  356

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D  V  L  +V+PI+GLCEL NCPQTT CG+LRG+ARP IGA IN  SFY +G
Sbjct  357   WAALFTNDEPVKALVASVMPIMGLCELGNCPQTTGCGILRGTARPVIGANINLGSFYFVG  416

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL-----VG  353
              P+A+ +AF +K+ F GL +GLL+AQVAC +S+L +V+ RTDWE E+ +A+ L     +G
Sbjct  417   TPVAVGLAFWFKIGFSGLWFGLLSAQVACALSLLYVVVVRTDWEAEALKAEKLTRGVEMG  476

Query  352   ESRETSFEDPMIKFKEGE  299
                 +  +D MI  +E +
Sbjct  477   NWNGSKNKDKMIDDEENK  494



>ref|XP_009593168.1| PREDICTED: MATE efflux family protein 5 [Nicotiana tomentosiformis]
Length=496

 Score =   393 bits (1010),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 228/497 (46%), Positives = 339/497 (68%), Gaps = 15/497 (3%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  T  +V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSL+LAGG
Sbjct  3     EKDPDFLSHKLPTPSQVVEELKELWGMALPITAMNCLVYVRAVVSVLFLGRLGSLQLAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +LL+A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMICILLLAIIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +ML++ QD +I  +A+ +C +++PDL  N++L PLR+YLR +G T P +W T IA
Sbjct  123   INLESIMLFMCQDKEITSVAATYCIYSLPDLATNTLLQPLRVYLRSQGVTKPQMWCTFIA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              + H+P+ ++L   + LG+ G+A+++ + N   ++ ++GY+    +     ++  A    
Sbjct  183   VLFHVPLNYFLVVVMGLGVPGVAMASVLTNLHMMVLMMGYVYVYGKWE---WRWTAGIGG  239

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                 +G     LL+LA+PSC+ +CLEWWWYE +T+LAGYL  P++ +A   I+IQTTSLM
Sbjct  240   VCGGLGP----LLKLAVPSCIGICLEWWWYEIVTVLAGYLPNPRLAVAATGIMIQTTSLM  295

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     ++ T + R+ W  +F
Sbjct  296   YTVPMALAGCVSARVGNELGAGKPYKAKLAATVALACAFVIGFINVIWTVIFRDKWGALF  355

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  +  L  +VLP+IG+CEL NCPQTT CG+LRG+ARP IGA IN  SFY +G P+A+
Sbjct  356   TKDEMLRALVASVLPLIGMCELGNCPQTTGCGILRGTARPAIGARINLGSFYFVGTPVAV  415

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIY-RTDWEKESARAK-----DLVGESRET  338
              +AF  K+ F GL YGLL+AQ AC IS+L V++  TDWE E+ +AK     +++G   +T
Sbjct  416   GLAFWLKVGFSGLWYGLLSAQAACAISILYVVHCCTDWEGEALKAKRLTNLEMMGHRDDT  475

Query  337   SF--EDPMIKFKEGEEF  293
             S   E  ++   E ++F
Sbjct  476   SDDEEQNVLLVNEKDKF  492



>ref|XP_004301437.1| PREDICTED: multidrug and toxin extrusion protein 1-like [Fragaria 
vesca subsp. vesca]
Length=546

 Score =   395 bits (1014),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 224/484 (46%), Positives = 315/484 (65%), Gaps = 7/484 (1%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             +    + N    ++    ++  +  T+ E ++E++ +     P    GL+ Y + MI ++
Sbjct  13    KAHFMKPNKTHDQDVDQDQELHRWPTLSEALQEIKAIGKISGPTTITGLLLYSRAMISML  72

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ LTLQRT+ 
Sbjct  73    FLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVL  132

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL  S+PI  +WFN+K ++LW  QD +I  +A  F  F+IPDL   S+LHPLRIYLR +
Sbjct  133   LLLSTSIPISFMWFNMKRILLWCGQDEEISSVAHTFILFSIPDLFFLSLLHPLRIYLRTQ  192

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
               T P+ + + I+ + H+P+ F L   L++G+ G+AI+    N    + L  +  ++N  
Sbjct  193   SITLPVTYCSAISVIFHVPLNFLLVVKLEMGVAGVAIAMVWTNLNLFILLFSFTYFSNVY  252

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
              ++   P +  LK        W  LL LA+P+C++VCLEWWWYEFM LL G L  P+ T+
Sbjct  253   KDSWVAPSSDCLKG-------WSSLLALAIPTCISVCLEWWWYEFMILLCGLLTNPKATI  305

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A+  I+IQTTSL+Y  PS+LS  +S+R+GNELGA RP KAR++  +++  AF      +L
Sbjct  306   ASMGILIQTTSLVYVFPSSLSLGVSTRIGNELGANRPAKARISMIVSLGCAFALGLLAML  365

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              TTL R  W + FT DTE+LELT   LPI GLCEL NCPQTT CGVLRGSARP +GA IN
Sbjct  366   FTTLMRHQWGRFFTNDTEILELTAIALPIAGLCELGNCPQTTGCGVLRGSARPTVGANIN  425

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               SFYL+G P+A++M FV K+ F GL  GLLAAQ +C + ML V+  TDW  +  RA +L
Sbjct  426   LGSFYLVGMPVAMVMGFVVKMGFAGLWLGLLAAQGSCALLMLYVLCTTDWMVQVKRASEL  485

Query  358   VGES  347
               E+
Sbjct  486   TAET  489



>ref|XP_010268640.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=539

 Score =   395 bits (1014),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 240/497 (48%), Positives = 320/497 (64%), Gaps = 9/497 (2%)
 Frame = -3

Query  1780  ANTNQ-QEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrl  1604
             AN N+  ++  + ++  +  T  EV+EE++ M     P    GLI Y + MI ++ +G L
Sbjct  21    ANPNKTMDDVYSGEELHRWPTPYEVVEEIKAMGKISSPTALTGLIMYSRAMISMIFLGHL  80

Query  1603  gslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMA  1424
             G LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL  
Sbjct  81    GQLELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLST  140

Query  1423  SLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWP  1244
             S+PI  +W N+K ++LW  QD +I  +A +F  F+IPDL   S+LHPLRIYLR +G T P
Sbjct  141   SIPISAMWLNMKRILLWCGQDEEISSMAHVFIVFSIPDLFFLSLLHPLRIYLRTQGITLP  200

Query  1243  LLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY  1064
             L + + I+ +LH+P+ F L    K+GI G+AI+    N    L L  +I ++    ++  
Sbjct  201   LTYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSAFIFFSGVYKDSWV  260

Query  1063  KPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
              P    L+        W  LL LA+P+C++VCLEWWWYEFM +L G LV P+ T+A+  I
Sbjct  261   APSMDCLRG-------WSSLLGLAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATIASMGI  313

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTSL+Y  PS+LS  +S+RVGNELGA RP KAR+A  +++  A       +L TTL 
Sbjct  314   LIQTTSLVYVFPSSLSLGVSTRVGNELGANRPAKARIAMIVSLACAAALGLAAMLFTTLV  373

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             R  W   FT D E+LELT   LPI+GLCEL NCPQTT CGVLRGSARP  GA IN  SFY
Sbjct  374   RHRWGLFFTDDAEILELTSVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFY  433

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES-  347
             L+G P+AI M FV K+ F GL  GLLAAQ +C I ML V+  TDW  ++ RA++L   S 
Sbjct  434   LVGMPVAIFMGFVAKMGFAGLWIGLLAAQASCAILMLYVLGTTDWVVQAERARELTNASL  493

Query  346   RETSFEDPMIKFKEGEE  296
               +SF     K    EE
Sbjct  494   SSSSFTKEATKVPNLEE  510



>gb|KHG30609.1| MATE efflux family protein 9 [Gossypium arboreum]
Length=502

 Score =   393 bits (1009),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 318/462 (69%), Gaps = 8/462 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
              + K  +  EV EE++++     P+ AM  + +++ ++ V+ +GRLGSLELAGGAL+IGF
Sbjct  8     SSHKFPSASEVFEEVKELWGMALPITAMNWLVFVRAVVSVLFLGRLGSLELAGGALSIGF  67

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
             TNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L +A++PI LLW NL  +
Sbjct  68    TNITGYSVLVGLASGLEPVCSQAYGSKNWELLSLSLQRMIIILFLATIPISLLWVNLDNI  127

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             M+++ QD  I  +A+ +C +++PDL+ N++L PLR+YLR +  T P++W +L+A M HLP
Sbjct  128   MVFMGQDKDITAMAATYCMYSLPDLLTNTLLQPLRVYLRSQRVTKPMMWCSLVAVMFHLP  187

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             + + L   + LG+ G+A+++ V N   ++ ++GY+  +          +           
Sbjct  188   LNYVLVMIMGLGVPGVAMASVVTNMNMVVLMVGYVWVSGRCEMRWTAGIGGVCGGVVP--  245

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
                  LLRLA+PSCL +CLEWWWYE +TL+AGYL  P + +A   I+IQTTS+MYT+P A
Sbjct  246   -----LLRLAVPSCLGICLEWWWYEIVTLMAGYLSNPTLAVAATGILIQTTSMMYTVPMA  300

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             L+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T + RE W  +FT D  V
Sbjct  301   LAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGIINVAWTVILREKWAGLFTKDDLV  360

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
               L  TVLPIIGLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+ +AF+ 
Sbjct  361   KPLVATVLPIIGLCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAVGLAFLL  420

Query  481   KLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDL  359
              + F GL +GLL+AQVACV+S+L  V+Y TDWE E+ +AK L
Sbjct  421   NVGFSGLWFGLLSAQVACVVSILYAVLYATDWEGEALKAKKL  462



>ref|XP_011076230.1| PREDICTED: MATE efflux family protein DTX1 [Sesamum indicum]
Length=540

 Score =   394 bits (1012),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 234/519 (45%), Positives = 333/519 (64%), Gaps = 26/519 (5%)
 Frame = -3

Query  1798  RHKHTRANTNQQEE-------KMAAKQTQK-HSTIPE---VMEELRKMIDTCFPMIAMGL  1652
              + H      Q  +       K A KQ+QK H+       V++E   +    FPMI  GL
Sbjct  26    HNDHNHPKKAQDTDMFTSLIPKSATKQSQKPHNPTTHLSLVIQEAISLSGIAFPMILTGL  85

Query  1651  ISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLT  1472
             + Y ++MI ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T
Sbjct  86    LLYSRSMISMLFLGRLGDLALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYT  145

Query  1471  IVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSI  1292
             ++ L+LQRT+ +L++ S PI LLW N+K ++L+  QD  I   A  +  +++PDL A ++
Sbjct  146   LLGLSLQRTVLLLVLTSFPISLLWLNMKRILLFCGQDEAIATQAQAYLFYSVPDLFAQAL  205

Query  1291  LHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllf  1112
             LHPLRIYLR +  T PL +  +++ + H+PI ++L   L LGI+G+A+S    NF  +  
Sbjct  206   LHPLRIYLRTQSNTLPLTFCAVVSILGHIPINYFLVSKLSLGIKGVALSGVWTNFNLVAS  265

Query  1111  llgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLL  932
             L+ YIL +      +YK     L      G  W  LL LA+PSC++VCLEWWWYE M LL
Sbjct  266   LILYILLS-----GVYKKTWGGLSMECLKG--WKSLLNLAIPSCISVCLEWWWYEIMILL  318

Query  931   AGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIV  752
              G L+ P+ T+A+  I+IQTTSL+Y  PS+LS S+S+RVGNE+G  RP KA+LA  + + 
Sbjct  319   CGLLLNPKATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNEIGGRRPEKAKLAAVVGLS  378

Query  751   LAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRG  572
              +F+     +      R +W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG
Sbjct  379   GSFVLGFSALFFAVSVRNIWASMFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRG  438

Query  571   SARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTD  392
             +ARP +GA IN   FYL+G P+A+ +AF +K++F+GL  GLLAAQ +C+++M++V+ RTD
Sbjct  439   TARPKVGANINLGCFYLVGMPVAVGLAFFYKMDFEGLWLGLLAAQASCMVTMMVVLLRTD  498

Query  391   WEKESARAKDLVG--------ESRETSFEDPMIKFKEGE  299
             WE E+ RA++L G        E  +   + P+    +G+
Sbjct  499   WEFEARRAEELTGGYEILDENEGVDDEKDQPIKAENKGD  537



>ref|XP_010061388.1| PREDICTED: MATE efflux family protein 5 [Eucalyptus grandis]
Length=520

 Score =   393 bits (1009),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 234/519 (45%), Positives = 330/519 (64%), Gaps = 25/519 (5%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
              KH + N +Q+ +K         + +  V+ E+R +     PMI  GL+ Y ++MI ++ 
Sbjct  7     QKHPQHNQSQKGQK---------TNLTLVVREVRAIAQIALPMILTGLLLYCRSMISMLF  57

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG L LAGG+LA+GF NITGYS+LSGLA+GMEPI SQAFG+K   ++ L+LQRT+ +
Sbjct  58    LGGLGELALAGGSLALGFANITGYSILSGLAMGMEPICSQAFGAKKHALLGLSLQRTVLL  117

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             L++ SLPI  LW N+K ++L+  QD  I   A  F  + IPDL+A S+LHPLRIYLR + 
Sbjct  118   LMLTSLPISFLWLNMKRILLFAGQDEDIATEAQSFLLYTIPDLLALSVLHPLRIYLRSQS  177

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T PL +   ++ + H+PI  +L   L LGI+G+A+     NF  +  L+ YIL +    
Sbjct  178   ITLPLTFCATLSVIFHVPINLFLVKHLGLGIKGVALGGVWTNFNLVASLIIYILVS----  233

Query  1075  EALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
               ++K     L S      EW  LL LA+PSC++VCLEWWWYE M LL G  + P+ T+A
Sbjct  234   -GVHKKTWGGLSSDCF--REWRNLLNLAIPSCVSVCLEWWWYEIMILLCGLFLNPRATVA  290

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
             +  I+IQTTSL+Y  PS+LS S+S+RVGNELGA RP KA+L+  + +   F+     ++ 
Sbjct  291   SMGILIQTTSLIYIFPSSLSFSVSTRVGNELGANRPLKAKLSAIVGLGCGFVLGLSALVF  350

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
                 R+ W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA +N 
Sbjct  351   AITVRKTWATMFTLDEEIMRLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKIGAHVNL  410

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL-  359
               FY++G P+ I +AF W   F+GL  GLLAAQ +C+++ML+V+  TDWE E+ RA++L 
Sbjct  411   GCFYVVGMPVGIGLAFFWGFNFQGLWLGLLAAQASCLVTMLVVLGFTDWEHEARRAEELT  470

Query  358   --------VGESRETSFEDPMIKFKEGEEFRISFEEGVN  266
                     V +S E   + P+I   E +E  ++  E ++
Sbjct  471   RAGDPAAAVADSEEFEAKKPLIVIAEIKEDSLNLSEDLD  509



>ref|XP_008234289.1| PREDICTED: MATE efflux family protein LAL5 [Prunus mume]
Length=555

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 331/510 (65%), Gaps = 18/510 (4%)
 Frame = -3

Query  1792  KHTRANTNQQEEKM---AAKQTQK---HSTIPEVMEELRKMIDTCFPMIAMGLISYMKNM  1631
             K T +   Q ++K+   A  QT K    S     ++E   +    FPMI  GL+ Y ++M
Sbjct  39    KSTTSQPEQIQKKLQLNAHHQTHKPYQKSHFSLALKEANSIASIAFPMILTGLLLYSRSM  98

Query  1630  ILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQ  1451
             I ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L+LQ
Sbjct  99    ISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHTLLGLSLQ  158

Query  1450  RTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIY  1271
             RT+ +L+  SLPI LLW N+K L+L   QD  I   A L+   ++PDL+A S+LHPLRIY
Sbjct  159   RTVLLLIFTSLPISLLWLNMKKLLLLCGQDETIASEAQLYLLCSLPDLLAQSLLHPLRIY  218

Query  1270  LRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilY  1091
             LR +  T PL +   +A +LH+PI ++L   L LGI+G+A+S   +NF  +  L+ YI+ 
Sbjct  219   LRTQSITLPLTFCATLAIILHIPINYFLVSYLNLGIRGVALSGVWSNFNLVASLIIYIII  278

Query  1090  TNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRP  911
             +    +       T    S     EW  LL LA+PSC++VCLEWWWYE M LL G L+ P
Sbjct  279   SGVHKK-------TWGGISMDCFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLLNP  331

Query  910   QVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASA  731
             + T+A+  I+IQTTSL+Y  PS+LS S+S+RVGNE+GA +P KA++A  + +  +F+   
Sbjct  332   RATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNEIGANQPKKAKIAAIVGLCCSFILGL  391

Query  730   FGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIG  551
               ++   + R +W  +FT D E+++LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +G
Sbjct  392   AALIFAVMVRNIWASMFTQDKEIMKLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVG  451

Query  550   ACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESAR  371
             A IN   FYL+G P+A+ + FV +L+F+GL  GLLAAQ  C ++ML+V+  TDWE E+ +
Sbjct  452   ANINLGCFYLVGMPVAVGLGFVLELDFQGLWLGLLAAQGCCALTMLVVLGVTDWEFEAQK  511

Query  370   AKDLVG-----ESRETSFEDPMIKFKEGEE  296
             AK L G     +  E   ED   K K  E+
Sbjct  512   AKQLTGAEEVVDDSEEVEEDKPSKAKIKED  541



>ref|XP_003615399.1| Multidrug and toxin extrusion protein [Medicago truncatula]
 gb|AES98357.1| MATE efflux family protein [Medicago truncatula]
Length=560

 Score =   394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 229/500 (46%), Positives = 324/500 (65%), Gaps = 8/500 (2%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             H     + +  ++     +  +  T+ E + E++++     P    GL+ Y + MI ++ 
Sbjct  25    HTKDPYSNSTLDDDHVQDELHRWPTLKEAITEIKEIGKISGPTTITGLLLYSRAMISMIF  84

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG +ELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K   I+ LTLQRT+ +
Sbjct  85    LGYLGEMELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTVLL  144

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LL  S+PI  +W N+K ++L+  QD +I  +A  F  F +PDL   SILHPLRIYLR +G
Sbjct  145   LLSTSIPISFIWINMKRILLFSGQDLEISSMAQSFILFLVPDLFLLSILHPLRIYLRTQG  204

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T PL + + ++ +LH+P+ F L    ++GI G++I+  + N   ++ L  ++ +++   
Sbjct  205   ITLPLTYCSAVSVLLHIPLNFLLVVHFQMGIAGVSIAMVLTNLNLVILLSSFLYFSSVYK  264

Query  1075  EALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
             ++   P    +K        W  LL LA+P+C++VCLEWWWYEFM ++ G LV P+ T+A
Sbjct  265   KSWISPSLDCIKG-------WSSLLSLAIPTCVSVCLEWWWYEFMIMMCGLLVNPKATIA  317

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
             +  I+IQTTSL+Y  PS+LS  +S+R+GNELGA RP KAR++  +++ LA +     +L 
Sbjct  318   SMGILIQTTSLVYVFPSSLSLGVSTRIGNELGANRPQKARISMIVSLFLAMVLGLGAMLF  377

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
             TTL R  W K FT D E+LELT  VLPI+GLCEL NCPQTT CGVLRGSARP IGA IN 
Sbjct  378   TTLMRNQWGKFFTNDREILELTSIVLPIVGLCELGNCPQTTGCGVLRGSARPTIGANINL  437

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLV  356
              SFYL+G P+AI + FV KL F GL  GLLAAQ +C + ML+V+ RTDW  +  RAK+L 
Sbjct  438   GSFYLVGMPVAIFLGFVAKLGFPGLWIGLLAAQGSCAMLMLVVLCRTDWNLQVQRAKELT  497

Query  355   GESRETSFEDPMIK-FKEGE  299
               S  +   D  +  F EG 
Sbjct  498   KSSTTSDDVDAKLPIFMEGN  517



>dbj|BAJ96265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   391 bits (1005),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 234/467 (50%), Positives = 319/467 (68%), Gaps = 14/467 (3%)
 Frame = -3

Query  1732  KHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNI  1553
             KH   PE  +E R ++   FPMI  GL+ Y+++MI ++ +GRLG L LAGG+LAIGF NI
Sbjct  9     KHYPPPERRQEARSILGLAFPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANI  68

Query  1552  TGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLW  1373
             TGYSVLSGLA+GMEPI  QAFG+ N +++ LT+QRT+ +L+ A++PIG LW +++PL+L 
Sbjct  69    TGYSVLSGLAMGMEPICGQAFGAGNYSLIGLTVQRTVLLLIAAAVPIGGLWMHMRPLLLL  128

Query  1372  LHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVF  1193
               QDA I  +A  +   ++PDL+  + LHP+RIYLR +    PL     +A  +HLPI +
Sbjct  129   CGQDAGIAAVAETYILASLPDLLLQAFLHPVRIYLRMQSVNLPLTVCATLAIAIHLPINY  188

Query  1192  YLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEW  1013
              L   L LG++G+A+++ +AN   LL LL YI +     + ++K       S+ S    W
Sbjct  189   VLVTVLGLGVKGVAMASVLANLNLLLLLLAYIFF-----KGVHKRTGGFALSAESF-RGW  242

Query  1012  VILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSN  833
               L+ LALPSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS 
Sbjct  243   GELISLALPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSF  302

Query  832   SISSRVGNELGAGRPGKARLATAIAIVLAF----LASAFGILLTTLGREVWVKIFttdte  665
              +S+RV NELGAG+P +A  A    I+L F    LASAF  L+    R+VW  +FT D  
Sbjct  303   GVSTRVSNELGAGQPEQASRAATAGIMLGFAFGALASAFAFLV----RDVWASMFTADPA  358

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             ++ LT +VLPI+GLCEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A+++AF 
Sbjct  359   IIALTASVLPILGLCELGNCPQTTGCGVLRGSARPKDAANINLRSFYLVGTPVALVLAFW  418

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESR  344
             +  +FKGL +GLLAAQ  C++ ML+VI RTDW  E+ R+K L G+ +
Sbjct  419   FHYDFKGLWFGLLAAQATCMVRMLLVIGRTDWAAEAKRSKQLTGQDK  465



>ref|XP_007220655.1| hypothetical protein PRUPE_ppa003689mg [Prunus persica]
 gb|EMJ21854.1| hypothetical protein PRUPE_ppa003689mg [Prunus persica]
Length=556

 Score =   393 bits (1010),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 239/510 (47%), Positives = 330/510 (65%), Gaps = 18/510 (4%)
 Frame = -3

Query  1792  KHTRANTNQQEEKM---AAKQTQK---HSTIPEVMEELRKMIDTCFPMIAMGLISYMKNM  1631
             K T +   Q ++K+   A  QT K    S     ++E   +    FPMI  GL+ Y ++M
Sbjct  39    KSTTSEPEQIQKKLQLNAHHQTHKPHQKSHFSLALKEANSIASIAFPMILTGLLLYSRSM  98

Query  1630  ILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQ  1451
             I ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L+LQ
Sbjct  99    ISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHTLLGLSLQ  158

Query  1450  RTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIY  1271
             RT+ +L+  SLPI LLW N+K L+L   QD  I   A L+   ++PDL+A  +LHPLRIY
Sbjct  159   RTVLLLIFTSLPISLLWLNMKKLLLLCGQDEAIASEAQLYLLCSLPDLLAQCLLHPLRIY  218

Query  1270  LRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilY  1091
             LR +  T PL +   +A +LH+PI ++L   L LGI+G+A+S   +NF  +  L+ YI+ 
Sbjct  219   LRTQSITLPLTFCATLAIILHIPINYFLVSYLNLGIRGVALSGVWSNFNLVASLIIYIII  278

Query  1090  TNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRP  911
             +    +       T    S     EW  LL LA+PSC++VCLEWWWYE M LL G L+ P
Sbjct  279   SGVHKK-------TWGGISMDCFREWKTLLNLAVPSCISVCLEWWWYEIMILLCGLLLNP  331

Query  910   QVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASA  731
             + T+A+  I+IQTTSL+Y  PS+LS S+S+RVGNE+GA +P KAR+A  + +  +F+   
Sbjct  332   RATVASMGILIQTTSLIYIFPSSLSFSVSTRVGNEIGANQPKKARIAAIVGLCCSFMLGL  391

Query  730   FGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIG  551
               ++   + R +W  +FT D E+++LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +G
Sbjct  392   AALIFAVMVRNIWASMFTQDKEIIKLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVG  451

Query  550   ACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESAR  371
             A IN   FYL+G P+A+ + FV +L+F+GL  GLLAAQ  C ++ML+V+  TDWE E+ +
Sbjct  452   ANINLGCFYLVGMPVAVGLGFVLELDFQGLWLGLLAAQGCCALTMLVVLGVTDWEFEAQK  511

Query  370   AKDLVG-----ESRETSFEDPMIKFKEGEE  296
             AK L G     +  E   ED   K K  E+
Sbjct  512   AKQLTGAEEVVDDSEEVEEDKPSKAKIKED  541



>ref|XP_010035093.1| PREDICTED: MATE efflux family protein LAL5-like [Eucalyptus grandis]
Length=548

 Score =   393 bits (1009),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 243/502 (48%), Positives = 326/502 (65%), Gaps = 19/502 (4%)
 Frame = -3

Query  1834  KNTHNQLYLLC*RHKHTRANTNQQEEKM--------AAKQTQKHSTIP--EVMEELRKMI  1685
             +N     YLL    +    NT  QE           A  Q    +  P  + +EE R + 
Sbjct  14    ENIKKSSYLL--SVEDQEVNTPDQEVNTPLVLKASPAPPQPPNSTRFPLAQAVEEARSIC  71

Query  1684  DTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPI  1505
                 PMI  GL+ Y + MI ++ +GRLG L LAGG+LAIGF NITGYSVLSGLA+GMEPI
Sbjct  72    RIALPMILTGLLLYSRCMISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPI  131

Query  1504  SSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQ  1325
               QAFG+K L+++ +TLQRT+ +LL+ S+PI LLW N+K ++L+  QD  I   A  +  
Sbjct  132   CGQAFGAKRLSVLGITLQRTVLLLLLTSIPISLLWLNMKSILLFCRQDESISVQAQSYLL  191

Query  1324  FAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAIS  1145
             +++PDL+A S+LHPLRIYLR +    PL +   I+  LH+PI ++L   L LGI+G+A+S
Sbjct  192   YSVPDLLAQSLLHPLRIYLRSQSINLPLTFCASISIFLHIPINYFLVIHLGLGIKGVALS  251

Query  1144  TFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCL  965
                 NF  +  L+ YI+Y+    +       T    S     EW  LL LA+PSC++VCL
Sbjct  252   AVWTNFNLVASLVIYIIYSGVYRD-------TWGGYSLECFREWRPLLSLAVPSCISVCL  304

Query  964   EWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPG  785
             EWWWYE M LL G L+ P+ T+A+  I+IQTT+ +Y  PS+LS S+S+RVGNELGA RP 
Sbjct  305   EWWWYEIMILLCGLLLNPRATVASMGILIQTTAFIYIFPSSLSFSVSTRVGNELGANRPA  364

Query  784   KARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANC  605
             KARLA ++ I L+F+     +L     R  W ++FT D E+  LT+TVLPIIGLCEL NC
Sbjct  365   KARLAASVGIGLSFVLGCSALLFAVTVRNHWARMFTEDGEIAALTLTVLPIIGLCELGNC  424

Query  604   PQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACV  425
             PQTT CGVLRGSARP IGA IN   FYL+G P+A+ +AF   L+F+GL  GLLAAQ +C+
Sbjct  425   PQTTGCGVLRGSARPKIGANINLGCFYLVGMPVAVGLAFYCHLDFRGLWLGLLAAQASCM  484

Query  424   ISMLIVIYRTDWEKESARAKDL  359
              +ML+V+ RTDWE ++ RA++L
Sbjct  485   ATMLVVLRRTDWEHQAMRAQEL  506



>gb|KHN31537.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=562

 Score =   393 bits (1010),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 234/496 (47%), Positives = 322/496 (65%), Gaps = 17/496 (3%)
 Frame = -3

Query  1720  IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYS  1541
             +PE ++E+  +     PMI  GL+ Y ++MI ++ +G LG L LAGG+LAIGF NITGYS
Sbjct  75    VPEAIKEVFSISKIVIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAIGFANITGYS  134

Query  1540  VLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQD  1361
             +LSGLA+GMEPI  QAFG+K  T++ L LQRTI +LL  SLPI LLW  +K ++L   QD
Sbjct  135   ILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPISLLWLYMKQILLLCGQD  194

Query  1360  AKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTF  1181
               I   A  +  ++IPDL+A S LHPLRIYLR +  T PL      + +LH+PI ++L  
Sbjct  195   EAIATQAQSYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLVA  254

Query  1180  SLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILL  1001
              LKLGI+G+A+   + NF  +  L+ YI+++    +       T    S     +W  LL
Sbjct  255   HLKLGIKGVALGGVLTNFNLVASLILYIVFSGTHKK-------TWGGFSFECFTQWKSLL  307

Query  1000  RLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISS  821
              LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTTSL+Y  PS+LS S+S+
Sbjct  308   NLAIPSCVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVST  367

Query  820   RVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtv  641
             RVGN+LGA +P KARL+  + +  +F++    ++   + R  W  +FT D +++ LT  V
Sbjct  368   RVGNKLGAQKPSKARLSAIVGLSCSFMSGVLALVFALMVRNTWASMFTKDKDIITLTSMV  427

Query  640   LPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGL  461
             LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P++I +AF    +F+GL
Sbjct  428   LPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQGL  487

Query  460   CYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG---------ESRETSFEDPMIKFK  308
               GLLAAQ +C ++ML+V+ RTDWE E+ RAK L G         +SRE   E P+ K +
Sbjct  488   WLGLLAAQGSCAVTMLVVLCRTDWEFEAQRAKKLTGMGGAASGVDQSREVDPEKPL-KHE  546

Query  307   EGEEFRISFEEGVNLQ  260
               E+  +  +   N Q
Sbjct  547   SNEDSLLLADSDENEQ  562



>ref|XP_010107396.1| Multidrug and toxin extrusion protein 2 [Morus notabilis]
 gb|EXC15934.1| Multidrug and toxin extrusion protein 2 [Morus notabilis]
Length=545

 Score =   392 bits (1008),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 225/478 (47%), Positives = 318/478 (67%), Gaps = 7/478 (1%)
 Frame = -3

Query  1786  TRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgr  1607
              + + N+ EE +    T + S  P  ++E   +     PMI  GL+ Y ++MI ++ +GR
Sbjct  26    NKQDDNKNEELVITIPTTQESQKPNFLKEANAISQIALPMILTGLLLYSRSMISMLFLGR  85

Query  1606  lgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLM  1427
             LG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L+LQRT+ +L +
Sbjct  86    LGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKNTLLGLSLQRTVLLLTL  145

Query  1426  ASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTW  1247
             AS+PI LLW N+K ++L   QD  I   A  +  F++PDL+A S+LHPLRIYLR +  T 
Sbjct  146   ASIPISLLWLNMKKILLLCGQDDAIATQAQSYLLFSLPDLLAQSLLHPLRIYLRTQSITL  205

Query  1246  PLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEAL  1067
             PL +   ++ +LH+PI + L   L  GI+G+A+S  + NF  +  L+ YIL +       
Sbjct  206   PLTYCATLSILLHIPINYLLVSHLNFGIRGVALSGVLTNFNLVASLILYILISGVHKN--  263

Query  1066  YKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAA  887
                  T    ST   ++W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  
Sbjct  264   -----TWPGISTDCFKQWRTLLGLAIPSCISVCLEWWWYEIMILLCGLLINPRATVASMG  318

Query  886   IVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTL  707
             I+IQTT+L+Y  PS+LS S+S+RVGNELGA +P +AR A  + ++ + +     ++ + +
Sbjct  319   ILIQTTALIYIFPSSLSFSVSTRVGNELGANKPKRARYAAHVGLLCSAILGLLALVFSVM  378

Query  706   GREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSF  527
              R VW K+FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   F
Sbjct  379   VRNVWAKMFTQDKEIVSLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCF  438

Query  526   YLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             Y++G P+A+++A+    +FKGL  GLLAAQ  C ++ML+V+  TDW+ E+ RA  L G
Sbjct  439   YMVGMPVALVLAYFLGFDFKGLWLGLLAAQWCCALTMLVVLGLTDWDSEAKRALVLTG  496



>ref|XP_008461457.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
 ref|XP_008461458.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
 ref|XP_008461459.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
 ref|XP_008461460.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
Length=493

 Score =   390 bits (1003),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 323/471 (69%), Gaps = 7/471 (1%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             E+      + K  ++ +V+EEL+++    FP+ AM  + + + ++ V+ +GR+GSLELAG
Sbjct  2     EDGNPDASSNKAPSVSQVVEELKELWGITFPVTAMNFLVFFRQVVSVLFLGRIGSLELAG  61

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             GALAIGFTNITGYSV+ GLA G+EPI SQA+GSKN  ++ L+LQR I +LL A++PIG L
Sbjct  62    GALAIGFTNITGYSVMVGLAAGLEPICSQAYGSKNWDLLCLSLQRMILILLFATIPIGFL  121

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W NL  +M++L QD  I  +A+++C +++PDL+ N++L PL+I+LR +  T P+++ TL+
Sbjct  122   WLNLDNIMVFLGQDHLITSMAAIYCIYSLPDLLTNTLLQPLKIFLRSQKDTKPMMYCTLV  181

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             A  LH+P+ + +   L +GI+G+A+++ + N   +  + GY+     + E  +      L
Sbjct  182   AVGLHVPLNYMMVVVLGMGIRGVAMASVLTNLNIVGLMSGYVWVWGRKGEMRW-----TL  236

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
             K     G    ++ RLA+PSCL +CLEWWWYE +T+L+GYL  P   +A   I+IQTTS+
Sbjct  237   KLGEVCGGVGPVM-RLAVPSCLGICLEWWWYEIVTVLSGYLSNPTSAVAATGILIQTTSM  295

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYT+P ALS  +S+RVGNELG+G+P KAR+A  +A+  AF+     +  T + R+ W  +
Sbjct  296   MYTVPLALSGCVSTRVGNELGSGKPKKARVAAMVALGCAFVIGGINVTWTVILRQTWATL  355

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D  V  L  + LPIIGLCEL NCPQTT  G+LRG+ARP +GA IN  SFYL+G P+A
Sbjct  356   FTDDVLVKSLVSSALPIIGLCELFNCPQTTGYGILRGTARPAVGARINLASFYLVGTPVA  415

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVG  353
             + +AF  KL F GL +GLL+AQ+AC +SML +V+  TDWE E+ +AK L G
Sbjct  416   LGLAFGLKLGFVGLWFGLLSAQLACAVSMLYVVVANTDWEGEALKAKKLAG  466



>ref|XP_008785753.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=546

 Score =   392 bits (1007),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 243/486 (50%), Positives = 313/486 (64%), Gaps = 16/486 (3%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             +  Q+  T+ EV+EE+  +     P    GL+ Y + MI ++ +G LG LELAGG+L+IG
Sbjct  30    EDLQRWPTVSEVVEEMGAIGRISIPTALTGLVLYSRAMISMLFLGYLGELELAGGSLSIG  89

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSVLSGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL AS+PI  LW N+K 
Sbjct  90    FANITGYSVLSGLAMGMEPICGQAYGAKQWKVLGLTLQRTVLLLLSASIPISFLWLNMKR  149

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD +I   A  F  FAIPDLV  S+LHPLR+YLR +  T P+ + + I+ +LH+
Sbjct  150   ILLWCGQDEQISSTAHTFITFAIPDLVFLSLLHPLRVYLRSQNITLPVTYCSCISVILHV  209

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ + L     +GI G A++    N   LL LL ++L +    ++   P A  LK     
Sbjct  210   PLNYLLVVHFGMGIAGAALAMVWTNLNLLLCLLLFVLVSGVYKDSWVSPSADCLKG----  265

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LLRLA+P+C +VCLEWWWYEFM +L G LV P+ T+A+  I+IQTTSL+Y  PS
Sbjct  266   ---WSALLRLAIPTCASVCLEWWWYEFMIMLCGLLVNPKATVASMGILIQTTSLVYVFPS  322

Query  844   ALSNSISSRVGNELGAGRPGKARLAT----AIAIVLAFLASAFGILLTTLGREVWVKIFt  677
             ALS  +S+RVGNELGA RP KAR AT    A A+VL  +A AF    TT  R  W ++FT
Sbjct  323   ALSLGVSTRVGNELGASRPAKARRATIVSQACAVVLGLMAMAF----TTSMRHRWGRLFT  378

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
              D E+LELT   LPI GLCEL NCPQTT CGVLRGSARPN GA IN  SFYL+G P+AI 
Sbjct  379   NDEEILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPNTGATINLGSFYLVGMPVAIF  438

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED-PM  320
             MAF   + F GL  GLLAAQ +C   M   +  TDW  E+ RAK+L   S  +S    P+
Sbjct  439   MAFAAGMGFAGLWLGLLAAQASCATLMAYALVTTDWVVEAERAKELTKASNSSSIAALPI  498

Query  319   IKFKEG  302
                 +G
Sbjct  499   ANDSDG  504



>ref|XP_009792677.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
 ref|XP_009792678.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
 ref|XP_009792679.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
Length=496

 Score =   390 bits (1002),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 225/497 (45%), Positives = 337/497 (68%), Gaps = 15/497 (3%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  T  +V+EEL+++     P+  M  + Y++ ++ V+ +GRLGSL+LAGG
Sbjct  3     EKDPDFLSHKLPTPSQVVEELKELWGMALPITGMNCLVYVRAVVSVLFLGRLGSLQLAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L++A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMICILMLAIIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +ML++ QD +I  +A+ +C +++PDL  N++L PLR+YLR +G T P +W T IA
Sbjct  123   INLESIMLFMCQDKEITAVAATYCIYSLPDLATNTLLQPLRVYLRSQGVTKPQMWCTFIA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              + H+P+ ++L   + LG+ G+A+++ + N   ++ ++GY+          ++  A    
Sbjct  183   VLFHVPLNYFLVVVMGLGVPGVAMASVLTNLHMMVLMMGYVYVYGRWE---WRWTAGIGG  239

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                 +      LL+LA+PSC+ +CLEWWWYE +T+LAGYL  P++ +A   I+IQTTSLM
Sbjct  240   ICGGL----GPLLKLAVPSCIGICLEWWWYEIVTVLAGYLPNPRLAVAATGIMIQTTSLM  295

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     ++ T + R+ W  +F
Sbjct  296   YTVPMALAGCVSARVGNELGAGKPYKAKLAATVALACAFVIGLINVIWTVIFRDKWGALF  355

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  +  L  +VLP+IG+CEL NCPQTT CG+LRG+ARP IGA IN  SFY +G P+A+
Sbjct  356   TKDDMLRALVASVLPLIGMCELGNCPQTTGCGILRGTARPAIGARINLGSFYFVGTPVAV  415

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIY-RTDWEKESARAK-----DLVGESRET  338
              +AF  K+ F GL YGLL+AQ AC IS+L V++  TDWE E+ +AK     +++G   +T
Sbjct  416   GLAFWLKVGFSGLWYGLLSAQAACAISILYVVHCCTDWEGEALKAKRLTNLEMMGHRDDT  475

Query  337   SFEDP--MIKFKEGEEF  293
             S +D   ++   E ++F
Sbjct  476   SDDDEQNVLLVNEKDKF  492



>ref|XP_007151906.1| hypothetical protein PHAVU_004G085700g [Phaseolus vulgaris]
 gb|ESW23900.1| hypothetical protein PHAVU_004G085700g [Phaseolus vulgaris]
Length=506

 Score =   390 bits (1002),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 339/492 (69%), Gaps = 9/492 (2%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             E K     + K  TI +V+EE++++     P+ AM ++ +++ ++ V+ +GRLGSLELAG
Sbjct  3     ENKDQDFFSHKFPTISQVVEEMKELWGMALPITAMNMLVFVRAVVSVLFLGRLGSLELAG  62

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             GAL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR + +LLMA +PI LL
Sbjct  63    GALSIGFTNITGYSVLVGLAAGLEPVCSQAYGSKNWDLLSLSLQRMVLILLMAIIPISLL  122

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W NL+ +ML++ QD+ I  +AS++C +++PDL+ N++L PLR++LR +  T P+++ +L+
Sbjct  123   WLNLERIMLFMGQDSAITGMASVYCFYSLPDLLTNTLLQPLRVFLRSQKVTKPMMYCSLV  182

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             A + H+P+ + L   ++LG+ G+A+++ + N   ++ + GY+    ++           +
Sbjct  183   AVLFHVPLNYLLVVVMELGVPGVAMASVLTNLNMVVLMAGYVCLCRKKEMVFKWGCGGGV  242

Query  1042  KSS--TSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
              +   + +G+    L+  A+PSCL +CLEWWWYE +T+LAGYL RP + +A   I+IQTT
Sbjct  243   VAGLCSGLGQ----LMEFAVPSCLMICLEWWWYEIVTVLAGYLPRPTLAVAATGILIQTT  298

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             S+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     ++ T +  + W 
Sbjct  299   SMMYTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGFINVIWTVILGQRWA  358

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT+D  V  L  +V+PI+GLCEL NCPQTT CG+LRG+ RP +GA IN  SFY +G P
Sbjct  359   GLFTSDDPVNVLVASVMPIMGLCELGNCPQTTGCGILRGTGRPGVGANINLGSFYFVGTP  418

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVIS-MLIVIYRTDWEKESARAKDLVGESRETSF  332
             +A+ +AF +K+ F GL YGLL+AQVAC +S M +V+ +TDWE E+ +A+ L      +S 
Sbjct  419   VAVGLAFWFKVGFSGLWYGLLSAQVACAVSIMYVVLVKTDWEVEALKAEKLTRVEMSSSC  478

Query  331   EDPMIKFKEGEE  296
                 ++ KE E+
Sbjct  479   NG--LRSKENEK  488



>ref|XP_008779545.1| PREDICTED: MATE efflux family protein 5-like [Phoenix dactylifera]
Length=554

 Score =   392 bits (1006),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 305/462 (66%), Gaps = 7/462 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             +  Q+  T+ EV+EE+R +     P    GL+ Y + MI ++ +G LG LELAGG+L+IG
Sbjct  30    EDLQRWPTLSEVVEEMRAIGRISIPTAVTGLVLYSRAMISMLFLGYLGDLELAGGSLSIG  89

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSVLSGLA+GMEPI  QA+G+K   ++ LTLQRTI +LL ASLPI  LWFN+K 
Sbjct  90    FANITGYSVLSGLAMGMEPICGQAYGAKQRKLLGLTLQRTILLLLSASLPISFLWFNMKR  149

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD  I   A  F  FA+PDLV  S LHPLRIYLR +  T P+ + + I+  LH+
Sbjct  150   ILLWCGQDESISSTAHTFIIFAVPDLVFLSFLHPLRIYLRSQNITLPVTYCSFISVALHV  209

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ + L   L++GI G+A++    N    L LL +IL +    ++   P A  L+     
Sbjct  210   PLNYLLVVHLRMGIAGVALAMVWTNLNLFLCLLLFILVSGVYRDSWVSPSADCLRG----  265

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LLRLA+P+C++VCLEWWWYEFM +L G L  P+ T+A+  I+IQTTSL+Y  PS
Sbjct  266   ---WSALLRLAVPTCVSVCLEWWWYEFMIMLCGLLANPRATVASMGILIQTTSLVYVFPS  322

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             ALS  +S+RVGNELGA RP KAR AT +++  A +     +  TT  R  W ++FT D +
Sbjct  323   ALSLGVSTRVGNELGANRPAKARRATIVSLACAAVLGLMAMAFTTSMRHRWGRLFTKDED  382

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             +LELT   LPI GLCEL NCPQTT CGVLRGSARP+ GA IN  SFYL+G P+AI+M FV
Sbjct  383   ILELTAAALPIAGLCELGNCPQTTGCGVLRGSARPSTGANINLGSFYLVGMPVAILMGFV  442

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               + F G+  GLLAAQ++C   M   +  TDW  E  RAK+L
Sbjct  443   AGMGFAGMWLGLLAAQLSCATLMAYALIATDWAAEVERAKEL  484



>ref|XP_006599450.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Glycine 
max]
 ref|XP_003548954.2| PREDICTED: MATE efflux family protein 5-like isoform X1 [Glycine 
max]
Length=505

 Score =   389 bits (1000),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 326/461 (71%), Gaps = 5/461 (1%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + K  T  +VMEE++++     P+ AM ++ +++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  11    SHKFPTTSQVMEEMKELWGMALPITAMNMLVFVRAVVSVLFLGRLGSLELAGGALSIGFT  70

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQAFGSKN  ++SL+LQR + +LLMA +PI LLW NL+ +M
Sbjct  71    NITGYSVLVGLAAGLEPVCSQAFGSKNWDLLSLSLQRMVLILLMAIVPISLLWLNLERIM  130

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             L++ QD+ I  +ASL+C +++PDL+ N++L PLR++LR +  T P+++ +L+A + H+P+
Sbjct  131   LFMGQDSAITGMASLYCFYSLPDLLTNTLLQPLRVFLRSQKVTKPMMYCSLVAVLFHVPL  190

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
              + L   + LG+ G+A+++ + N   ++ + GY+    ++   L           + +G+
Sbjct  191   NYLLVVVMGLGVPGVAMASVMTNLNMVVLMAGYVCVCRKREVVLKWRCGGGGVVCSGLGQ  250

Query  1018  EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSAL  839
                 L+  A+PSCL +CLEWWWYE +T+LAGYL RP + +A   I+IQTTS+MYT+P AL
Sbjct  251   ----LMGFAVPSCLMICLEWWWYEIVTVLAGYLPRPTLAVAATGILIQTTSMMYTVPMAL  306

Query  838   SNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevl  659
             +  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T +  + W  +FT D  V 
Sbjct  307   AGCVSARVGNELGAGKPYKAKLAATVALGCAFVIGFINVTWTVILGQRWAGLFTNDEPVK  366

Query  658   eltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWK  479
              L  +V+PI+GLCEL NCPQTT CG+LRG+ARP IGA IN  SFY +G P+A+ +AF +K
Sbjct  367   ALVASVMPIMGLCELGNCPQTTGCGILRGTARPGIGAHINLGSFYFVGTPVAVGLAFWFK  426

Query  478   LEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
             + F GL +GLL+AQVAC +S+L +V+ RTDWE E+ +A+ L
Sbjct  427   VGFSGLWFGLLSAQVACAVSILYVVLVRTDWEAEALKAEKL  467



>gb|KDP41539.1| hypothetical protein JCGZ_15946 [Jatropha curcas]
Length=537

 Score =   390 bits (1002),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 227/461 (49%), Positives = 305/461 (66%), Gaps = 7/461 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             +  +  T  EV+EE++ +     P    GLI Y + MI ++ +G LG LELAGG+L+IGF
Sbjct  9     ELHRWPTPSEVLEEIKALGKISGPTAITGLILYSRAMISMIFLGYLGELELAGGSLSIGF  68

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYSV+SGLA+GMEPI  QA+G+K   I+ LTLQRT+ +LL  S+PI  +W N+K +
Sbjct  69    ANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTVLLLLSTSIPISFMWINMKRI  128

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +LW  QD +I  +A  F  F++PDL   S+LHPLRIYLR +  T PL + + I+ +LH+P
Sbjct  129   LLWCGQDQEISSVAHTFILFSVPDLFFLSLLHPLRIYLRTQSITLPLTYCSAISVLLHVP  188

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             + F L    KLGI G+AI+    N    L L  ++ ++    ++   P    LK      
Sbjct  189   LNFLLVVHFKLGIAGVAIAMVWTNLNVFLLLFSFVYFSGVYKDSWVSPSLDCLKG-----  243

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
               W  LL LA+P+C++VCLEWWWYEFM +L G LV P+ T+A+  I+IQTTSL+Y  PS+
Sbjct  244   --WSSLLALAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATVASMGILIQTTSLVYVFPSS  301

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA RP KAR++  +++  A       +L TT  R  W + FT+D+E+
Sbjct  302   LSLGVSTRVGNELGANRPAKARISMIVSLACAVCLGLLAMLFTTFMRHQWGRFFTSDSEI  361

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             L+LT   LPI GLCEL NCPQTT CG LR SARP IGA IN  SFYL+G P+AI M FV 
Sbjct  362   LQLTAIALPIAGLCELGNCPQTTGCGALRASARPTIGANINLGSFYLVGFPVAIFMGFVA  421

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             KL F GL  GLLAAQ +C   ML V+++TDW+ ++ RAK+L
Sbjct  422   KLGFAGLWLGLLAAQASCATFMLYVLWKTDWKVQAERAKEL  462



>ref|XP_002510003.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF52190.1| multidrug resistance pump, putative [Ricinus communis]
Length=528

 Score =   390 bits (1001),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 230/470 (49%), Positives = 308/470 (66%), Gaps = 7/470 (1%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             ++  +  T  EV+EE++ +     P    GLI Y + MI ++ +G LG LELAGG+L+IG
Sbjct  10    EELHRWPTPSEVLEEIKAIGKISGPTAITGLILYSRAMISMLFLGYLGELELAGGSLSIG  69

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSV+SGLA+GMEPI  QA+G+K +  + LTLQRT+ +LL  S+PI  +W N+K 
Sbjct  70    FANITGYSVISGLAMGMEPICGQAYGAKQMKFLGLTLQRTVLLLLSTSVPISFMWLNMKR  129

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD +I   A  F  FAIPDL   S+LHPLR+YLR +  T PL + + I+ +LH+
Sbjct  130   ILLWCGQDQEISSTAHTFILFAIPDLFFLSLLHPLRVYLRTQSITLPLTYCSAISVLLHV  189

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ F L    KLG+ G+AI+    N    LFL+ +I ++    ++   P    L+     
Sbjct  190   PLNFLLVVHFKLGVAGVAIAMVWTNLNLFLFLISFIYFSGIYKDSWVAPSMDCLRG----  245

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LL LA+P+C++VCLEWWWYEFM +L G LV P+ T+A+  I+IQTTSL+Y  PS
Sbjct  246   ---WSSLLALAVPTCVSVCLEWWWYEFMIMLCGLLVNPKATIASMGILIQTTSLVYVFPS  302

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS  +S+RVGNELGA RP KAR++  +++  A       +L TTL R  W + FT D E
Sbjct  303   SLSLGVSTRVGNELGANRPAKARISMIVSLSCAVGLGLLAMLFTTLMRHQWGRFFTNDVE  362

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             +LELT   LPI+GLCEL NCPQT  CGVLRGSARP IGA IN  SFYL+G P+ ++M FV
Sbjct  363   ILELTAVALPIVGLCELGNCPQTAGCGVLRGSARPTIGANINLGSFYLVGMPVGMLMGFV  422

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETS  335
              K+ F GL  GLLAAQ +C I ML V+ RTDW  ++ RA+ L   S   S
Sbjct  423   AKMGFAGLWLGLLAAQASCAILMLYVLCRTDWSVQAERARKLTQTSATNS  472



>ref|XP_011030028.1| PREDICTED: MATE efflux family protein LAL5 [Populus euphratica]
Length=547

 Score =   390 bits (1001),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 241/506 (48%), Positives = 329/506 (65%), Gaps = 17/506 (3%)
 Frame = -3

Query  1744  KQTQKHSTI--PEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggala  1571
             ++TQ+   I     + E   +    FPMI  GL+ Y ++MI ++ +GRLG L LAGG+LA
Sbjct  45    QETQEPDIINLSLAIREAISIAKIAFPMILTGLLLYPRSMISMLFLGRLGELALAGGSLA  104

Query  1570  iGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNL  1391
             +GF NITGYS+LSGLA+GMEPI  QAFG++   ++ LTLQRTI +L++ASLPI  LW N+
Sbjct  105   VGFANITGYSILSGLAMGMEPICGQAFGAQKHRLLGLTLQRTILLLIVASLPISFLWLNM  164

Query  1390  KPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATML  1211
             K ++L+  QD  I   A  F  +++PDL+A S LHPLRIYLR +  T PL +   +A +L
Sbjct  165   KSILLFCGQDESIATEAQSFLVYSLPDLLAQSFLHPLRIYLRTQTITLPLTFCATLAIIL  224

Query  1210  HLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSST  1031
             H+PI ++L   L LG +G+A+S    NFI +  L+ YIL +    +       T    S 
Sbjct  225   HIPINYFLVTHLNLGTKGVALSGVWTNFILVGSLIIYILVSGVHKK-------TWGGFSM  277

Query  1030  SIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTL  851
                +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQTT+L+Y  
Sbjct  278   ECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQTTALIYIF  337

Query  850   PSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttd  671
             PS+LS S+S+RVGNELGA +P KA+LA  + + L+F+     +    + R+VW  +FT D
Sbjct  338   PSSLSFSVSTRVGNELGANQPKKAKLAANVGLSLSFIFGFSALAFAVMVRKVWASMFTQD  397

Query  670   tevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMA  491
              E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+ + 
Sbjct  398   KEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGTPVAVWLG  457

Query  490   FVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKF  311
             F    +F+GL  GLLAAQ +CV++ML+V+ RTDWE E+ RAK L       S  D  ++ 
Sbjct  458   FYAGFDFEGLWLGLLAAQGSCVVTMLLVLGRTDWESEAQRAKKLTNALVLVSNVDDSLQV  517

Query  310   KE--------GEEFRISFEEGVNLQK  257
             +E         E+    FEE VNL K
Sbjct  518   EEKKPPNAEIKEDSLHLFEELVNLYK  543



>ref|XP_010695442.1| PREDICTED: MATE efflux family protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   390 bits (1001),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 230/482 (48%), Positives = 310/482 (64%), Gaps = 7/482 (1%)
 Frame = -3

Query  1780  ANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlg  1601
             + TN  ++    +   K  T+ EV+ E+R +     P    GL+ Y + MI ++ +G LG
Sbjct  41    STTNTIDDFDDDQDLHKWPTLSEVVGEMRAIGKISGPTTVTGLLLYSRAMISMLFLGYLG  100

Query  1600  slelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMAS  1421
              LELAGG+LAIGF NITGYS++SGLA+GMEPI  QA+G+K + ++ LTLQRT+ +L   S
Sbjct  101   ELELAGGSLAIGFANITGYSIISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVLLLFSIS  160

Query  1420  LPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPL  1241
             LPI  +W N+K ++LW  QD +I  +A +F  F+IPDL   S+LHPLRIYLR +  T PL
Sbjct  161   LPIAFMWVNMKRILLWCGQDEEISSVAHVFILFSIPDLFFLSLLHPLRIYLRTQSITLPL  220

Query  1240  LWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYK  1061
              + T I+ + H+P+ F L   LKLGI G+AI+    N    +    +I ++    ++   
Sbjct  221   TYCTAISVVFHIPLNFLLVVHLKLGIAGVAIAMVWTNLNLCILFSSFIYFSRVYKDSWIA  280

Query  1060  PLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             P    L+        W  LL LA+P+C +VCLEWWWYEFM +L G L  P+ T+A+  I+
Sbjct  281   PSMDCLRG-------WSSLLALAIPTCASVCLEWWWYEFMIMLCGLLANPRATIASMGIL  333

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSL+Y  PS+LS  +S+RVGNELGA RP KAR++  +++  A L     +L TTL R
Sbjct  334   IQTTSLVYVFPSSLSLGVSTRVGNELGARRPAKARVSMIVSLACAVLLGLCAMLFTTLMR  393

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
               W + FT+D E+L LT   LPI+GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL
Sbjct  394   HQWGRFFTSDPEILHLTAIALPIVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYL  453

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             +G P+A+   FV K+ F GL  GLLAAQ +C + ML V+ RTDW  +  RAK+L   S  
Sbjct  454   VGMPVAMFFGFVMKMGFAGLWLGLLAAQGSCALLMLYVLCRTDWTLQVDRAKELTNSSSP  513

Query  340   TS  335
              +
Sbjct  514   NT  515



>ref|XP_006587359.1| PREDICTED: multidrug and toxin extrusion protein 2-like, partial 
[Glycine max]
Length=502

 Score =   387 bits (995),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/476 (48%), Positives = 310/476 (65%), Gaps = 10/476 (2%)
 Frame = -3

Query  1723  TIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGY  1544
               PE ++E+  +     PMI  GL+ Y ++MI ++ +G LG L LAGG+LA+GF NITGY
Sbjct  17    NFPESIKEVFSISKIAIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAVGFANITGY  76

Query  1543  SVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQ  1364
             S+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +LL  SLPI LLW  +K ++L   Q
Sbjct  77    SILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPITLLWLYMKQILLLCGQ  136

Query  1363  DAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLT  1184
             D  I   A  +  ++IPDL+A S LHPLRIYLR +  T PL      + +LH+PI ++L 
Sbjct  137   DEAIATQAQQYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLV  196

Query  1183  FSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVIL  1004
               LKLGI+G+A+     NF  +  L+ YI++++   +       T    S     +W  L
Sbjct  197   AHLKLGIKGVALGGVWTNFNLVASLILYIVFSSTHKK-------TWGGFSFECFTQWKSL  249

Query  1003  LRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSIS  824
             L LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTTSL+Y  PS+LS S+S
Sbjct  250   LNLAIPSCVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVS  309

Query  823   SRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvt  644
             +RVGN+LGA +P KARL+  + +  +F++    +    + R  W  +FT D E++ LT  
Sbjct  310   TRVGNKLGAQKPSKARLSAIVGLSCSFMSGVLALFFALMVRNTWASMFTKDKEIITLTSM  369

Query  643   vLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKG  464
             VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P++I +AF    +F+G
Sbjct  370   VLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQG  429

Query  463   LCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG---ESRETSFEDPMIKFKE  305
             L  GLLAAQ +C ++ML+V+ RTDWE E+ RAK L G   +      +DP    K 
Sbjct  430   LWLGLLAAQGSCAVTMLVVLCRTDWEFEAQRAKKLTGMGVDHNHHEVDDPEKPLKH  485



>ref|XP_002322435.2| hypothetical protein POPTR_0015s13900g [Populus trichocarpa]
 gb|EEF06562.2| hypothetical protein POPTR_0015s13900g [Populus trichocarpa]
Length=554

 Score =   389 bits (1000),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 230/497 (46%), Positives = 323/497 (65%), Gaps = 7/497 (1%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             Q+E+    Q    + +   + E   + +  FPM+  GL+ Y ++MI ++ +GRLG L LA
Sbjct  45    QKERRQETQIPNQTDLSLFLREAISIANIAFPMMLTGLLLYPRSMISMLFLGRLGELALA  104

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GG+LA+GF NITGYS+LSGLA+GMEPI  QAFG++   ++  TLQRTI +L++ASLPI  
Sbjct  105   GGSLAVGFANITGYSILSGLAVGMEPICGQAFGAQKHHLLGQTLQRTILLLIVASLPISF  164

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW N+K ++L+  QD  I   A LF  ++IPDL+A S LHPLRIYLR +  T PL +   
Sbjct  165   LWLNMKSILLFCGQDESIATEAQLFLIYSIPDLLAQSFLHPLRIYLRTQSITLPLTFCAT  224

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             +A +LH+PI ++L   L LG +G+A+S    NFI +  L+ YIL +    +       T 
Sbjct  225   LAIILHIPINYFLVTHLNLGTKGVALSGVWTNFILVGSLIIYILVSGVHKK-------TW  277

Query  1045  LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
                S    +EW  LL LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTT+
Sbjct  278   GGFSVECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTA  337

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             L+Y  PS+LS S+S+RVGN+LGA +P KA+ A    +  +F+     +    + R+VW  
Sbjct  338   LIYIFPSSLSFSVSTRVGNQLGANQPKKAKFAAIAGLSFSFIFGFSALSFAVMVRKVWAS  397

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
             +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+
Sbjct  398   MFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPV  457

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED  326
             A+ + F  + +F+GL  GLLAAQ +C ++ML V+ RTDWE E+ RAK+L       +  D
Sbjct  458   AVWLGFFTRFDFEGLWLGLLAAQGSCAVTMLFVLGRTDWEHEAQRAKELTNALVLVANVD  517

Query  325   PMIKFKEGEEFRISFEE  275
               ++ +E +  +   +E
Sbjct  518   DSLEVEEKKPPKAEIKE  534



>ref|XP_004513681.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cicer 
arietinum]
Length=535

 Score =   389 bits (998),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 218/474 (46%), Positives = 320/474 (68%), Gaps = 7/474 (1%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             TN   +K    + +  + + +  +E+  + +   PMI   L+ Y ++MI ++ +G L  L
Sbjct  17    TNPLIQKQQKPKKRILNNLSKTFKEMSSISNIALPMILTCLLLYCRSMISMLFLGHLDEL  76

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LA+GF NITGYS+LSGLA+GMEPI  QA+G+K  T++ L LQ+TI +LL+ S+P
Sbjct  77    ALAGGSLAVGFANITGYSILSGLAVGMEPICGQAYGAKKFTLLGLCLQKTILLLLLVSMP  136

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I +LW  +K ++L+ +QD +I  +A ++  ++IPDL+A SILHPLRIYLR +  T PL  
Sbjct  137   ISILWLYMKKILLFFNQDQEIAEMAQIYILYSIPDLIAQSILHPLRIYLRTQSITLPLTL  196

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 +  LH+PI ++L F L LG++G+A+S    NF  +  L+ YI+Y+ + +E  +   
Sbjct  197   CATFSIFLHIPINYFLVFYLNLGVKGVALSGVWTNFNLVGSLIIYIIYS-KTHEKTWGGF  255

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
             +    S      +W  LL LA+PSC+++CLEWWWYEFMTL  GYL  P+ T+A+  I+IQ
Sbjct  256   SFECFS------KWAPLLNLAIPSCVSICLEWWWYEFMTLFCGYLNNPKSTVASMGILIQ  309

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
              TSLMY LP +LSNS+S+RVGN +GA +P KA+L+  + +  +FL     +  T L R +
Sbjct  310   ITSLMYILPHSLSNSVSTRVGNMIGAQKPSKAKLSAIVGLFFSFLCGLLALSFTFLVRNI  369

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D +++ LT  VLPIIGLCE+ NCPQTT CGVLRG+ARP +GA IN   FYL+G
Sbjct  370   WATMFTNDKDIIFLTSMVLPIIGLCEVGNCPQTTGCGVLRGTARPKVGANINLGCFYLVG  429

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
              P+++ +AF    +F+GL +GLLAAQ +C ++M IV+Y+TDW  E+ +A+ L G
Sbjct  430   MPVSVWLAFYGGYDFQGLWFGLLAAQGSCAVTMFIVVYKTDWNFEALKARKLTG  483



>ref|XP_004139701.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cucumis 
sativus]
 gb|KGN44431.1| hypothetical protein Csa_7G290540 [Cucumis sativus]
Length=493

 Score =   387 bits (993),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 218/471 (46%), Positives = 323/471 (69%), Gaps = 7/471 (1%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             E+      + K  ++ +V+EEL+++    FP+ AM  + + + ++ V+ +GR+GSLELAG
Sbjct  2     EDGNPDASSNKAPSVSQVVEELKELWGITFPVTAMNFLVFFRQVVSVLFLGRIGSLELAG  61

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             GALAIGFTNITGYSV+ GLA G+EPI SQA+GSKN  ++ L+LQR I +LL A++PIG L
Sbjct  62    GALAIGFTNITGYSVMVGLAAGLEPICSQAYGSKNWDLLCLSLQRMILILLFATVPIGFL  121

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W NL  +M++L QD  I  +A+++C +++PDL+ N++L PL+I+LR +  T P+++ TL+
Sbjct  122   WLNLDNIMVFLGQDHLITSMAAIYCIYSMPDLLTNTLLQPLKIFLRSQKDTKPMMYCTLV  181

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             A  LH+P+ + +   L +G++G+A+++ + N   +  + GY+     + E  +      L
Sbjct  182   AVGLHVPLNYMMVVVLGMGMRGVAMASVLTNLNIVGLMSGYVWVWGRKGEMRW-----TL  236

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
             K     G    ++ +LA+PSCL +CLEWWWYE +T+L+GYL  P   +A   I+IQTTS+
Sbjct  237   KLGEVCGGMGPVM-KLAVPSCLGICLEWWWYEIVTVLSGYLSNPTSAVAATGILIQTTSM  295

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYT+P ALS  +S+RVGNELG+G+P KAR+A  +A+  AF+     +  T + R+ W  +
Sbjct  296   MYTVPLALSGCVSTRVGNELGSGKPKKARVAAMVALGCAFVIGGINVTWTVILRQTWATL  355

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D  V  L  + LPIIGLCEL NCPQTT  G+LRG+ARP +GA IN  SFYL+G P+A
Sbjct  356   FTHDVLVKSLVSSALPIIGLCELFNCPQTTAYGILRGTARPAVGARINLASFYLVGTPVA  415

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVG  353
             + +AF  +L F GL +GLL+AQ+AC +SML +V+  TDWE E+ +AK L G
Sbjct  416   LALAFGLQLGFVGLWFGLLSAQLACALSMLYVVVANTDWEAEALKAKRLAG  466



>ref|XP_004501069.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=561

 Score =   389 bits (999),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 230/471 (49%), Positives = 311/471 (66%), Gaps = 7/471 (1%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
             N    +E     +  +  T  EV+EE++ +     P    GLI Y + MI ++ +G LG 
Sbjct  30    NNPHDDEVQDQNELHRWPTPNEVIEEMKAIAKISCPTAITGLILYSRAMISMLFLGYLGE  89

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
              ELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K   I+ LTLQ+TI +LL  S+
Sbjct  90    TELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQKTILLLLSTSI  149

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI L W N+K ++L+L QD +I   A  F  F+IPDL   S LHPLRIYLR +G T PL 
Sbjct  150   PISLTWLNMKKILLFLGQDEEISSTAQTFILFSIPDLFFLSFLHPLRIYLRTQGITLPLT  209

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
             +S+ I+ +LH+P+ F L    K+G+ G++I+  + N   L+FL  ++ ++    E+    
Sbjct  210   YSSAISVILHVPLNFLLVIHFKMGVVGVSIAMILTNLNLLIFLSSFVYFSGVYKESW---  266

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
                 +  S    + W  LL L++PSC++VCLEWWWYE M +L G LV P+ TLA+  I+I
Sbjct  267   ----VSISLECFKGWSSLLSLSIPSCVSVCLEWWWYELMIILCGLLVNPKATLASMGILI  322

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSL+Y  PS+LS  +S+RVGNELGA RP KAR +  +++  AF      +L TTL R 
Sbjct  323   QTTSLVYVFPSSLSLGVSTRVGNELGANRPSKARFSMIVSLFCAFGLGILAMLFTTLMRN  382

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT D E+L LT  VLPI+GLCE+ NCPQTT CGVLRGSARP++GA IN  SFYL+
Sbjct  383   QWGRLFTNDVEILNLTAMVLPIVGLCEIGNCPQTTGCGVLRGSARPSVGANINLGSFYLV  442

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAK  365
             G P+AI++ FV+K+ F GL  GLLAAQV+C   ML V+  TDW  +  RAK
Sbjct  443   GMPVAIVLGFVFKMGFYGLWIGLLAAQVSCAALMLFVLCTTDWNDQVERAK  493



>ref|XP_004143992.1| PREDICTED: MATE efflux family protein 6-like [Cucumis sativus]
Length=490

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 221/461 (48%), Positives = 316/461 (69%), Gaps = 7/461 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             +T+       V+ E + + D  FPMI +G + Y ++MI ++ +GRLG L LAGG+LAIGF
Sbjct  22    ETKFPYRFSHVLSEAKSIADIAFPMILVGFLMYSRSMISMLFLGRLGGLSLAGGSLAIGF  81

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +LL++SLPI  LWFN+K +
Sbjct  82    ANITGYSLLSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLISSLPISFLWFNMKKI  141

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L+  QD  I + A  +   ++PDLVA S LHPLRIYLR +    PL +  ++A + H+P
Sbjct  142   LLFCGQDVDIANEAHSYILCSLPDLVALSFLHPLRIYLRSQSINLPLTYCAILAILFHIP  201

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             I ++     + GI+G+A+     NF  +  L+ ++L++      +YK     + S     
Sbjct  202   INYFFVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFS-----GVYKKTWPGMSSDCL--  254

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             +EW  LL LA+PSC++VCLEWWWYE M LL+G+++ PQ T+A+  I+IQTT+L+Y  PS+
Sbjct  255   KEWKSLLGLAIPSCISVCLEWWWYEIMILLSGFMLNPQSTVASMGILIQTTALIYIFPSS  314

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA  P KA+LA  + + ++F      +L     R+VW  +FT D ++
Sbjct  315   LSFGVSTRVGNELGANHPNKAKLAAIVGLCISFFLGISALLFAFKIRKVWATMFTEDIQI  374

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             +ELT  +LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY++G P+AI ++F  
Sbjct  375   IELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPVAIWLSFYG  434

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               +FKGL  GLLAAQ +C ++ML+V+ RT+WE+++ RAK+L
Sbjct  435   GWDFKGLWIGLLAAQASCAMTMLMVLTRTNWEEQAERAKEL  475



>emb|CAN77415.1| hypothetical protein VITISV_000475 [Vitis vinifera]
Length=527

 Score =   388 bits (996),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 235/477 (49%), Positives = 307/477 (64%), Gaps = 11/477 (2%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
             +T+ +EE+    Q  +  T  E +EE++ +     P    GL+ Y + MI ++ +G LG 
Sbjct  4     HTDDEEEQ----QLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYSRAMISMLFLGYLGE  59

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
             LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL  S+
Sbjct  60    LELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSTSI  119

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI  +W N+K ++ W  QD +I  +A  F  F+IPDL   SILHPLRIYLR +  T PL 
Sbjct  120   PISFMWLNMKRILSWCGQDEEISSMAHTFIIFSIPDLFFLSILHPLRIYLRTQSITLPLT  179

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
             + + I+ +LH+P+ F L    KLGI G+AI+    N    L L+ +I ++     +   P
Sbjct  180   YCSAISVLLHVPLNFLLVVHFKLGIAGVAIAMVWTNLNLFLLLISFIFFSGVYKGSWVAP  239

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
                 L+        W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T+A+  I+I
Sbjct  240   SIDCLRG-------WSSLLALAVPTCISVCLEWWWYEFMIMLCGLLANPKATIASMGILI  292

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSL+Y  PSALS  +S+RVGNELGA RP KAR+   +++  A       +L TTL R 
Sbjct  293   QTTSLVYVFPSALSLGVSTRVGNELGANRPAKARICMIVSLFCAVALGLAAMLFTTLMRH  352

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W + FT D EVLELT   LPI GLCEL NCPQTT CGVLRGSARP  GA IN  SFYL+
Sbjct  353   QWGRFFTNDAEVLELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTEGANINLGSFYLV  412

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             G P+AIIM FV K+ F GL  GLLAAQ +C   ML V+ RTDW  +  RA+DL   S
Sbjct  413   GMPVAIIMGFVAKMGFAGLWLGLLAAQTSCAFLMLYVLCRTDWVVQVKRARDLTQTS  469



>ref|XP_002283609.2| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=553

 Score =   389 bits (998),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 236/483 (49%), Positives = 309/483 (64%), Gaps = 11/483 (2%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             +K    +T+ +EE+    Q  +  T  E +EE++ +     P    GL+ Y + MI ++ 
Sbjct  24    NKTMDLHTDDEEEQ----QLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYSRAMISMLF  79

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K   ++ LTLQRT+ +
Sbjct  80    LGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLL  139

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LL  S+PI  +W N+K ++ W  QD +I  +A  F  F+IPDL   SILHPLRIYLR + 
Sbjct  140   LLSTSIPISFMWLNMKRILSWCGQDEEISSMAHTFIIFSIPDLFFLSILHPLRIYLRTQS  199

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T PL + + I+ +LH+P+ F L    KLGI G+AI+    N    L L+ +I ++    
Sbjct  200   ITLPLTYCSAISVLLHVPLNFLLVVHFKLGIAGVAIAMVWTNLNLFLLLISFIFFSGVYK  259

Query  1075  EALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
              +   P    L+        W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T+A
Sbjct  260   GSWVAPSIDCLRG-------WSSLLALAVPTCISVCLEWWWYEFMIMLCGLLANPKATIA  312

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
             +  I+IQTTSL+Y  PSALS  +S+RVGNELGA RP KAR+   +++  A       +L 
Sbjct  313   SMGILIQTTSLVYVFPSALSLGVSTRVGNELGANRPAKARICMIVSLFCAVALGLAAMLF  372

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
             TTL R  W + FT D EVLELT   LPI GLCEL NCPQTT CGVLRGSARP  GA IN 
Sbjct  373   TTLMRHQWGRFFTNDAEVLELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTEGANINL  432

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLV  356
              SFYL+G P+AIIM FV K+ F GL  GLLAAQ +C   ML V+ RTDW  +  RA+DL 
Sbjct  433   GSFYLVGMPVAIIMGFVAKMGFAGLWLGLLAAQTSCAFLMLYVLCRTDWVVQVKRARDLT  492

Query  355   GES  347
               S
Sbjct  493   QTS  495



>ref|XP_007152342.1| hypothetical protein PHAVU_004G121900g [Phaseolus vulgaris]
 gb|ESW24336.1| hypothetical protein PHAVU_004G121900g [Phaseolus vulgaris]
Length=571

 Score =   389 bits (999),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 229/497 (46%), Positives = 321/497 (65%), Gaps = 9/497 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             Q  K   +  + H  +P+ + E+  +     PMI  GL+ Y ++MI ++ +G LG L LA
Sbjct  70    QPIKTVTEPAKSH--LPDTINEVISISKIAIPMILTGLLLYCRSMISMLFLGHLGELALA  127

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +LL  SLPI L
Sbjct  128   GGSLAVGFANITGYSILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPISL  187

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW ++K ++L   QD  +   A  +  ++IPDL+A S LHPLRIYLR +  T PL     
Sbjct  188   LWLHMKKILLLCGQDEAMATQAQSYLVYSIPDLIAQSFLHPLRIYLRSQSITLPLTLCAS  247

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             ++ +LH+PI ++L   L+LGI+G+A+     NF  +  L+ YI+++    +       T 
Sbjct  248   LSILLHIPINYFLVSHLRLGIKGVALGGVWTNFNLVASLILYIVFSGTHKK-------TW  300

Query  1045  LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
                S     +W  LL LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTTS
Sbjct  301   GGFSFECFTQWKSLLNLAIPSCVSVCLEWWWYEIMILLCGLLVNPRATVASMGILIQTTS  360

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             L+Y  PS+LS S+S+RVGN+LGA +P KARL+  + +  +F++    ++   + R  W  
Sbjct  361   LLYIFPSSLSFSVSTRVGNKLGAQKPSKARLSAIVGLSCSFVSGVLALVFALMVRNTWAS  420

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
             +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+
Sbjct  421   MFTKDKEIISLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPV  480

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED  326
             +I +AF    +F+GL  GLLAAQ +C +SML+V+ RTDWE E+ RAK L G    +S +D
Sbjct  481   SIWLAFFSGYDFQGLWLGLLAAQGSCAVSMLVVLCRTDWEFEAQRAKKLTGMGGASSVDD  540

Query  325   PMIKFKEGEEFRISFEE  275
                +    +  +   +E
Sbjct  541   HNHEVDPEKPLKFESKE  557



>ref|XP_006574768.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Glycine 
max]
 ref|XP_006574769.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Glycine 
max]
Length=507

 Score =   387 bits (993),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 217/461 (47%), Positives = 324/461 (70%), Gaps = 3/461 (1%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + K  T  +VMEE++++     P+ AM ++ +++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  11    SHKFPTTSQVMEEMKELWGMALPITAMNMLVFVRAVVSVLFLGRLGSLELAGGALSIGFT  70

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR + +LLMA +PI LLW NL+ +M
Sbjct  71    NITGYSVLVGLAAGLEPVCSQAYGSKNWDLLSLSLQRMVLILLMAIVPISLLWLNLERIM  130

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             L++ QD+ I  +ASL+C +++PDL+ N++L PLR++LR +  T P+++ +L+A + H+P+
Sbjct  131   LFMGQDSAITGMASLYCFYSLPDLLTNTLLQPLRVFLRSQKVTKPMMYCSLVAVLFHVPL  190

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
              + L   + LG+ G+A+++ + N   ++ + GY+    ++ E + K     +        
Sbjct  191   NYLLVVVMGLGVPGVAMASVMTNLNMVVLMAGYVCVCRKR-EVVVKWGCWGVGGGVVCSG  249

Query  1018  EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSAL  839
                 L+  A+PSCL +CLEWWWYE +T+LAGYL RP + +A   I+IQTTS+MYT+P AL
Sbjct  250   L-GQLMGFAVPSCLMICLEWWWYEIVTVLAGYLPRPTLAVAATGILIQTTSMMYTVPMAL  308

Query  838   SNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevl  659
             +  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T +  + W  +FT D  V 
Sbjct  309   AGCVSARVGNELGAGKPYKAKLAAVVALGCAFVIGFINVTWTVILGQRWAGLFTNDEPVK  368

Query  658   eltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWK  479
              L  +V+PI+GLCEL NCPQTT CG+LRG ARP IGA IN  SFY +G P+A+ +AF +K
Sbjct  369   ALVASVMPIMGLCELGNCPQTTGCGILRGMARPGIGAHINLGSFYFVGTPVAVGLAFWFK  428

Query  478   LEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
             + F GL +GLL+AQVAC +S+L +V+ RTDWE E+ +A+ L
Sbjct  429   VGFSGLWFGLLSAQVACAVSILYVVLVRTDWEAEALKAEKL  469



>ref|XP_004496604.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cicer 
arietinum]
Length=545

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 230/535 (43%), Positives = 338/535 (63%), Gaps = 20/535 (4%)
 Frame = -3

Query  1885  CHCGVDCLCMEVKLHE*KNTHNQLYLLC*RHKHTRANTNQQEEKMAAKQTQKHSTIPEVM  1706
             C C  +   + V++ +    +N +  +    K T   T QQ++K       + + +    
Sbjct  10    CKCNSNPEFLVVQIKDQNEPNNNMMTIPLIQKDTNIATYQQQQKNPTTIQIQKTHLRATF  69

Query  1705  EELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGL  1526
             +E+  +     PMI  GL+ Y ++MI ++ +G LG L LAGG+LA+GF NITGYS+LSGL
Sbjct  70    KEIISIAKIALPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAVGFANITGYSILSGL  129

Query  1525  ALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIH  1346
             A+GMEPI  QAFG+K  T++ L LQRTI +LL+ S+PI +LW   K ++L   Q+  I  
Sbjct  130   AVGMEPICGQAFGAKRYTLLGLCLQRTILLLLLTSIPISILWLYTKKILLLCGQEESIAT  189

Query  1345  IASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLG  1166
              A L+  ++IPDL+A S LHPLRIYLR +  T PL     +A  LH+PI ++L   L +G
Sbjct  190   QAQLYLIYSIPDLLAQSFLHPLRIYLRSQSITLPLTLCATLAIFLHVPINYFLVSHLNMG  249

Query  1165  IQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALP  986
             I+G+A+S    NF  +  L+ YI+++    +       T    S+   ++W  LL LA+P
Sbjct  250   IKGVALSGVWTNFNVVASLILYIVFSGTHKK-------TWGGFSSQCFKQWKSLLNLAIP  302

Query  985   SCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNE  806
             SCL+VCLEWWWYE M LL G L+ P+ T+A+  I+IQTTSL+Y  PS+LS S+S+RVGN+
Sbjct  303   SCLSVCLEWWWYEIMILLCGLLINPRATVASMGILIQTTSLLYIFPSSLSFSVSTRVGNK  362

Query  805   LGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIG  626
             LGA +P KA+++  + +  +F+   F ++   + R++W  +FT D E++++T  VLP+IG
Sbjct  363   LGAQKPSKAKISAIVGLSCSFILGVFSLIFAVMVRKIWASMFTEDKEIIKITSLVLPLIG  422

Query  625   LCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLL  446
             LCEL NCPQTT CGVLRG+ARP +GA INF  FY++G P+AI +AF    +F+GL  GLL
Sbjct  423   LCELGNCPQTTGCGVLRGTARPRVGANINFGCFYIIGMPVAICLAFFVGFDFQGLWLGLL  482

Query  445   AAQVACVISMLIVIYRTDWEKESARAKDL-------------VGESRETSFEDPM  320
              AQ +C ++ML+V+ +TDW+ E+ RAK L             V +S+E   E P+
Sbjct  483   VAQGSCAVTMLVVLSQTDWDGEALRAKKLTGLGTITTTSTVNVDDSKEIDTEKPL  537



>ref|XP_011081156.1| PREDICTED: MATE efflux family protein 5 [Sesamum indicum]
Length=503

 Score =   387 bits (993),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 224/478 (47%), Positives = 314/478 (66%), Gaps = 9/478 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T+Q E   + K+   H ++   ++E + + +   PMI  GL+ Y ++MI ++ +GRLG L
Sbjct  11    TSQLEHDGSCKKIDDHLSLS--LKEAKSIANISLPMILTGLLVYSRSMISMLFLGRLGDL  68

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGGALA+GF NITGYS+LSGLA+GMEPI  QAFG++   ++ LTLQRT+ +LL+ S+P
Sbjct  69    SLAGGALALGFANITGYSILSGLAMGMEPICGQAFGAQRFKLLGLTLQRTVILLLLTSIP  128

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I  LW N+K +++   QD  I   A  +  F++PDL+A S LHPLRIYLR +  T PL +
Sbjct  129   IAFLWLNMKQILIVCGQDHDIAMEAQSYILFSLPDLIAQSFLHPLRIYLRSQSITLPLTY  188

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 + +LH+PI + L   L LGI+GIA++    NF  +  L+ Y+  +       YK  
Sbjct  189   CAAFSILLHIPINYLLVTVLNLGIKGIALAGVWTNFNLVGSLIMYVAISGA-----YKKT  243

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
                + S    G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQ
Sbjct  244   WAGISSDCFKG--WRSLINLAIPSCISVCLEWWWYEIMILLCGLLINPRATVASMGILIQ  301

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTSL+Y  PS+LS  +S+RVGNELGA RP  A+L+  + +  +F      +      R +
Sbjct  302   TTSLIYIFPSSLSFGVSTRVGNELGANRPKCAKLSATLGLCASFFLGLAALFFAFTVRNI  361

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D E+L LT TVLPIIGLCEL NCPQTT CG LRG+ARP +GA IN   FYL+G
Sbjct  362   WASLFTQDPEILALTSTVLPIIGLCELGNCPQTTGCGALRGTARPKMGANINLGCFYLVG  421

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
              P+A++++F +  +FKGL  GLLAAQ +C ++ML V+ RTDWE ++ RAK+L G++  
Sbjct  422   MPVAVLLSFYYGYDFKGLWMGLLAAQGSCAVAMLFVLARTDWEVQAVRAKELTGKTSH  479



>ref|XP_011099184.1| PREDICTED: MATE efflux family protein 5 [Sesamum indicum]
Length=494

 Score =   386 bits (992),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 223/501 (45%), Positives = 329/501 (66%), Gaps = 15/501 (3%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  +  +V+EEL+ +     P+ AM  + Y++ ++ V+ + RLGSLELAGG
Sbjct  3     EKGPDFYSHKFPSSSQVVEELKGLWSMALPITAMNFLVYVRAVVSVLFLARLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+G KN  ++SL+L   I +LL+A +PIG+LW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGRKNWDLLSLSLHLMIFILLLAIIPIGILW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +ML++ QD  I  +A+ +C +++PDL+ N++L PLR+YLR +G T P  W TL++
Sbjct  123   INLESIMLFMGQDKDITSMAATYCIYSLPDLLTNTLLQPLRVYLRSQGVTKPQFWCTLMS  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              + H+P+ + L   +  G++G+A+++ + N   ++ ++GY+           + +    +
Sbjct  183   VIFHIPLNYVLVMVMGAGVRGVAMASVLTNLHMMVLMMGYVCVYGRWKWRWTRGVGRTCR  242

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                        LL+LA+PSC+ +CLEWWWYE +T+LAGYL  P++ +A   I+IQTTSLM
Sbjct  243   RIRR-------LLKLAVPSCIGICLEWWWYEIVTVLAGYLPNPKLAVAATGIMIQTTSLM  295

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LAT +A+V AF      I+ T + RE W ++F
Sbjct  296   YTVPMALAGCVSARVGNELGAGKPYKAKLATNVALVCAFAIGFVNIIWTVIFREKWGELF  355

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  +  L  +VLPIIGLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+
Sbjct  356   TKDEMLKSLVASVLPIIGLCELGNCPQTTGCGILRGAARPVVGAHINLGSFYFVGTPVAV  415

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVGE--SRETSFE  329
             ++AF +   F GL  GLL+AQ AC IS+L  V+  TDWE E+ +A          E S +
Sbjct  416   LLAFRYGFGFSGLWLGLLSAQAACAISVLYFVLCCTDWESEAVKASTFTSPEMGNEWSSD  475

Query  328   DPMIKFKEGEEFRISFEEGVN  266
             D     +E +E  +  ++ VN
Sbjct  476   D-----EEEQELLVVQDQNVN  491



>ref|XP_008444968.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
Length=590

 Score =   389 bits (1000),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 312/479 (65%), Gaps = 8/479 (2%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             H H   N  +  +   A Q  +  T+ E +EE++++     P    GL+ Y + MI V+ 
Sbjct  44    HHHLNNNLLKPSDDQLA-QLHRFPTLSEAVEEMKEIGKISGPTAITGLLLYSRAMISVLF  102

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG LELAGG+L+IGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ +TLQRT+ +
Sbjct  103   LGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLL  162

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LL +S+PI  +W N+K ++LW  QD +I  +A  F  F+IPDL+  S+LHPLRIYLR + 
Sbjct  163   LLTSSVPISFMWLNMKRILLWCGQDEEISTVAQTFILFSIPDLIFLSLLHPLRIYLRTQS  222

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T PL + + ++ +LH+P+ F L    K+GI G+AI+    N    LFL+ ++ ++    
Sbjct  223   ITLPLTYCSALSVLLHVPLNFLLVVHFKMGISGVAIAMVWFNLNVFLFLVSFVYFSGVYK  282

Query  1075  EALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
             ++   P       S      W  LL LA+P+C++VCLEWWWYEFM +L G LV P+ T+A
Sbjct  283   DSWVSP-------SVDCLHGWTPLLSLAIPTCVSVCLEWWWYEFMIMLCGLLVNPKATIA  335

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
             +  I+IQTTSL+Y  PS+LS  +S+RVGNELGA RP KAR++  ++++ A       ++ 
Sbjct  336   SMGILIQTTSLVYVFPSSLSFGVSTRVGNELGANRPAKARISMIVSLICAVALGVAAMVF  395

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
             TTL R  W + FT D E+LELT   LPI+GLCEL NCPQTT CGVLRGSARP  GA IN 
Sbjct  396   TTLMRHKWGRFFTDDAEILELTAVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINL  455

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              SFYL+G P+AI+M FV K+ F GL  GLLAAQ  C + M+ V+  TDW  +  RA  L
Sbjct  456   GSFYLVGFPVAILMGFVVKMGFAGLWIGLLAAQGTCALMMIYVLCTTDWMVQVERAMQL  514



>emb|CDP09810.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   387 bits (993),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 228/472 (48%), Positives = 318/472 (67%), Gaps = 11/472 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T + ++ ++AK+T     I E     + M +   PMI  GL+ Y ++MI ++ +GRLG L
Sbjct  11    TLKPQDTLSAKKTHLSLAITEA----KCMANIAIPMILTGLLLYSRSMISMLFLGRLGEL  66

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGGALAIGF NITGYS+LSGLA+GMEPI  QAFG++   ++ LTLQRT+ MLL  S+P
Sbjct  67    SLAGGALAIGFANITGYSILSGLAMGMEPICGQAFGAQRYKLLGLTLQRTVLMLLWTSIP  126

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I L+W N+K ++L+  QD  I   A  +  +++PDL+A S LHPLRIYLR +  T PL +
Sbjct  127   IALIWCNMKRILLFCGQDHAIATEAQSYIFYSLPDLIALSFLHPLRIYLRSQSITVPLTF  186

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                ++ +LH+PI ++L   L LGI+G+AIS    NF  ++ L+ Y+ ++    +      
Sbjct  187   CAALSILLHIPINYFLVVVLNLGIKGVAISGVWTNFNLVISLITYVTFSGVAKKTWGGMS  246

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
             +  LK        W  L+ LA+PSC++VCLEWWWYE M LL+G+L+ PQ T+A+  I+IQ
Sbjct  247   SQCLKG-------WRSLMNLAIPSCISVCLEWWWYEIMILLSGFLLNPQATVASMGILIQ  299

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTSL+Y  PS+LS S+S+RVGNELGA RP KA+LA  I +  +F+     +    + R V
Sbjct  300   TTSLIYIFPSSLSFSVSTRVGNELGASRPEKAKLAAIIGLSSSFMLGLSALSFAIMVRNV  359

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D  ++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G
Sbjct  360   WASMFTQDASIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKMGANINLGCFYLVG  419

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              P+AI ++F    +F+GL  GLLAAQ +C ++ML+V+ RTDW+ ++ RAK+L
Sbjct  420   MPVAIWLSFFLGYDFRGLWVGLLAAQGSCAVTMLVVLVRTDWDLQAQRAKEL  471



>ref|XP_010933890.1| PREDICTED: MATE efflux family protein 5-like [Elaeis guineensis]
Length=550

 Score =   388 bits (996),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 239/502 (48%), Positives = 314/502 (63%), Gaps = 13/502 (3%)
 Frame = -3

Query  1855  EVKLHE*KNTHNQLYLLC*RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTC  1676
             +   HE  + H  L     +   T  N ++    +  K   +   +     E R ++   
Sbjct  14    QCDYHE--DPHGLLTAPFVQKPQTATNPSEDAPVLTPKPPTE---LALAFVEARSILSLA  68

Query  1675  FPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQ  1496
              PM   GL+ Y ++MI ++ +GRLG L LAGG+LAIGF NITGYSVLSGLA+GMEPI  Q
Sbjct  69    LPMALTGLLIYSRSMISMLFLGRLGGLPLAGGSLAIGFANITGYSVLSGLAMGMEPICGQ  128

Query  1495  AFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAI  1316
             AFG+K L I+ L LQRTI +LL AS+PI  +W N++PL+L   QDA I   A  +  F++
Sbjct  129   AFGAKKLPILGLALQRTILLLLSASIPIAFIWANMRPLLLLCGQDADISAAAQSYILFSL  188

Query  1315  PDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAI-STF  1139
             PDL   S LHPLRIYLR +  T PL ++  IA +LHLPI + L    +LGI G+A+ S +
Sbjct  189   PDLFLQSFLHPLRIYLRSQSITLPLTYAATIAALLHLPINYLLVSIFRLGIPGVALASVW  248

Query  1138  VANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEW  959
                 + LL L    L    ++     P A + +        W  LL LALPSC++VCLEW
Sbjct  249   TNLNLLLLLLAYLYLSGVSKSTGGIIPSAESFRC-------WSSLLNLALPSCVSVCLEW  301

Query  958   WWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKA  779
             WWYE M LL G L+ P+ T+A+  I+IQTTSL+Y  PS+LS  +S+RVGNELGA RP +A
Sbjct  302   WWYEIMILLCGLLLNPKSTVASMGILIQTTSLIYIFPSSLSFGVSTRVGNELGANRPDRA  361

Query  778   RLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQ  599
             R A  + +  +FL   F +      R VW ++FT D  +  LT +VLPI+G+CEL NCPQ
Sbjct  362   RRAAFVGLSSSFLLGLFALSFAVSVRHVWSRMFTADPAIAVLTTSVLPILGMCELGNCPQ  421

Query  598   TTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVIS  419
             TT CGVLRGSARP  GA IN  SFY +G P+A+ +AF   L+FKGL  GLLAAQ ACV+ 
Sbjct  422   TTGCGVLRGSARPRAGANINLGSFYFVGTPVAVALAFWGGLDFKGLWLGLLAAQAACVLL  481

Query  418   MLIVIYRTDWEKESARAKDLVG  353
             ML VI+RTDW+ ++ RAK L G
Sbjct  482   MLAVIHRTDWDLQAERAKRLTG  503



>ref|XP_009798743.1| PREDICTED: MATE efflux family protein DTX1-like [Nicotiana sylvestris]
Length=520

 Score =   387 bits (993),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 232/488 (48%), Positives = 320/488 (66%), Gaps = 18/488 (4%)
 Frame = -3

Query  1789  HTRANTNQQEE---------KMAAKQT--QKHSTIPEVMEELRKMIDTCFPMIAMGLISY  1643
             + + N N+ +E         K   K     K +    V +E + + +  FPMI  GL+ Y
Sbjct  10    YCKCNCNEPQEANMFTLLIPKCPTKNLLLDKTTHFSLVFKEAQSVANIAFPMILTGLLLY  69

Query  1642  MKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVS  1463
              +++I ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K   ++ 
Sbjct  70    SRSLISMLFLGRLGGLALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKYNLLG  129

Query  1462  LTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHP  1283
             L+LQRTI +L+  S PI LLW N+K ++L+  QD  I   A  +  ++IPDL A S+LHP
Sbjct  130   LSLQRTILLLIFTSSPIALLWVNMKTILLYCGQDEDIATEAQSYLFYSIPDLFAQSLLHP  189

Query  1282  LRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllg  1103
             LRIYLR +  T PL +  ++  +LH+PI F L   L LG++G+A+S    NF  +  L+ 
Sbjct  190   LRIYLRTQSITLPLTFCAVLTILLHIPINFLLVTKLNLGVKGVALSAVWTNFNLVASLIV  249

Query  1102  yilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGY  923
             YIL +      +YK    NL  ST   + W  LL L++PSC++VCLEWWWYE M LL G 
Sbjct  250   YILIS-----GVYKKTWENL--STECLKGWKELLNLSIPSCISVCLEWWWYEIMILLCGG  302

Query  922   LVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAF  743
             L+ P+ T+A+  I+IQ TSL+Y  PS+LS S+S+RVGNELGA  P KA+LA  + +  +F
Sbjct  303   LLNPKATVASMGILIQITSLIYIFPSSLSFSVSTRVGNELGARNPNKAKLAAIVGLAGSF  362

Query  742   LASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSAR  563
             +     +      R+VW K+FT D E+L LT  VLPIIGLCEL NCPQTT CGVLRG+AR
Sbjct  363   ILGFSALFFAVTVRKVWAKMFTQDNEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTAR  422

Query  562   PNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEK  383
             P +GA IN   FY +G P+A+ ++F    +F+GL  GLLAAQ +C+++ML+V+ RTDW+ 
Sbjct  423   PKVGANINLGCFYFVGMPVAVGLSFYAGFDFEGLWLGLLAAQASCMVTMLVVLIRTDWDF  482

Query  382   ESARAKDL  359
             E+ RAKDL
Sbjct  483   EAVRAKDL  490



>ref|XP_010521129.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 5 
[Tarenaya hassleriana]
Length=484

 Score =   385 bits (990),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 220/479 (46%), Positives = 319/479 (67%), Gaps = 29/479 (6%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
              + KH + P+V+EELR++     P+ AM  + Y++         RLGSLELAGGAL+IGF
Sbjct  11    SSHKHPSPPQVLEELRELWAMVLPITAMNCLVYLR------AXARLGSLELAGGALSIGF  64

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
             TNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+L R I +LL+A++PI LLW NL P+
Sbjct  65    TNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLHRMIVILLIAAVPISLLWLNLGPI  124

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             ML++ QD  I   A+ +C +++PDL+ N++L PLR++LR +  T P++W TL A   H+P
Sbjct  125   MLFMGQDPDITGTAAEYCIYSLPDLLTNTLLQPLRVFLRSQQGTKPMMWCTLAAVAFHVP  184

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             + ++L   L+ G+ G+A++  + N I +  ++GY+  +        +P     +   ++G
Sbjct  185   LNYWLVMVLRWGVPGVAVAAVMTNLIMVGLMVGYVWGSGRWRS---RP-----ERVEAVG  236

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             E    L+++A+PSCL +CLEWWWYE +T++ GYL +P++ +A   I+IQTTSLMYT+P A
Sbjct  237   EGIGPLMKMAVPSCLGICLEWWWYEIVTVMGGYLDKPKLAVAATGILIQTTSLMYTVPMA  296

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             L+  +S+RVGNELGAGRP KARLA  +A+  AF+     ++ T + RE           +
Sbjct  297   LAGCVSARVGNELGAGRPYKARLAANVALGCAFVIGGVNVVWTVVLRE------RGGEPL  350

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
               L  +V+PI+GLCEL NCPQTT CG+LRG+ARP +GA +N  SFY +G P+A+ +AF  
Sbjct  351   KALVASVMPILGLCELGNCPQTTGCGILRGTARPAVGAHVNLGSFYFVGTPVAVGLAFWL  410

Query  481   KLEFKGLCYGLLAAQVACVISMLI-VIYRTDWEKESARAKDLVG--------ESRETSF  332
             K+ F GL +GLL+AQ ACV+S+L  V+ RTDWE E+ RA  +          ES E SF
Sbjct  411   KIGFSGLWFGLLSAQAACVVSILYAVLVRTDWEGEAVRAMKVTSLELRHVDVESHEGSF  469



>ref|XP_010471203.1| PREDICTED: MATE efflux family protein 5-like [Camelina sativa]
Length=480

 Score =   385 bits (989),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 221/481 (46%), Positives = 324/481 (67%), Gaps = 23/481 (5%)
 Frame = -3

Query  1675  FPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQ  1496
              P+ AM  + Y++ ++ V+ +GRLGSLELAGGAL+IGFTNITGYSVL GLA G+EP+ SQ
Sbjct  3     LPITAMNCLVYVRAVVSVLFLGRLGSLELAGGALSIGFTNITGYSVLVGLASGLEPVCSQ  62

Query  1495  AFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAI  1316
             A+GSKN  +++L+L R + +LL+AS+PI LLW NL P+ML++ QD +I   A+ +C +A+
Sbjct  63    AYGSKNWDLLTLSLHRMVVILLVASVPISLLWINLGPIMLFMGQDPEITATAAEYCLYAL  122

Query  1315  PDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFV  1136
             PDL+ N++L PLR+YLR +  T P++W TL A   H+P+ ++L      G+ G+AI++ V
Sbjct  123   PDLLTNTLLQPLRVYLRSQRVTKPMMWCTLAAVAFHVPLNYWLVMVKLWGVPGVAIASVV  182

Query  1135  ANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVI---------LLRLALPS  983
              N I +  L+GY+  + +    L+K +     S T++ +   +         L+R+A+PS
Sbjct  183   TNLIMVGLLVGYVWMSGK----LHKRVNEGGGSITAVAQSSSVMELVGGLGPLMRVAVPS  238

Query  982   CLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNEL  803
             CL +CLEWWWYE +T+L GYL  P++ +A   I+IQTTSLMYT+P AL+  +S+RVGNEL
Sbjct  239   CLGICLEWWWYEIVTVLGGYLDNPKLAVAATGILIQTTSLMYTVPMALAGCVSARVGNEL  298

Query  802   GAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGL  623
             GAGRP KARLA  +A+  AF+  A  ++ T + +E W  +FT    +  L  +V+PI+GL
Sbjct  299   GAGRPYKARLAANVALACAFVIGALNVVWTVVLKERWAGLFTGYEPLKVLVASVMPIVGL  358

Query  622   CELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLA  443
             CEL NCPQTT CG+LRG+ RP +GA +N  SFY +G P+A+ +AF  K+ F GL +GLL+
Sbjct  359   CELGNCPQTTGCGILRGTGRPAVGAHVNLGSFYFVGTPVAVGLAFWLKIGFSGLWFGLLS  418

Query  442   AQVACVISMLI-VIYRTDWEKESARAKDL-------VGESRETSFEDPMIKFKEGEEFRI  287
             AQ AC +S+L  V+ RTDWE E+ +A  L       VG   E+S    ++  + G + ++
Sbjct  419   AQAACAVSILYAVLARTDWEGEAVKAMSLTSLEMGKVGNDEESSLL--LLDDRNGNDEKL  476

Query  286   S  284
              
Sbjct  477   G  477



>gb|KGN50143.1| hypothetical protein Csa_5G155540 [Cucumis sativus]
Length=534

 Score =   387 bits (993),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 221/461 (48%), Positives = 316/461 (69%), Gaps = 7/461 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             +T+       V+ E + + D  FPMI +G + Y ++MI ++ +GRLG L LAGG+LAIGF
Sbjct  22    ETKFPYRFSHVLSEAKSIADIAFPMILVGFLMYSRSMISMLFLGRLGGLSLAGGSLAIGF  81

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +LL++SLPI  LWFN+K +
Sbjct  82    ANITGYSLLSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLISSLPISFLWFNMKKI  141

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L+  QD  I + A  +   ++PDLVA S LHPLRIYLR +    PL +  ++A + H+P
Sbjct  142   LLFCGQDVDIANEAHSYILCSLPDLVALSFLHPLRIYLRSQSINLPLTYCAILAILFHIP  201

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             I ++     + GI+G+A+     NF  +  L+ ++L++      +YK     + S     
Sbjct  202   INYFFVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFS-----GVYKKTWPGMSSDCL--  254

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             +EW  LL LA+PSC++VCLEWWWYE M LL+G+++ PQ T+A+  I+IQTT+L+Y  PS+
Sbjct  255   KEWKSLLGLAIPSCISVCLEWWWYEIMILLSGFMLNPQSTVASMGILIQTTALIYIFPSS  314

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA  P KA+LA  + + ++F      +L     R+VW  +FT D ++
Sbjct  315   LSFGVSTRVGNELGANHPNKAKLAAIVGLCISFFLGISALLFAFKIRKVWATMFTEDIQI  374

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             +ELT  +LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY++G P+AI ++F  
Sbjct  375   IELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPVAIWLSFYG  434

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               +FKGL  GLLAAQ +C ++ML+V+ RT+WE+++ RAK+L
Sbjct  435   GWDFKGLWIGLLAAQASCAMTMLMVLTRTNWEEQAERAKEL  475



>ref|XP_004165956.1| PREDICTED: LOW QUALITY PROTEIN: MATE efflux family protein 6-like 
[Cucumis sativus]
Length=542

 Score =   387 bits (993),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 221/461 (48%), Positives = 316/461 (69%), Gaps = 7/461 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             +T+       V+ E + + D  FPMI +G + Y ++MI ++ +GRLG L LAGG+LAIGF
Sbjct  22    ETKFPYRFSHVLSEAKSIADIAFPMILVGFLMYSRSMISMLFLGRLGGLSLAGGSLAIGF  81

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +LL++SLPI  LWFN+K +
Sbjct  82    ANITGYSLLSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLISSLPISFLWFNMKKI  141

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L+  QD  I + A  +   ++PDLVA S LHPLRIYLR +    PL +  ++A + H+P
Sbjct  142   LLFCGQDVDIANEAHSYILCSLPDLVALSFLHPLRIYLRSQSINLPLTYCAILAILFHIP  201

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             I ++     + GI+G+A+     NF  +  L+ ++L++      +YK     + S     
Sbjct  202   INYFXVCVFEWGIRGVALGAVWTNFNFVGSLVVFVLFS-----GVYKKTWPGMSSDCL--  254

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             +EW  LL LA+PSC++VCLEWWWYE M LL+G+++ PQ T+A+  I+IQTT+L+Y  PS+
Sbjct  255   KEWKSLLGLAIPSCISVCLEWWWYEIMXLLSGFMLNPQSTVASMGILIQTTALIYIFPSS  314

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA  P KA+LA  + + ++F      +L     R+VW  +FT D ++
Sbjct  315   LSFGVSTRVGNELGANHPNKAKLAAIVGLCISFFLGISALLFAFKIRKVWATMFTEDIQI  374

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             +ELT  +LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY++G P+AI ++F  
Sbjct  375   IELTSLILPIIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPVAIWLSFYG  434

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               +FKGL  GLLAAQ +C ++ML+V+ RT+WE+++ RAK+L
Sbjct  435   GWDFKGLWIGLLAAQASCAMTMLMVLTRTNWEEQAERAKEL  475



>gb|KHN40254.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=572

 Score =   388 bits (996),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 231/493 (47%), Positives = 318/493 (65%), Gaps = 12/493 (2%)
 Frame = -3

Query  1723  TIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGY  1544
               PE ++E+  +     PMI  GL+ Y ++MI ++ +G LG L LAGG+LA+GF NITGY
Sbjct  87    NFPESIKEVFSISKIAIPMILTGLLLYCRSMISMLFLGHLGELALAGGSLAVGFANITGY  146

Query  1543  SVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQ  1364
             S+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +LL  SLPI LLW  +K ++L   Q
Sbjct  147   SILSGLAVGMEPICGQAFGAKRFTLLGLCLQRTILLLLFTSLPITLLWLYMKQILLLCGQ  206

Query  1363  DAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLT  1184
             D  I   A  +  ++IPDL+A S LHPLRIYLR +  T PL      + +LH+PI ++L 
Sbjct  207   DEAIATQAQQYLVYSIPDLIAQSFLHPLRIYLRTQSITLPLTLCASFSILLHIPINYFLV  266

Query  1183  FSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVIL  1004
               LKLGI+G+A+     NF  +  L+ YI++++   +       T    S     +W  L
Sbjct  267   AHLKLGIKGVALGGVWTNFNLVASLILYIVFSSTHKK-------TWGGFSFECFTQWKSL  319

Query  1003  LRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSIS  824
             L LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTTSL+Y  PS+LS S+S
Sbjct  320   LNLAIPSCVSVCLEWWWYEIMILLCGLLVNPKATVASMGILIQTTSLLYIFPSSLSFSVS  379

Query  823   SRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvt  644
             +RVGN+LGA +P KARL+  + +  +F++    +    + R  W  +FT D E++ LT  
Sbjct  380   TRVGNKLGAQKPSKARLSAIVGLSCSFMSGVLALFFALMVRNTWASMFTKDKEIITLTSM  439

Query  643   vLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKG  464
             VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P++I +AF    +F+G
Sbjct  440   VLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGMPVSIWLAFFTGYDFQG  499

Query  463   LCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG---ESRETSFEDPM--IKFKEGE  299
             L  GLLAAQ +C ++ML+V+ RTDWE E+ RAK L G   +      +DP   +K +  E
Sbjct  500   LWLGLLAAQGSCAVTMLVVLCRTDWEFEAQRAKKLTGMGVDHNHHEVDDPEKPLKHESKE  559

Query  298   EFRISFEEGVNLQ  260
             +  +  +   N Q
Sbjct  560   DSLLLADSDENEQ  572



>ref|XP_010053335.1| PREDICTED: MATE efflux family protein LAL5-like [Eucalyptus grandis]
 gb|KCW77609.1| hypothetical protein EUGRSUZ_D01923 [Eucalyptus grandis]
Length=497

 Score =   385 bits (989),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 227/481 (47%), Positives = 323/481 (67%), Gaps = 8/481 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             + +E  +A+   K S +  +++E R +     PM+  GL+ Y ++ I ++ +GRLG L L
Sbjct  16    RDQEDPSAEDPGKTS-LGVLLKEGRSLSAIAVPMVLTGLLIYARSAISMLFLGRLGDLAL  74

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYSVLSGLA+GMEPI  QAFG+    ++ LT+QRTI +LL+ S+PI 
Sbjct  75    AGGSLAIGFANITGYSVLSGLAMGMEPICGQAFGAGRYKVLGLTMQRTILLLLLTSIPIS  134

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             +LW N+KP++L+  Q   I   A L+   ++PDLVA S+LHPLRIYLR +  T PL +  
Sbjct  135   VLWLNMKPILLYFGQQDDISSQAQLYILCSLPDLVAQSLLHPLRIYLRSQSITMPLTFCA  194

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
               A +LH+ I + L   L LGI+G+A++  + N   +  L+ Y+L +           + 
Sbjct  195   AQAIILHVLINYLLVNVLGLGIRGVALAAVLTNINLVASLILYVLISGVHKNTWGGFSSE  254

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
              LK   S       L+ LA+PSC++VCLEWWWYE M LL GYL+ P+ T+A+  ++IQTT
Sbjct  255   CLKGFKS-------LVDLAVPSCISVCLEWWWYEIMILLCGYLLNPRATVASMGVLIQTT  307

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS S+S+RVGNELGAG+P KARLA  + +  +F+     ++ TT+ R  W 
Sbjct  308   ALVYIFPSSLSFSVSTRVGNELGAGQPDKARLAMNVGLAFSFVLGFAALVFTTMVRHTWA  367

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
             ++FT DT+++ LT  VLP+IGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  368   RMFTQDTDIVALTSMVLPLIGLCELGNCPQTTGCGVLRGTARPKMGAHINLGCFYLVGMP  427

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFE  329
             +A+ ++F    +FKGL  GLLAAQ +CV++ML+V+ RT+WE E+ RA++L  E+  T   
Sbjct  428   IAVWLSFFLGFDFKGLWLGLLAAQGSCVVTMLLVLVRTNWEGEARRAQELTRENATTVDG  487

Query  328   D  326
             D
Sbjct  488   D  488



>emb|CBI19327.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   387 bits (995),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 235/477 (49%), Positives = 307/477 (64%), Gaps = 11/477 (2%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
             +T+ +EE+    Q  +  T  E +EE++ +     P    GL+ Y + MI ++ +G LG 
Sbjct  4     HTDDEEEQ----QLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYSRAMISMLFLGYLGE  59

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
             LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL  S+
Sbjct  60    LELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSTSI  119

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI  +W N+K ++ W  QD +I  +A  F  F+IPDL   SILHPLRIYLR +  T PL 
Sbjct  120   PISFMWLNMKRILSWCGQDEEISSMAHTFIIFSIPDLFFLSILHPLRIYLRTQSITLPLT  179

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
             + + I+ +LH+P+ F L    KLGI G+AI+    N    L L+ +I ++     +   P
Sbjct  180   YCSAISVLLHVPLNFLLVVHFKLGIAGVAIAMVWTNLNLFLLLISFIFFSGVYKGSWVAP  239

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
                 L+        W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T+A+  I+I
Sbjct  240   SIDCLRG-------WSSLLALAVPTCISVCLEWWWYEFMIMLCGLLANPKATIASMGILI  292

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSL+Y  PSALS  +S+RVGNELGA RP KAR+   +++  A       +L TTL R 
Sbjct  293   QTTSLVYVFPSALSLGVSTRVGNELGANRPAKARICMIVSLFCAVALGLAAMLFTTLMRH  352

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W + FT D EVLELT   LPI GLCEL NCPQTT CGVLRGSARP  GA IN  SFYL+
Sbjct  353   QWGRFFTNDAEVLELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTEGANINLGSFYLV  412

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             G P+AIIM FV K+ F GL  GLLAAQ +C   ML V+ RTDW  +  RA+DL   S
Sbjct  413   GMPVAIIMGFVAKMGFAGLWLGLLAAQTSCAFLMLYVLCRTDWVVQVKRARDLTQTS  469



>ref|XP_008219166.1| PREDICTED: MATE efflux family protein 5 [Prunus mume]
Length=549

 Score =   387 bits (993),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 225/496 (45%), Positives = 316/496 (64%), Gaps = 12/496 (2%)
 Frame = -3

Query  1789  HTRANTNQQEE-----KMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMIL  1625
             H   N+N+  +         ++  +  T+ E ++E++ +     P    GL+ Y + MI 
Sbjct  19    HFIMNSNKTMDLHAAADDDDQELHRWPTLSEALQEIKAIGKISGPTTITGLLLYSRAMIS  78

Query  1624  VVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRT  1445
             ++ +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ LTLQRT
Sbjct  79    MLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTLQRT  138

Query  1444  ISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLR  1265
             + +LL  S+PI  +W N+K ++LW  QD +I  +A  F  F+IPDL   S+LHPLRIYLR
Sbjct  139   VLLLLSTSIPISFMWLNMKRVLLWCGQDEEISSVAHTFILFSIPDLFFLSLLHPLRIYLR  198

Query  1264  CKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN  1085
              +  T PL + + I+ +LH+P+ F L     +GI G+AI+    N    + L  +  ++N
Sbjct  199   TQNITLPLTYCSAISVVLHVPLNFLLVVKFNMGISGVAIAMVWFNLNLFILLSSFTYFSN  258

Query  1084  EQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQV  905
                ++   P       ST     W  LL LA+P+C++VCLEWWWYE M +L G L  P+ 
Sbjct  259   VYKDSWVCP-------STDCIRGWSSLLALAIPTCISVCLEWWWYELMIMLCGLLANPKA  311

Query  904   TLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFG  725
             T+A+  I+IQTT+L+Y  PS+LS  +S+RVGNELGA R  KAR++T +++  A       
Sbjct  312   TIASMGILIQTTALVYVFPSSLSLGVSTRVGNELGANRAAKARISTIVSLACAVALGLLA  371

Query  724   ILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGAC  545
             +L TTL R  W + FT+D E+LELT   LPI+GLCEL NCPQTT CGVLRGSARP IGA 
Sbjct  372   MLFTTLMRHQWGRFFTSDPEILELTAIALPIVGLCELGNCPQTTGCGVLRGSARPTIGAN  431

Query  544   INFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAK  365
             IN  SFYL+G P+A++M FV K+ F GL  GLLAAQ +C + M  V+  TDW  +  RA+
Sbjct  432   INLGSFYLVGMPVAMLMGFVVKMGFAGLWLGLLAAQGSCALLMFYVLRTTDWNAQVKRAR  491

Query  364   DLVGESRETSFEDPMI  317
             +L   S  +S   P++
Sbjct  492   ELTQASASSSTTPPIL  507



>ref|XP_009341257.1| PREDICTED: MATE efflux family protein LAL5-like isoform X2 [Pyrus 
x bretschneideri]
Length=549

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 227/492 (46%), Positives = 318/492 (65%), Gaps = 18/492 (4%)
 Frame = -3

Query  1765  QEEKMAAKQTQKH--STIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             Q E++   Q + H  S     ++E   +    FPMI  GL+ Y ++MI ++ +G LG L 
Sbjct  43    QPEQVHKSQFKPHKRSHFSLALKEANSIAAIAFPMILTGLLLYSRSMISMLFLGGLGELA  102

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L+LQRT+ +LL  SLPI
Sbjct  103   LAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKNTLLGLSLQRTVLLLLFTSLPI  162

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
              LLW N+K ++L   QD  I   A L+   ++PDL+A S LHPLRIYLR +  T PL   
Sbjct  163   SLLWLNVKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRIYLRSQSITLPLTLC  222

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
               +A +LH+PI + L   L LGI+G+A+S   +NF  +  ++ YI+ +    +       
Sbjct  223   ATLAIILHIPINYLLVSHLDLGIKGVALSGVWSNFNLVASVIIYIIVSGVHKK-------  275

Query  1051  TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             T    S     EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  ++IQT
Sbjct  276   TWGGISMDCFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVASMGVLIQT  335

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             T+L+Y  PS+LS S+S+RVGNE+GA  P KA+LA  + +  +F+     ++  T  R +W
Sbjct  336   TALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFMLGLSALVFATTVRNIW  395

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
               +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G 
Sbjct  396   ASMFTQDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGM  455

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL---------  359
             P+A+ + F    +F+GL  GLLAA+ +C ++ML+V+ RTDWE E+ +AK+L         
Sbjct  456   PVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWEFEARKAKELTGANAAEVA  515

Query  358   VGESRETSFEDP  323
             VG+S +   + P
Sbjct  516   VGDSEDVEEDKP  527



>ref|XP_009344271.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=508

 Score =   385 bits (989),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 221/472 (47%), Positives = 313/472 (66%), Gaps = 8/472 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +  K+       H T +   + E + + +  FPM+  GL+ Y ++MI ++ +G LG L L
Sbjct  10    ESPKLEQYNQNPHKTHLSLALTEAKCIANIAFPMVLTGLLLYSRSMISMLFLGHLGELSL  69

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL+ S+PI 
Sbjct  70    AGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKKFKLLGLTLQRTVILLLLTSIPIA  129

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LWFN+K ++L+  Q  +I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +  
Sbjct  130   FLWFNMKTILLFCGQQDEIATEAHSYILYSLPDLIAQSLLHPLRIYLRTQSITMPLTFCA  189

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
              +A +LH+PI + L   L LGI+G+A+S    N   +  L+ YI  +      +YK    
Sbjct  190   ALAILLHIPINYLLVHVLNLGIKGVALSGVWTNANLVGSLIAYIAIS-----GVYKRTWG  244

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                     G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  245   GFSKEFFAG--WKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  302

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +ARLAT + +  +F+     +L     R +W 
Sbjct  303   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  362

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT D+E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  363   SMFTKDSEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  422

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             +A+ ++   + +F+GL  GLLAAQ +CV++ML  ++RT+W+ ++ RAK+L G
Sbjct  423   VAVWLSLYEQFDFRGLWLGLLAAQGSCVLTMLFALFRTNWDLQAQRAKELTG  474



>ref|XP_009796993.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=533

 Score =   385 bits (990),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 242/509 (48%), Positives = 336/509 (66%), Gaps = 16/509 (3%)
 Frame = -3

Query  1783  RANTNQQEEKMAAKQTQKHST------IPEVMEELRKMIDTCFPMIAMGLISYMKNMILV  1622
             ++ TNQ + + +      H T      +  + +E + + +  FPMI  GL+ Y ++MI +
Sbjct  31    KSPTNQYQAQNSEVPNYPHKTNNKITHLSLIFKEAQSIANIAFPMILTGLLLYSRSMISM  90

Query  1621  VCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTI  1442
             + +GRLG L LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG++   ++ LTLQRTI
Sbjct  91    LFLGRLGDLALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQKFNLLGLTLQRTI  150

Query  1441  SMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRC  1262
              +LL+ S PI LLW N+K ++L+  QD  I   A  +  +A+PDL A S+LHPLRIYLR 
Sbjct  151   LLLLLTSFPIALLWVNMKTILLYCGQDEDIATEAQSYLFYALPDLFAQSLLHPLRIYLRT  210

Query  1261  KGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE  1082
             +  T PL    ++A +LH+PI F L   L LG++G+A+S+   NF  ++ L+ YI+ +  
Sbjct  211   QSITLPLTCCAVLAILLHIPINFLLVTKLNLGVKGVALSSVWTNFNLVVSLIIYIIIS--  268

Query  1081  QNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
                 LYK   T  K S  I + W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T
Sbjct  269   ---GLYK--KTWQKLSMEIIKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPKAT  323

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             +A+  I+IQTTSL+Y  PS+LS S+S+RVGN+LGA RP KA++A  + +  +F+     +
Sbjct  324   VASMGILIQTTSLIYIFPSSLSFSVSTRVGNKLGARRPDKAKVAAIVGLAGSFILGFSAL  383

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
                   R+VW K+FT D E+L LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA I
Sbjct  384   FFAVTVRKVWAKMFTNDKEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANI  443

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             N   FYL+G P+A+ ++F    +F+GL  GLLAAQ +C+++ML+V+  TDW+ E+ RAK+
Sbjct  444   NLGCFYLVGMPVAVGLSFYAGFDFQGLWLGLLAAQASCMVTMLLVLLHTDWDFEAQRAKE  503

Query  361   LVGESRETSFEDPMIKFKEGEEFRISFEE  275
             L G +  ++F D     KE EE      E
Sbjct  504   LTGTTTVSNFLD---HNKETEENNKQLNE  529



>ref|XP_009341256.1| PREDICTED: MATE efflux family protein LAL5-like isoform X1 [Pyrus 
x bretschneideri]
Length=559

 Score =   387 bits (993),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 227/492 (46%), Positives = 318/492 (65%), Gaps = 18/492 (4%)
 Frame = -3

Query  1765  QEEKMAAKQTQKH--STIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             Q E++   Q + H  S     ++E   +    FPMI  GL+ Y ++MI ++ +G LG L 
Sbjct  43    QPEQVHKSQFKPHKRSHFSLALKEANSIAAIAFPMILTGLLLYSRSMISMLFLGGLGELA  102

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L+LQRT+ +LL  SLPI
Sbjct  103   LAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKNTLLGLSLQRTVLLLLFTSLPI  162

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
              LLW N+K ++L   QD  I   A L+   ++PDL+A S LHPLRIYLR +  T PL   
Sbjct  163   SLLWLNVKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRIYLRSQSITLPLTLC  222

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
               +A +LH+PI + L   L LGI+G+A+S   +NF  +  ++ YI+ +    +       
Sbjct  223   ATLAIILHIPINYLLVSHLDLGIKGVALSGVWSNFNLVASVIIYIIVSGVHKK-------  275

Query  1051  TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             T    S     EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  ++IQT
Sbjct  276   TWGGISMDCFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVASMGVLIQT  335

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             T+L+Y  PS+LS S+S+RVGNE+GA  P KA+LA  + +  +F+     ++  T  R +W
Sbjct  336   TALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFMLGLSALVFATTVRNIW  395

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
               +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G 
Sbjct  396   ASMFTQDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGM  455

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL---------  359
             P+A+ + F    +F+GL  GLLAA+ +C ++ML+V+ RTDWE E+ +AK+L         
Sbjct  456   PVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWEFEARKAKELTGANAAEVA  515

Query  358   VGESRETSFEDP  323
             VG+S +   + P
Sbjct  516   VGDSEDVEEDKP  527



>ref|XP_009623490.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=513

 Score =   385 bits (988),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 228/488 (47%), Positives = 322/488 (66%), Gaps = 15/488 (3%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
              Q+E++    +QK++    ++E ++ + +  FPMI  GL+ Y ++MI ++ +GRLG L L
Sbjct  14    DQKEQINNIPSQKNNLTLAILE-VKCIANIAFPMIFTGLLLYSRSMISMIFLGRLGELSL  72

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +LL+ S+PI 
Sbjct  73    AGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTLQRTIILLLLTSIPIS  132

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LW  +K L++   Q+  I   A  +  +++PDL+  S LHPLRIYLR +  T PL +  
Sbjct  133   FLWLYMKRLLILCGQNHNIASEAQNYILYSLPDLLTQSFLHPLRIYLRSQSITLPLTYCA  192

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
               A ++H+PI ++L   L LGI+G+A+S    NF  +  L+ YIL +    +      + 
Sbjct  193   AFAILIHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLILYILVSEVHKKTWNGITSE  252

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
              LK        W  LL LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  253   CLKG-------WKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQSTVASMGILIQTT  305

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +A+LA  I +  +F+     +   T+ R++W 
Sbjct  306   ALIYIFPSSLSFGVSTRVGNELGANRPNRAKLAAIIGLCSSFILGVSALFFATMVRKIWA  365

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
             +IFT D E+L LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  366   RIFTLDQEILALTAMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  425

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVIS-MLIVIYRTDWEKESARAKDLVG------E  350
             +AI + F    +F+GL  GLLAAQ +C ++ MLI++ +T+WE+++ RAK+L        E
Sbjct  426   VAIWLGFFMGYDFRGLWLGLLAAQASCAVTMMLIILAKTNWEEQARRAKELTAIINGDYE  485

Query  349   SRETSFED  326
             + +  F D
Sbjct  486   NEDEKFID  493



>ref|XP_009377927.1| PREDICTED: MATE efflux family protein 5-like, partial [Pyrus 
x bretschneideri]
Length=518

 Score =   385 bits (988),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 221/472 (47%), Positives = 313/472 (66%), Gaps = 8/472 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +  K+       H T +   + E + + +  FPM+  GL+ Y ++MI ++ +G LG L L
Sbjct  20    ESPKLEQYNQNPHKTHLSLALTEAKCIANIAFPMVLTGLLLYSRSMISMLFLGHLGELSL  79

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL+ S+PI 
Sbjct  80    AGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKKFKLLGLTLQRTVILLLLTSIPIA  139

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LWFN+K ++L+  Q  +I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +  
Sbjct  140   FLWFNMKTILLFCGQQDEIATEAHSYILYSLPDLIAQSLLHPLRIYLRTQSITMPLTFCA  199

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
              +A +LH+PI + L   L LGI+G+A+S    N   +  L+ YI  +      +YK    
Sbjct  200   ALAILLHIPINYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAIS-----GVYKRTWG  254

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                     G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  255   GFSKECFAG--WKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  312

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +ARLAT + +  +F+     +L     R +W 
Sbjct  313   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  372

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT D+E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  373   SMFTKDSEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  432

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             +A+ ++F  + +F+GL  GLLAAQ +CV++ML  ++ T+W+ ++ RAK+L G
Sbjct  433   VAVWLSFYEQFDFRGLWLGLLAAQGSCVLTMLFALFTTNWDLQAQRAKELTG  484



>ref|XP_008238780.1| PREDICTED: MATE efflux family protein LAL5-like [Prunus mume]
Length=504

 Score =   384 bits (987),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 311/469 (66%), Gaps = 7/469 (1%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             E    +Q  + + +   + E + + +  FPM+  GL+ Y + MI ++ +GRLG L LAGG
Sbjct  10    ENPKLEQENQKTHLSLALIEAKCIANIAFPMVLTGLLLYSRTMISMLFLGRLGELALAGG  69

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             +LAIGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL+ S+PI LLW
Sbjct  70    SLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGLTLQRTVILLLLTSIPIALLW  129

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
             FN+K ++L   Q   I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +   +A
Sbjct  130   FNMKRILLSCGQQDDIATQAQSYIFYSLPDLIAQSLLHPLRIYLRSQSITVPLTFCATLA  189

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              +LH+PI + L   L LGI+G+A+S    N   +  L+ YI  +      +YK       
Sbjct  190   ILLHIPINYLLVCVLNLGIKGVALSGVWTNVNLVGSLIFYIAIS-----GVYKKTWGGF-  243

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
              S    E W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT L+
Sbjct  244   -SKECFEGWKSLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTGLI  302

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             Y  PS+LS  +S+RVGNELGA RP +A+LAT + +  +F+     +L     R +W  ++
Sbjct  303   YIFPSSLSFGVSTRVGNELGANRPKRAKLATIVGLSYSFILGFSALLFAVTVRNIWASMY  362

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D+E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+
Sbjct  363   TQDSEIITLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMPVAV  422

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
              + F    +F+GL  GLLAAQ +CV++ML V+ RT+WE ++ RAK+L G
Sbjct  423   WLGFFAGFDFRGLWLGLLAAQGSCVVTMLFVLARTNWEIQAQRAKELTG  471



>ref|XP_007020248.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY17473.1| MATE efflux family protein [Theobroma cacao]
Length=501

 Score =   384 bits (986),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 226/496 (46%), Positives = 325/496 (66%), Gaps = 14/496 (3%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  +  +V+EEL+++     P+ AM  + +++ ++ V+ +GRLGSLELAGG
Sbjct  3     EKDIDCSSHKLPSASQVLEELKELWGMALPITAMNWLVFVRAVVSVLFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L +A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWELLSLSLQRMIIILFLAIIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +M+++ QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P++W +L+A
Sbjct  123   VNLESIMVFMGQDKDITAMAATYCMYSLPDLLTNTLLQPLRVFLRSQRVTKPMMWCSLVA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              M H+P+ + L   + LG+ G+A+++ V N   +  ++GY+  +          +     
Sbjct  183   VMFHVPLNYMLVMVMGLGVPGVAMASVVTNMNMVALMVGYVWVSGRWEMRWTAGIGGVCG  242

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                        LLRLA+PSCL +CLEWWWYE +T++AGYL  P + +A   I+IQTTS+M
Sbjct  243   GVVP-------LLRLAVPSCLGICLEWWWYEIVTVMAGYLPNPTLAVAATGILIQTTSMM  295

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T + RE W  +F
Sbjct  296   YTVPMALAGCVSARVGNELGAGKPHKAKLAAMVALGCAFVIGILNVAWTVILRERWAGLF  355

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  V  L  TVLPIIGLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+
Sbjct  356   TKDDLVKPLVATVLPIIGLCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAV  415

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVGESRETSFEDP  323
              +AF   + F GL +GLL+AQVAC +S+L +V+  TDWE E+  AK L      TS E  
Sbjct  416   GLAFWLNVGFPGLWFGLLSAQVACAVSILCVVLLYTDWEAEALNAKKL------TSMEMS  469

Query  322   MIKFKEGEEFRISFEE  275
                   GE+     EE
Sbjct  470   SCNNGHGEKGYEMDEE  485



>gb|KEH17144.1| MATE efflux family protein [Medicago truncatula]
Length=527

 Score =   385 bits (988),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 227/502 (45%), Positives = 320/502 (64%), Gaps = 15/502 (3%)
 Frame = -3

Query  1774  TNQQEEKMAAKQT-QKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
             TN    K    QT   +  +    +E+  +    FPMI   L+ Y ++MI ++ +G L  
Sbjct  14    TNPLIPKPKKNQTFSFYHHLTHTFKEMNSISKIAFPMILTCLLLYCRSMISMLFLGHLND  73

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
             L LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +LL+ S+
Sbjct  74    LALAGGSLAIGFANITGYSILSGLAVGMEPICGQAFGAKKFTLLGLCLQRTILLLLLVSI  133

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI   W  +K ++L+ +QD +I  +A  +  ++IPDL+A S +HPLRIYLR +  T PL 
Sbjct  134   PISFSWLYMKKMLLFFNQDEEIATMAQTYILYSIPDLIAQSFIHPLRIYLRTQSITLPLT  193

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
                  + +LH+PI ++L   L LGI+G+A+S    NF  +  L+ YI Y+    +     
Sbjct  194   LCATFSILLHIPINYFLVIYLNLGIKGVALSGVWTNFNLVASLIFYIYYSGTHKK-----  248

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
               T    S     EW+ LL LA+PSC++VCLEWWWYEFMT+  GYL  P+ ++A+  ++I
Sbjct  249   --TWAGFSLESFREWLPLLNLAIPSCVSVCLEWWWYEFMTIFCGYLSNPRSSVASMGVLI  306

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             Q TSLMY  P +LSNS+S+RVGN +GA +P KA+L+    +  +F+   F  + T   R 
Sbjct  307   QITSLMYIFPYSLSNSVSTRVGNMIGAQKPSKAKLSAISGLSFSFICGVFAFIFTLCVRN  366

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
             +W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+
Sbjct  367   MWASMFTKDKEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLV  426

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRET  338
             G P+++ +AF    +F+GL  GLLAAQ +C ++MLIV+Y+TDW+ E+ RA+ L G  +E 
Sbjct  427   GMPVSVWLAFYGGYDFQGLWLGLLAAQGSCALTMLIVLYKTDWKFEALRARKLTGSEKEN  486

Query  337   SFEDPMIKFKEGEEFRISFEEG  272
                    + KE +E ++   E 
Sbjct  487   -------ENKEIDEEKLHISEN  501



>ref|XP_008354220.1| PREDICTED: MATE efflux family protein LAL5-like [Malus domestica]
Length=559

 Score =   386 bits (991),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 226/492 (46%), Positives = 319/492 (65%), Gaps = 18/492 (4%)
 Frame = -3

Query  1765  QEEKMAAKQTQKH--STIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             Q E++   Q + H  S     ++E   +    FPMI  GL+ Y+++MI ++ +GRLG L 
Sbjct  43    QPEQVHKSQFKPHNKSHFSLALKEANSIAAIAFPMILTGLLLYLRSMISMLFLGRLGELA  102

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L+LQR + +LL  SLPI
Sbjct  103   LAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKKHTLLGLSLQRMVLLLLFTSLPI  162

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
              LLW N+K ++L   QD  I   A L+   ++PDL+A S LHPLRIYLR +  T PL   
Sbjct  163   SLLWLNMKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRIYLRSQSITLPLTLC  222

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
               +A +LH+PI + L   L LGI+G+A+S   +NF  +  ++ YI+ +    +       
Sbjct  223   ATLAIILHIPINYLLVSHLDLGIKGVALSGVWSNFNLVASVIVYIIVSGVHKK-------  275

Query  1051  TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             T    S     EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  ++IQT
Sbjct  276   TWGGISMDCFGEWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVASMGVLIQT  335

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             T+L+Y  PS+LS S+S+RVGNE+GA  P KA+LA  + +  +F+     ++  T  R +W
Sbjct  336   TALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCFSFMLGLSALVFATTVRNIW  395

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
               +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G 
Sbjct  396   ASMFTQDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGM  455

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL---------  359
             P+A+ + F    +F+GL  GLLAA+ +C ++ML+V+ RTDWE E+ +A++L         
Sbjct  456   PVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWEFEARKARELTGAAAAEAA  515

Query  358   VGESRETSFEDP  323
             VG+S +   + P
Sbjct  516   VGDSEDVEEDKP  527



>ref|XP_008369500.1| PREDICTED: MATE efflux family protein 5 [Malus domestica]
 ref|XP_008345365.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=507

 Score =   384 bits (986),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 221/472 (47%), Positives = 312/472 (66%), Gaps = 8/472 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +  K+       H T +   + E + + +  FPM+  GL+ Y ++MI ++ +G LG L L
Sbjct  9     ESPKLEQYNQNPHKTHLSLALTEAKCIANIAFPMVLTGLLLYSRSMISMLFLGHLGELSL  68

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+L+IGF NITGYSVL GLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL+ S+PI 
Sbjct  69    AGGSLSIGFANITGYSVLXGLAMGMEPICGQAYGAKKFKLLGLTLQRTVILLLLTSIPIA  128

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LWFN+K ++L+  Q  +I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +  
Sbjct  129   FLWFNMKXILLFCGQQDEIATEAHSYILYSLPDLLAQSLLHPLRIYLRTQSXTMPLTFCA  188

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
              +A +LH+PI + L   L LGI+G A+S    N   +  L+ YI  +      +YK    
Sbjct  189   ALAILLHIPINYLLVHVLNLGIKGXALSGVWTNVNLVGSLIAYIAIS-----GVYKKTWG  243

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                     G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  244   GFSKECFTG--WKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  301

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +ARLAT + +  +F+     +L     R +W 
Sbjct  302   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  361

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT D+E++ LT  VLPIIGLCEL NCPQTT CGVLRG ARP +GA IN   FYL+G P
Sbjct  362   SMFTKDSEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGIARPKLGANINLGCFYLVGMP  421

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             +A+ ++F  + +F+GL  GLLAAQ +CV++ML V++RT+W+ ++ RAK+L G
Sbjct  422   VAVWLSFYVQFDFRGLWLGLLAAQGSCVLTMLFVLFRTNWDLQAQRAKELTG  473



>ref|XP_009600301.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=540

 Score =   385 bits (989),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 238/502 (47%), Positives = 334/502 (67%), Gaps = 13/502 (3%)
 Frame = -3

Query  1783  RANTNQQEEKMAAKQTQKHST------IPEVMEELRKMIDTCFPMIAMGLISYMKNMILV  1622
             ++ TNQ + + +      H T      +  V +E++ + D  FPMI  GL+ Y ++MI +
Sbjct  38    KSPTNQYQAQNSEVPNYPHKTNNKITHLSLVFKEVQSIADIAFPMILTGLLLYSRSMISM  97

Query  1621  VCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTI  1442
             + +GRLG L LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG++   ++ LTLQRTI
Sbjct  98    LFLGRLGDLALAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQKYNLLGLTLQRTI  157

Query  1441  SMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRC  1262
              +LL+ S PI LLW N+K ++L+  QD  I   A  +  +A+PDL A S+LHPLRIYLR 
Sbjct  158   LLLLLTSFPIALLWVNMKTILLYCGQDEDIATEAQSYLFYALPDLFAQSLLHPLRIYLRT  217

Query  1261  KGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE  1082
             +  T PL    ++A +LH+PI F L   L LG++G+A+S+   NF  ++ L+ YI+ +  
Sbjct  218   QSITLPLTCCAVLAILLHIPINFLLVTKLNLGVKGVALSSVWTNFNLVVSLIIYIIISGI  277

Query  1081  QNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
               +       T  K S  I + W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T
Sbjct  278   YKK-------TWEKLSMEIIKGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPKAT  330

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             +A+  I+IQTTSL+Y  PS+LS S+S+RVGNELGA RP KA++A  + +  +F+     +
Sbjct  331   VASMGILIQTTSLIYIFPSSLSFSVSTRVGNELGARRPDKAKVAAIVGLAGSFILGFSAL  390

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
                 + R+VW K+FT D E+L LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA I
Sbjct  391   FFAVIVRKVWAKMFTNDKEILALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANI  450

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             N   FYL+G P+A+ ++F    +F+GL  GLLAAQ +C+++ML+V+  TDW+ E+ RAK+
Sbjct  451   NLGCFYLVGMPVAVGLSFYAGFDFEGLWLGLLAAQASCMVTMLLVLLHTDWDFEAQRAKE  510

Query  361   LVGESRETSFEDPMIKFKEGEE  296
             L G +  ++F D     +E  +
Sbjct  511   LTGITAVSNFLDHNKDIEENNK  532



>ref|XP_004490498.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Cicer 
arietinum]
Length=559

 Score =   385 bits (990),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 229/474 (48%), Positives = 314/474 (66%), Gaps = 9/474 (2%)
 Frame = -3

Query  1741  QTQKHS--TIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalai  1568
             Q + H+  T+ E +EE++++     P    GL+ Y + MI ++ +G LG +ELAGG+L+I
Sbjct  41    QDELHTWPTLSEALEEIKEIGKISCPTTITGLLLYSRAMISMIFLGYLGEMELAGGSLSI  100

Query  1567  GFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLK  1388
             GF NITGYSV+SGLA+GMEPI  QA+G+K   I+ LTLQRTI +LL  S+PI  +W N++
Sbjct  101   GFANITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTILLLLSTSIPISFIWLNME  160

Query  1387  PLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLH  1208
              ++LW  Q+ +I   A  F  F IPDL   SILHPLRIYLR +G T PL + + I+   H
Sbjct  161   TILLWSGQNQEISSKAQTFILFLIPDLFLLSILHPLRIYLRTQGITMPLTYCSAISVFFH  220

Query  1207  LPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTS  1028
             +P+ F L   L++GI G+AI+  + N   +L L  ++ +++   ++   P    +K    
Sbjct  221   VPLNFLLVVHLEMGIGGVAIAMVLTNLNLILLLSSFLYFSSVYKQSWVPPSLECIKG---  277

Query  1027  IGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
                 W  LL LA+P+C++VCLEWWWYEFM ++ G LV P+ T+A+  I+IQTTSL+Y  P
Sbjct  278   ----WSSLLSLAIPTCVSVCLEWWWYEFMIMMCGLLVNPKATIASMGILIQTTSLVYVFP  333

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdt  668
             S+LS  +S+R+GNELGA RP KAR++  +++  A +     ++ TTL R  W K FT D 
Sbjct  334   SSLSLGVSTRIGNELGANRPRKARISMIVSLFCALILGLGAMVFTTLMRHKWGKFFTNDN  393

Query  667   evleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAF  488
             E+LELT  VLPI+GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P+AI + F
Sbjct  394   EILELTSIVLPIVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPIAIFLGF  453

Query  487   VWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED  326
               K+ F GL  GLLAAQ +C   ML+V+ RTDW  +  RAK+L   S  T+  D
Sbjct  454   FAKMGFAGLWLGLLAAQASCACLMLVVLCRTDWNVQVQRAKELTKTSTITTCHD  507



>ref|XP_010548775.1| PREDICTED: MATE efflux family protein 5-like [Tarenaya hassleriana]
Length=514

 Score =   384 bits (986),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 226/494 (46%), Positives = 322/494 (65%), Gaps = 15/494 (3%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
              H H  ++++  +    +    +  T  E MEE++++     P    GL+ Y ++MI ++
Sbjct  30    NHPHDYSDSSHND----SLDLHRWPTFLEGMEEVKEIGKISGPTAVTGLLMYSRSMISML  85

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              +G LG LELAGG+LAIGF NITGYSV+SGLA+GMEPI  QA+G+  + ++ LTLQRTI 
Sbjct  86    FLGYLGELELAGGSLAIGFANITGYSVISGLAMGMEPICGQAYGANQMKLLGLTLQRTIL  145

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL +S+PI   W N++ ++ W  QD  I  ++  F  FAIPDL   S+LHPLRIYLR +
Sbjct  146   LLLSSSVPISFFWLNVRRILSWCGQDEDISSVSQTFLLFAIPDLFFLSLLHPLRIYLRTQ  205

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
               T P+ +ST ++ +LH+P+ F L   L++GI G+AI+  + N   ++ L  ++ +T   
Sbjct  206   SITLPVTYSTAVSVLLHIPLNFLLVTKLEMGIVGVAIAMVLTNLNLVILLSSFVYFTGVH  265

Query  1078  NEALYKPLATN-LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
              +  + PL+ + LK        W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T
Sbjct  266   RDT-WVPLSADCLKG-------WSSLLSLAIPTCVSVCLEWWWYEFMIMLCGLLANPKTT  317

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             +++  I+IQTT+L+Y  PS+LS  +S+R+GNELGA RP KAR++  I++  A       +
Sbjct  318   VSSMGILIQTTALIYVFPSSLSLGVSTRIGNELGAKRPRKARISMIISLFCALGLGLVAM  377

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
             + T L R  W ++FT D E+LELT   LPI GLCEL NCPQTT C VLRGSARP +GA I
Sbjct  378   VFTILVRHQWGRLFTKDAEILELTSIALPIAGLCELGNCPQTTGCSVLRGSARPALGANI  437

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             N  SFYL+G P+AII+ FV KL F GL  GLLAAQ  C   ML  +++TDWE ++ RA++
Sbjct  438   NLGSFYLVGMPVAIILGFVLKLGFPGLWLGLLAAQATCAALMLCALWKTDWEVQAQRAEE  497

Query  361   LVGESRETSFEDPM  320
             L   ++  S  DP+
Sbjct  498   LTSNTQSES--DPV  509



>ref|XP_010061582.1| PREDICTED: MATE efflux family protein 5 [Eucalyptus grandis]
Length=566

 Score =   385 bits (990),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 310/474 (65%), Gaps = 8/474 (2%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQT-QKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlg  1601
             N N++   M  +    +  T  E +EE++ +     P    GL+ Y++ MI ++ +GRLG
Sbjct  20    NPNKKSSPMDLQDDLHRWPTPSEALEEIKAIGKISGPTAVTGLLLYLRAMISMLFLGRLG  79

Query  1600  slelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMAS  1421
              LEL+GG+LAIGF NITGYSV+SGLA+GMEPI  QA+G++   ++ LTLQRT+ +LL AS
Sbjct  80    ELELSGGSLAIGFANITGYSVISGLAMGMEPICGQAYGARQCKMLGLTLQRTVLLLLSAS  139

Query  1420  LPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPL  1241
             +PI  +W N+K ++LW  QD +I   A  F  F++PDL   S+LHPLRIYLR +  T PL
Sbjct  140   VPISFMWANMKEILLWCGQDEEISSTAHTFILFSMPDLFFLSLLHPLRIYLRTQNITLPL  199

Query  1240  LWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYK  1061
              + +  + +LH+P+ F L    K+GI G+AI+    N    + L  YI ++     +   
Sbjct  200   TYCSAASVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFVLLSAYIYFSRVYEGSWVA  259

Query  1060  PLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
             P A  L+        W  LL LA+P+C++VCLEWWWYE M +L G L  P+ T+A+  I+
Sbjct  260   PSADCLRG-------WSSLLALAVPTCVSVCLEWWWYELMIVLCGLLASPRATVASMGIL  312

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSL+Y  PS+LS  +S+RVGNELGA RP +AR++  IA+V A       +L TTL R
Sbjct  313   IQTTSLVYVFPSSLSLGVSTRVGNELGARRPARARISAIIALVCAVGLGLGAMLFTTLVR  372

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
               W ++FT + E+LELT   LPI GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL
Sbjct  373   HQWGRLFTENAEILELTAAALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYL  432

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             +G P+AI+M FV K+ F GL  GLLAAQ +C + ML V+ RTDW  +  RAK+L
Sbjct  433   IGMPVAIVMGFVAKVGFAGLWLGLLAAQASCALLMLYVLCRTDWAVQVERAKEL  486



>ref|XP_006434640.1| hypothetical protein CICLE_v10000855mg [Citrus clementina]
 gb|ESR47880.1| hypothetical protein CICLE_v10000855mg [Citrus clementina]
Length=523

 Score =   384 bits (986),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 224/472 (47%), Positives = 327/472 (69%), Gaps = 12/472 (3%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + K  +  +V+EEL+++     PM  M ++ +++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  12    SHKLPSFSQVVEELKELWGMALPMTGMNILVFIRAVVSVLFLGRLGSLELAGGALSIGFT  71

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L  A++PI LLW NL+ +M
Sbjct  72    NITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMILILFFATIPISLLWLNLETVM  131

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             +++ QD  I  +A+ +  +A+PDL+ N++L PLR++LR +  T P++W TL+A M H+P+
Sbjct  132   IFMGQDKDITAMAATYTLYALPDLLTNTLLQPLRVFLRSQKVTKPMMWCTLVAVMFHVPL  191

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN----EQNEALYKPLATNLKSST  1031
              + L   LKLG+ G+A+++ V N   L+FL+GY+ + +    + +    +   T    +T
Sbjct  192   NYCLVMKLKLGVPGVAMASVVCNLNMLVFLVGYVWWVSGGDPDHDRGHGRWEMTRWTWTT  251

Query  1030  SIGEEWVI-------LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             + G  +         L++LA+PSCL +CLEWWWYE +TL+AGYL  P +++A   I+IQT
Sbjct  252   TAGIGFGGVCGGIGPLMKLAVPSCLGICLEWWWYEIVTLMAGYLQNPTLSVAATGIMIQT  311

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             TS+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF      +  T + R+ W
Sbjct  312   TSMMYTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFFIGIINVTWTVIFRDRW  371

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
               +FT D  V  L  +VLPIIGLCEL NCPQTT CG+LRG+ARP IGA IN  SFY +G 
Sbjct  372   AGLFTNDDLVKPLVESVLPIIGLCELGNCPQTTGCGILRGTARPVIGARINLGSFYFVGT  431

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
             P+A+ +AF  K+ F GL +GLL+AQ AC +S+L +V+ RTDWE E+ +A  L
Sbjct  432   PVAVGLAFGQKIGFSGLWFGLLSAQAACAVSILYVVLVRTDWEAEAMKAMKL  483



>ref|XP_011033802.1| PREDICTED: MATE efflux family protein LAL5-like [Populus euphratica]
Length=526

 Score =   384 bits (986),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 229/498 (46%), Positives = 324/498 (65%), Gaps = 16/498 (3%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             + Q+ + +   + E R + +   PMI  GL+ Y ++MI ++ +GR G L LAGG+LAIGF
Sbjct  39    ENQQRTHLALAIREARCIANIALPMILTGLLLYSRSMISMLFLGRQGELALAGGSLAIGF  98

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGL++GMEPI  QAFG+K   ++ L LQRTI +L + S+PI LLWFN+K +
Sbjct  99    ANITGYSILSGLSMGMEPICGQAFGAKRYKLLGLALQRTILLLFLVSIPIALLWFNMKKI  158

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L+  Q+  I   A L+  +++PDLVA SILHPLRIYLR +  T PL +   ++ +LH+P
Sbjct  159   LLFCGQEDDISTEAQLYILYSLPDLVAQSILHPLRIYLRSQSITLPLTFCATLSILLHIP  218

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             + + L     LGI+G+A+S    NF  +  L+ Y++ +      +YK     +  S    
Sbjct  219   VNYLLVSVFNLGIKGVALSAVWTNFSLVGSLVIYVMIS-----GVYKKTWGGI--SLECL  271

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             + W  LL LA+PSC++VCLEWWWYE M LL G L+ P  T+A+  I+IQTT+ +Y  PS+
Sbjct  272   KGWRSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPTATVASMGILIQTTAFIYIFPSS  331

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAI----VLAFLASAFGILLTTLGREVWVKIFtt  674
             LS  +S+RVGNELGA  P KA+LA  + +    VL F A  F +++    R++W  +FT 
Sbjct  332   LSFGVSTRVGNELGANNPQKAKLAATVGLSSSFVLGFAALCFAVMV----RKIWASMFTQ  387

Query  673   dtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIM  494
             D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+ +
Sbjct  388   DAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKMGANINLGCFYLVGMPVAVWL  447

Query  493   AFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE-SRETSFEDPMI  317
             +F    +FKGL  GLLAAQ +CV++ML V+ RTDWE ++ RAK+L G  S +    +   
Sbjct  448   SFYAGFDFKGLWLGLLAAQGSCVVTMLFVLARTDWECQAQRAKELTGNVSNDADHNEEDW  507

Query  316   KFKEGEEFRISFEEGVNL  263
             K K+ +    S +   +L
Sbjct  508   KLKDPKNSSSSLDGNESL  525



>gb|KCW46389.1| hypothetical protein EUGRSUZ_K00224, partial [Eucalyptus grandis]
Length=450

 Score =   381 bits (979),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 228/437 (52%), Positives = 305/437 (70%), Gaps = 7/437 (2%)
 Frame = -3

Query  1669  MIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAF  1490
             MI  GL+ Y + MI ++ +GRLG L LAGG+LAIGF NITGYSVLSGLA+GMEPI  QAF
Sbjct  1     MILTGLLLYSRCMISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGLAMGMEPICGQAF  60

Query  1489  GSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPD  1310
             G+K L+++ +TLQRT+ +LL+ S+PI LLW N+K ++L+  QD  I   A  +  +++PD
Sbjct  61    GAKRLSVLGITLQRTVLLLLLTSIPISLLWLNMKSILLFCRQDESISVQAQSYLLYSVPD  120

Query  1309  LVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVAN  1130
             L+A S+LHPLRIYLR +    PL +   I+  LH+PI ++L   L LGI+G+A+S    N
Sbjct  121   LLAQSLLHPLRIYLRSQSINLPLTFCASISIFLHIPINYFLVIHLGLGIKGVALSAVWTN  180

Query  1129  figllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWY  950
             F  +  L+ YI+Y+    +       T    S     EW  LL LA+PSC++VCLEWWWY
Sbjct  181   FNLVASLVIYIIYSGVYRD-------TWGGYSLECFREWRPLLSLAVPSCISVCLEWWWY  233

Query  949   EFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLA  770
             E M LL G L+ P+ T+A+  I+IQTT+ +Y  PS+LS S+S+RVGNELGA RP KARLA
Sbjct  234   EIMILLCGLLLNPRATVASMGILIQTTAFIYIFPSSLSFSVSTRVGNELGANRPAKARLA  293

Query  769   TAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTC  590
              ++ I L+F+     +L     R  W ++FT D E+  LT+TVLPIIGLCEL NCPQTT 
Sbjct  294   ASVGIGLSFVLGCSALLFAVTVRNHWARMFTEDGEIAALTLTVLPIIGLCELGNCPQTTG  353

Query  589   CGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI  410
             CGVLRGSARP IGA IN   FYL+G P+A+ +AF   L+F+GL  GLLAAQ +C+ +ML+
Sbjct  354   CGVLRGSARPKIGANINLGCFYLVGMPVAVGLAFYCHLDFRGLWLGLLAAQASCMATMLV  413

Query  409   VIYRTDWEKESARAKDL  359
             V+ RTDWE ++ RA++L
Sbjct  414   VLRRTDWEHQAMRAQEL  430



>ref|XP_002303561.2| hypothetical protein POPTR_0003s12140g [Populus trichocarpa]
 gb|EEE78540.2| hypothetical protein POPTR_0003s12140g [Populus trichocarpa]
Length=526

 Score =   384 bits (985),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 228/498 (46%), Positives = 320/498 (64%), Gaps = 16/498 (3%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             + Q+ + +   + E R + +   PMI  GL+ Y ++MI ++ +GR G L LAGG+LAIGF
Sbjct  39    ENQQRTHLALAIREARCIANIALPMILTGLLLYSRSMISMLFLGRQGELALAGGSLAIGF  98

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGL++GMEPI  QAFG+K   ++ L LQRTI +L + S+PI LLWFN+K +
Sbjct  99    ANITGYSILSGLSMGMEPICGQAFGAKRYKLLGLALQRTILLLFLVSIPIALLWFNMKKI  158

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L+  Q+  I   A L+  +++PDLVA SILHPLRIYLR +  T PL +   ++ +LH+P
Sbjct  159   LLFCGQEDDISTEAQLYILYSLPDLVAQSILHPLRIYLRSQSITLPLTFCATLSILLHIP  218

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             + + L     LGI+G+A+     NF  +  L+ Y++ +    +         LK      
Sbjct  219   VNYLLVSVFNLGIKGVALGAVWTNFSLVGSLVIYVMISGVSKKTWGGISLECLKG-----  273

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
               W  LL LA+PSC++VCLEWWWYE M LL G L+ P  T+A+  I+IQTT+ +Y  PS+
Sbjct  274   --WRSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPTATVASMGILIQTTAFIYIFPSS  331

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAI----VLAFLASAFGILLTTLGREVWVKIFtt  674
             LS  +S+RVGNELGA  P KA+LA  + +    VL F A  F +++    R++W  +FT 
Sbjct  332   LSFGVSTRVGNELGANNPQKAKLAATVGLSSSFVLGFAALCFAVMV----RKIWASMFTQ  387

Query  673   dtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIM  494
             D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA IN   FYL+G P+A+ +
Sbjct  388   DAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVGMPVAVWL  447

Query  493   AFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE-SRETSFEDPMI  317
             +F    +FKGL  GLLAAQ +CV++ML V+ RTDWE ++ RAK+L G  S +    +   
Sbjct  448   SFYAGFDFKGLWLGLLAAQGSCVVTMLFVLARTDWECQAQRAKELTGNVSNDADHNEEDE  507

Query  316   KFKEGEEFRISFEEGVNL  263
             K K+ +    S +   +L
Sbjct  508   KLKDPKNSSSSLDGNDSL  525



>ref|XP_002274808.1| PREDICTED: MATE efflux family protein 6 [Vitis vinifera]
Length=534

 Score =   384 bits (985),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 314/486 (65%), Gaps = 15/486 (3%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             +NQQ+       TQ H ++   + E   +     PMI  GL+ Y ++MI ++ +GRLG L
Sbjct  41    SNQQQ------YTQTHLSL--AIREANSIAKIALPMILTGLLLYSRSMISMLFLGRLGEL  92

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K   ++ L+LQRT+ +LL  SLP
Sbjct  93    ALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGAKRHALLGLSLQRTVLLLLFTSLP  152

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I  LW N+K ++L+  QD  I   A  +  +++PDL A S+LHPLRIYLR +  T PL +
Sbjct  153   IAFLWLNMKRILLFCGQDEDIAAEAQSYLLYSLPDLFAQSLLHPLRIYLRTQSITLPLTF  212

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                ++  +H+PI + L   L LGI+G+A+S    NF  +  L+ Y+L +      +YK  
Sbjct  213   CATMSIFMHIPINYLLVSHLNLGIKGVALSGVWTNFNLVGSLIIYLLIS-----GVYKKT  267

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
                L      G  W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQ
Sbjct  268   WGGLSMECLRG--WKPLLNLAVPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQ  325

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTSL+Y  PS+LS S+S+RVGNELGA +P KA+ A  I +  +F      +L   + R V
Sbjct  326   TTSLIYIFPSSLSFSVSTRVGNELGANQPNKAKCAAIIGLACSFTLGFSALLFAVMVRNV  385

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G
Sbjct  386   WASMFTQDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPRVGANINLGCFYLVG  445

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETS  335
              P+A+ + F    +F+GL  GLLAAQ +CV++ML+V+ RTDWE E+ RAK L        
Sbjct  446   TPVAVGLGFYAGFDFEGLWLGLLAAQASCVVTMLVVLNRTDWEVEAQRAKQLTSGPLVPD  505

Query  334   FEDPMI  317
              ED ++
Sbjct  506   EEDDLL  511



>ref|XP_004490499.1| PREDICTED: MATE efflux family protein 5-like isoform X2 [Cicer 
arietinum]
Length=515

 Score =   383 bits (983),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 225/463 (49%), Positives = 308/463 (67%), Gaps = 7/463 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             + +EE++++     P    GL+ Y + MI ++ +G LG +ELAGG+L+IGF NITGYSV+
Sbjct  8     QALEEIKEIGKISCPTTITGLLLYSRAMISMIFLGYLGEMELAGGSLSIGFANITGYSVI  67

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEPI  QA+G+K   I+ LTLQRTI +LL  S+PI  +W N++ ++LW  Q+ +
Sbjct  68    SGLAMGMEPICGQAYGAKQWKILGLTLQRTILLLLSTSIPISFIWLNMETILLWSGQNQE  127

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I   A  F  F IPDL   SILHPLRIYLR +G T PL + + I+   H+P+ F L   L
Sbjct  128   ISSKAQTFILFLIPDLFLLSILHPLRIYLRTQGITMPLTYCSAISVFFHVPLNFLLVVHL  187

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
             ++GI G+AI+  + N   +L L  ++ +++   ++   P    +K        W  LL L
Sbjct  188   EMGIGGVAIAMVLTNLNLILLLSSFLYFSSVYKQSWVPPSLECIKG-------WSSLLSL  240

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             A+P+C++VCLEWWWYEFM ++ G LV P+ T+A+  I+IQTTSL+Y  PS+LS  +S+R+
Sbjct  241   AIPTCVSVCLEWWWYEFMIMMCGLLVNPKATIASMGILIQTTSLVYVFPSSLSLGVSTRI  300

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
             GNELGA RP KAR++  +++  A +     ++ TTL R  W K FT D E+LELT  VLP
Sbjct  301   GNELGANRPRKARISMIVSLFCALILGLGAMVFTTLMRHKWGKFFTNDNEILELTSIVLP  360

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             I+GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P+AI + F  K+ F GL  
Sbjct  361   IVGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPIAIFLGFFAKMGFAGLWL  420

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED  326
             GLLAAQ +C   ML+V+ RTDW  +  RAK+L   S  T+  D
Sbjct  421   GLLAAQASCACLMLVVLCRTDWNVQVQRAKELTKTSTITTCHD  463



>ref|XP_007155701.1| hypothetical protein PHAVU_003G223900g [Phaseolus vulgaris]
 gb|ESW27695.1| hypothetical protein PHAVU_003G223900g [Phaseolus vulgaris]
Length=549

 Score =   384 bits (986),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 227/495 (46%), Positives = 314/495 (63%), Gaps = 24/495 (5%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
              T Q E+  AA QT        V +E+  +     PMI  GL+ Y ++MI ++ +G LG 
Sbjct  45    TTPQVEKNSAAMQTH-------VFKEVISIAKIALPMILTGLLLYCRSMISMLFLGHLGE  97

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
             L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QA+G+K  T++ L LQRT+ +LL  SL
Sbjct  98    LALAGGSLAVGFANITGYSILSGLAVGMEPICGQAYGAKKFTLLGLCLQRTVLLLLFTSL  157

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI LLW  +K ++L   QD  I   A  +  ++IPDL+  S LHPLRIYLR +  T PL 
Sbjct  158   PISLLWLYMKHILLLCGQDQDIASQAQSYLLYSIPDLLTQSFLHPLRIYLRSQSITLPLT  217

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
                 ++ +LH+PI + L   L LGI+G+A+S    N   +  L+ Y++++    +     
Sbjct  218   LCATLSILLHVPINYLLVSHLNLGIKGVALSGVWTNLNLVASLILYVVFSGTHKK-----  272

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
               T    S     +W  LL LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+I
Sbjct  273   --TWGGFSVECFTQWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGILI  330

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSL+Y  PS++S S+S+RVGN+LGA +P KARL+  + +  +F+     ++ T + R 
Sbjct  331   QTTSLLYIFPSSISFSVSTRVGNKLGAQKPSKARLSAIVGLSCSFILGGLALVFTIMVRN  390

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
             +W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+
Sbjct  391   IWASMFTQDMEIINLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLV  450

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG-----  353
             G P+A+ + F    +F+GL  GLLAAQ +C ++ML+V+ RTDW+ E+ RAK L       
Sbjct  451   GMPVAVWLGFFAGFDFQGLWVGLLAAQGSCAVTMLVVLSRTDWDAEALRAKKLTSVVVVV  510

Query  352   -----ESRETSFEDP  323
                  +S+E   E P
Sbjct  511   DDDDVDSKEVGAEKP  525



>ref|XP_004238041.1| PREDICTED: MATE efflux family protein 5 [Solanum lycopersicum]
Length=550

 Score =   384 bits (985),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 227/482 (47%), Positives = 312/482 (65%), Gaps = 9/482 (2%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHS--TIPEVMEELRKMIDTCFPMIAMGLISYMKNMIL  1625
               K    N+N+  +     + Q H   T  E  EE++++     P    GL+ Y ++MI 
Sbjct  15    NEKVHFVNSNKPIDVQVDDEEQLHKWPTPSEAFEEMKEIGKIAGPTAITGLVLYSRSMIS  74

Query  1624  VVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRT  1445
             ++ +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ +TLQRT
Sbjct  75    MLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGITLQRT  134

Query  1444  ISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLR  1265
             + +LL  S+PI  +W N+K ++LW  QD  I ++A  F  FAIPDL   S+LHPLRIYLR
Sbjct  135   VLLLLSTSIPISFMWLNMKTILLWCGQDEDISNMAHTFILFAIPDLFFLSLLHPLRIYLR  194

Query  1264  CKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN  1085
              +  T PL + + I+ +LH+P+ F L     LGI G+A++  + N    L L  ++ ++ 
Sbjct  195   TQNITLPLTYCSAISVLLHVPLNFLLVRYCDLGIAGVALAMVLTNLNFFLLLCSFVYFSG  254

Query  1084  EQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQV  905
                ++   P       S      W  LL LA+P+C++VCLEWWWYEFM LL G L  P+ 
Sbjct  255   VYKDSWVAP-------SMDCVRGWSSLLALAIPTCVSVCLEWWWYEFMILLCGLLPNPKA  307

Query  904   TLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFG  725
             T+A+  I+IQTTSL+Y  PS+LS  +S+RVGNELGA RPG+AR++  +++V A       
Sbjct  308   TIASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPGRARVSMIVSLVCAMALGLGA  367

Query  724   ILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGAC  545
             +L  TL R  W  +FT D E+L+LT   LPI+GLCEL NCPQTT CGVLRGSARP IGA 
Sbjct  368   MLFATLMRHKWGGLFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRGSARPTIGAN  427

Query  544   INFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAK  365
             IN  SFYL+G P+AI++ F+ K  F GL  GLLAAQ +C I ML V+ +TDW+ +  R+K
Sbjct  428   INLGSFYLVGMPVAILVGFILKKGFGGLWIGLLAAQASCAILMLYVLCKTDWKVQVERSK  487

Query  364   DL  359
              L
Sbjct  488   QL  489



>ref|XP_007038589.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY23090.1| MATE efflux family protein [Theobroma cacao]
Length=553

 Score =   384 bits (985),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 325/491 (66%), Gaps = 16/491 (3%)
 Frame = -3

Query  1771  NQQEEKMAAKQTQKHS---TIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlg  1601
             NQ+++     Q QK     ++P  ++E   +     PMI  GL+ Y +++I ++ +GRLG
Sbjct  44    NQEQKYPVPIQPQKQDGAPSLPLAVKEAISIAKIALPMILTGLMLYSRSLISMLFLGRLG  103

Query  1600  slelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMAS  1421
              L LAGG+LAIGF NITGYS+LSGLA+GME I  QAFG++  T++ +TLQRT+ +L ++S
Sbjct  104   ELALAGGSLAIGFANITGYSILSGLAMGMESICGQAFGARKYTLLGITLQRTVLLLFVSS  163

Query  1420  LPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPL  1241
             LPI LLW N+K +++   QD  I   A  +  +++PDL+A S+LHPLRIYLR +  T+PL
Sbjct  164   LPISLLWINMKTILILCGQDETIATEAQSYLVYSVPDLLAQSLLHPLRIYLRTQSITFPL  223

Query  1240  LWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYK  1061
                 +++ +LH+PI + L   LKLGI+G+A+S  + NF  +  L+ YILY     +    
Sbjct  224   TCCAILSILLHIPINYLLVSHLKLGIKGVALSGVLTNFNLVGSLIIYILYFGVHKK----  279

Query  1060  PLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                T    S    +EW  L  LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+
Sbjct  280   ---TWGGFSMECFKEWKSLTNLAIPSCISVCLEWWWYEIMILLCGLLLNPEATVASMGIL  336

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTT+L+Y  PS+LS S+S+RVGNELGA +P +A+LA  + +   F+     +L   + R
Sbjct  337   IQTTALIYIFPSSLSFSVSTRVGNELGANQPKRAKLAAFVGLFCGFMLGFSALLFAVMVR  396

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
              +W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL
Sbjct  397   NMWASMFTDDREIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYL  456

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG----  353
             +G P+A+ + F    +FKGL  GLLAAQ +C+++M++V+ RTDW+ E+ RAK+L G    
Sbjct  457   VGMPVAVWLGFFAGFDFKGLWLGLLAAQGSCMLTMMMVLVRTDWDSEAQRAKELTGTVVV  516

Query  352   --ESRETSFED  326
               +S+E   E 
Sbjct  517   VDDSKEVEQEK  527



>ref|XP_006473222.1| PREDICTED: MATE efflux family protein 5-like [Citrus sinensis]
Length=522

 Score =   382 bits (982),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 223/472 (47%), Positives = 324/472 (69%), Gaps = 12/472 (3%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + K  +  +V+EEL+++     PM  M ++ +++ ++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  12    SHKLPSFSQVVEELKELWGMALPMTGMNILVFIRAVVSVLFLGRLGSLELAGGALSIGFT  71

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L  A +PI LLW NL+ +M
Sbjct  72    NITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMILILFFAIIPISLLWLNLETVM  131

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             +++ QD  I  +A+ +  +A+PDL+ N++L PLR++LR +  T P++W TL+A M H+P+
Sbjct  132   IFMGQDKDITAMAATYTLYALPDLLTNTLLQPLRVFLRSQKVTKPMMWCTLVAVMFHVPL  191

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN----EQNEALYKPLATNLKSST  1031
              + L   LKLG+ G+A+++ V N   L+ L+GY+ + +    + +    +   T    +T
Sbjct  192   NYCLVMKLKLGVPGVAMASVVCNLNMLVLLVGYVWWVSGGDPDHDRGHGRWEMTRWTWTT  251

Query  1030  SIGEEWVI-------LLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             + G  +         L++LA+PSCL +CLEWWWYE +TL+AGYL  P + +A   I+IQT
Sbjct  252   TAGIGFGGVCGGIGPLMKLAVPSCLGICLEWWWYEIVTLMAGYLQNPTLAVAATGIMIQT  311

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             TS+MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF      +  T + R+ W
Sbjct  312   TSMMYTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFFIGIINVTWTVIFRDRW  371

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
               +FT D  V  L  +VLPIIGLCEL NCPQTT CG+LRG+ARP IGA IN  SFY +G 
Sbjct  372   AGLFTNDDLVKPLVASVLPIIGLCELGNCPQTTGCGILRGTARPVIGARINLGSFYFVGT  431

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
             P+A+ +AF  K+ F GL +GLL+AQ AC +S+L +V+ RTDWE E+ +A  L
Sbjct  432   PVAVGLAFGQKIGFSGLWFGLLSAQAACAVSILYVVLVRTDWEAEAMKAMKL  483



>ref|XP_002318258.2| hypothetical protein POPTR_0012s13930g, partial [Populus trichocarpa]
 gb|EEE96478.2| hypothetical protein POPTR_0012s13930g, partial [Populus trichocarpa]
Length=445

 Score =   379 bits (974),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 223/437 (51%), Positives = 303/437 (69%), Gaps = 7/437 (2%)
 Frame = -3

Query  1669  MIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAF  1490
             MI  GL+ Y ++MI ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAF
Sbjct  1     MILTGLLLYPRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQAF  60

Query  1489  GSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPD  1310
             G++   ++ LTLQRTI +L++ASLPI  LW N+K ++L+  QD  I   A  F  +++PD
Sbjct  61    GAQKHRLLGLTLQRTILLLIVASLPISFLWLNMKSILLFCGQDESIATEAQSFLVYSLPD  120

Query  1309  LVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVAN  1130
             L+A S LHPLRIYLR +  T PL +   +A +LH+PI ++L   L LG +G+A+S    N
Sbjct  121   LLAQSFLHPLRIYLRTQTITLPLTFCATLAIILHIPINYFLVTHLNLGTKGVALSGVWTN  180

Query  1129  figllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWY  950
             F  +  L+ YIL +    +       T    S    +EW  LL LA+PSC++VCLEWWWY
Sbjct  181   FNLVGSLIIYILVSGVHKK-------TWGGFSMECFKEWKTLLNLAIPSCISVCLEWWWY  233

Query  949   EFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLA  770
             E M LL G L+ P+ T+A+  I+IQTT+L+Y  PS+LS S+S+RVGNELGA +P KA+LA
Sbjct  234   EIMILLCGLLLNPRATVASMGILIQTTALIYIFPSSLSFSVSTRVGNELGANQPMKAKLA  293

Query  769   TAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTC  590
               + + L+F+     +    + R+VW  +FT D E++ LT  VLPIIGLCEL NCPQTT 
Sbjct  294   ANVGLSLSFIFGFSALAFAVMVRKVWASMFTQDKEIIALTSLVLPIIGLCELGNCPQTTG  353

Query  589   CGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLI  410
             CGVLRG+ARP +GA IN   FYL+G P+A+ + F    +F+GL  GLLAAQ +CV++ML+
Sbjct  354   CGVLRGTARPKVGANINLGCFYLVGTPVAVWLGFYAGFDFEGLWLGLLAAQGSCVVTMLL  413

Query  409   VIYRTDWEKESARAKDL  359
             V+ RTDWE E+ RAK+L
Sbjct  414   VLGRTDWESEAKRAKEL  430



>ref|XP_010553670.1| PREDICTED: MATE efflux family protein 5-like [Tarenaya hassleriana]
Length=532

 Score =   382 bits (982),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 234/515 (45%), Positives = 330/515 (64%), Gaps = 24/515 (5%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             H +++ N +       +    +  T  E +EE+++M     P    GL+ Y + MI ++ 
Sbjct  33    HDYSQFNDDD------SLGFNRWPTFLEGVEEVKEMGKISGPTAITGLLMYTRAMISMLF  86

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG L+LAGG+LAIGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ LTLQRTI +
Sbjct  87    LGYLGELDLAGGSLAIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTLQRTILL  146

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LL +S+PI   W N++ ++LW  QD +I  +A  F  FAIPDL   S+LHPLRIYLR + 
Sbjct  147   LLSSSIPISFFWLNVRRILLWCGQDEEISSVAQTFLLFAIPDLFFLSLLHPLRIYLRTQS  206

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T P+ +ST ++ +LH+P+ F L    ++GI G+AI+  + N   ++ L  ++ +T    
Sbjct  207   ITLPVTYSTAVSILLHIPLNFLLVTKFEMGIVGVAIAMVLTNLNLVVLLSSFVYFTGVHR  266

Query  1075  EALYKPLATN-LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
             +  + PL+ + LK        W  LL LA+P+C++VCLEWWWYEFM ++ G L  P+ T+
Sbjct  267   DT-WVPLSVDCLKG-------WSSLLSLAIPTCVSVCLEWWWYEFMIMMCGLLANPKATV  318

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAI----AIVLAFLASA  731
             A+  I+IQTT+L+Y  PS+LS  +S+R+GNELGA RP KAR++  I    A+ L  +A A
Sbjct  319   ASMGILIQTTALVYVFPSSLSLGVSTRIGNELGAKRPRKARISVIISLFCAVGLGIMAMA  378

Query  730   FGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIG  551
             F IL+    R  W ++FTTD E+LELT   LPI GLCEL NCPQTT CGVLRGSARP +G
Sbjct  379   FTILV----RHKWGRLFTTDAEILELTSMALPIAGLCELGNCPQTTGCGVLRGSARPTLG  434

Query  550   ACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESAR  371
             A IN  SFYL+G P+AI++ FV KL F GL  GLLAAQ  C   M   +++TDWE ++ R
Sbjct  435   ANINLGSFYLVGMPVAILLGFVLKLGFPGLWLGLLAAQATCATLMFCALWKTDWEVQAQR  494

Query  370   AKDLVGESRETSFEDPMIKFKEGEEFRISFEEGVN  266
             A++L  +S   +   P +        R+S E   N
Sbjct  495   AEELTSQSHHNNKSPPPL-LPVAATARVSLEADHN  528



>gb|KGN62780.1| hypothetical protein Csa_2G372760 [Cucumis sativus]
Length=588

 Score =   384 bits (986),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 311/469 (66%), Gaps = 9/469 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
              ++++A  Q  +  T+ E +EE++++     P    GL+ Y + MI ++ +G LG LELA
Sbjct  55    SDDQLA--QLHRLPTLSEAVEEMKEIGKISGPTAITGLLLYSRAMISMLFLGYLGELELA  112

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GG+L+IGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ +TLQRT+ +LL +S+PI  
Sbjct  113   GGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVLLLLTSSVPISF  172

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             +W N+K ++LW  QD +I  +A  F  F+IPDL+  S+LHPLRIYLR +  T PL + + 
Sbjct  173   MWLNMKRILLWCGQDEEISTVAQTFILFSIPDLIFLSLLHPLRIYLRTQSITLPLTYCSA  232

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             ++ +LH+P+ F L    K+GI G+AI+    N    LFL+ ++ ++    ++   P    
Sbjct  233   LSVLLHVPLNFLLVVHFKMGISGVAIAMVWFNLNVFLFLVSFVYFSGVYKDSWVSP----  288

Query  1045  LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
                S      W  LL LA+P+C++VCLEWWWYEFM +L G LV P+ T+A+  I+IQTTS
Sbjct  289   ---SVDCLHGWTPLLSLAIPTCVSVCLEWWWYEFMIMLCGLLVNPKATIASMGILIQTTS  345

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             L+Y  PS+LS  +S+RVGNELGA RP KAR++  ++++ A       ++ TTL R  W +
Sbjct  346   LVYVFPSSLSFGVSTRVGNELGANRPAKARISMIVSLICAVALGVAAMVFTTLMRHKWGR  405

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
              FT D E+LELT   LPI+GLCEL NCPQTT CGVLRGSARP  GA IN  SFYL+G P+
Sbjct  406   FFTDDAEILELTAVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLVGFPV  465

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             AI+M FV K+ F GL  GLLAAQ  C + M+ V+  TDW  +  RA  L
Sbjct  466   AILMGFVVKMGFAGLWIGLLAAQGTCALMMIYVLCTTDWMVQVERAMQL  514



>ref|XP_003555370.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=550

 Score =   383 bits (983),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 226/488 (46%), Positives = 315/488 (65%), Gaps = 14/488 (3%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T   EEK   +  Q H     V++EL  +    FPMI  GL+ Y ++MI ++ +GRLG L
Sbjct  45    TTLHEEKNDPRTMQTHH---HVLKELISICKIAFPMILTGLLLYCRSMISMLFLGRLGEL  101

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LA+GF NI+GYS+LSGLA+GME I  QA+G+K  +++ L LQRTI +LL   +P
Sbjct  102   ALAGGSLAVGFANISGYSILSGLAVGMESICGQAYGAKKFSLLGLCLQRTILLLLFTCIP  161

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I LLW  +K ++L   QD  I   A  +  ++IPDL+A S LHPLRIYLR +  T PL  
Sbjct  162   ISLLWLYMKHILLLCGQDEAIATQAQSYLLYSIPDLLAQSFLHPLRIYLRSQSITLPLTL  221

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 + +LH+PI + L   L  GI+G+A+S    N   +  L+ YI+++    +      
Sbjct  222   CATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNLNLVASLILYIVFSGTHKK------  275

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
              T    S     +W  LL LA+PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQ
Sbjct  276   -TWGGFSFECFTQWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLVNPRATVASMGILIQ  334

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TTSL+Y  PS++S S+S+RVGN+LGA +P KA+ ++ + +  +F+   F ++ T L R +
Sbjct  335   TTSLLYIFPSSISFSVSTRVGNKLGAQKPSKAKFSSIVGLSCSFMLGVFALVFTILVRNI  394

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D E++ LT  VLP+IGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G
Sbjct  395   WANMFTQDKEIITLTSFVLPVIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVG  454

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL----VGES  347
              P+A+ + F    +F+GL  GLLAAQ +C ++ML+V+ RTDW+ E+ RAK L    V +S
Sbjct  455   MPVAVWLGFFAGFDFQGLWLGLLAAQGSCAVTMLVVLSRTDWDAEALRAKKLTSVVVDDS  514

Query  346   RETSFEDP  323
             +E   E P
Sbjct  515   KEVGAEKP  522



>gb|KCW68566.1| hypothetical protein EUGRSUZ_F02179 [Eucalyptus grandis]
Length=539

 Score =   382 bits (981),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 227/459 (49%), Positives = 304/459 (66%), Gaps = 7/459 (2%)
 Frame = -3

Query  1735  QKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTN  1556
              +  T  E +EE++ +     P    GL+ Y++ MI ++ +GRLG LEL+GG+LAIGF N
Sbjct  8     HRWPTPSEALEEIKAIGKISGPTAVTGLLLYLRAMISMLFLGRLGELELSGGSLAIGFAN  67

Query  1555  ITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLML  1376
             ITGYSV+SGLA+GMEPI  QA+G++   ++ LTLQRT+ +LL AS+PI  +W N+K ++L
Sbjct  68    ITGYSVISGLAMGMEPICGQAYGARQCKMLGLTLQRTVLLLLSASVPISFMWANMKEILL  127

Query  1375  WLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIV  1196
             W  QD +I   A  F  F++PDL   S+LHPLRIYLR +  T PL + +  + +LH+P+ 
Sbjct  128   WCGQDEEISSTAHTFILFSMPDLFFLSLLHPLRIYLRTQNITLPLTYCSAASVLLHVPLN  187

Query  1195  FYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEE  1016
             F L    K+GI G+AI+    N    + L  YI ++     +   P A  L+        
Sbjct  188   FLLVVHFKMGIAGVAIAMVWTNLNLFVLLSAYIYFSRVYEGSWVAPSADCLRG-------  240

Query  1015  WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALS  836
             W  LL LA+P+C++VCLEWWWYE M +L G L  P+ T+A+  I+IQTTSL+Y  PS+LS
Sbjct  241   WSSLLALAVPTCVSVCLEWWWYELMIVLCGLLASPRATVASMGILIQTTSLVYVFPSSLS  300

Query  835   NSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevle  656
               +S+RVGNELGA RP +AR++  IA+V A       +L TTL R  W ++FT + E+LE
Sbjct  301   LGVSTRVGNELGARRPARARISAIIALVCAVGLGLGAMLFTTLVRHQWGRLFTENAEILE  360

Query  655   ltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKL  476
             LT   LPI GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P+AI+M FV K+
Sbjct  361   LTAAALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLIGMPVAIVMGFVAKV  420

Query  475   EFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              F GL  GLLAAQ +C + ML V+ RTDW  +  RAK+L
Sbjct  421   GFAGLWLGLLAAQASCALLMLYVLCRTDWAVQVERAKEL  459



>ref|XP_006421854.1| hypothetical protein CICLE_v10007191mg [Citrus clementina]
 ref|XP_006490328.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Citrus 
sinensis]
 gb|ESR35094.1| hypothetical protein CICLE_v10007191mg [Citrus clementina]
 gb|KDO60095.1| hypothetical protein CISIN_1g048788mg [Citrus sinensis]
Length=525

 Score =   382 bits (980),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 226/483 (47%), Positives = 319/483 (66%), Gaps = 12/483 (2%)
 Frame = -3

Query  1672  PMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQA  1493
             PMI  GL+ Y ++MI V+ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QA
Sbjct  47    PMILTGLLLYSRSMISVLFLGRLGELALAGGSLAVGFANITGYSILSGLAMGMEPICGQA  106

Query  1492  FGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIP  1313
             FG++   ++ L LQ+TI +L+  S+PI LLW N+K ++L+  Q+  I  +A  +  +++P
Sbjct  107   FGAQRHNLLGLALQKTILLLMFTSIPISLLWLNMKNILLFCGQNEDIATVAQSYLFYSLP  166

Query  1312  DLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVA  1133
             DL+A S+LHPLRIYLR +  T PL +   ++ +LH+PI ++L   L LGI+G+A+S    
Sbjct  167   DLLAQSLLHPLRIYLRSQAITLPLTFCATLSILLHIPINYFLVTQLNLGIKGVALSGVWT  226

Query  1132  NfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWW  953
             NF  +  L+ YI+ +      +Y+        S    +E   LL LA+PSC++VCLEWWW
Sbjct  227   NFNLVASLIIYIIISK-----VYQKTWGGF--SMDCFKECKTLLNLAIPSCISVCLEWWW  279

Query  952   YEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARL  773
             YE M LL GYL+ P+ T+A+  I+IQTTSL+Y  PS+LS S+S+RVGNELGA +P KA+L
Sbjct  280   YEIMILLCGYLLNPRATIASMGILIQTTSLIYIFPSSLSFSVSTRVGNELGANQPKKAKL  339

Query  772   ATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTT  593
             A  + +  +F+     +      R++W  +FT D E++ LT  VLPIIGLCEL NCPQTT
Sbjct  340   AAIVGLSCSFMLGFSALFFAASVRKIWASMFTQDKEIIALTSIVLPIIGLCELGNCPQTT  399

Query  592   CCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISML  413
              CGVLRG+ARP +GA IN   FY++G P+A+ +AF    +F+GL  GLLAAQ +CV++ML
Sbjct  400   GCGVLRGTARPKVGANINLGCFYIVGFPVAVWLAFYMGFDFEGLWLGLLAAQGSCVVTML  459

Query  412   IVIYRTDWEKESARAKDLVGE----SRETSFEDPMIKFK-EGEEFRISFEEGVNLQK*YS  248
             +V+ +TDWE E+ RAK+L G+          E   +  K E +E  +   +G N     S
Sbjct  460   VVLGKTDWEFEAQRAKELTGDGVVVDDSKDVEQQKLPSKAEIKEDSLYLLDGNNFDNKSS  519

Query  247   HQK  239
             H  
Sbjct  520   HHD  522



>ref|XP_009619046.1| PREDICTED: MATE efflux family protein LAL5-like [Nicotiana tomentosiformis]
Length=531

 Score =   382 bits (981),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 222/475 (47%), Positives = 312/475 (66%), Gaps = 19/475 (4%)
 Frame = -3

Query  1783  RANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrl  1604
             + N  Q  EK+ A Q         +++E R++    FP+    LI Y ++++ ++ +G L
Sbjct  42    QENPKQMHEKITASQ---------IIQESREVFKLAFPIALTALILYSRSILSMLFLGHL  92

Query  1603  gslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMA  1424
             G  ELA G+LAI F NITGYSVLSGLALGMEP+ SQAFG++   ++SLTLQR++  LL  
Sbjct  93    GDTELAAGSLAIAFANITGYSVLSGLALGMEPLCSQAFGAQRPKLLSLTLQRSVVFLLCC  152

Query  1423  SLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWP  1244
              LPI  LW N+  ++L+LHQD  I  +A  +  F++PDL+ NS  HP+RIYLR +G T+P
Sbjct  153   CLPITFLWLNISHILLYLHQDPNITRLAHTYLVFSLPDLITNSFFHPIRIYLRAQGITYP  212

Query  1243  LLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY  1064
             L  ++L  T+LHLP+ + L  SL+LG+ G+AI++  +N   L+ L  Y+++         
Sbjct  213   LTLASLAGTVLHLPLNYLLVSSLQLGVAGVAIASATSNMAALVALCFYVIHD--------  264

Query  1063  KPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
             KP  T  K S      W+ L+RLA PSC++VCLEWWWYE M LL G LV P+ T+A+  I
Sbjct  265   KPTWT--KPSLECLTGWMPLVRLAAPSCVSVCLEWWWYEIMILLCGLLVDPKATVASMGI  322

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTS +Y  PS+LS ++S+RVGNELGA RP KAR++  ++I+LA L     ++  T  
Sbjct  323   LIQTTSFLYVFPSSLSFAVSTRVGNELGANRPDKARVSATVSILLAGLMGLSAMVFATTM  382

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             R +W K+FT D  ++E+T  +LPI+GLCEL NCPQT  CGV+RG+ARP   A +N  +FY
Sbjct  383   RNIWAKMFTYDARIIEMTSVILPILGLCELGNCPQTVGCGVVRGTARPTTAANVNLGAFY  442

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             L+G P+AI + F   L F GL  GLLAAQV C   ML V+  T+W+ ++ RA+ L
Sbjct  443   LVGMPVAIGLGFWLGLGFVGLWVGLLAAQVCCAGLMLYVVGTTNWDCQAMRAQVL  497



>ref|XP_011038168.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
 ref|XP_011038169.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
 ref|XP_011038170.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
 ref|XP_011038171.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
 ref|XP_011038172.1| PREDICTED: MATE efflux family protein 5 [Populus euphratica]
Length=502

 Score =   381 bits (978),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 219/490 (45%), Positives = 324/490 (66%), Gaps = 17/490 (3%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             EEK     + K  +  +V+EEL+++     P+ A  L+++ + ++ V+ +GRLGSLELAG
Sbjct  2     EEKELDFYSHKLPSASQVVEELKELWGMALPITAAHLMAFFRAVVSVMFLGRLGSLELAG  61

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             GAL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L +A +PI LL
Sbjct  62    GALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMILILGIAIIPISLL  121

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W NL+ +M ++ QD  I  +A+ +C +++PDL+ N++L PLR++LR +G T P+++ +L+
Sbjct  122   WLNLESIMNFMGQDPNITAMAATYCIYSLPDLLTNTLLQPLRVFLRSQGVTKPMMYCSLL  181

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             A + H+P+ + L   +  G+ G+A+++ V N   +  ++ Y+ + + Q E  ++     +
Sbjct  182   AVIFHVPLNYVLVVVMGWGVPGVALASAVTNMNMVALMVAYVWWVSGQWEMKWRVEIGGV  241

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
                         LL+LA+PSCL +CLEWWWYE +TLLAGYL  P + +A   I+IQTTS+
Sbjct  242   CGGVGP------LLKLAVPSCLGICLEWWWYEIVTLLAGYLPNPTLAVAATGILIQTTSM  295

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             MYT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T   R+ W  +
Sbjct  296   MYTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGILNVTWTVFLRQRWAGL  355

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             F  D  V  L   VLPIIGLCEL NCPQTT CG+LR +ARP +GA IN  SFY +G P+A
Sbjct  356   FIKDVRVKGLVAAVLPIIGLCELGNCPQTTGCGILRATARPAVGAGINLGSFYFVGTPVA  415

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL----------V  356
             + +AF   + F GL  GLL+AQ AC +S+L +V+ RTDWE E+ +AK+L          V
Sbjct  416   VGLAFGLDVGFSGLWLGLLSAQAACALSILYVVLIRTDWEHEALKAKELTSMEMSACNGV  475

Query  355   GESRETSFED  326
             G  +   +E+
Sbjct  476   GRKQHEEYEE  485



>ref|XP_007210853.1| hypothetical protein PRUPE_ppa015493mg, partial [Prunus persica]
 gb|EMJ12052.1| hypothetical protein PRUPE_ppa015493mg, partial [Prunus persica]
Length=485

 Score =   380 bits (976),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 304/450 (68%), Gaps = 7/450 (2%)
 Frame = -3

Query  1702  ELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLA  1523
             E + + +  FPM+  GL+ Y + MI ++ +GRLG L LAGG+LAIGF NITGYSVLSGLA
Sbjct  10    EAKCIANIAFPMVLTGLLLYSRTMISMLFLGRLGELALAGGSLAIGFANITGYSVLSGLA  69

Query  1522  LGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHI  1343
             +GMEPI  QA+G+K   ++ LTLQRT+ +LL+ S+PI LLWFN+K ++L   Q   I   
Sbjct  70    MGMEPICGQAYGAKRFKLLGLTLQRTVILLLLTSIPIALLWFNMKRILLSCGQQDDIATQ  129

Query  1342  ASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGI  1163
             A  +  +++PDL+A S+LHPLRIYLR +  T PL +   +A +LH+PI + L   L LGI
Sbjct  130   AKSYIFYSLPDLIAQSLLHPLRIYLRSQSITVPLTFCATLAILLHIPINYLLVCVLNLGI  189

Query  1162  QGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPS  983
             +G+A+S   +N   +  L+ YI  +      +YK            G  W  L+ LA+PS
Sbjct  190   KGVALSGVWSNVNLVGSLIFYIAIS-----GVYKKTWGGFSKECFKG--WKSLMNLAIPS  242

Query  982   CLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNEL  803
             C++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT L+Y  PS+LS  +S+RVGNEL
Sbjct  243   CISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTGLIYIFPSSLSFGVSTRVGNEL  302

Query  802   GAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGL  623
             GA RP +A+LAT + +  +F+     +L     R +W  ++T D+E++ LT  VLPIIGL
Sbjct  303   GANRPERAKLATIVGLSYSFILGFSALLFAVTVRNIWASMYTQDSEIITLTSMVLPIIGL  362

Query  622   CELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLA  443
             CEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+ + F    +F+GL  GLLA
Sbjct  363   CELGNCPQTTGCGVLRGAARPKLGANINLGCFYLVGMPVAVWLGFFAGFDFRGLWLGLLA  422

Query  442   AQVACVISMLIVIYRTDWEKESARAKDLVG  353
             AQ +CV++ML V+ RT+WE ++ RAK+L G
Sbjct  423   AQGSCVVTMLFVLARTNWELQAQRAKELTG  452



>ref|XP_004292491.1| PREDICTED: MATE efflux family protein 9-like [Fragaria vesca 
subsp. vesca]
Length=500

 Score =   380 bits (977),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 212/466 (45%), Positives = 319/466 (68%), Gaps = 13/466 (3%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + K     +V+EELR++    FP+ AM  + +++  + VV +GRLGS+ELAGGAL+IGFT
Sbjct  12    SHKFPCASQVLEELRELWGMAFPITAMNCLVFVRAAVSVVFLGRLGSMELAGGALSIGFT  71

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSV+ GLA G+EP+ SQA+G+KN  +++ +LQR + +L++A++PI +LW NL+ +M
Sbjct  72    NITGYSVMVGLASGLEPVCSQAYGNKNWDLLTRSLQRMVLILVLATIPIAVLWLNLERIM  131

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             ++  QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P ++ TL+A   H+P+
Sbjct  132   VFAGQDRAITAMAATYCLYSLPDLLTNTLLQPLRVFLRSQKVTKPQMYCTLVAVAFHVPL  191

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
                L   + LG+ G+A+++ + N   ++ +              +    T L+ +  IGE
Sbjct  192   NLVLVKQMGLGVPGVAVASVLTNLNMVVLMA---------GYVWWGKGMTVLRWTAGIGE  242

Query  1018  EWV---ILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
              +     LL+LA+PSCL +CLEWWWYE +T++AGYL  P + +A   I+IQTTS+MYT+P
Sbjct  243   VFGGLGPLLKLAVPSCLGICLEWWWYEIVTIMAGYLPNPTLAVAATGILIQTTSMMYTVP  302

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdt  668
              AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T + RE W  +FT D 
Sbjct  303   MALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGVINVTWTVILRERWAGLFTKDE  362

Query  667   evleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAF  488
              V  L  +V+PI+GLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+ +AF
Sbjct  363   LVKVLVASVMPIMGLCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAVGLAF  422

Query  487   VWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVG  353
               K+ F GL +GLL+AQVAC +S+L +V+ +TDWE E+ +AK L G
Sbjct  423   WLKIGFAGLWFGLLSAQVACAVSILYVVLVKTDWEAEALKAKMLTG  468



>ref|XP_003592313.1| Multidrug and toxin extrusion protein [Medicago truncatula]
 gb|AES62564.1| MATE efflux family protein [Medicago truncatula]
Length=540

 Score =   382 bits (980),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 226/500 (45%), Positives = 325/500 (65%), Gaps = 12/500 (2%)
 Frame = -3

Query  1783  RANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrl  1604
             + + N +      ++T   +T  EV+     +    FPMI  GL+ Y ++MI ++ +G L
Sbjct  42    QKDINIENPTTQFQKTHLRATFKEVIS----ISKIAFPMIFTGLLLYCRSMISMLFLGHL  97

Query  1603  gslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMA  1424
             G L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQ+TI +LL+ 
Sbjct  98    GELALAGGSLAVGFANITGYSILSGLAVGMEPICGQAFGAKRFTLLGLCLQKTILLLLLT  157

Query  1423  SLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWP  1244
             S+PI LLW   K ++L   Q+  I   A ++  ++IPDL+A S LHPLRIYLR +  T P
Sbjct  158   SIPISLLWLYTKHILLLCGQEEDIATQAQIYLLYSIPDLLAQSFLHPLRIYLRSQSITLP  217

Query  1243  LLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY  1064
             L     +A  LH+PI ++L   L +GI+G+A+S    NF  +  L+ YI+++    +   
Sbjct  218   LTLCATLAIFLHIPINYFLVSHLNMGIKGVALSGVWTNFNLVASLILYIVFSGTHKK---  274

Query  1063  KPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
                 T    S+   ++W  LL LA+PSCL+VCLEWWWYE M LL G L+ P+ T+A+  I
Sbjct  275   ----TWGGFSSQCFKQWKSLLNLAVPSCLSVCLEWWWYEIMILLCGLLINPRATVASMGI  330

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTSL+Y  PS++S S+S+RVGN+LGA +P KA+L+  + +  +F+   F ++   + 
Sbjct  331   LIQTTSLLYIFPSSISFSVSTRVGNKLGAQKPSKAKLSAIVGLTCSFILGVFALVFAVMV  390

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             R +W  +FT D E++++T  VLP+IGLCEL NCPQTT CGVLRG+ARP +GA INF  FY
Sbjct  391   RNIWASMFTEDKEIIKITSLVLPLIGLCELGNCPQTTGCGVLRGTARPKVGANINFGCFY  450

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESR  344
             ++G P+AI +AF    +F+GL  GLL AQ  C ++ML+V+ +TDW+ E+ RAK L G   
Sbjct  451   IVGMPVAIWLAFYVGFDFQGLWIGLLVAQGTCAVTMLVVLSQTDWDCEALRAKKLTGIGE  510

Query  343   ETSFEDPMI-KFKEGEEFRI  287
              T   D  I   KE +E ++
Sbjct  511   ATKTSDVFIDDSKEVDEEKL  530



>ref|XP_010536256.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Tarenaya 
hassleriana]
Length=506

 Score =   380 bits (976),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 326/500 (65%), Gaps = 18/500 (4%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             HK++    + + E     QT+   +I +++ E   +    FP I   LI Y+++ I ++ 
Sbjct  9     HKNSSTGPDPESEP---DQTRIFPSISQIISEGESLFSIAFPTILAALILYVRSAISMIF  65

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG LELAGG+LAI F NITGYSVLSGLALGM+P+ SQAFG++   ++SLTLQRT+  
Sbjct  66    LGHLGELELAGGSLAIAFANITGYSVLSGLALGMDPLCSQAFGAEKPKLLSLTLQRTVLF  125

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LL  S+ I +LW NL+ +M++LHQD  I  +A ++   +IPDLV NS+LHPLRIYLR +G
Sbjct  126   LLACSVGILVLWLNLEKIMIFLHQDPTISSLAQVYVLCSIPDLVTNSVLHPLRIYLRAQG  185

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T PL  +TL  T+ H+PI F+L   L++G+ G+A++   +NF  L+FL+ YI +T    
Sbjct  186   ITHPLTLATLAGTIFHIPINFFLVSYLQMGLVGVAMAASASNFFVLMFLVFYIWFT----  241

Query  1075  EALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
               L++   TN   S+   ++W  L+ LA PSC++VCLEWWWYE MT+L G L  P+  +A
Sbjct  242   -GLHRATWTN--PSSECFKDWGPLIHLAAPSCVSVCLEWWWYEIMTVLCGLLANPKAPIA  298

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
                I+IQTTSL+Y  PS+L  +IS+RVGNELG+ RP  ARLA  +A+  A L        
Sbjct  299   AMGILIQTTSLLYIFPSSLGFAISTRVGNELGSNRPHNARLAATVAVAFAGLMGLTAFAF  358

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
                   +W K+FT D E++ LT  VLPI+GLCE+ NCPQT  CGVLRGSARP+  A IN 
Sbjct  359   AWGVSNIWGKMFTRDIEIINLTALVLPILGLCEIGNCPQTVGCGVLRGSARPSTAANINL  418

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAK---  365
              +FYL+G P+A+ +AF   + F GL  GLLAAQ++C + ML ++  TDWE E+ RAK   
Sbjct  419   GAFYLVGMPVAVGLAFRTGIGFCGLWLGLLAAQISCAVMMLYIVGSTDWEGEAKRAKVLT  478

Query  364   ----DLVGESRET-SFEDPM  320
                 D+V  ++++    DP+
Sbjct  479   CTGVDVVITAQDSDDLTDPL  498



>ref|XP_010086543.1| MATE efflux family protein LAL5 [Morus notabilis]
 gb|EXB19760.1| MATE efflux family protein LAL5 [Morus notabilis]
Length=547

 Score =   382 bits (980),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 314/464 (68%), Gaps = 8/464 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             QTQ ++ +  V++E + +     PM+  GL+ Y +++I ++ +GRLG L LAGG+LAI F
Sbjct  46    QTQTNN-VSLVLKEAKCIAKVSLPMVLTGLLLYSRSLISMLFLGRLGELPLAGGSLAIAF  104

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGLA+GMEPI  QAFG+K   ++SL +QRTI +LL+ S+PI +LW N+K +
Sbjct  105   ANITGYSLLSGLAIGMEPICGQAFGAKRFKLLSLAMQRTILLLLLTSIPISILWLNMKKI  164

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L+  Q   I   A  +  F+IPDL+A S+LHPLRIYLR +  T PL +    A +LH+P
Sbjct  165   LLFCGQQENIAANAQSYILFSIPDLIAQSLLHPLRIYLRTQSVTLPLTFCAAFAILLHIP  224

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             I F L   L LGI+G+A+S    N   +  L+ Y++ +      +YK   T    S+   
Sbjct  225   INFLLVSFLDLGIKGVALSGVWTNANFVGSLIVYVVVS-----GVYK--KTWCGVSSECF  277

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
             +EW  LL LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT+LMY  PS+
Sbjct  278   KEWKSLLNLAIPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTALMYIFPSS  337

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA  P +ARLA  + ++ +F+     +    + R+VW  +FT D E+
Sbjct  338   LSFGVSTRVGNELGANNPWRARLAAKVGLLCSFVLGFSALFFAVVVRKVWASMFTKDGEI  397

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             + LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+AI ++F  
Sbjct  398   IALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPCLGANINLGCFYLVGMPVAIWLSFYA  457

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
               +FKGL  GLLAAQ +CV++ML  + RT+WE E+ RAK+L G 
Sbjct  458   GFDFKGLWLGLLAAQGSCVLTMLFCLGRTNWEVEAQRAKELTGN  501



>ref|XP_006364986.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=551

 Score =   382 bits (980),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 229/491 (47%), Positives = 315/491 (64%), Gaps = 10/491 (2%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQ--KHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMIL  1625
               K    N+N+  +    ++ Q  K  T  E  EE++++     P    GL+ Y ++MI 
Sbjct  15    NEKVHFVNSNKPIDVQVDEEEQLRKWPTPSEAFEEMKEIGKIAGPTALTGLVLYSRSMIS  74

Query  1624  VVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRT  1445
             ++ +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ +TLQRT
Sbjct  75    MLFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGITLQRT  134

Query  1444  ISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLR  1265
             + +LL  S+PI  +W N+K ++LW  QD  I ++A  F  FAIPDL   S+LHPLRIYLR
Sbjct  135   VLLLLSTSIPISFMWLNMKRILLWCGQDEDISNMAHTFIVFAIPDLFFLSLLHPLRIYLR  194

Query  1264  CKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTN  1085
              +  T PL + + I+ +LH+P+ F L     LGI G+A++  + N    L L  ++ ++ 
Sbjct  195   TQNITLPLTYCSAISVLLHVPLNFLLVRYCDLGIAGVALAMVLTNLNFFLLLCSFVYFSG  254

Query  1084  EQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQV  905
                ++   P       S      W  LL LA+P+C++VCLEWWWYEFM LL G L  P+ 
Sbjct  255   VYKDSWVAP-------SMDCVRGWSSLLALAIPTCVSVCLEWWWYEFMILLCGLLANPKA  307

Query  904   TLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFG  725
             T+A+  I+IQTTSL+Y  PS+LS  +S+RVGNELGA RPG+AR++  +++  A       
Sbjct  308   TIASMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPGRARISMIVSLFCAMALGLGA  367

Query  724   ILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGAC  545
             +L TTL R  W   FT D E+L+LT   LPI+GLCEL NCPQTT CGVLRGSARP IGA 
Sbjct  368   MLFTTLMRHKWGGFFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRGSARPTIGAN  427

Query  544   INFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAK  365
             IN  SFY +G P+AI++ F+ K  F GL  GLLAAQ +C I ML V+ +TDW+ +  R+K
Sbjct  428   INLGSFYFVGMPVAILVGFLLKKGFGGLWIGLLAAQASCAILMLYVLCKTDWKVQVERSK  487

Query  364   DLVGESRETSF  332
              L  +S  TS 
Sbjct  488   QLT-QSTSTSL  497



>ref|XP_006842445.1| hypothetical protein AMTR_s00077p00047440 [Amborella trichopoda]
 gb|ERN04120.1| hypothetical protein AMTR_s00077p00047440 [Amborella trichopoda]
Length=505

 Score =   380 bits (976),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 225/479 (47%), Positives = 320/479 (67%), Gaps = 10/479 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIP---EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrl  1604
             T +++ +   ++T+  +  P   EV+EELR +     PM+   L+ Y +++I ++ +G L
Sbjct  21    TTKEKGREYREKTEDAAAWPSPREVVEELRSLGGIAGPMVMTSLLLYSRSVISMLFLGHL  80

Query  1603  gslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMA  1424
             G  ELAG +L++GF NITGYSV+SGLALGMEPI  QA+G+K  +++SL LQRT  +LL+A
Sbjct  81    GETELAGASLSMGFANITGYSVISGLALGMEPICGQAYGAKRCSLLSLALQRTFLLLLIA  140

Query  1423  SLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWP  1244
             ++PI +LW N++P++LWL QD  I  IAS F  F++PDL+A + L PLRI+LR +    P
Sbjct  141   TIPISILWLNMEPILLWLGQDHTITGIASTFIAFSLPDLLAQAFLQPLRIFLRTQNLIKP  200

Query  1243  LLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALY  1064
             L+     A +LH+P  ++L   LKLGI+G+A++    +F  + +LL Y+ +T    ++  
Sbjct  201   LIHGATFALILHIPTNYFLVIYLKLGIRGVALAASSGSFNMVFYLLAYLAFT----KSAL  256

Query  1063  KPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
             KP   NL      G  W  LL L+LPS  +VCLEWWWYE M +L G L  P+ ++A+  I
Sbjct  257   KPW-ENLTRECLQG--WKPLLYLSLPSAASVCLEWWWYELMIILCGLLSNPRASVASMGI  313

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTT+L+Y  PS++S ++S+RVG+ELGA +P KAR AT +A+V   +     +L T   
Sbjct  314   LIQTTALIYVFPSSISLAVSTRVGHELGANQPDKARRATVVAMVSGAMMGFLALLFTLSM  373

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
                W K+FT D E+L LT   LPI+GLCEL NCPQTT CGVLRGSARP+IGA IN  SFY
Sbjct  374   SHFWAKMFTNDAEILLLTSITLPIVGLCELGNCPQTTGCGVLRGSARPSIGANINLGSFY  433

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             L+G P++I+M F +KL F GL  GL AAQ +CV  ML  ++ TDW+ ++ RAK L+ E 
Sbjct  434   LIGMPVSILMGFGFKLGFVGLWLGLAAAQGSCVALMLYTVFNTDWKCQAKRAKLLIAED  492



>ref|XP_009339656.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=509

 Score =   380 bits (975),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 311/472 (66%), Gaps = 8/472 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +  K+       H T +   + E + + +  FPM+  GL+ Y ++MI ++ +GRLG L L
Sbjct  10    ESPKLEQYNQNHHKTHLSLALIEAKCIANIAFPMVLTGLLLYSRSMISMLFLGRLGELSL  69

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYSVLSGLA+GMEPI  QA+G+K   ++  TLQRT+ +L + S+PI 
Sbjct  70    AGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGQTLQRTVILLFLTSIPIA  129

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LW N+K ++L   Q  +I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +  
Sbjct  130   FLWLNMKRILLSCGQQDEIATEAYSYILYSLPDLIAQSLLHPLRIYLRTQSITVPLTFCA  189

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
              +A +LH+P+ + L   L LGI+G+A+S    N   +  L+ YI  +      +YK    
Sbjct  190   ALAILLHIPVNYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAIS-----GVYKKTWG  244

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                     G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  245   GFSKECFKG--WKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  302

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +ARLAT + +  +F+     +L     R +W 
Sbjct  303   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  362

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT ++E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  363   SMFTQESEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  422

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             +A+ ++F    +F+GL  GLLAAQ +CV++MLIV++RT+W+ +  RAK+L G
Sbjct  423   VAVWLSFYAGFDFRGLWLGLLAAQGSCVLTMLIVLFRTNWDLQGQRAKELTG  474



>ref|XP_009364191.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=509

 Score =   380 bits (975),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 311/472 (66%), Gaps = 8/472 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +  K+       H T +   + E + + +  FPM+  GL+ Y ++MI ++ +GRLG L L
Sbjct  10    ESPKLEQYNQNHHKTHLSLALIEAKCIANIAFPMVLTGLLLYSRSMISMLFLGRLGELSL  69

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYSVLSGLA+GMEPI  QA+G+K   ++  TLQRT+ +L + S+PI 
Sbjct  70    AGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGQTLQRTVILLFLTSIPIA  129

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LW N+K ++L   Q  +I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +  
Sbjct  130   FLWLNMKRILLSCGQQDEIATEAYSYILYSLPDLIAQSLLHPLRIYLRTQSITVPLTFCA  189

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
              +A +LH+P+ + L   L LGI+G+A+S    N   +  L+ YI  +      +YK    
Sbjct  190   ALAILLHIPVNYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAIS-----GVYKKTWG  244

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                     G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  245   GFSKECFKG--WKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  302

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +ARLAT + +  +F+     +L     R +W 
Sbjct  303   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  362

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT ++E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  363   SMFTQESEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  422

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             +A+ ++F    +F+GL  GLLAAQ +CV++MLIV++RT+W+ +  RAK+L G
Sbjct  423   VAVWLSFYAGFDFRGLWLGLLAAQGSCVLTMLIVLFRTNWDLQGQRAKELTG  474



>ref|XP_009371284.1| PREDICTED: MATE efflux family protein LAL5-like [Pyrus x bretschneideri]
Length=556

 Score =   381 bits (979),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 224/472 (47%), Positives = 315/472 (67%), Gaps = 9/472 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKH--STIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
              Q E++   Q   H  S     ++E   +    FPMI  GL+ Y +++I ++ +GRLG L
Sbjct  42    SQPEQVPKLQFNPHKESHFSLALKEANSIAVIAFPMILTGLLLYSRSIISMLFLGRLGEL  101

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LA+GF NITGYS++SGLA+GMEPI  QAFG++  T++ L+LQRT+ +LL  SLP
Sbjct  102   ALAGGSLAVGFANITGYSIISGLAMGMEPICGQAFGARKHTLLGLSLQRTVLLLLFTSLP  161

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I LLW N+K ++L   QD  I   A L+   ++PDL+A S LHPLRIYLR +  T PL  
Sbjct  162   ISLLWLNMKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRIYLRSQSITLPLSL  221

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                +A +LH+PI ++L   L LGI+G+A+S   +NF  +  L+ YI+ +      +YK  
Sbjct  222   CATLAIILHIPINYFLVSHLDLGIKGVALSGVWSNFNLVASLIVYIIVS-----GVYKKT  276

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
                +  S     EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  ++IQ
Sbjct  277   WGGI--SMECFREWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVASMGVLIQ  334

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TT+L+Y  PS+LS S+S+RVGNE+GA  P KA+LA  + +  +F+     ++  T+ R +
Sbjct  335   TTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFVLGLSALVFATMVRNI  394

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G
Sbjct  395   WASMFTQDKEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVG  454

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              P+A+ + F    +F+GL  GLLAA+ +C ++ML+V+ RTDWE E+ +AK+L
Sbjct  455   MPVAVGLGFFLGFDFQGLWLGLLAAEGSCALTMLVVLGRTDWELEARKAKEL  506



>gb|AES73927.2| MATE efflux family protein [Medicago truncatula]
Length=553

 Score =   381 bits (978),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 224/484 (46%), Positives = 307/484 (63%), Gaps = 7/484 (1%)
 Frame = -3

Query  1777  NTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgs  1598
             N    +E     + Q+  T  EV+EEL+ +     P    GL+ Y + MI ++ +G LG 
Sbjct  27    NDPPHDEVQDQNELQRWPTPNEVIEELKAIGKISGPTAITGLLLYSRAMISMLFLGYLGE  86

Query  1597  lelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASL  1418
              ELAGG+L+IGF NITGYSVLSGLA+GMEPI  QA+G+K   I+ LTLQRT+ +LL  S+
Sbjct  87    TELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKILGLTLQRTVLLLLSTSI  146

Query  1417  PIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLL  1238
             PI  LW N+K +++   QD +I   A  F  F++PDL   S LHPLRIYLR +  T PL 
Sbjct  147   PIAYLWLNMKKILMSCGQDEEISSTAQTFILFSLPDLFFLSFLHPLRIYLRTQNITLPLT  206

Query  1237  WSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKP  1058
             + + I+  LH+P+ F L    K+G+ G+AI+    N   L+FL  ++ ++    ++   P
Sbjct  207   YCSAISVTLHVPLNFLLVIHFKMGVAGVAIAMIWFNLNLLIFLSSFVFFSRVYKDSWVFP  266

Query  1057  LATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVI  878
                 LK        W  LL L++PSC++VCLEWWWYE M +L G LV P+ T+++  I+I
Sbjct  267   SIDCLKG-------WSSLLALSIPSCVSVCLEWWWYELMIILCGLLVNPKSTISSMGILI  319

Query  877   QTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGRE  698
             QTTSL+Y  PS+LS  +S+RVGN LGA  P KAR +  +++   F      ++ TTL R 
Sbjct  320   QTTSLVYVFPSSLSFGVSTRVGNLLGANSPSKARFSMIVSMFCGFGLGILAMVFTTLMRN  379

Query  697   VWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLM  518
              W ++FT+D E++ LT   LPI+GLCE+ NCPQTT CGVLRGSARP +GA IN  SFYL+
Sbjct  380   QWGRLFTSDDEIINLTAMALPIVGLCEIGNCPQTTGCGVLRGSARPTVGANINLGSFYLV  439

Query  517   GAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRET  338
             G P+AI++ FV K+ F GL +GLLAAQ +C I ML V+  TDW  +  RAK+L   +   
Sbjct  440   GMPVAIVLGFVVKMGFVGLWFGLLAAQGSCAILMLYVLCTTDWNDQIERAKNLTKATTTI  499

Query  337   SFED  326
              F D
Sbjct  500   GFSD  503



>ref|XP_011041639.1| PREDICTED: MATE efflux family protein LAL5-like [Populus euphratica]
Length=549

 Score =   381 bits (978),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 229/497 (46%), Positives = 320/497 (64%), Gaps = 7/497 (1%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             Q+E     Q    + +   + E   +    FPM+  GL+ Y ++MI ++ +GRLG L LA
Sbjct  45    QKELRQETQIPNQTDLTLFIREAISIAKIAFPMMLTGLLLYPRSMISMLFLGRLGELALA  104

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GG+LA+GF NITGYS+LSGLA+GMEPI  QAFG++   ++  TLQRTI +L++ASLPI  
Sbjct  105   GGSLAVGFANITGYSILSGLAVGMEPICGQAFGAQKHHLLGQTLQRTILLLIVASLPISF  164

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW N+K ++L+  QD  I   A  F  +++PDL+A S LHPLRIYLR +  T PL +   
Sbjct  165   LWLNMKSILLFCGQDESIATEAQSFLVYSLPDLLAQSFLHPLRIYLRTQTITLPLTFCAT  224

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             +A +LH+PI ++L   L LG +G+A+S    NFI +  L+ YIL +    +       T 
Sbjct  225   LAIILHIPINYFLVTHLNLGTKGVALSGVWTNFILVGSLIIYILVSGVHKK-------TW  277

Query  1045  LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
                S    +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQTT+
Sbjct  278   GGFSVECFKEWKTLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQTTA  337

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             L+Y  PS+LS S+S+RVGNELGA +P KA+ A    +  +F+     +    + R+VW  
Sbjct  338   LIYIFPSSLSFSVSTRVGNELGANQPKKAKFAAIAGLSFSFIFGFSALSFAVMVRKVWAS  397

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
             +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+
Sbjct  398   MFTQDEEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVGTPV  457

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFED  326
             A+ + F    +F+GL  GLLAAQ +CV++ML V+ RTDWE E+ RAK+L       +  D
Sbjct  458   AVWLGFYAGFDFEGLWLGLLAAQGSCVVTMLFVLGRTDWEIEAQRAKELTHALVLVTNVD  517

Query  325   PMIKFKEGEEFRISFEE  275
               ++ +E +  +   +E
Sbjct  518   DSLEVEEKKPPKAEIKE  534



>gb|KHN34999.1| MATE efflux family protein 6 [Glycine soja]
Length=502

 Score =   379 bits (973),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 223/474 (47%), Positives = 314/474 (66%), Gaps = 8/474 (2%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             E+     QT+ H ++   + E++ + +   PM+  GL+ Y +++I ++ +GR+G L LAG
Sbjct  15    EQGQNNHQTKTHFSL--ALNEVKCIANIALPMVLTGLLLYSRSVISMLFLGRVGELALAG  72

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             G+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K   ++ L +QRTI +LL+ S+ I  L
Sbjct  73    GSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLAMQRTIVLLLLTSVLISFL  132

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W N+K L++   Q   I   A  F  F+IPDLVA S+LHPLRIYLR +  T PL ++  +
Sbjct  133   WLNMKKLLILCGQQEDIATEAQSFILFSIPDLVAQSLLHPLRIYLRSQSITLPLTYTASL  192

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             + +LH+PI ++L   LKLGI+GIA+     NF  ++ L+ YI  +      +YK     +
Sbjct  193   SILLHVPINYFLVSVLKLGIKGIALGAVWTNFNLVVSLILYIWVS-----GVYKKTWPGV  247

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
              S   I   W  LL LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  ++IQTT+L
Sbjct  248   -SLKGILSGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGVLIQTTAL  306

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             +Y  PS+LS ++S+RVGNELGA  P KA++A  + + +++      +      R+ W  +
Sbjct  307   IYIFPSSLSFAVSTRVGNELGAENPKKAKVAALVGLCISYGLGFSALFFAVSVRQAWASM  366

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A
Sbjct  367   FTRDAEIIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVA  426

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             + ++F    +FKGL  GLLAAQ +C+ +MLIV+ RT+WE +  RAK+L   S E
Sbjct  427   VRLSFFAGFDFKGLWLGLLAAQASCMFTMLIVLARTNWEGQVQRAKELTSSSEE  480



>gb|KHN02797.1| MATE efflux family protein 9 [Glycine soja]
Length=530

 Score =   380 bits (975),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 231/511 (45%), Positives = 321/511 (63%), Gaps = 17/511 (3%)
 Frame = -3

Query  1825  HNQLYLLC*RHKHTRANTNQQEEKMAAKQTQKHSTIP----EVMEELRKMIDTCFPMIAM  1658
             H   +L C  +        + + K+     QK  T+      V++EL  +     PMI  
Sbjct  3     HISSHLPCKCNSMKSQEAEESDMKITNPLIQKDITVTPPHHHVLKELISISKIALPMILT  62

Query  1657  GLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKN  1478
             GL+ Y ++MI ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEP   QA+G+K 
Sbjct  63    GLLLYCRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAVGMEPFCGQAYGAKK  122

Query  1477  LTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVAN  1298
              T++ L LQRTI +LL  S+PI LLW  +K ++L   QD  I   A  +  ++IPDL+A 
Sbjct  123   FTLLGLCLQRTILLLLFTSIPISLLWLYMKHILLLCGQDEAIATQAQSYLLYSIPDLLAQ  182

Query  1297  SILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigl  1118
             S LHPLRIYLR +  T PL      + +LH+PI + L   L  GI+G+A+S    N   +
Sbjct  183   SFLHPLRIYLRSQSITLPLTLCATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNLNLV  242

Query  1117  lfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMT  938
               L+ YI+++    +       T    S     +W  LL LA+PSC++VCLEWWWYE M 
Sbjct  243   ASLILYIVFSGTHKK-------TWGGFSFECFTQWKSLLNLAIPSCISVCLEWWWYEIMI  295

Query  937   LLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIA  758
             LL G LV P+ T+A+  I+IQTTSL+Y LPS++S S+S+RVGN+LGA +P KA+L+  + 
Sbjct  296   LLCGLLVNPRATVASMGILIQTTSLLYILPSSISFSVSTRVGNKLGAQKPSKAKLSAIVG  355

Query  757   IVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVL  578
             +  +F+      + T L R +W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVL
Sbjct  356   LSCSFMLGFLAFVFTILVRNIWASMFTQDKEIITLTSLVLPIIGLCELGNCPQTTGCGVL  415

Query  577   RGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYR  398
             RG+ARP +GA IN   FYL+G P+A+ + F   L+F+GL  GLLAAQ +C ++ML+V+ +
Sbjct  416   RGTARPKVGANINLGCFYLVGMPVAVWLGFFAGLDFQGLWLGLLAAQGSCAVTMLVVMSQ  475

Query  397   TDWEKESARAKDL------VGESRETSFEDP  323
             TDW+ E+ RAK L      V +S+E   E P
Sbjct  476   TDWDVEALRAKKLTSVVVAVDDSKEVGAEKP  506



>ref|XP_002267095.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
 ref|XP_010665024.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
 ref|XP_010665025.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
 ref|XP_010665026.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
 ref|XP_010665027.1| PREDICTED: MATE efflux family protein 5 [Vitis vinifera]
Length=500

 Score =   379 bits (972),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 219/494 (44%), Positives = 327/494 (66%), Gaps = 9/494 (2%)
 Frame = -3

Query  1735  QKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTN  1556
             QK  ++ +V+EEL ++     P+ AM  + Y++  + V+ +GRLG LELAGGAL+IGFTN
Sbjct  11    QKLPSVTQVVEELNELWSMALPITAMNCLVYVRAAVSVLFLGRLGRLELAGGALSIGFTN  70

Query  1555  ITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLML  1376
             ITGYSVL GLA G+EP+ SQA+GSKN  ++SL+L R + +L +A +PI  LW NL  +M+
Sbjct  71    ITGYSVLVGLASGLEPVCSQAYGSKNWELLSLSLVRMVLILGVAIIPISFLWVNLDRVMV  130

Query  1375  WLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIV  1196
              + QD +I  +A+ +C +++PDL  N++L PLR+YLR +  T P+++ +L+A  LH+P+ 
Sbjct  131   AMGQDKEITAMAARYCLYSLPDLATNTLLQPLRVYLRSQRVTKPMMYCSLVAVALHVPLN  190

Query  1195  FYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEE  1016
               +   + LG++G+A+++ V N   ++ + GY+       E  ++     +         
Sbjct  191   AVMVEVMGLGVEGVAMASVVTNLNMVVLMAGYVYVRGGW-EVKWRVGIGGVCGGVGP---  246

Query  1015  WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALS  836
                LL+LA+PSC+ +CLEWWWYE +T+LAGYL  P + +A   I+IQTTS MYT+P AL+
Sbjct  247   ---LLKLAVPSCIGICLEWWWYEIVTVLAGYLPNPTLAVAATGILIQTTSFMYTVPMALA  303

Query  835   NSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevle  656
               +S+RVGNELG G+P +A+LA  +A+  AFL     ++ T + RE W  +FT D  V  
Sbjct  304   GCVSARVGNELGGGKPNRAKLAAMVALGCAFLIGIINVIWTVIFREKWAGVFTKDEMVKA  363

Query  655   ltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKL  476
             L  +V+P++G+CEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+ +AF  K+
Sbjct  364   LVASVMPLMGVCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAVGLAFWLKV  423

Query  475   EFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGE  299
              F GL YGLL+AQVAC I +L +V+ RTDWE E+ +AK L      TS  D +++ +E E
Sbjct  424   GFSGLWYGLLSAQVACAIWILYVVLMRTDWEAEATKAKKLTSLEMATSC-DGVVRNEEQE  482

Query  298   EFRISFEEGVNLQK  257
             E   +   G+ L +
Sbjct  483   EGDDNESRGLLLSE  496



>ref|XP_010316145.1| PREDICTED: multidrug and toxin extrusion protein 2-like isoform 
X2 [Solanum lycopersicum]
Length=526

 Score =   379 bits (974),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 227/487 (47%), Positives = 313/487 (64%), Gaps = 13/487 (3%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             R   +  N ++Q+      QT +  T  EVMEE++ +    FP+IA GL+ Y K+MI ++
Sbjct  43    RAGTSTTNPDEQD------QTHQRLTGSEVMEEVKLLYSIAFPIIAAGLLVYGKSMISML  96

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              MGRLG   LAGG+L+IG  NITG+SVLSGLA+GME ISSQA G+K  +++  TLQRTI 
Sbjct  97    FMGRLGKEALAGGSLSIGIANITGFSVLSGLAMGMEAISSQACGAKQWSLMGQTLQRTIL  156

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL +S+PI LLW  ++PL+L+  QD  I  IAS +  F +PDL   SI++PL+IYLR +
Sbjct  157   ILLFSSIPISLLWIKIEPLLLFCGQDPTISSIASTYLSFCLPDLFFQSIINPLKIYLRTQ  216

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
               T+P+ +S   +  LH PI ++L + L LGI+G+A++  +A+F  L  L  Y+ Y+   
Sbjct  217   NVTFPVTFSAAFSLALHAPINYFLIYHLGLGIKGVAMAVVIADFNLLGVLFLYVSYSGVH  276

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
              ++           ST   E W  +L LA+PSC++VCLEWWWYE M LL+G L      +
Sbjct  277   RKSWQG-------WSTKCFEGWKPILILAIPSCISVCLEWWWYELMILLSGVLFNAAEAV  329

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             +T  I++Q TSL Y  PSALS ++S+RVGNELGA RP KA+ +  +AI+ A + S   ++
Sbjct  330   STMGILLQATSLAYIFPSALSLAVSTRVGNELGANRPNKAKTSCYVAIMCATVTSLLLMI  389

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
               T  R  W   FT D  +  LT   +P++GLCEL NCPQTT CG LRGSARP +   IN
Sbjct  390   SMTSLRNAWGNAFTDDESICWLTAAAMPVVGLCELGNCPQTTGCGALRGSARPALAVHIN  449

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             F SFY +G PLAI++ FV K+   GLC+GLLAAQ  C   M+ V+ RTDW  ++ RAK+L
Sbjct  450   FGSFYGVGLPLAIVLGFVMKMGVLGLCFGLLAAQGVCACLMVCVLSRTDWMIQAQRAKEL  509

Query  358   VGESRET  338
             +G   E 
Sbjct  510   IGVDVEN  516



>ref|XP_004232036.1| PREDICTED: multidrug and toxin extrusion protein 2-like isoform 
X1 [Solanum lycopersicum]
Length=526

 Score =   379 bits (974),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 227/487 (47%), Positives = 313/487 (64%), Gaps = 13/487 (3%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             R   +  N ++Q+      QT +  T  EVMEE++ +    FP+IA GL+ Y K+MI ++
Sbjct  43    RAGTSTTNPDEQD------QTHQRLTGSEVMEEVKLLYSIAFPIIAAGLLVYGKSMISML  96

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              MGRLG   LAGG+L+IG  NITG+SVLSGLA+GME ISSQA G+K  +++  TLQRTI 
Sbjct  97    FMGRLGKEALAGGSLSIGIANITGFSVLSGLAMGMEAISSQACGAKQWSLMGQTLQRTIL  156

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL +S+PI LLW  ++PL+L+  QD  I  IAS +  F +PDL   SI++PL+IYLR +
Sbjct  157   ILLFSSIPISLLWIKIEPLLLFCGQDPTISSIASTYLSFCLPDLFFQSIINPLKIYLRTQ  216

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
               T+P+ +S   +  LH PI ++L + L LGI+G+A++  +A+F  L  L  Y+ Y+   
Sbjct  217   NVTFPVTFSAAFSLALHAPINYFLIYHLGLGIKGVAMAVVIADFNLLGVLFLYVSYSGVH  276

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
              ++           ST   E W  +L LA+PSC++VCLEWWWYE M LL+G L      +
Sbjct  277   RKSWQG-------WSTKCFEGWKPILILAIPSCISVCLEWWWYELMILLSGVLFNAAEAV  329

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             +T  I++Q TSL Y  PSALS ++S+RVGNELGA RP KA+ +  +AI+ A + S   ++
Sbjct  330   STMGILLQATSLAYIFPSALSLAVSTRVGNELGANRPNKAKTSCYVAIMCATVTSLLLMI  389

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
               T  R  W   FT D  +  LT   +P++GLCEL NCPQTT CG LRGSARP +   IN
Sbjct  390   SMTSLRNAWGNAFTDDESICWLTAAAMPVVGLCELGNCPQTTGCGALRGSARPALAVHIN  449

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             F SFY +G PLAI++ FV K+   GLC+GLLAAQ  C   M+ V+ RTDW  ++ RAK+L
Sbjct  450   FGSFYGVGLPLAIVLGFVMKMGVLGLCFGLLAAQGVCACLMVCVLSRTDWMIQAQRAKEL  509

Query  358   VGESRET  338
             +G   E 
Sbjct  510   IGVDVEN  516



>gb|KDP30286.1| hypothetical protein JCGZ_17156 [Jatropha curcas]
Length=504

 Score =   379 bits (972),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 219/481 (46%), Positives = 326/481 (68%), Gaps = 12/481 (2%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             +QK  +  +V+EEL+++     P+ A  L+++ ++++ V+ +GRLGSLELAGGAL+IGFT
Sbjct  10    SQKLPSASQVLEELKELWGMALPITAAHLMAFFRSVVSVMFLGRLGSLELAGGALSIGFT  69

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQAFGSKN  ++SL+LQR I +L +A +PI  LW NL+ +M
Sbjct  70    NITGYSVLVGLASGLEPVCSQAFGSKNWDLMSLSLQRMILILFIAIIPISFLWVNLESIM  129

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
               + QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P+++ +L+A + H+P+
Sbjct  130   NLMGQDPNITAMAATYCIYSLPDLLTNTLLQPLRVFLRSQQVTKPIMYCSLLAVIFHVPL  189

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
              + L   + LG+ G+A+++ V N   ++ ++GY+ + + + E  +      +        
Sbjct  190   NYMLVVVMGLGVPGVAMASVVTNMNMVVLMVGYVWWVSGRWEMRWTGGIGGVCGGVG---  246

Query  1018  EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSAL  839
                 LL+LA+PSCL +CLEWWWYE + ++AGYL  P + +A + I+IQTTS+MYT+P AL
Sbjct  247   ---QLLKLAVPSCLGICLEWWWYEIVIVMAGYLPNPTLAVAASGILIQTTSMMYTVPMAL  303

Query  838   SNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevl  659
             +  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T   RE W  +FT D  V 
Sbjct  304   AGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGIINVTWTVFLRERWAGLFTKDRLVK  363

Query  658   eltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWK  479
              L  +VLPIIGLCEL NCPQTT CG+LRG+ARP IGA IN  SFY +G P+A+ +AF   
Sbjct  364   GLVASVLPIIGLCELGNCPQTTGCGILRGTARPAIGARINLGSFYFVGTPVAVGLAFGLN  423

Query  478   LEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGE  299
             + F GL  GLL+AQVAC +S+L V+ RTDWE E+ +++ L      TS E   +   EG+
Sbjct  424   VGFTGLWIGLLSAQVACAVSVLYVLIRTDWEHEALKSRKL------TSMEMRGMNNVEGD  477

Query  298   E  296
             +
Sbjct  478   K  478



>ref|XP_009364190.1| PREDICTED: MATE efflux family protein 5-like [Pyrus x bretschneideri]
Length=559

 Score =   380 bits (976),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 311/472 (66%), Gaps = 8/472 (2%)
 Frame = -3

Query  1765  QEEKMAAKQTQKHST-IPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             +  K+       H T +   + E + + +  FPM+  GL+ Y ++MI ++ +GRLG L L
Sbjct  60    ESPKLEQYNQNHHKTHLSLALIEAKCIANIAFPMVLTGLLLYSRSMISMLFLGRLGELSL  119

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYSVLSGLA+GMEPI  QA+G+K   ++  TLQRT+ +L + S+PI 
Sbjct  120   AGGSLAIGFANITGYSVLSGLAMGMEPICGQAYGAKRFKLLGQTLQRTVILLFLTSIPIA  179

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
              LW N+K ++L   Q  +I   A  +  +++PDL+A S+LHPLRIYLR +  T PL +  
Sbjct  180   FLWLNMKRILLSCGQQDEIATEAYSYILYSLPDLIAQSLLHPLRIYLRTQSITVPLTFCA  239

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
              +A +LH+P+ + L   L LGI+G+A+S    N   +  L+ YI  +      +YK    
Sbjct  240   ALAILLHIPVNYLLVHVLNLGIKGVALSGVWTNVNLVGSLIAYIAIS-----GVYKKTWG  294

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
                     G  W  L+ LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT
Sbjct  295   GFSKECFKG--WKNLMNLAIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTT  352

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             +L+Y  PS+LS  +S+RVGNELGA RP +ARLAT + +  +F+     +L     R +W 
Sbjct  353   ALIYIFPSSLSFGVSTRVGNELGANRPERARLATIVGLSYSFILGFSALLFAVTVRNIWA  412

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
              +FT ++E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P
Sbjct  413   SMFTQESEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFYLVGMP  472

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
             +A+ ++F    +F+GL  GLLAAQ +CV++MLIV++RT+W+ +  RAK+L G
Sbjct  473   VAVWLSFYAGFDFRGLWLGLLAAQGSCVLTMLIVLFRTNWDLQGQRAKELTG  524



>ref|XP_007018359.1| Multidrug and toxin extrusion protein 1 [Theobroma cacao]
 gb|EOY15584.1| Multidrug and toxin extrusion protein 1 [Theobroma cacao]
Length=549

 Score =   380 bits (975),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 233/494 (47%), Positives = 316/494 (64%), Gaps = 12/494 (2%)
 Frame = -3

Query  1756  KMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
             K   +Q  +  T+ E MEE++ +     P     L+ Y + MI ++ +G LG LELAGG+
Sbjct  29    KDDEEQLHRLPTLSEAMEEIKAIGKISGPTAMSSLLLYSRAMISMLFLGYLGELELAGGS  88

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             L+IG  NITGYSV+SGLA+GMEPI  QA+G+K   ++ LTLQRT+ +LL AS+PI  +W 
Sbjct  89    LSIGVANITGYSVISGLAMGMEPICGQAYGAKQWKLLGLTLQRTVLLLLSASIPISFMWV  148

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
             N+K ++LW  QD +I  +A  F  F+IPDL   S+LHPLRIYLR +  T P+ + + I+ 
Sbjct  149   NMKGILLWCGQDQEISSVARTFIIFSIPDLFFLSLLHPLRIYLRTQSITLPVTYCSAISV  208

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKS  1037
             +LH+P+ F L    KLG+ G+AI+    N    L L  ++ ++    ++   P       
Sbjct  209   LLHVPLNFLLVVHFKLGVAGVAIAMVWTNLNLFLLLSSFVYFSGVYKDSWVTP-------  261

Query  1036  STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMY  857
             ST     W  LL LA+P+C +VCLEWWWYE M LL G L  P+ T+A+  I+IQTTSL+Y
Sbjct  262   STDCLRGWSSLLGLAVPTCASVCLEWWWYEIMILLCGLLANPKATIASMGILIQTTSLVY  321

Query  856   TLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFt  677
               PSALS  +S+RVGNELGA RPG+AR++  +++  A       +L  TL R  W K+FT
Sbjct  322   CFPSALSVGVSTRVGNELGAKRPGQARISMIVSLFCAVAIGVAAMLFATLMRHQWGKLFT  381

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
              D E+LELT   LPI GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P++++
Sbjct  382   NDAEILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVSLL  441

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMI  317
             M F+ K+ F GL  GLLAAQV+C   ML+V+ RTDW  ++ RA  L     +TS + P +
Sbjct  442   MGFMTKMGFAGLWLGLLAAQVSCAFFMLVVLCRTDWMLQAERASVLT----QTSNKLPSL  497

Query  316   KFK-EGEEFRISFE  278
                 + EE+  S E
Sbjct  498   PISTKQEEYSNSKE  511



>ref|NP_001170523.1| putative MATE efflux family protein [Zea mays]
 gb|ACR33951.1| unknown [Zea mays]
 tpg|DAA36411.1| TPA: putative MATE efflux family protein [Zea mays]
Length=568

 Score =   380 bits (977),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 235/497 (47%), Positives = 326/497 (66%), Gaps = 19/497 (4%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +   E R ++    PMI  GL+ Y+++MI ++ +GRLG L LAGG+LAIGF NITGYSVL
Sbjct  86    DAHAEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVL  145

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEPI  QAFG+ N +++ +T+QRT+ +L+ A++PIG LW +++PL+L   QDA 
Sbjct  146   SGLAMGMEPICGQAFGAGNFSLLGITMQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDAG  205

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A  +   ++PDLV  + +HP+RIYLR +    PL     +A ++HLPI + L   L
Sbjct  206   IAAVAETYILASLPDLVLQAFIHPVRIYLRAQSINLPLTVCAALAIVIHLPINYVLVTVL  265

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
              LGI+G+A ++ +AN   LLFL+ YIL+     ++++K     L S  S    W  L+ L
Sbjct  266   GLGIRGVAFASVLANLNLLLFLVAYILF-----KSVHKRTGGFLLSRESF-RGWGELVSL  319

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             ALPSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV
Sbjct  320   ALPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRV  379

Query  814   GNELGAGRPGKARLATAIAIVLAF----LASAFGILLTTLGREVWVKIFttdtevleltv  647
              NELGA RP +A  A A+ ++L F    LASAF  L+    R VW  +FT D  ++ LT 
Sbjct  380   SNELGANRPEEASRAAAVGLMLGFAFGGLASAFAFLV----RNVWASMFTADPAIIALTA  435

Query  646   tvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFK  467
             +VLPI+GLCEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A+++AF    +FK
Sbjct  436   SVLPILGLCELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWLHYDFK  495

Query  466   GLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRI  287
             GL  GLLAAQ  C++ ML+VI RTDW  E+ R++ L G       +D     K G + + 
Sbjct  496   GLWLGLLAAQATCMVRMLLVIGRTDWACEAKRSRQLTGGLVAEDSDD-----KAGGDEKS  550

Query  286   SFEEGVNLQK*YSHQKR  236
                   ++++  +H  R
Sbjct  551   RLLGDTDIEQANAHSDR  567



>ref|XP_003538709.1| PREDICTED: MATE efflux family protein 6-like [Glycine max]
Length=534

 Score =   379 bits (973),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 223/474 (47%), Positives = 314/474 (66%), Gaps = 8/474 (2%)
 Frame = -3

Query  1762  EEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelag  1583
             E+     QT+ H ++   + E++ + +   PM+  GL+ Y +++I ++ +GR+G L LAG
Sbjct  47    EQGQNNHQTKTHFSL--ALNEVKCIANIALPMVLTGLLLYSRSVISMLFLGRVGELALAG  104

Query  1582  galaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLL  1403
             G+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K   ++ L +QRTI +LL+ S+ I  L
Sbjct  105   GSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLAMQRTIVLLLLTSVLISFL  164

Query  1402  WFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLI  1223
             W N+K L++   Q   I   A  F  F+IPDLVA S+LHPLRIYLR +  T PL ++  +
Sbjct  165   WLNMKKLLILCGQQEDIATEAQSFILFSIPDLVAQSLLHPLRIYLRSQSITLPLTYTASL  224

Query  1222  ATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNL  1043
             + +LH+PI ++L   LKLGI+GIA+     NF  ++ L+ YI  +      +YK     +
Sbjct  225   SILLHVPINYFLVSVLKLGIKGIALGAVWTNFNLVVSLILYIWVS-----GVYKKTWPGV  279

Query  1042  KSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSL  863
              S   I   W  LL LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  ++IQTT+L
Sbjct  280   -SLKGILSGWKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGVLIQTTAL  338

Query  862   MYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKI  683
             +Y  PS+LS ++S+RVGNELGA  P KA++A  + + +++      +      R+ W  +
Sbjct  339   IYIFPSSLSFAVSTRVGNELGAENPKKAKVAALVGLCISYGLGFSALFFAVSVRQAWASM  398

Query  682   FttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLA  503
             FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A
Sbjct  399   FTRDAEIIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVA  458

Query  502   IIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
             + ++F    +FKGL  GLLAAQ +C+ +MLIV+ RT+WE +  RAK+L   S E
Sbjct  459   VRLSFFAGFDFKGLWLGLLAAQASCMFTMLIVLARTNWEGQVQRAKELTSSSEE  512



>ref|XP_008437213.1| PREDICTED: MATE efflux family protein 5 [Cucumis melo]
Length=533

 Score =   379 bits (973),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 217/452 (48%), Positives = 310/452 (69%), Gaps = 7/452 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
              V+ E + + D  FPMI +G + Y ++MI ++ +GRLG L LAGG+LAIGF NITGYS+L
Sbjct  31    HVLTEAKSIADIAFPMILVGFLMYSRSMISMLFLGRLGGLALAGGSLAIGFANITGYSLL  90

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGL++GMEPI  QAFG+K   ++ LTLQRTI +LL++SLPI  LWFN+K ++L+  QD  
Sbjct  91    SGLSMGMEPICGQAFGAKKFKLLGLTLQRTIILLLISSLPISFLWFNMKKILLFCGQDVD  150

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I + A  +   ++PDL+A S LHPLRIYLR +    PL +  +IA + H+PI +      
Sbjct  151   IANEAHSYILCSLPDLIALSFLHPLRIYLRSQSINLPLTYCAIIAILFHIPINYLFVCVF  210

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
             + GI+G+A+     NF  +  L+ ++L++      +YK     + S      EW  LL L
Sbjct  211   EWGIRGVALGAVWTNFNFVGSLVVFVLFS-----GVYKKTWPGMSSDCL--TEWKSLLGL  263

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             A+PSC++VCLEWWWYE M LL+G+++ PQ T+A+  I+IQTT+L+Y  PS+LS  +S+RV
Sbjct  264   AIPSCISVCLEWWWYEIMILLSGFMLNPQSTVASMGILIQTTALIYIFPSSLSFGVSTRV  323

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
             GNELGA  P +A+LA  + + ++F      ++     R+VW  +FT D +++ELT  +LP
Sbjct  324   GNELGANHPNRAKLAAIVGLCISFFLGISALVFAFKIRKVWTTMFTEDIQIIELTSLILP  383

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             IIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY++G P+AI ++F    +FKGL  
Sbjct  384   IIGLCELGNCPQTTSCGVLRGTARPKLGANINLGCFYMVGMPVAIWLSFYGGWDFKGLWI  443

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             GLLAAQ +C ++ML V+ RT+WE+++ RAK+L
Sbjct  444   GLLAAQASCAMTMLWVLARTNWEEQAERAKEL  475



>ref|XP_010271543.1| PREDICTED: MATE efflux family protein 5-like [Nelumbo nucifera]
Length=542

 Score =   379 bits (973),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 231/491 (47%), Positives = 312/491 (64%), Gaps = 8/491 (2%)
 Frame = -3

Query  1792  KHTRANTNQQEEKMA-AKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVC  1616
             K   AN N+    +   ++  +  T  E +EE++ +     P    GL+ Y + MI ++ 
Sbjct  17    KTHFANPNKTMNDLNNDEELHRWPTPSEAVEEIKAIGKISGPTALTGLLMYSRAMISMLF  76

Query  1615  MgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISM  1436
             +G LG LELAGG+L+IGF NITGYSV+SGLA+GM+PI  QA+G+K   ++ LTLQRT+ +
Sbjct  77    LGHLGQLELAGGSLSIGFANITGYSVISGLAMGMDPICGQAYGAKQWKLLGLTLQRTVLL  136

Query  1435  LLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKG  1256
             LL AS+PI L+W N+K ++LW  QD ++  +A +F  F+IPDL   S+LHPLRIYLR + 
Sbjct  137   LLAASIPISLMWLNMKRILLWCGQDQEVSTVAHVFILFSIPDLFFLSLLHPLRIYLRTQS  196

Query  1255  TTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQN  1076
              T PL   + I+ ++H+P+ F L   LK+GI G+AI+    N   +L L  ++L++    
Sbjct  197   ITLPLTCCSAISVIIHVPLNFLLVVHLKMGIAGVAIAMVWTNLNLVLLLSAFVLFSGVYK  256

Query  1075  EALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLA  896
             ++   P    L+        W  LL LA+P+C++VCLEWWWYE M +L G LV P+ T+A
Sbjct  257   DSWIAPSMDCLRG-------WSSLLGLAVPTCISVCLEWWWYELMIMLCGLLVNPKATIA  309

Query  895   TAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILL  716
             +  I+IQTTSL+Y  PS+LS  +S+RVGNELGA RP KAR A  +++  A       +L 
Sbjct  310   SMGILIQTTSLVYVFPSSLSLGVSTRVGNELGANRPAKARSAMIVSLACAAALGLAAMLF  369

Query  715   TTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINF  536
             TTL R  W + FT D E+L +T   LPI+GLCEL NCPQTT CGVLRGSARP  GA IN 
Sbjct  370   TTLMRHRWGQFFTGDAEILNITSVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANINL  429

Query  535   YSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLV  356
              SFYL+G P+AI M FV KL F GL  GLLAAQ  C   ML V+  TDW  +  RA+ L 
Sbjct  430   GSFYLVGMPVAIFMGFVAKLGFPGLWIGLLAAQATCATLMLYVLATTDWMLQVERARQLT  489

Query  355   GESRETSFEDP  323
               S   + E P
Sbjct  490   LTSSSFTKEQP  500



>ref|XP_009765487.1| PREDICTED: MATE efflux family protein 5 [Nicotiana sylvestris]
Length=549

 Score =   379 bits (974),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 225/485 (46%), Positives = 309/485 (64%), Gaps = 9/485 (2%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHS--TIPEVMEELRKMIDTCFPMIAMGLISYMKNMILV  1622
              K    N+++  +  A  +   H   T  E  EE++++     P    GL+ Y ++MI +
Sbjct  16    EKAHFVNSHKPMDFQADDEELLHRWPTPTEAFEEIKEIGKISGPTALTGLVLYSRSMISM  75

Query  1621  VCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTI  1442
             + +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ +TLQRT+
Sbjct  76    LFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGITLQRTV  135

Query  1441  SMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRC  1262
              +LL  S+PI  +W N+K ++LW  QD  I  +A  F  FAIPDL   S+LHPLRIYLR 
Sbjct  136   LLLLSTSIPISFMWLNMKRILLWCGQDEDISSMAHTFIVFAIPDLFFLSLLHPLRIYLRT  195

Query  1261  KGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE  1082
             +  T PL + + I+ +LH+P+ F L     LGI G+A++    N    L L  +I ++  
Sbjct  196   QNITLPLTYCSAISVLLHVPLNFLLVRYFNLGIAGVALAMVWTNLNLFLLLCSFIYFSGV  255

Query  1081  QNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
               ++   P       S      W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T
Sbjct  256   YKDSWVVP-------SMDCVRGWSSLLGLAIPTCVSVCLEWWWYEFMIMLCGLLANPKAT  308

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             +A+  I+IQTTSL+Y  PSALS  +S+RVGN+LGA RP +AR++  +++  A       +
Sbjct  309   IASMGILIQTTSLVYVFPSALSLGVSTRVGNQLGANRPARARISMIVSLFCAIGLGLGAM  368

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
             L TTL R  W   FT D E+L+LT   LPI+GLCEL NCPQTT CGVLRGSARP IGA I
Sbjct  369   LFTTLMRHKWGLFFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRGSARPTIGANI  428

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             N  SFYL+G P+A I+ F+ K+ F GL  GLLAAQ +C   ML V+++TDW+ +  R+K 
Sbjct  429   NLGSFYLVGMPVAFILGFILKMGFAGLWLGLLAAQASCATLMLCVLFKTDWKVQVERSKQ  488

Query  361   LVGES  347
             L   S
Sbjct  489   LTQSS  493



>ref|XP_008376528.1| PREDICTED: MATE efflux family protein LAL5-like [Malus domestica]
Length=556

 Score =   379 bits (974),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 224/472 (47%), Positives = 313/472 (66%), Gaps = 9/472 (2%)
 Frame = -3

Query  1768  QQEEKMAAKQTQKH--STIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
              Q E++   Q   H  S     ++E   +    FPMI  GL+ Y +++I ++ +GRLG L
Sbjct  42    SQPEQVPKLQFNPHKESHFSLALKEANSIAVIAFPMILTGLLLYSRSIISMLFLGRLGEL  101

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG++   ++ L+LQRT+ +LL  SLP
Sbjct  102   ALAGGSLAVGFANITGYSILSGLAMGMEPICGQAFGARKHALLGLSLQRTVLLLLFTSLP  161

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I LLW N+K ++L   QD  I   A L+   ++PDL+A S LHPLRIYLR +  T PL  
Sbjct  162   ISLLWLNMKKILLICGQDEAIAAEAQLYLLCSLPDLLAQSFLHPLRIYLRSQSITLPLSL  221

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                +A +LH+PI ++L   L LGI+G+A+S    NF  +  L+ YI+        +YK  
Sbjct  222   CATLAIILHIPINYFLVSHLDLGIKGVALSGVWTNFNLVASLIAYIIVY-----GVYKKT  276

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
                +  S    +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  ++IQ
Sbjct  277   WGGI--SMECFKEWRTLLNLAVPSCISVCLEWWWYEIMILLCGLLINPRATVASMGVLIQ  334

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TT+L+Y  PS+LS S+S+RVGNE+GA  P KA+LA  + +  +F+     ++  T+ R +
Sbjct  335   TTALIYIFPSSLSFSVSTRVGNEIGANNPKKAKLAAIVGLCCSFVLGLSALVFATMVRNI  394

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G
Sbjct  395   WASMFTQDKEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYLVG  454

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              P+A+ + F    +F+GL +GLLAA+ +C ++ML V+ RTDWE E+ +AK+L
Sbjct  455   MPVAVGLGFFLGFDFQGLWFGLLAAEGSCALTMLAVLGRTDWELEARKAKEL  506



>ref|XP_008365847.1| PREDICTED: MATE efflux family protein 9-like [Malus domestica]
Length=499

 Score =   377 bits (968),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 222/484 (46%), Positives = 329/484 (68%), Gaps = 7/484 (1%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             + K  +  +V+EELR++    FP+ AM  + +++  + V+ +GRLGSLELAGGAL++GFT
Sbjct  10    SHKFPSASQVLEELRELWGMAFPITAMNCLVFIRAAVSVLFLGRLGSLELAGGALSLGFT  69

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSVL GLA G+EP+ SQA+G+KN  ++SL+LQR + +LL+A +PI LLW NL+P+M
Sbjct  70    NITGYSVLMGLASGLEPVCSQAYGNKNYDLLSLSLQRMVLILLLAVIPISLLWINLQPIM  129

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             +++ QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P+++ ++IA   H+P+
Sbjct  130   VFMGQDKAITAMAATYCLYSLPDLLTNTVLQPLRVFLRSQKVTXPMMYCSMIAVAFHVPL  189

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
                L   + LG+ G+A+++ + N    + + GY+ +   + E  +      L S   IG 
Sbjct  190   NVVLVVVMGLGVPGVAVASVLTNLNMAVLMAGYVWWRWRKMEMRWTAGIGYLCS--GIGP  247

Query  1018  EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSAL  839
                 L++LA+PSCL +CLEWWWYE +T++AGYL  P + +A   I+IQTTS+MYT+P AL
Sbjct  248   ----LVKLAVPSCLGICLEWWWYEIVTVMAGYLPNPTMAVAATGILIQTTSMMYTVPLAL  303

Query  838   SNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevl  659
             S  +S+RVGNELG G+P KA+LA  +A+  AF+     +  T + RE W  +FT D  V 
Sbjct  304   SGCVSARVGNELGCGKPYKAKLAAMVALGCAFVIGIINVTWTVILRERWAGLFTKDELVK  363

Query  658   eltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWK  479
              L  +V+PI+GLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+ +AF  K
Sbjct  364   ALVASVMPIMGLCELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAVGLAFWLK  423

Query  478   LEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEG  302
             + F GL +GLL+AQVAC +S+L +V+ RTDWE ES +AK L G        +     K+ 
Sbjct  424   VGFGGLWFGLLSAQVACAVSILYVVVARTDWEAESLKAKMLTGIEMGDCKNEGQGHEKDD  483

Query  301   EEFR  290
             EE +
Sbjct  484   EESK  487



>ref|XP_003535626.1| PREDICTED: MATE efflux family protein 5-like [Glycine max]
Length=530

 Score =   378 bits (970),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 234/513 (46%), Positives = 324/513 (63%), Gaps = 19/513 (4%)
 Frame = -3

Query  1831  NTHNQLYLLC*RHKHTRANTNQQEEKMAAKQTQKHSTIP----EVMEELRKMIDTCFPMI  1664
             +  +QL   C   K   A   + + K+     QK  T+      V++EL  +     PMI
Sbjct  3     HISSQLPCKCNSMKSQEAE--ESDMKITNPLIQKDITVTPPHHHVLKELISISKIALPMI  60

Query  1663  AMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGS  1484
               GL+ Y ++MI ++ +GRLG L LAGG+LA+GF NITGYS+LSGLA+GMEP   QA+G+
Sbjct  61    LTGLLLYCRSMISMLFLGRLGELALAGGSLAVGFANITGYSILSGLAVGMEPFCGQAYGA  120

Query  1483  KNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLV  1304
             K  T++ L LQRTI +LL  S+PI LLW  +K ++L   QD  I   A  +  ++IPDL+
Sbjct  121   KKFTLLGLCLQRTILLLLFTSIPISLLWLYMKHILLLCGQDEAIATQAQSYLLYSIPDLL  180

Query  1303  ANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfi  1124
             A S LHPLRIYLR +  T PL      + +LH+PI + L   L  GI+G+A+S    NF 
Sbjct  181   AQSFLHPLRIYLRSQSITLPLTLCATFSILLHIPINYLLVSHLNWGIKGVALSGVWTNFN  240

Query  1123  gllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEF  944
              +  L+ YI+++    +       T    S     +W  LL LA+PSC++VCLEWWWYE 
Sbjct  241   LIASLILYIVFSGTHKK-------TWGGFSFECFTQWKSLLDLAIPSCISVCLEWWWYEI  293

Query  943   MTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATA  764
             M LL G LV P+ T+A+  I+IQTTSL+Y LPS++S S+S+RVGN+LGA +P KA+L+  
Sbjct  294   MILLCGLLVNPRATVASMGILIQTTSLLYILPSSISFSVSTRVGNKLGAQKPSKAKLSAI  353

Query  763   IAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCG  584
             + +  +F+      + T L R +W  +FT D E++ LT  VLPIIGLCEL NCPQTT CG
Sbjct  354   VGLSCSFMLGFLAFVFTILVRNIWASMFTQDKEIITLTSLVLPIIGLCELGNCPQTTGCG  413

Query  583   VLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVI  404
             VLRG+ARP +GA IN   FYL+G P+A+ + F   L+F+GL  GLLAAQ +C ++ML+V+
Sbjct  414   VLRGTARPKVGANINLGCFYLVGMPVAVWLGFFAGLDFQGLWLGLLAAQGSCAVTMLVVM  473

Query  403   YRTDWEKESARAKDL------VGESRETSFEDP  323
              +TDW+ E+ RAK L      V +S+E   E P
Sbjct  474   SQTDWDVEALRAKKLTSVVVAVDDSKEVGAEKP  506



>ref|XP_006433714.1| hypothetical protein CICLE_v10000751mg [Citrus clementina]
 gb|ESR46954.1| hypothetical protein CICLE_v10000751mg [Citrus clementina]
 gb|KDO81340.1| hypothetical protein CISIN_1g008783mg [Citrus sinensis]
Length=553

 Score =   379 bits (972),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 227/480 (47%), Positives = 307/480 (64%), Gaps = 7/480 (1%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             +  +T  N          ++  +  T  E +EE++ +     P    GLI Y + MI ++
Sbjct  17    KPHYTNLNKTVDLHTDDPEELHRRPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISML  76

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              +G LG LELAGG+L+IGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ +TLQRT+ 
Sbjct  77    FLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVL  136

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL  SLPI  +W N+K ++LW  QD +I  +A  F  FAIPDL   S+LHPLR+YLR +
Sbjct  137   LLLSTSLPISFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQ  196

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
             G T PL + + I+ +LH+P+ F L    K+GI G+AI+    N    L L  ++ ++   
Sbjct  197   GITLPLTYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVH  256

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
              ++   P       S      W  LL LA+P+C++VCLEWWWYE M ++ G L+ P+  +
Sbjct  257   KDSWVSP-------SMDCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAI  309

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A+  I+IQ TSL+Y  PS+LS  +S+RVGNELGA RP KAR++  +++  A       +L
Sbjct  310   ASMGILIQITSLIYVFPSSLSLGVSTRVGNELGANRPSKARISMIVSLFCAVALGLMAVL  369

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              TTL R  W + FT D E+LELT   LPIIGLCEL NCPQTT CGVLRGSARP  GA IN
Sbjct  370   FTTLMRHKWGRFFTNDAEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASIN  429

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               SFYL+G P+AI+M FV K+ F GL  GLLAAQ +C + ML V+ RTDW  ++ RAK+L
Sbjct  430   LGSFYLVGMPVAILMGFVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKEL  489



>ref|XP_008663473.1| PREDICTED: MATE efflux family protein 5-like [Zea mays]
 gb|AFW59144.1| putative MATE efflux family protein [Zea mays]
Length=573

 Score =   379 bits (974),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 235/498 (47%), Positives = 326/498 (65%), Gaps = 17/498 (3%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             E   E R ++    PMI  GL+ Y+++MI ++ +GRLG L LAGG+LAIGF NITGYSVL
Sbjct  88    EARGEARSILGLALPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVL  147

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEPI  QAFG+ N  ++ +T QRT+ +L+ A++PIG LW +++PL+L   QD  
Sbjct  148   SGLAMGMEPICGQAFGAGNFPLLGVTTQRTVLLLVAAAVPIGGLWMHMRPLLLLCGQDTG  207

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A  +   ++PDLV  + +HP+RIYLR +    PL     +A  +HLP+ + L   L
Sbjct  208   IASVAETYILASLPDLVLQAFIHPVRIYLRAQSINLPLTVCAALAIAIHLPVNYVLVTVL  267

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
              LGI+G+A ++ +AN   LLFLL YIL+       +++     + S  S    W  L+ L
Sbjct  268   GLGIRGVAFASVLANLNLLLFLLAYILF-----RGVHRRTGGFVLSRESF-RGWGELVSL  321

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             ALPSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV
Sbjct  322   ALPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRV  381

Query  814   GNELGAGRPGKARLATAIAIVLAF----LASAFGILLTTLGREVWVKIFttdtevleltv  647
              NELGA RP +A  A A+ +VL F    LASAF  L+    R VW  +FT D  ++ LT 
Sbjct  382   SNELGANRPEEASRAAAVGLVLGFASGGLASAFAFLV----RNVWASMFTADPAIVALTA  437

Query  646   tvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFK  467
             +VLPI+GLCEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A+++AF    +FK
Sbjct  438   SVLPILGLCELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWLHYDFK  497

Query  466   GLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRI  287
             GL +GLLAAQ  C++ ML+VI RTDW  E+ R+++L G     + +D  +K    E+ R+
Sbjct  498   GLWFGLLAAQATCMVRMLLVIGRTDWACEAKRSRELTGAGGAVA-KDSDVKAGGDEKSRL  556

Query  286   SFEEGVNLQK*YSHQKRK  233
              F    ++++  +H   +
Sbjct  557   LFY--TDMEQANAHSADQ  572



>ref|XP_002509706.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF51093.1| multidrug resistance pump, putative [Ricinus communis]
Length=539

 Score =   378 bits (971),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 223/469 (48%), Positives = 312/469 (67%), Gaps = 13/469 (3%)
 Frame = -3

Query  1738  TQKHSTIPE------VMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagga  1577
             +Q  +T P+       ++E + + +  FPMI  GL+ Y ++MI ++ +GRLG L LAGG+
Sbjct  42    SQPQNTNPQNNHLSLAIKEAKCIANIAFPMILTGLLLYSRSMISMLFLGRLGELALAGGS  101

Query  1576  laiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWF  1397
             LAIGF NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +L + S PI  LWF
Sbjct  102   LAIGFANITGYSILSGLAMGMEPICGQAFGAKRYKLIGLTLQRTILLLFLISFPIAFLWF  161

Query  1396  NLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIAT  1217
             N+K ++++  Q+  I   A  +  +++PDL+  S+LHPLRIYLR +  T PL +   ++ 
Sbjct  162   NMKKILIFCGQEDDIATEAQSYILYSLPDLILQSLLHPLRIYLRTQSITLPLTFCAALSI  221

Query  1216  MLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKS  1037
             +LH+PI ++L   L LGI+G+A+S    NF  +  L+ Y+L++      +YK   + + S
Sbjct  222   LLHIPINYFLVSVLNLGIKGVALSGIWTNFNLVASLIIYVLFS-----GVYKKTWSGISS  276

Query  1036  STSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMY  857
                 G  W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQTT+L+Y
Sbjct  277   ECFKG--WKSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPRATVASMGILIQTTALIY  334

Query  856   TLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFt  677
               PS+LS S+S+RVGNELGA  P KA+ A  + +  +F      +    + R VW  +FT
Sbjct  335   IFPSSLSFSVSTRVGNELGASNPLKAKFAAIVCLSSSFFLGFSALFFAVMVRNVWSCMFT  394

Query  676   tdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAII  497
              D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+A P  GA IN   FYL+G P+A+ 
Sbjct  395   EDAEIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTATPKTGANINLACFYLVGMPVAVF  454

Query  496   MAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGE  350
             ++F    +FKGL  GLLAAQ +CV++ML V+ RTDWE ++ RA+ L G 
Sbjct  455   LSFYAGFDFKGLWLGLLAAQGSCVVTMLFVLTRTDWELQARRARQLTGN  503



>ref|XP_006652664.1| PREDICTED: MATE efflux family protein 9-like [Oryza brachyantha]
Length=570

 Score =   379 bits (973),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 316/493 (64%), Gaps = 13/493 (3%)
 Frame = -3

Query  1705  EELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG---FTNITGYSVL  1535
             +E R ++   FPMI  GL+ Y+++MI ++ +G LG L LAGG+LAIG   F NI GYSVL
Sbjct  87    DEARSILGLAFPMILTGLLLYLRSMISMLFLGHLGGLALAGGSLAIGPFGFANIPGYSVL  146

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GMEPI  QAFG+ N  ++ +T+QRT+ +L++A++PIG LW  ++PL+L+  QDA 
Sbjct  147   SGLAMGMEPICGQAFGAGNYALLGITMQRTVLLLIVAAVPIGGLWLQMRPLLLFCGQDAA  206

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A  +   ++PDLV  + LHP+RIYLR +    PL     +A ++HLPI + L   L
Sbjct  207   IAAVAETYIFASLPDLVLQAFLHPVRIYLRTQSINLPLTVCAGLAIVIHLPINYVLVVFL  266

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
              LGI+G+A+++ +AN   +L LL YI       + ++K     + S+ S    W  L+ L
Sbjct  267   GLGIKGVALASVLANLNLVLLLLAYIFL-----KGVHKRTGGFVLSAESF-RGWGELISL  320

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             ALPSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV
Sbjct  321   ALPSCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRV  380

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
              NELGAG+P +A  A  + ++L F    F      L R VW  +FT D  ++ LT  VLP
Sbjct  381   SNELGAGQPEEASRAATVGLMLGFAFGTFASAFAFLVRNVWASMFTADPAIVALTAAVLP  440

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             I+G+CEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A++MAF +  +FKGL +
Sbjct  441   ILGMCELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVMAFWFHFDFKGLWF  500

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEE  275
             GLLAAQ  C++ ML+VI RTDW  E+ R+K L G        D  +   +     +    
Sbjct  501   GLLAAQATCMVRMLLVIGRTDWAAEAKRSKQLTGAGAANMESDDRVAADKTSRLLVD---  557

Query  274   GVNLQK*YSHQKR  236
               ++++   H  R
Sbjct  558   -TDMKQSSDHSDR  569



>ref|NP_001053606.2| Os04g0571600 [Oryza sativa Japonica Group]
 emb|CAD41573.3| OSJNBa0088I22.5 [Oryza sativa Japonica Group]
 dbj|BAH01153.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF15520.2| Os04g0571600 [Oryza sativa Japonica Group]
Length=560

 Score =   378 bits (971),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 231/489 (47%), Positives = 316/489 (65%), Gaps = 10/489 (2%)
 Frame = -3

Query  1702  ELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLA  1523
             E R ++   FPMI  GL+ Y+++MI ++ +G LG L LAGG+LAIGF NITGYSVLSGLA
Sbjct  81    EARSILGLAFPMILTGLLLYLRSMISMLFLGHLGGLALAGGSLAIGFANITGYSVLSGLA  140

Query  1522  LGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHI  1343
             +GMEPI  QAFG+ N  ++ +T+QRT+ +L+ A++PIG LW  ++PL+L+  QDA I  +
Sbjct  141   MGMEPICGQAFGAGNYALLGVTMQRTVLLLIAAAIPIGGLWVQMRPLLLFCGQDAAIAAV  200

Query  1342  ASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGI  1163
             A  +   ++PDLV  + LHP+RIYLR +    PL     +A  +HLPI + L   L LG+
Sbjct  201   AETYIFASLPDLVLQAFLHPVRIYLRTQSINLPLTVCAGLAIAIHLPINYVLVVVLGLGV  260

Query  1162  QGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPS  983
             + +A+++ +AN   +LFLL YI       + ++K     L S+ S    W  L+ LALPS
Sbjct  261   KAVALASVLANLNLVLFLLAYIFL-----KGVHKRTGGFLLSAESF-RGWGELISLALPS  314

Query  982   CLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNEL  803
             C++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV NEL
Sbjct  315   CVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNEL  374

Query  802   GAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGL  623
             GAG+P +A  A  + +VL F   AF      L R VW  +FT D  ++ LT +VLPI+GL
Sbjct  375   GAGQPEEASRAATVGLVLGFGFGAFASAFAFLVRNVWASMFTADPAIVALTASVLPILGL  434

Query  622   CELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLA  443
             CEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A++MAF + L+F+GL +GLLA
Sbjct  435   CELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVMAFWFHLDFRGLWFGLLA  494

Query  442   AQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEGVNL  263
             AQ  C + ML+VI RTDW  E+ R+K L G        D  +   E     +      ++
Sbjct  495   AQATCTVRMLLVIGRTDWAAEAKRSKQLTGAGAANMESDDRVAADEKSRLPVD----TDV  550

Query  262   QK*YSHQKR  236
             ++   H  R
Sbjct  551   ERSSDHTDR  559



>ref|XP_009400058.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score =   378 bits (971),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 306/462 (66%), Gaps = 7/462 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             +   +  T  EV+EE+R +     P    GLI Y++ MI ++ +G LG LELAGG+L+IG
Sbjct  47    QDLHRWPTPSEVVEEMRAIGKISIPTALTGLIIYLRAMISMLFLGYLGELELAGGSLSIG  106

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSVLSGLA+GMEPI  QAFG++   ++ LTLQRT+ +LL  S+PI LLW N++ 
Sbjct  107   FANITGYSVLSGLAMGMEPICGQAFGARQRKLLGLTLQRTVLLLLCTSVPISLLWLNMRR  166

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD +I   A  F  FAIPDL   S LHP+RIYLR +  T+P+ + + ++ +LH+
Sbjct  167   ILLWCGQDEQISSTAQTFIAFAIPDLFFLSFLHPMRIYLRSQNITFPVTYCSFVSVVLHV  226

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ + L    K+G+ G+A++    N    + LL +IL++    ++   P +  L+     
Sbjct  227   PLNYILVVHWKMGVAGVALAMVWTNLNLFICLLLFILFSRVYKDSWVSPSSDCLRG----  282

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LL+LA+P+C++VCLEWWWYE M ++ G L+ P+ T+A+  I+IQTTSL+Y  PS
Sbjct  283   ---WSELLKLAIPTCVSVCLEWWWYELMIMMCGLLLNPKATVASMGILIQTTSLVYVFPS  339

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             ALS  +S+RVGNELG  RP KAR AT +++  A L     +  TT  R  W ++FT D E
Sbjct  340   ALSLGVSTRVGNELGGNRPAKARTATIVSLAAAVLLGLAAMTFTTSIRHRWGRLFTDDAE  399

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             +LELT   LPI GLCEL NCPQTT CGVLRGSARP+ GA IN  SFYL+GAP+AI++ FV
Sbjct  400   ILELTAVALPIAGLCELGNCPQTTGCGVLRGSARPSTGANINLGSFYLVGAPVAILLGFV  459

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               + F GL  GLLAAQ +C + M   ++ TDW  E+ +AK L
Sbjct  460   MGMGFPGLWLGLLAAQASCALLMAFALFNTDWMVEAEKAKAL  501



>ref|XP_009628917.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana tomentosiformis]
Length=517

 Score =   377 bits (967),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 225/476 (47%), Positives = 316/476 (66%), Gaps = 21/476 (4%)
 Frame = -3

Query  1771  NQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             NQ E+     +T++H T+   + E + M +   PMI +GL+ Y ++MI ++ +GRLG L 
Sbjct  14    NQNEQS----KTEQH-TLFLAISETKSMANIALPMIFIGLLLYSRSMISMLFLGRLGELS  68

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K   I+ L+LQRTI +LL+ S+PI
Sbjct  69    LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKILGLSLQRTILLLLLVSIPI  128

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
               LW N+K ++++  QD  I   A  +  ++IPDL A S LHPLRIYLR +    PL + 
Sbjct  129   SFLWCNMKQILVFCGQDHDIATQAQSYIIYSIPDLFALSFLHPLRIYLRSQSIIMPLTYC  188

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
               +A ++H+PI ++L   L LGI+G+A+S    NF  +  L+ YI+ +            
Sbjct  189   AALAILVHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLIAYIIVSGVHK--------  240

Query  1051  TNLKSSTSIGEE----WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
                K+ ++I +E    W  LL L++PSC++VCLEWWWYE M LL G L+ P+  +A+  I
Sbjct  241   ---KTWSAISKECFKGWKTLLNLSIPSCISVCLEWWWYEIMILLCGLLLNPKANVASMGI  297

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTSL+Y  PS+LS  +S+RVGNELGA RP +A+LA  I +  +F+     +    L 
Sbjct  298   LIQTTSLIYIFPSSLSVGVSTRVGNELGANRPNQAKLAAIIGLCYSFIFGLLALSFAILV  357

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             R +W  ++T D E++ LT  +LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY
Sbjct  358   RNIWASMYTQDQEIIALTSIILPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFY  417

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIY-RTDWEKESARAKDL  359
             L+G P+AI + F    +FKGL  GLLAAQ +C ++ML++I  RT+WE ++ RAK+L
Sbjct  418   LVGMPVAIYLGFFRGYDFKGLWIGLLAAQASCAVTMLLIILARTNWEDQAKRAKEL  473



>ref|XP_009786207.1| PREDICTED: MATE efflux family protein LAL5-like [Nicotiana sylvestris]
Length=530

 Score =   377 bits (968),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 220/462 (48%), Positives = 308/462 (67%), Gaps = 10/462 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             KQ  +  T  ++++E R++    FP+    L  Y ++++ ++ +G LG  ELA G+LAI 
Sbjct  45    KQIHEKITASQIIQESREVFKLAFPIALTALTFYSRSILSMLFLGHLGDTELAAGSLAIA  104

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSVLSGLALGMEP+ SQAFG++   ++SLTLQR++  LL   LPI  LW N+  
Sbjct  105   FANITGYSVLSGLALGMEPLCSQAFGAQRPKLLSLTLQRSVVFLLSCCLPITFLWVNISH  164

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++L+LHQD  I  +A  +  F++PDL+ NS+ HP+RIYLR +G T+PL  ++L  T+LHL
Sbjct  165   ILLYLHQDPNITRLAHTYLVFSLPDLITNSLFHPIRIYLRAQGITYPLTLASLAGTVLHL  224

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ + L   L+LG+ G+AI++  +N   L+ L+ Y+++         KP  T  K S   
Sbjct  225   PLNYLLVSLLQLGVAGVAIASATSNVAALVALVFYVVHD--------KPTWT--KPSLEC  274

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W+ L+RLA PSC++VCLEWWWYE M LL G LV P+ T+A+  I+IQTT+ +Y  PS
Sbjct  275   LTGWMPLVRLAAPSCVSVCLEWWWYEIMILLCGLLVDPKATVASMGILIQTTAFLYVFPS  334

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS ++S+RVGNELGA RP KARL+  ++I LA L     ++  T  R  W K+FT D  
Sbjct  335   SLSFAVSTRVGNELGANRPDKARLSATVSIFLAGLMGLSAMVFATTMRNSWAKMFTYDVR  394

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             ++ELT TVLPI+GLCEL NCPQT  CGV+RG+ARP   A +N  +FYL+G P+A+ + F 
Sbjct  395   IIELTSTVLPILGLCELGNCPQTVGCGVVRGTARPTTAANVNLGAFYLVGMPVAVGLGFW  454

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               L F GL  GLLAAQV C   ML V+  T+W+ ++ RAK L
Sbjct  455   IGLGFVGLWVGLLAAQVCCAGLMLYVVGTTNWDCQAMRAKVL  496



>ref|XP_004511602.1| PREDICTED: MATE efflux family protein 5-like [Cicer arietinum]
Length=530

 Score =   377 bits (967),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 223/487 (46%), Positives = 321/487 (66%), Gaps = 14/487 (3%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             KQ  K S     + E + + +   PM+  GL+ Y +++I ++ +GR+G L LAGG+LAIG
Sbjct  46    KQQHKKSHFSLALNEAKYIANIALPMVLTGLLLYSRSIISMLFLGRVGELALAGGSLAIG  105

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYS+LSGLA+GMEPI  QAFG+K   ++ LT+QRT  +LL+ S+ I  LW N+K 
Sbjct  106   FANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTMQRTTILLLVTSIFISFLWLNMKK  165

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++++  Q   I ++A  +  +++PDL+A S+LHPLRIYLR +  T PL +S  ++ +LH+
Sbjct  166   ILIFCGQQEDIANVAQSYIIYSLPDLIAQSLLHPLRIYLRSQSITLPLTYSATLSILLHV  225

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             PI +YL   LKLGI+GIA+     NF  ++ L+ YI  +    +       T    S++ 
Sbjct  226   PINYYLVSVLKLGIKGIALGAVWTNFNLVVSLIIYIWVSGTHKK-------TWPGFSSAC  278

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
              + W  LL LA+PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTT+L+Y  PS
Sbjct  279   FKRWKPLLNLAIPSCISVCLEWWWYEIMILLCGLLINPQATVASMGILIQTTALIYIFPS  338

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS  +S+RVGNELGA  P +A+LA  + +  +F    F +      R +W  +FT D E
Sbjct  339   SLSFGVSTRVGNELGAENPQRAKLAALVGLCFSFFLGFFALFFAISVRNIWASMFTNDVE  398

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             ++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+ ++F 
Sbjct  399   IIALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVAVWLSFF  458

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKE  305
                +FKGL +GLLAAQ +C+++ML V++RT+WE +  RAK+L          DP  + +E
Sbjct  459   AGFDFKGLWFGLLAAQGSCMLTMLFVLFRTNWECQVQRAKELTS-------SDPSEEEEE  511

Query  304   GEEFRIS  284
              ++F +S
Sbjct  512   EDKFFVS  518



>emb|CDP20804.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   375 bits (964),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 325/470 (69%), Gaps = 11/470 (2%)
 Frame = -3

Query  1753  MAAKQTQKHS-TIP---EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslela  1586
             MA K ++  S  IP   +V+EE++++     P+ AM  + Y++ ++ V+ +GRLGSLELA
Sbjct  1     MAEKDSEFFSHKIPSSFQVVEEMKELWSMALPITAMNCLVYVRAVVSVLFLGRLGSLELA  60

Query  1585  ggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGL  1406
             GGAL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++S++LQR I +L +A +PI L
Sbjct  61    GGALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSISLQRMIFILFLAIIPISL  120

Query  1405  LWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTL  1226
             LW NL+ +M++L QD +I  +AS++C +++PDL+ N++L PLR+YLR +G T P LW T 
Sbjct  121   LWVNLESIMVFLGQDIEITRMASVYCLYSLPDLLTNTLLQPLRVYLRSQGVTKPQLWCTF  180

Query  1225  IATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATN  1046
             +A + H+P+ + L   + LG+ G+A+++ + N   ++ L+GY+          +K +A  
Sbjct  181   VAVIFHVPLNYVLVVVMGLGVPGVAMASVLTNLHMVVLLVGYVYVWGRWE---WKCMAGM  237

Query  1045  LKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTS  866
                          LL+LA+PSC+ +CLEWWWYE +T+LAGYL  P++ +A   I+IQTTS
Sbjct  238   GGGICGGVGP---LLKLAVPSCIGICLEWWWYEIVTVLAGYLPNPRLAVAATGILIQTTS  294

Query  865   LMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVK  686
             LMYT+P ALS  +S+RVGNELGAG+P KA+LA  +A+  AF+     I+ T + R  W  
Sbjct  295   LMYTVPMALSGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGFVNIIWTVMFRHKWGG  354

Query  685   IFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPL  506
             +FT D  +  L  +VLPIIG CEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+
Sbjct  355   LFTEDDMLKALVASVLPIIGSCELGNCPQTTGCGILRGTARPVVGARINLGSFYFVGTPV  414

Query  505   AIIMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
             A+ +AF + + F GL +GLL+AQ AC IS+L +V+  TDWE ES +AK L
Sbjct  415   AVGLAFWFHVGFSGLWFGLLSAQAACAISILYVVLVCTDWESESLKAKKL  464



>ref|XP_003611148.1| Multidrug and toxin extrusion protein [Medicago truncatula]
 gb|AES94106.1| MATE efflux family protein [Medicago truncatula]
Length=539

 Score =   377 bits (968),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 215/461 (47%), Positives = 313/461 (68%), Gaps = 7/461 (2%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             + QK +     + E + + +   PM+  GL+ Y +++I ++ +GR+G L LAGG+LAIGF
Sbjct  53    KQQKKTHFSLALNEAKHISNIALPMVLTGLLLYSRSIISMLFLGRVGELALAGGSLAIGF  112

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYS+LSGLA+GMEPI  QAFG+K   ++ LT+QRT+ +LL+ S+ I  LW N+K L
Sbjct  113   ANITGYSILSGLAMGMEPICGQAFGAKRFKLLGLTMQRTVILLLVTSIFISFLWLNMKRL  172

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L   Q   I ++A  +  +++PDLVA S+LHPLRIYLR +  T PL +S  ++ +LH+P
Sbjct  173   LLLCGQQEDIANVAQSYILYSLPDLVAQSLLHPLRIYLRSQSITLPLTYSATLSILLHIP  232

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             I ++L   L+LGI+GIA+ +   NF  ++ L+ YI  +       +K   + + S+   G
Sbjct  233   INYFLVNVLQLGIRGIALGSVWTNFNLVVSLIIYIWVSGT-----HKKTWSGISSACFKG  287

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
               W  LL LA+PSC++VCLEWWWYE M LL G L+ P  T+A+  ++IQTT+L+Y  PS+
Sbjct  288   --WKSLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPHATVASMGVLIQTTALIYIFPSS  345

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA  P KA+LA  + +  +F+     +      R +W  +FT+D ++
Sbjct  346   LSFGVSTRVGNELGAENPQKAKLAAIVGLCFSFVLGFSALFFAFSVRNIWATMFTSDPQI  405

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             + LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL+G P+A+ ++F  
Sbjct  406   IALTSMVLPIIGLCELGNCPQTTVCGVLRGTARPKLGANINLGCFYLVGMPVAVWLSFFA  465

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               +FKGL +GL+AAQ +C+I+ML V+ RT+WE ++ RAK+L
Sbjct  466   GFDFKGLWFGLMAAQGSCMITMLFVLVRTNWENQAERAKEL  506



>ref|XP_011074913.1| PREDICTED: MATE efflux family protein 5-like [Sesamum indicum]
 ref|XP_011074914.1| PREDICTED: MATE efflux family protein 5-like [Sesamum indicum]
Length=493

 Score =   375 bits (964),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 227/493 (46%), Positives = 328/493 (67%), Gaps = 12/493 (2%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             +K     + K  +  +V+EEL+++     P+ AM  + Y++ ++ V+ +GRLGSLELAGG
Sbjct  3     DKSPDFNSHKFPSSSQVVEELKELWSMALPITAMNCLVYVRAVVSVLFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+L R I ML +A +PI +LW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWELLSLSLHRMIFMLFLAIIPISVLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +ML++ QD  I  +A+++C ++IPDL+ N+ L PLR+YLR +G T P +W TL+A
Sbjct  123   VNLESIMLFMGQDKDITSMAAIYCIYSIPDLLTNTFLQPLRVYLRSQGVTKPQMWCTLMA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              + H+P+ + L   + LG+ G+A+++ + N   ++ ++GY+       E  +K       
Sbjct  183   VIFHVPLNYVLVVVMGLGVPGVAMASVLTNLHMMVLMMGYVCVYGRW-EWKWKAGIGGGC  241

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                        LL+LA+PSC+ +CLEWWWYE +T+LAGYL  P++ +A   I+IQTTSLM
Sbjct  242   GGVGP------LLKLAVPSCIGICLEWWWYEIVTVLAGYLPNPKLAVAATGIMIQTTSLM  295

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF      ++ T + RE W   F
Sbjct  296   YTVPMALAGCVSARVGNELGAGKPYKAKLAARVALACAFAIGFINVIWTVIFREKWGGFF  355

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             TTD E+  L  +VLPIIGLCEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+
Sbjct  356   TTDDELKALVASVLPIIGLCELGNCPQTTGCGILRGTARPVVGAHINLGSFYFVGTPIAV  415

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVI-YRTDWEKESARAKDL----VGESRETS  335
              +AF   + F GL  GLL+AQ AC +S+L VI Y T+WE E+ +A +L    +G    T 
Sbjct  416   GLAFWLSIGFTGLWLGLLSAQAACAVSILYVIFYCTNWEGEAVKASELSSLEMGNKCGTD  475

Query  334   FEDPMIKFKEGEE  296
              E+  +   E E+
Sbjct  476   EEEKRLLVMEKEK  488



>ref|XP_004140853.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cucumis 
sativus]
Length=498

 Score =   375 bits (963),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 315/491 (64%), Gaps = 10/491 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T+Q  +    + T  H ++   ++E   +    FPM+   L+ Y +++I ++ +GRLG L
Sbjct  14    TSQHFQLPTKQTTNTHFSL--AIQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGEL  71

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +L + S+P
Sbjct  72    PLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTILLLSLTSIP  131

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I  LWFN+K ++L   QD  I   A LF  +++PDL A S++HPLRIYLR +  T PL +
Sbjct  132   IAFLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLTF  191

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 + +LH+PI ++L   L  GI+G+AI+    NF  +  L+ YIL      +      
Sbjct  192   CAAFSILLHIPINYFLVSYLNFGIRGVAIAGVWTNFNLVASLILYILVFRVHKD------  245

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
              T    S    +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQ
Sbjct  246   -TWGGFSLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQ  304

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TT+L+Y  PS+LS S+S+RVGNELGA +P KARLA  + +  +F+     +      R++
Sbjct  305   TTALIYIFPSSLSFSVSTRVGNELGAEQPKKARLAAIVGLFCSFVLGICALFFAVSIRKI  364

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA IN   FYL+G
Sbjct  365   WASMFTDDKDIIGLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVG  424

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE-T  338
              P+A+ ++F    +F+GL  GLLAAQ  C  +ML+V+  TDWE E+ RA+ L G   +  
Sbjct  425   MPVAVGLSFYGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEQVV  484

Query  337   SFEDPMIKFKE  305
               E  M K K+
Sbjct  485   EAESLMPKNKQ  495



>ref|XP_006840487.1| hypothetical protein AMTR_s00045p00191740 [Amborella trichopoda]
 gb|ERN02162.1| hypothetical protein AMTR_s00045p00191740 [Amborella trichopoda]
Length=484

 Score =   375 bits (962),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 215/488 (44%), Positives = 314/488 (64%), Gaps = 14/488 (3%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             Q      +  V +EL+++     P  A  L  + + +I  +C+G LG + LAGG+LA+ F
Sbjct  8     QEGHSHRLDLVWDELKRIGFIALPSTATALTGHARGLISALCLGLLGPINLAGGSLALAF  67

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              N+T  S+LSGLALGMEP+ +QA GS N  ++  TL RT+++L + +L I  LW  +KPL
Sbjct  68    INVTSQSLLSGLALGMEPLCTQAAGSNNFLLLYTTLLRTMALLAIFALVIAPLWLAMKPL  127

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
              L L QD+++  +A+++C+ A+P L A  +  P+R+Y+RC+G    ++W   +  ++HL 
Sbjct  128   ALALGQDSEVATVAAVYCKAALPTLAAACLGLPMRVYMRCRGWVGAMVWCGAVGVVVHLL  187

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             + + L F + + ++G+A++ ++A       +   +        A  +            G
Sbjct  188   LAWILVFRVGMELKGVAVAGWLAEAGVAGLMSVCVERGKSSRVAGLRG-----------G  236

Query  1021  EE--WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
             EE  W  L+R+A+PSC+ VCLEWWWYE MTLLAGYL  P+VTLA A I+IQTTSLMYT+P
Sbjct  237   EEGGWKELMRMAVPSCVGVCLEWWWYELMTLLAGYLYNPKVTLAAAGIIIQTTSLMYTIP  296

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdt  668
               LS + S+RVGN LG  RP +AR+AT +A+ LA +AS   +  T L R+ W  +FT D 
Sbjct  297   VGLSAAASTRVGNALGGDRPDRARIATWVAMSLAVIASLLCLTWTILARKQWAGLFTNDE  356

Query  667   evleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAF  488
             EVLEL +  LP+IGLCE+ NCPQTT CGVLRGSARP IGA IN YSFYL+G P+ I +AF
Sbjct  357   EVLELVMGALPVIGLCEIGNCPQTTACGVLRGSARPAIGATINLYSFYLVGTPIGIALAF  416

Query  487   VWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG-ESRETSFEDPMIKF  311
              + + F GLCYGLL AQ+ C +S+++V+ RTDW+KE+ +AK +VG +S E++ E      
Sbjct  417   GFDMGFVGLCYGLLCAQLVCSMSIVLVVLRTDWDKEALKAKHIVGIDSHESNLEVVEACL  476

Query  310   KEGEEFRI  287
             K   + ++
Sbjct  477   KMNRQIKV  484



>ref|XP_009387104.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   376 bits (966),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 226/462 (49%), Positives = 301/462 (65%), Gaps = 7/462 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             +   +   + E  EE+R +     P    GL+ Y + MI ++ +G LG LELAGG+L+IG
Sbjct  11    QDLHRCPGLAEAAEEMRAIGKISIPTALTGLVLYSRAMISMLFLGGLGQLELAGGSLSIG  70

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSVL GLA+GMEPI  QAFG+K   ++ LTLQRTI +LL AS+PI  LW N+K 
Sbjct  71    FANITGYSVLFGLAMGMEPICGQAFGAKQRKLLGLTLQRTILLLLSASIPIAFLWLNMKR  130

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD +I   A +F  FAIPDL   S+LHPLRIYLR +  T+P+ + +L++ +LHL
Sbjct  131   ILLWCGQDERISSTAHIFITFAIPDLFFLSVLHPLRIYLRSQNITFPVTYCSLVSVVLHL  190

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ + L   LK+GI G+A++    N    + LL ++L +    ++  +P    L+     
Sbjct  191   PLNYLLVVHLKMGIAGVALAMVWTNLNLFICLLLFVLCSGVCKDSWVRPSMDCLRG----  246

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LL+LA PSC++VCLEWWWYEFM L +G L  P+  +A+  I+IQTTSL+Y  PS
Sbjct  247   ---WSTLLKLAAPSCVSVCLEWWWYEFMVLFSGLLANPKAAVASMGILIQTTSLVYVFPS  303

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             ALS  +S+RVGNELGA RP KAR A  +++  A L     ++ TT  R  W ++FT D E
Sbjct  304   ALSLGVSTRVGNELGANRPAKARTAAVVSLACAVLLGLAAMVFTTSMRHQWGRLFTNDAE  363

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
              L+LT   LPI GLCEL NCPQTT CGVLRGSARP  GA IN  SFYL+G P+AI+++FV
Sbjct  364   TLKLTALALPIAGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLIGLPVAILLSFV  423

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              K+   GL  GLLAAQ +C   M  V+  TDW  E  RA++L
Sbjct  424   GKMGLPGLWLGLLAAQASCAAIMAYVLAGTDWRMEVERAREL  465



>gb|EAZ31690.1| hypothetical protein OsJ_15838 [Oryza sativa Japonica Group]
Length=560

 Score =   377 bits (968),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 230/489 (47%), Positives = 315/489 (64%), Gaps = 10/489 (2%)
 Frame = -3

Query  1702  ELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLA  1523
             E R ++   FPMI  GL+ Y+++MI ++ +G LG L LAGG+LAIGF NITGYSVLSGLA
Sbjct  81    EARSILGLAFPMILTGLLLYLRSMISMLFLGHLGGLALAGGSLAIGFANITGYSVLSGLA  140

Query  1522  LGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHI  1343
             +GMEPI  QAFG+ N  ++ +T+QRT+ +L+ A++PIG LW  ++PL+L+  QDA I  +
Sbjct  141   MGMEPICGQAFGAGNYALLGVTMQRTVLLLIAAAIPIGGLWVQMRPLLLFCGQDAAIAAV  200

Query  1342  ASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGI  1163
             A  +   ++PDLV  + LHP+RIYLR +    PL     +A  +HLPI + L   L LG+
Sbjct  201   AETYIFASLPDLVLQAFLHPVRIYLRTQSINLPLTVCAGLAIAIHLPINYVLVVVLGLGV  260

Query  1162  QGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPS  983
             + +A+++ +AN   +LFLL YI       + ++K     L S+ S    W  L+ LALPS
Sbjct  261   KAVALASVLANLNLVLFLLAYIFL-----KGVHKRTGGFLLSAESF-RGWGELISLALPS  314

Query  982   CLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNEL  803
             C++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV NEL
Sbjct  315   CVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNEL  374

Query  802   GAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGL  623
             G G+P +A  A  + +VL F   AF      L R VW  +FT D  ++ LT +VLPI+GL
Sbjct  375   GGGQPEEASRAATVGLVLGFGFGAFASAFAFLVRNVWASMFTADPAIVALTASVLPILGL  434

Query  622   CELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLA  443
             CEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A++MAF + L+F+GL +GLLA
Sbjct  435   CELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVMAFWFHLDFRGLWFGLLA  494

Query  442   AQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEGVNL  263
             AQ  C + ML+VI RTDW  E+ R+K L G        D  +   E     +      ++
Sbjct  495   AQATCTVRMLLVIGRTDWAAEAKRSKQLTGAGAANMESDDRVAADEKSRLPVD----TDV  550

Query  262   QK*YSHQKR  236
             ++   H  R
Sbjct  551   ERSSDHTDR  559



>gb|EPS65920.1| hypothetical protein M569_08857 [Genlisea aurea]
Length=508

 Score =   375 bits (963),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 222/493 (45%), Positives = 318/493 (65%), Gaps = 11/493 (2%)
 Frame = -3

Query  1771  NQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             N   + +     +   ++ + +EE++++     P    GLI Y + MI +V +G LG LE
Sbjct  11    NAHNDDVHDPSLRAFPSLSQGIEEVKEIGKLSGPTAVTGLILYSRAMISMVFLGYLGELE  70

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGG+L+IG  NITGYSV+SGLA+GMEPI  QAFG+K + ++ LTLQRTI +LL AS PI
Sbjct  71    LAGGSLSIGVANITGYSVISGLAMGMEPICGQAFGAKQMKLLGLTLQRTILLLLTASFPI  130

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
              L+W N+K ++LW +QD +I  +A  F  FA+PDL   S LHPLRIYLR +G T P+ + 
Sbjct  131   SLIWVNMKRILLWCNQDEEISTMAQNFIVFAVPDLFVLSFLHPLRIYLRTQGITLPVTYL  190

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
             + ++ +LH+P+   L   LK+G+ GIA++  + N   +L +  Y+ ++      +YKP  
Sbjct  191   SSVSVLLHVPLNLILVRYLKMGVGGIALAMALTNLNLVLLMGFYVYFS-----GVYKP--  243

Query  1051  TNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQT  872
             + +  S      W  LL LA+P+C++VCLEWWWYE M +L+G L  P  T+++  I+IQT
Sbjct  244   SWVAPSMDCLRGWTTLLSLAVPTCISVCLEWWWYEIMIMLSGLLPNPTATISSMGILIQT  303

Query  871   TSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVW  692
             TSL+Y  PS+LS  +S+RV NELGA RP +AR++  +++V A       +  T   R+ W
Sbjct  304   TSLVYVFPSSLSLGVSTRVSNELGARRPARARVSAIVSMVAAAALGVIAMGFTVAIRKRW  363

Query  691   VKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGA  512
              ++FT+D E+L+LT   LPI+GLCEL NCPQTT CGVLRG+ARP +GA IN  SFYL+G 
Sbjct  364   GRLFTSDAEILKLTAAALPIVGLCELGNCPQTTGCGVLRGTARPTLGANINLGSFYLVGM  423

Query  511   PLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESR----  344
             P+A++  FV+KL F GL  GLLAAQ  C   M   +YR DW  +  RAK+L  +S     
Sbjct  424   PVALLTGFVFKLGFPGLWLGLLAAQGCCAAMMTAALYRIDWTAQVERAKELCRDSSSGAG  483

Query  343   ETSFEDPMIKFKE  305
             +T+ + P +   E
Sbjct  484   KTTDDAPDVIDNE  496



>ref|XP_004173805.1| PREDICTED: multidrug and toxin extrusion protein 2-like [Cucumis 
sativus]
Length=498

 Score =   375 bits (962),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 315/491 (64%), Gaps = 10/491 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T+Q  +    + T  H ++   ++E   +    FPM+   L+ Y +++I ++ +GRLG L
Sbjct  14    TSQHFQLPTKQTTNTHFSL--AIQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGEL  71

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +L + S+P
Sbjct  72    PLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTILLLSLTSIP  131

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I  LWFN+K ++L   QD  I   A LF  +++PDL A S++HPLRIYLR +  T PL +
Sbjct  132   IAFLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLTF  191

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 + +LH+PI ++L   L  GI+G+AI+    NF  +  L+ YIL      +      
Sbjct  192   CAAFSILLHIPINYFLVSYLNFGIRGVAIAGVWTNFNLVASLILYILVFRVHKD------  245

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
              T    S    +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQ
Sbjct  246   -TWGGFSLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQ  304

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TT+L+Y  PS+LS S+S+RVGNELGA +P KARLA  + +  +F+     +      R++
Sbjct  305   TTALIYIFPSSLSFSVSTRVGNELGAEQPKKARLAAIVGLSCSFVLGICALFFAVSIRKI  364

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA IN   FYL+G
Sbjct  365   WASMFTDDKDIIGLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVG  424

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE-T  338
              P+A+ ++F    +F+GL  GLLAAQ  C  +ML+V+  TDWE E+ RA+ L G   +  
Sbjct  425   MPVAVGLSFYGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEQVV  484

Query  337   SFEDPMIKFKE  305
               E  M K K+
Sbjct  485   EAESLMPKNKQ  495



>ref|XP_009615001.1| PREDICTED: MATE efflux family protein 5 [Nicotiana tomentosiformis]
Length=552

 Score =   376 bits (966),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 225/485 (46%), Positives = 308/485 (64%), Gaps = 9/485 (2%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHS--TIPEVMEELRKMIDTCFPMIAMGLISYMKNMILV  1622
              K    N+++  +  A  +   H   T  E  EE++++     P    GL+ Y ++MI +
Sbjct  16    EKAHFVNSHKPMDFQADDEELLHRWPTPTEAFEEIKEIGKISGPTALTGLVLYSRSMISM  75

Query  1621  VCMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTI  1442
             + +G LG LELAGG+L+IGF NITGYSV+SGLA+GMEPI  QA+G+K + ++ +TLQRT+
Sbjct  76    LFLGYLGELELAGGSLSIGFANITGYSVISGLAMGMEPICGQAYGAKQMKLLGITLQRTV  135

Query  1441  SMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRC  1262
              +LL  S+PI  +W N+K ++LW  QD  I  +A  F  FAIPDL   S+LHPLRIYLR 
Sbjct  136   LLLLSTSIPISFMWLNMKRILLWCGQDEDISSMAHTFIVFAIPDLFFLSLLHPLRIYLRT  195

Query  1261  KGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNE  1082
             +  T PL + + I+ +LH+P+ F L     LGI G+A++    N    L L  +I ++  
Sbjct  196   QNITLPLTYCSAISVLLHVPLNFLLVRYFNLGIAGVALAMVWTNLNLFLLLCSFIYFSGV  255

Query  1081  QNEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVT  902
               ++   P       S      W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T
Sbjct  256   YKDSWVVP-------SMDCVRGWSSLLGLAIPTCVSVCLEWWWYEFMIMLCGLLANPKAT  308

Query  901   LATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGI  722
             +A+  I+IQTTSL+Y  PSALS  +S+RVGNELGA RP +AR++  +++  A       +
Sbjct  309   IASMGILIQTTSLVYVFPSALSLGVSTRVGNELGANRPARARISMIVSLFCAIGLGLGAM  368

Query  721   LLTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACI  542
             L TTL +  W   FT D E+L+LT   LPI+GLCEL NCPQTT CGVLRGSARP IGA I
Sbjct  369   LFTTLMKHKWGLFFTKDVEILKLTSIALPIVGLCELGNCPQTTGCGVLRGSARPTIGANI  428

Query  541   NFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKD  362
             N  SFYL+G P+A I+ F+ K+ F GL  GLLAAQ +C   ML V+ +TDW+ +  R+K 
Sbjct  429   NLGSFYLVGMPVAFILGFILKMGFAGLWLGLLAAQASCATLMLCVLCKTDWKVQVERSKQ  488

Query  361   LVGES  347
             L   S
Sbjct  489   LTQSS  493



>ref|XP_002326006.2| hypothetical protein POPTR_0019s11600g [Populus trichocarpa]
 gb|EEF00388.2| hypothetical protein POPTR_0019s11600g [Populus trichocarpa]
Length=501

 Score =   374 bits (961),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 214/468 (46%), Positives = 320/468 (68%), Gaps = 7/468 (1%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  +  +V EEL+++     P+ A  L+++ + ++ V+ +GRLGSLELAGG
Sbjct  3     EKDPDFYSHKLPSASQVFEELKELWGMALPITAAHLMAFFRAVVSVMFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L +A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMIVILGIAIIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +M ++ QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P+++ +L+A
Sbjct  123   LNLESIMNFMGQDPNITAMAATYCMYSLPDLLTNTLLQPLRVFLRSQRVTKPIMYCSLLA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              + H+P+ + L   +  G+ G+A+++ V N   ++ ++GY+ + + + E  ++     + 
Sbjct  183   VIFHVPLNYALVVVMGWGVPGVALASVVTNMNMVMLMVGYVWWVSGRWEMRWRVEIGGVC  242

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                        LL++A+PSCL +CLEWWWYE +T+LAGYL  P + +A   I+IQTTS+M
Sbjct  243   GGLG------PLLKVAVPSCLGICLEWWWYEIVTVLAGYLPNPTLAVAATGILIQTTSMM  296

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T   RE W  +F
Sbjct  297   YTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGVLNVTWTVFLRERWAGLF  356

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  V  L   VLPIIGLCEL NCPQTT CG+LR +ARP +GA IN  SFY +G P+A+
Sbjct  357   TKDVLVKGLVAAVLPIIGLCELGNCPQTTGCGILRATARPAVGARINLGSFYFVGTPVAV  416

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
              +AF   + F GL +GLL+AQ+AC +S+L +V+ RTDWE E+ +AK+L
Sbjct  417   GLAFGLNIGFSGLWFGLLSAQIACALSILYVVMVRTDWEHEAFKAKEL  464



>gb|KHN39984.1| Multidrug and toxin extrusion protein 1 [Glycine soja]
Length=544

 Score =   376 bits (965),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 223/464 (48%), Positives = 303/464 (65%), Gaps = 10/464 (2%)
 Frame = -3

Query  1738  TQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFT  1559
             T+ H   P+ + E++ +     P    GLI Y + MI ++ +G LG +ELAGG+L+IGF 
Sbjct  16    TKSH---PKAIAEMKAIGRISGPTAITGLILYSRAMISMIFLGYLGEMELAGGSLSIGFA  72

Query  1558  NITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLM  1379
             NITGYSV+SGLA+GMEPI  QA+G+K   I+ LTLQRT+ +LL  S+PI  +W N+  ++
Sbjct  73    NITGYSVISGLAMGMEPICGQAYGAKQWKILGLTLQRTVLLLLSTSIPISFMWLNMMRIL  132

Query  1378  LWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPI  1199
             LW  QD +I  +A  F  F+IPDL   S+LHP+RIYLR +  T PL + + I+ +LH+P+
Sbjct  133   LWSGQDQEIASVAQTFITFSIPDLFLLSLLHPIRIYLRTQSITLPLTYCSAISVLLHVPL  192

Query  1198  VFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGE  1019
              F L   LK+GI G+A +  + N   +L +  ++ ++     +   P    +K       
Sbjct  193   NFLLVVHLKMGIAGVATAMVLTNLNLILLISSFVYFSGAYKASWVPPSVDCIKG------  246

Query  1018  EWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSAL  839
              W  LL LA+P+C++VCLEWWWYEFM +L G LV P+ T+A+  I+IQTTSL+Y  PS+L
Sbjct  247   -WSSLLSLAIPTCVSVCLEWWWYEFMIMLCGLLVSPKATIASMGILIQTTSLVYVFPSSL  305

Query  838   SNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevl  659
             S  +S+RVGNELGA  P KAR++  +++  A       +L TTL R  W + FT D E+L
Sbjct  306   SLGVSTRVGNELGANNPRKARVSMIVSLFCAVALGLAAMLFTTLMRHQWGRFFTNDHEIL  365

Query  658   eltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWK  479
             E+T  VLPI GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P+AI++ FV K
Sbjct  366   EITSLVLPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAILLGFVAK  425

Query  478   LEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGES  347
             + F GL  GLLAAQ +C   ML V+  TDW  +  RAK+L   S
Sbjct  426   MGFAGLWLGLLAAQASCAGLMLYVLCTTDWNVQVERAKELTKNS  469



>ref|XP_009389312.1| PREDICTED: MATE efflux family protein LAL5-like [Musa acuminata 
subsp. malaccensis]
Length=539

 Score =   375 bits (964),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 226/463 (49%), Positives = 305/463 (66%), Gaps = 6/463 (1%)
 Frame = -3

Query  1741  QTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGF  1562
             Q +  +++   + E + ++    PM+  GL+ Y ++MI ++ +GRLG L LAGGALAIGF
Sbjct  45    QPKPPNSVTLALIEAKSILSLALPMVLTGLLLYSRSMISMLFLGRLGDLPLAGGALAIGF  104

Query  1561  TNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPL  1382
              NITGYSVLSGLA+GMEPI  QAFG++   ++ L L RT+ +LL ASLPI LLWF ++P+
Sbjct  105   ANITGYSVLSGLAMGMEPICGQAFGAQRHRLLGLALHRTVLLLLFASLPIALLWFYIRPI  164

Query  1381  MLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLP  1202
             +L L QD  +   AS +   ++PDL+  S LHPLRIYLR +  T PL     I+  LHLP
Sbjct  165   LLLLGQDPALAAAASAYLHASLPDLLLQSFLHPLRIYLRTQSITLPLTACAAISVALHLP  224

Query  1201  IVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIG  1022
             I + L   L+LGI G+A+++   N   +LFL+ YI  ++             L  ST   
Sbjct  225   ISYLLVSVLRLGIGGVALASVWTNVNLVLFLVAYIYLSDLHRST------GGLSFSTECF  278

Query  1021  EEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSA  842
              +W  LL LA+PSC++VCLEWWWYE M +L G L+ PQ T+A+  I+IQTTSL+Y  PS+
Sbjct  279   RDWRPLLNLAVPSCVSVCLEWWWYEIMIILCGLLLNPQATVASMGILIQTTSLIYIFPSS  338

Query  841   LSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtev  662
             LS  +S+RVGNELGA RP +AR A  + +  +F    F    +   R  W  +FT D+ +
Sbjct  339   LSFGVSTRVGNELGANRPDRARRAATVGLSCSFALGLFAFCFSVSVRHAWATMFTADSAI  398

Query  661   leltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVW  482
             L LT +VLPI+GLCE  NCPQTT CGVLRGSARP++GA +N  SFY +G P+A+ +AF  
Sbjct  399   LGLTSSVLPILGLCEFGNCPQTTGCGVLRGSARPSVGANVNLGSFYAVGMPVAVGLAFFT  458

Query  481   KLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG  353
              L+FKGL  GLLAAQ  CV+ ML+VI RTDW  ++ RA+ L G
Sbjct  459   GLDFKGLWLGLLAAQTTCVLLMLLVIKRTDWITQAERAQQLTG  501



>ref|XP_008381014.1| PREDICTED: MATE efflux family protein 5 [Malus domestica]
 ref|XP_008381015.1| PREDICTED: MATE efflux family protein 5 [Malus domestica]
Length=505

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 228/495 (46%), Positives = 333/495 (67%), Gaps = 15/495 (3%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  +  +V EELR++    FP+ AM  + +++  + V+ +GRLGSLELAGG
Sbjct  3     EKDPDICSHKFPSASQVWEELRELWGMAFPITAMNCLVFVRAAVSVLFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQAFG+KN  ++SL+LQR + +LL+A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLMGLASGLEPVCSQAFGNKNYDLLSLSLQRMVLILLLAVIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +M+++ QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P+++ +LIA
Sbjct  123   INLQSIMVFMGQDKAITAMAATYCLYSLPDLLTNTVLQPLRVFLRSQKVTKPMMYCSLIA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
                H+P+   L   + LG+ G+A+++ + N    + + GY+ +   + E  +     +L 
Sbjct  183   VAFHVPLNVVLVVVMGLGVPGVAVASVLTNMNMAVLMAGYVWWGXRKGEXRWTFGIGDLC  242

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
             S   IG     LL+LA+PSCLA+CLEWWWYE +T++AGYL  P + +A   I+IQTTS+M
Sbjct  243   SG--IGP----LLKLAVPSCLAICLEWWWYEIVTVMAGYLPNPTLAVAATGILIQTTSMM  296

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL   +S+RVGNELG G+P KA+LA  +A+  AF+     +  T + RE W  +F
Sbjct  297   YTVPLALCGCVSARVGNELGCGKPYKAKLAAMVALGCAFVIGIINVTWTVILRERWAGLF  356

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  V  L  +V+PI+G+CEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+
Sbjct  357   TKDELVKALVASVMPIMGICELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAV  416

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL----VGESRETS  335
              +AF  K+ F GL +GLL+AQVAC +S+L +V+ RTDWE ES  A+ L    +GE R+  
Sbjct  417   GLAFWLKVGFPGLWFGLLSAQVACAVSILYVVVARTDWEAESLNARMLTGLEMGECRDKR  476

Query  334   FEDPMIKFKEGEEFR  290
              E      K+ EE +
Sbjct  477   QEHE----KDEEESK  487



>gb|KCW90739.1| hypothetical protein EUGRSUZ_A02813, partial [Eucalyptus grandis]
Length=465

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 286/442 (65%), Gaps = 16/442 (4%)
 Frame = -3

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYS+LSGLA+GMEPI SQAFG+K   ++ L+LQRT+ +L++ SLPI  LW N+K 
Sbjct  24    FANITGYSILSGLAMGMEPICSQAFGAKKHALLGLSLQRTVLLLMLTSLPISFLWLNMKR  83

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++L+  QD  I   A  F  + IPDL+A S+LHPLRIYLR +  T PL +   ++ + H+
Sbjct  84    ILLFAGQDEDIATEAQSFLLYTIPDLLALSVLHPLRIYLRSQSITLPLTFCATLSVIFHV  143

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             PI  +L   L LGI+G+A+     NF  +  L+ YIL +      ++K     L S    
Sbjct  144   PINLFLVKHLGLGIKGVALGGVWTNFNLVASLIIYILVS-----GVHKKTWGGLSSDCF-  197

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
               EW  LL LA+PSC++VCLEWWWYE M LL G  + P+ T+A+  I+IQTTSL+Y  PS
Sbjct  198   -REWRNLLNLAIPSCVSVCLEWWWYEIMILLCGLFLNPRATVASMGILIQTTSLIYIFPS  256

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS S+S+RVGNELGA RP KA+L+  + +   F+     ++     R+ W  +FT D E
Sbjct  257   SLSFSVSTRVGNELGANRPLKAKLSAIVGLGCGFVLGLSALVFAITVRKTWATMFTLDEE  316

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             ++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA +N   FY++G P+ I +AF 
Sbjct  317   IMRLTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKIGAHVNLGCFYVVGMPVGIGLAFF  376

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL---------VGESRETSF  332
             W   F+GL  GLLAAQ +C+++ML+V+  TDWE E+ RA++L         V +S E   
Sbjct  377   WGFNFQGLWLGLLAAQASCLVTMLVVLGFTDWEHEARRAEELTRAGDPAAAVADSEEFEA  436

Query  331   EDPMIKFKEGEEFRISFEEGVN  266
             + P+I   E +E  ++  E ++
Sbjct  437   KKPLIVIAEIKEDSLNLSEDLD  458



>ref|XP_002981285.1| hypothetical protein SELMODRAFT_53188, partial [Selaginella moellendorffii]
 gb|EFJ17473.1| hypothetical protein SELMODRAFT_53188, partial [Selaginella moellendorffii]
Length=463

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 306/452 (68%), Gaps = 7/452 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +V+EEL++M     PM+ MGL+ Y ++MI ++ +G LG +ELAGGAL++GF NITGYSVL
Sbjct  18    QVVEELKQMSGIAGPMVVMGLLLYARSMISMLFLGHLGKMELAGGALSMGFANITGYSVL  77

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             +GLA+GMEPI  QA G+K   ++ +TLQRTI +LL   +PI  LW N++ ++LW  QD  
Sbjct  78    AGLAMGMEPICGQACGAKRWHLMGITLQRTILVLLCVCVPIASLWINMQRILLWCGQDEG  137

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A  +  F++PDL+A +IL+PLRIYLR +  T PL W + +A  LH+PI   L   L
Sbjct  138   ITAMAGTYILFSLPDLLAQAILNPLRIYLRTQNITTPLTWCSALALALHVPINLLLVIHL  197

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
             K+ I+G+A+S  + +F  ++FL+GY+  + +           +LK       +W  LL L
Sbjct  198   KMRIRGVALSAALTDFNLVIFLVGYLRISGKYKRTWDGWSRDSLK-------DWRPLLNL  250

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             A+PSC++VCLEWWWYEFM +++G L   +  +A+  I+IQTT+L+Y  PS+LS ++S+RV
Sbjct  251   AIPSCISVCLEWWWYEFMIIVSGLLTNAKAAVASMGILIQTTALVYIFPSSLSLAVSTRV  310

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
             GNELGA RP KAR+A  +A+  A + +   +  TT  R VW  +FT D  +L LT  VLP
Sbjct  311   GNELGANRPAKARIAMMVALACAGVVAVLAMTFTTTMRHVWGGMFTKDDSILSLTSLVLP  370

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             I+GLCEL NCPQTT CGVLRG ARP+ GA IN  SFY +G P+A+ + F++ + F GL  
Sbjct  371   IVGLCELGNCPQTTGCGVLRGCARPSTGANINLGSFYFVGMPVAMALGFLFNVGFPGLWL  430

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             GLLAAQ  C   M+IV+ RTDW  ++ RAK L
Sbjct  431   GLLAAQGTCAALMMIVLMRTDWALQAERAKHL  462



>ref|XP_007040126.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY24627.1| MATE efflux family protein [Theobroma cacao]
Length=511

 Score =   374 bits (960),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 225/486 (46%), Positives = 320/486 (66%), Gaps = 18/486 (4%)
 Frame = -3

Query  1747  AKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalai  1568
               Q  + + +  V++E + +    FPM+  G++ Y ++MI ++ +GRLG L LAGG+LAI
Sbjct  15    GDQDSEKTCLSLVVKEAKCIASIAFPMVLTGILLYSRSMISMLFLGRLGELALAGGSLAI  74

Query  1567  GFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLK  1388
             GF NITGYSVLSGLA+GMEPI  QAFG+K   ++ LT+QR I +LL+ S+ I  LWFN+K
Sbjct  75    GFANITGYSVLSGLAMGMEPICGQAFGAKRYKLLGLTMQRMILLLLLTSIFIASLWFNMK  134

Query  1387  PLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLH  1208
              ++L+  QD  I + A  +  +++PDL+A SILHPLR YLR +  T PL + + +A +LH
Sbjct  135   NILLFCGQDENIANEAQSYILYSLPDLLAQSILHPLRTYLRTQSITLPLTYCSALAILLH  194

Query  1207  LPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTS  1028
             +P+ + L   L LGI+G+A+ +   NF  +  L+ Y+  +      +YK     + S   
Sbjct  195   IPVNYLLVSVLNLGIKGVALGSIWTNFNLVGSLIVYVKIS-----GVYKKTWGGISSECL  249

Query  1027  IGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
              G  W  LL L++PSC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  P
Sbjct  250   KG--WKYLLNLSIPSCISVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFP  307

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAI----VLAFLASAFGILLTTLGREVWVKIF  680
             S+LS  +S+RVGNELGA  P KA+LA  + +    V+   A AF IL+    R+ W  +F
Sbjct  308   SSLSFGVSTRVGNELGANNPNKAKLAAIVGLSSSSVIGLSALAFAILV----RKKWATMF  363

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D E++ LT  VLPI+GLCEL NCPQTT CGVLRG+ARP  GA IN   FYL+G P+A+
Sbjct  364   TEDPEIIALTSMVLPILGLCELGNCPQTTGCGVLRGTARPKSGANINLGCFYLVGMPIAV  423

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPM  320
              ++F+   +FKGL  GLLAAQ +CV++ML V+  TDW+ ++ RA++L   +R    +D  
Sbjct  424   WLSFLAGFDFKGLWLGLLAAQASCVVTMLFVVACTDWDLQARRAQEL---TRAVPVDDDD  480

Query  319   IKFKEG  302
                ++G
Sbjct  481   QTNRDG  486



>ref|XP_006472377.1| PREDICTED: MATE efflux family protein 5-like [Citrus sinensis]
Length=553

 Score =   375 bits (963),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 226/480 (47%), Positives = 306/480 (64%), Gaps = 7/480 (1%)
 Frame = -3

Query  1798  RHKHTRANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             +  +T  N          ++  +  T  E +EE++ +     P    GLI Y + MI ++
Sbjct  17    KPHYTNLNKTVDLHTDDPEELHRWPTPSEALEEMKAIGKISGPTAMTGLILYSRAMISML  76

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              +G LG LELAGG+L+IGF NITGYSVLSGLA+GMEPI  QA+G+K   ++ +TLQRT+ 
Sbjct  77    FLGYLGELELAGGSLSIGFANITGYSVLSGLAMGMEPICGQAYGAKQWKLLGITLQRTVL  136

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL  SLPI  +W N+K ++LW  QD +I  +A  F  FAIPDL   S+LHPLR+YLR +
Sbjct  137   LLLSTSLPISFMWLNMKRILLWCGQDDEISSVAQTFILFAIPDLFFLSLLHPLRVYLRSQ  196

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
             G T PL + + I+ +LH+P+ F L    K+GI G+AI+    N    L L  ++ ++   
Sbjct  197   GITLPLTYCSAISVLLHVPLNFLLVVHFKMGIAGVAIAMVWTNLNLFLLLSSFVYFSGVH  256

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
              ++   P       S      W  LL LA+P+C++VCLEWWWYE M ++ G L+ P+  +
Sbjct  257   KDSWVSP-------SMDCVRGWSSLLALAIPNCISVCLEWWWYELMIMICGLLINPKAAI  309

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A+  I+IQ TSL+Y  PS+LS  +S+R GNELGA RP KAR++  +++  A       +L
Sbjct  310   ASMGILIQITSLIYVFPSSLSLGVSTRAGNELGANRPSKARISMIVSLFCAVALGLMAVL  369

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              TTL R  W + FT D E+LELT   LPIIGLCEL NCPQTT CGVLRGSARP  GA IN
Sbjct  370   FTTLMRHKWGRFFTNDAEILELTAIALPIIGLCELGNCPQTTGCGVLRGSARPKTGASIN  429

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               SFYL+G P+AI+M FV K+ F GL  GLLAAQ +C + ML V+ RTDW  ++ RAK+L
Sbjct  430   LGSFYLVGMPVAILMGFVAKMGFPGLWLGLLAAQASCALVMLHVLCRTDWMVQAERAKEL  489



>ref|XP_002969674.1| hypothetical protein SELMODRAFT_63250, partial [Selaginella moellendorffii]
 gb|EFJ28798.1| hypothetical protein SELMODRAFT_63250, partial [Selaginella moellendorffii]
Length=463

 Score =   372 bits (955),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 306/452 (68%), Gaps = 7/452 (2%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             +V+EEL++M     PM+ MGL+ Y ++MI ++ +G LG +ELAGGAL++GF NITGYSVL
Sbjct  18    QVVEELKQMSGIAGPMVVMGLLLYARSMISMLFLGHLGKMELAGGALSMGFANITGYSVL  77

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             +GLA+GMEPI  QA G+K   ++ +TLQRTI +LL   +PI  LW N++ ++LW  QD  
Sbjct  78    AGLAMGMEPICGQACGAKRWHLMGITLQRTILVLLCVCVPIASLWINMQRILLWCGQDEG  137

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A  +  F++PDL+A +IL+PLRIYLR +  T PL W + +A  LH+PI   L   L
Sbjct  138   ITAMAGTYILFSLPDLLAQAILNPLRIYLRTQNITTPLTWCSALALALHVPINLLLVIHL  197

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
             K+ I+G+A+S  + +F  ++FL+GY+  + +           +LK       +W  LL L
Sbjct  198   KMRIRGVALSAALTDFNLVIFLVGYLRISGKYKRTWDGWSRDSLK-------DWRPLLNL  250

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             A+PSC++VCLEWWWYEFM +++G L   +  +A+  I+IQTT+L+Y  PS+LS ++S+RV
Sbjct  251   AIPSCISVCLEWWWYEFMIIVSGLLTNAKAAVASMGILIQTTALVYIFPSSLSLAVSTRV  310

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLP  635
             GNELGA RP KAR+A  +A+  A + +   +  TT  R VW  +FT D  +L LT  VLP
Sbjct  311   GNELGANRPAKARIAMMVALACAGVVAVLAMTFTTTMRHVWGGMFTKDDSILSLTSLVLP  370

Query  634   IIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCY  455
             I+GLCEL NCPQTT CGVLRG ARP+ GA IN  SFY +G P+A+ + F++ + F GL  
Sbjct  371   IVGLCELGNCPQTTGCGVLRGCARPSTGANINLGSFYFVGMPVAMALGFLFNVGFPGLWL  430

Query  454   GLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
             GLLAAQ  C   M+IV+ RTDW  ++ RAK L
Sbjct  431   GLLAAQGTCAALMMIVLMRTDWALQAERAKRL  462



>emb|CAH67053.1| OSIGBa0127A14.5 [Oryza sativa Indica Group]
 gb|EAY95222.1| hypothetical protein OsI_17039 [Oryza sativa Indica Group]
Length=560

 Score =   375 bits (963),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 232/489 (47%), Positives = 317/489 (65%), Gaps = 10/489 (2%)
 Frame = -3

Query  1702  ELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGLA  1523
             E R ++   FPMI  GL+ Y+++MI ++ +G LG L LAGG+LAIGF NITGYSVLSGLA
Sbjct  81    EARSILGLAFPMILTGLLLYLRSMISMLFLGHLGGLALAGGSLAIGFANITGYSVLSGLA  140

Query  1522  LGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIHI  1343
             +GMEPI  QAFG+ N  ++ +T+QRT+ +L+ A++PIG LW  ++PL+L+  QDA I  +
Sbjct  141   MGMEPICGQAFGAGNYALLGVTMQRTVLLLIAAAIPIGGLWVQMRPLLLFCGQDAAIAAV  200

Query  1342  ASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLGI  1163
             A  +   ++PDLV  + LHP+RIYLR +    PL     +A  +HLPI + L   L LG+
Sbjct  201   AETYIFASLPDLVLQAFLHPVRIYLRTQSINLPLTVCAGLAIAIHLPINYVLVVVLGLGV  260

Query  1162  QGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALPS  983
             +G+A+++ +AN   +LFLL YI       + ++K     L S+ S    W  L+ LALPS
Sbjct  261   KGVALASVLANLNLVLFLLAYIFL-----KGVHKRTGGFLLSAESF-RGWGELISLALPS  314

Query  982   CLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNEL  803
             C++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV NEL
Sbjct  315   CVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNEL  374

Query  802   GAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIGL  623
             GAG+P +A  A  + +VL F   AF      L R VW  +FT D  ++ LT +VLPI+GL
Sbjct  375   GAGQPEEASRAATVGLVLGFGFGAFASAFAFLVRNVWASMFTADPAIVALTASVLPILGL  434

Query  622   CELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLA  443
             CEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A++MAF + L+F+GL +GLLA
Sbjct  435   CELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVMAFWFHLDFRGLWFGLLA  494

Query  442   AQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEEFRISFEEGVNL  263
             AQ  C + ML+VI RTDW  E+ R+K L G        D  +   E     +      ++
Sbjct  495   AQATCTVRMLLVIGRTDWAAEAKRSKQLTGAGAANMESDDRVAADEKSRLPVD----TDV  550

Query  262   QK*YSHQKR  236
             ++   H  R
Sbjct  551   ERSSDHTDR  559



>ref|XP_008339010.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=551

 Score =   375 bits (962),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 304/462 (66%), Gaps = 7/462 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             ++  +  T+ E ++E++ +     P    GL+ Y + MI ++ +G LG L+LAGG+L+IG
Sbjct  43    QELHRWPTLSEAVQEIKAIGKISGPSTMTGLLLYSRAMISMLFLGYLGELQLAGGSLSIG  102

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSV+SGLA+GMEPI  QA+G+K L ++ LTLQRT+ +LL  SLPI  +W N+K 
Sbjct  103   FANITGYSVISGLAMGMEPICGQAYGAKQLKLLGLTLQRTVLLLLSTSLPISFMWLNMKR  162

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD +I  +A  F  F+IPDL   S+LHPLRIYLR +  T P+ + + I+ +LH+
Sbjct  163   VLLWCGQDEEISSVAHTFTLFSIPDLFFLSLLHPLRIYLRTQNITLPVTYCSAISVLLHI  222

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ F L    ++GI G+AI+    N    + L  +  ++N   +    P A  L+     
Sbjct  223   PLNFLLVVKFQMGISGVAIAMVWTNLNLFILLFSFTYFSNVYKDTWVCPSADCLRG----  278

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LL L++P+C++VCLEWWWYEFM +L G L  P+ T+A+  I+IQTTSL+Y  PS
Sbjct  279   ---WSSLLALSIPTCISVCLEWWWYEFMIMLCGLLANPKATIASMGILIQTTSLVYVFPS  335

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS  +S+RVGN LGA RP KAR++  +++V A       +L TTL R  W + FT D E
Sbjct  336   SLSLGVSTRVGNLLGAKRPSKARISMIVSLVCAVALGLLAMLFTTLMRHQWGRFFTNDAE  395

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             +L+LT   LPI GLCEL NCPQTT CGVLRGSARP +GA IN  SFYL+G P+A++M FV
Sbjct  396   ILKLTAIALPIAGLCELGNCPQTTACGVLRGSARPTVGANINLGSFYLVGMPVAMLMGFV  455

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              K+ F GL  GLLAAQ +C + M  V+  TDW  +  R+KDL
Sbjct  456   VKMGFAGLWLGLLAAQGSCALLMFYVVCTTDWNLQVKRSKDL  497



>ref|XP_011002496.1| PREDICTED: MATE efflux family protein 5-like isoform X1 [Populus 
euphratica]
Length=501

 Score =   373 bits (957),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 217/468 (46%), Positives = 319/468 (68%), Gaps = 7/468 (1%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  +  +V EEL+++     P+ A  L+++ + ++ V+ +GRLGSLELAGG
Sbjct  3     EKDPDFYSHKLPSASQVFEELKELWGMALPITAAHLMAFFRAVVSVMFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQA+GSKN  ++SL+LQR I +L +A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLVGLASGLEPVCSQAYGSKNWDLLSLSLQRMIVILGIAIIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +M ++ QD  I  +A+ +C +++PDL+ NS+L PLR++LR +  T PL++ +L+A
Sbjct  123   LNLESIMNFMGQDPNITAMAATYCMYSLPDLLTNSLLQPLRVFLRSQRVTKPLMYCSLLA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
              + H+P+ + L   +  G+ G+A+++ V N   +L ++GY+ + + + E  ++     + 
Sbjct  183   VIFHVPLNYALVVVMGWGVPGVALASVVTNMNMVLLMVGYVWWVSGRWEMRWRVEIGGVC  242

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
                        LL++A+PSCL +CLEWWWYE +T+LAG L  P +  A   I+IQTTS+M
Sbjct  243   GGVG------PLLKVAVPSCLGICLEWWWYEIVTVLAGDLPNPTLAGAATGILIQTTSMM  296

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL+  +S+RVGNELGAG+P KA+LA  +A+  AF+     +  T   RE W  +F
Sbjct  297   YTVPMALAGCVSARVGNELGAGKPYKAKLAAMVALGCAFVIGILNVTWTVFLRERWAGLF  356

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  V  L   VLPIIGLCEL NCPQTT CG+LR +ARP +GA IN  SFY +G P+A+
Sbjct  357   TKDVLVKGLVAAVLPIIGLCELGNCPQTTGCGILRATARPAVGARINLGSFYFVGTPVAV  416

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDL  359
              +AF  K+ F GL +GLL+AQ+AC +S+L +V+ RTDWE E+ +AK+L
Sbjct  417   GLAFGLKIGFSGLWFGLLSAQIACALSILYVVMVRTDWEHEAFKAKEL  464



>ref|XP_006353367.1| PREDICTED: MATE efflux family protein 5-like [Solanum tuberosum]
Length=530

 Score =   374 bits (959),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 237/497 (48%), Positives = 321/497 (65%), Gaps = 16/497 (3%)
 Frame = -3

Query  1756  KMAAKQTQKHSTIPE----VMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslel  1589
             K     T  H T  +    V  E + + +  FPMI  GL+ Y ++MI ++ +GRLG L L
Sbjct  39    KSPTNDTYPHITNKKITSLVFNEAKSIANIAFPMILTGLLLYSRSMISMLFLGRLGGLAL  98

Query  1588  aggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIG  1409
             AGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG++   ++ LTLQRT+ +LL+ S PI 
Sbjct  99    AGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAQKYNLLGLTLQRTVLLLLLISFPIA  158

Query  1408  LLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWST  1229
             L W N+K ++L+  QD  I   A  +  +++PDL A S+LHPLRIYLR +  T PL    
Sbjct  159   LFWVNMKTILLYCGQDEDIATEAQSYLFYSLPDLFAQSLLHPLRIYLRTQSITLPLTCCA  218

Query  1228  LIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLAT  1049
             + A +LH+PI F L   L LG++G+A+S    NF  +  L+ YI+ +      +YK    
Sbjct  219   IFAILLHIPINFLLVIKLNLGVRGVAMSGVWTNFNLVGSLIVYIVVS-----GVYKKTWE  273

Query  1048  NLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTT  869
              L      G  W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQTT
Sbjct  274   RLSMECLKG--WKSLLNLAIPSCISVCLEWWWYEIMILLCGLLINPKATVASMGILIQTT  331

Query  868   SLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWV  689
             SL+Y  PS+LS S+S+RVGNELGA RPGKA++A  + +  +F+     +      R VW 
Sbjct  332   SLIYIFPSSLSFSVSTRVGNELGARRPGKAKVAAIVGLAGSFILGFTALFFAVTVRNVWA  391

Query  688   KIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAP  509
             K+FT D E+L LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY++G P
Sbjct  392   KMFTNDKEILALTSVVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYIVGMP  451

Query  508   LAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG-----ESR  344
             +A+ ++F    +F+GL  GLLAAQ +C+++ML+V+  TDWE E+ RAK L G     E++
Sbjct  452   VAVGLSFYMGFDFQGLWIGLLAAQASCMLTMLLVLLHTDWEFEAIRAKQLTGTTILDETK  511

Query  343   ETSFEDPMIKFKEGEEF  293
             ET  E+     +  E F
Sbjct  512   ETIQENTSSNKQLNENF  528



>ref|XP_008439170.1| PREDICTED: MATE efflux family protein LAL5 [Cucumis melo]
Length=543

 Score =   374 bits (960),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 229/491 (47%), Positives = 314/491 (64%), Gaps = 10/491 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T+Q  +      T  H ++   ++E   +    FPM+   L+ Y +++I ++ +GRLG L
Sbjct  59    TSQHFQLPTKLTTNTHFSL--AVQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGEL  116

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQRT+ +L + S+P
Sbjct  117   PLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTVLLLSLTSIP  176

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I LLWFN+K ++L   QD  I   A LF  +++PDL A S++HPLRIYLR +  T PL +
Sbjct  177   ISLLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLTF  236

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 + +LH+PI + L   L  GI+G+AI+    NF  +  L+ YIL      +      
Sbjct  237   CAAFSILLHIPINYLLVSYLNFGIRGVAIAGVWTNFNLVASLILYILIFRVHKD------  290

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
              T    S    +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQ
Sbjct  291   -TWAGFSLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQ  349

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TT+L+Y  PS+LS S+S+RVGNELGA +P KA+LA  + +  +FL     +      R++
Sbjct  350   TTALIYIFPSSLSFSVSTRVGNELGAEQPKKAKLAAIVGLSCSFLLGICALFFAVSIRKI  409

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA IN   FYL+G
Sbjct  410   WASMFTEDKDIIALTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVG  469

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE-T  338
              P+A+ ++F    +F+GL  GLLAAQ  C  +ML+V+  TDWE E+ RA+ L G   E  
Sbjct  470   MPVAVGLSFFGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEEVV  529

Query  337   SFEDPMIKFKE  305
               E  M K K+
Sbjct  530   EAESLMPKNKQ  540



>gb|KGN57343.1| hypothetical protein Csa_3G180310 [Cucumis sativus]
Length=555

 Score =   374 bits (961),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 315/491 (64%), Gaps = 10/491 (2%)
 Frame = -3

Query  1774  TNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsl  1595
             T+Q  +    + T  H ++   ++E   +    FPM+   L+ Y +++I ++ +GRLG L
Sbjct  71    TSQHFQLPTKQTTNTHFSL--AIQEAFSISQIAFPMVLTSLLLYSRSLISMLFLGRLGEL  128

Query  1594  elaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLP  1415
              LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K  T++ L LQRTI +L + S+P
Sbjct  129   PLAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKKFTLLGLALQRTILLLSLTSIP  188

Query  1414  IGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLW  1235
             I  LWFN+K ++L   QD  I   A LF  +++PDL A S++HPLRIYLR +  T PL +
Sbjct  189   IAFLWFNVKNILLLCKQDPSIASQAQLFLLYSLPDLFAQSLIHPLRIYLRSQSITLPLTF  248

Query  1234  STLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPL  1055
                 + +LH+PI ++L   L  GI+G+AI+    NF  +  L+ YIL      +      
Sbjct  249   CAAFSILLHIPINYFLVSYLNFGIRGVAIAGVWTNFNLVASLILYILVFRVHKD------  302

Query  1054  ATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQ  875
              T    S    +EW  LL LA+PSC++VCLEWWWYE M LL G L+ P+ T+A+  I+IQ
Sbjct  303   -TWGGFSLQCFKEWGDLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKATVASMGILIQ  361

Query  874   TTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREV  695
             TT+L+Y  PS+LS S+S+RVGNELGA +P KARLA  + +  +F+     +      R++
Sbjct  362   TTALIYIFPSSLSFSVSTRVGNELGAEQPKKARLAAIVGLFCSFVLGICALFFAVSIRKI  421

Query  694   WVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMG  515
             W  +FT D +++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP IGA IN   FYL+G
Sbjct  422   WASMFTDDKDIIGLTSMVLPIIGLCELGNCPQTTGCGVLRGTARPKIGANINLGCFYLVG  481

Query  514   APLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE-T  338
              P+A+ ++F    +F+GL  GLLAAQ  C  +ML+V+  TDWE E+ RA+ L G   +  
Sbjct  482   MPVAVGLSFYGGFDFRGLWLGLLAAQGCCAAAMLVVLGFTDWEFEAIRARKLTGGCEQVV  541

Query  337   SFEDPMIKFKE  305
               E  M K K+
Sbjct  542   EAESLMPKNKQ  552



>ref|XP_009339076.1| PREDICTED: MATE efflux family protein 5 [Pyrus x bretschneideri]
Length=505

 Score =   372 bits (956),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 225/491 (46%), Positives = 330/491 (67%), Gaps = 7/491 (1%)
 Frame = -3

Query  1759  EKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelagg  1580
             EK     + K  +  +V EELR++    FP+ AM  + +++  + V+ +GRLGSLELAGG
Sbjct  3     EKDPDICSHKFPSASQVWEELRELWGMAFPITAMNCLVFVRAAVSVLFLGRLGSLELAGG  62

Query  1579  alaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLW  1400
             AL+IGFTNITGYSVL GLA G+EP+ SQAFG+KN  ++SL+LQR + +LL+A +PI LLW
Sbjct  63    ALSIGFTNITGYSVLMGLASGLEPVCSQAFGNKNYDLLSLSLQRMVLILLLAVIPISLLW  122

Query  1399  FNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIA  1220
              NL+ +M+++ QD  I  +A+ +C +++PDL+ N++L PLR++LR +  T P+++ +LIA
Sbjct  123   INLQSIMVFMGQDKAITAMAATYCLYSLPDLLTNTVLQPLRVFLRSQKVTKPMMYCSLIA  182

Query  1219  TMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLK  1040
                H+P+   L   + LG+ G+A+++ + N    + + GY+ +  ++ E  +     +L 
Sbjct  183   VAFHVPLNVVLVVVMGLGVPGVAVASVLTNLNMAVLMAGYVWWGWKKGEMRWTFGIGDLC  242

Query  1039  SSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLM  860
             S   IG     LL+LA+PSCLA+CLEWWWYE +T++AGYL  P + +A   I+IQTTS+M
Sbjct  243   SG--IGP----LLKLAVPSCLAICLEWWWYEIVTVMAGYLPNPTLAVAATGILIQTTSMM  296

Query  859   YTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIF  680
             YT+P AL   +S+RVGNELG G+P KA+LA  +A+  AF+     +  T + RE W  +F
Sbjct  297   YTVPLALCGCVSARVGNELGCGKPYKAKLAAMVALGCAFVIGIINVTWTVILRERWAGLF  356

Query  679   ttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAI  500
             T D  V  L  +V+PI+G+CEL NCPQTT CG+LRG+ARP +GA IN  SFY +G P+A+
Sbjct  357   TKDELVKALVASVMPIMGICELGNCPQTTGCGILRGTARPAVGARINLGSFYFVGTPVAV  416

Query  499   IMAFVWKLEFKGLCYGLLAAQVACVISML-IVIYRTDWEKESARAKDLVGESRETSFEDP  323
              +AF  K+ F GL +GLL+AQVAC +S+L +V+ RTDWE ES  A+ L G       +  
Sbjct  417   GLAFWLKVGFPGLWFGLLSAQVACAVSILYVVVARTDWEAESLNARMLTGLEMGECRDKR  476

Query  322   MIKFKEGEEFR  290
                 K+ EE +
Sbjct  477   QGHEKDEEESK  487



>ref|XP_003580355.1| PREDICTED: MATE efflux family protein 5-like [Brachypodium distachyon]
Length=580

 Score =   375 bits (962),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 228/470 (49%), Positives = 310/470 (66%), Gaps = 8/470 (2%)
 Frame = -3

Query  1705  EELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVLSGL  1526
             +E R ++   FPMI  GL+ Y+++MI ++ +GRLG L LAGG+LAIGF NITGYSVLSGL
Sbjct  90    DEARSILGLAFPMILTGLLLYLRSMISMLFLGRLGGLALAGGSLAIGFANITGYSVLSGL  149

Query  1525  ALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAKIIH  1346
             A+GMEPI  QAFG+ N  ++ +T+QRT+ +L+ A++PIG LW +++PL+L   QDA I  
Sbjct  150   AMGMEPICGQAFGAGNYALIGVTVQRTVLLLIAAAVPIGGLWMHMRPLLLLCGQDAAIAA  209

Query  1345  IASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSLKLG  1166
             +A  +   ++PDL+  + LHP+RIYLR +    PL     +A  +HLPI + L   L LG
Sbjct  210   VAETYILASLPDLLLQAFLHPVRIYLRMQSINLPLTVCATLAIAIHLPINYALVTVLGLG  269

Query  1165  IQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRLALP  986
             I+G+A+++ +AN   LL LL YI +     + ++K   +    S      W  L+ LALP
Sbjct  270   IRGVAMASVLANLNLLLLLLAYIFF-----KGVHKRTGSFFMLSMESFRGWGELITLALP  324

Query  985   SCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRVGNE  806
             SC++VCLEWWWYE M LL G L+ PQ T+A+  I+IQTTSL+Y  PS+LS  +S+RV NE
Sbjct  325   SCVSVCLEWWWYEIMILLCGLLLNPQATVASMGILIQTTSLIYIFPSSLSFGVSTRVSNE  384

Query  805   LGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdtevleltvtvLPIIG  626
             LGAGR  +A  A    I+L     AF      L R VW  +FT D  ++ LT +VLPI+G
Sbjct  385   LGAGRTQEASRAATAGIMLGLAFGAFASAFAFLVRNVWASMFTADPAIIALTASVLPILG  444

Query  625   LCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKGLCYGLL  446
             LCEL NCPQTT CGVLRGSARP   A IN  SFYL+G P+A+++AF +  +FKGL +GLL
Sbjct  445   LCELGNCPQTTGCGVLRGSARPKDAASINLRSFYLVGTPVALVLAFWFHFDFKGLWFGLL  504

Query  445   AAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKEGEE  296
             AAQ  C++ ML+VI RTDW  E+ R+K L G     +    +   KEG +
Sbjct  505   AAQATCMVRMLLVIGRTDWAAEAKRSKQLTGAG---AGAGDVSSAKEGND  551



>emb|CDP21676.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   374 bits (959),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 223/480 (46%), Positives = 309/480 (64%), Gaps = 8/480 (2%)
 Frame = -3

Query  1795  HKHTR-ANTNQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
              KH     T+   +     Q  +  T  E ++E++ +     P    GL+ Y + MI ++
Sbjct  25    QKHMDICTTHDDYDYDDDDQLHRWPTPTEALQEIKAIGKISGPTALTGLLLYSRAMISML  84

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              +G LG LELAGG+LAIGF NITGYSV+SGLA+GMEPI  QA+G++ + ++ +TLQRT+ 
Sbjct  85    FLGYLGELELAGGSLAIGFANITGYSVISGLAMGMEPICGQAYGARQMKLLGITLQRTVL  144

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL  S+PI L W N+K ++LW  QD +I  ++  F  +AIPDL   S+LHPLRIYLR +
Sbjct  145   LLLATSIPISLTWLNMKRILLWCGQDEEISSMSHTFLVYAIPDLFFLSLLHPLRIYLRTQ  204

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
               T PL + + I+ +LH+P+ F L     +GI G+A++    N    L L  ++ ++   
Sbjct  205   SITLPLTYCSAISVLLHVPLNFLLVRYFNMGIAGVALAMVWTNLNLFLLLCSFLYFSGVY  264

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
              ++   P    L+        W  LL LA+P+C++VCLEWWWYEFM +L G L+ P+ T+
Sbjct  265   KDSWVAPSMDCLRG-------WSSLLALAVPTCVSVCLEWWWYEFMIMLCGLLLNPKATV  317

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A+  I+IQTTSL+Y  PSALS  +S+RVGNELGA RP  AR++  ++++ A       +L
Sbjct  318   ASMGILIQTTSLVYVFPSALSLGVSTRVGNELGANRPASARISMIVSLICAVALGLAAML  377

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              T L R  W + FT+D E+LELT   LPI+GLCEL NCPQTT CGVLRGSARP  GA IN
Sbjct  378   FTILMRHQWGRFFTSDAEILELTSVALPIVGLCELGNCPQTTGCGVLRGSARPTTGANIN  437

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               SFYL+G P+AI++ FV K+ F GL  GLLAAQ +C + ML V+ RTDW  +  RAK+L
Sbjct  438   LGSFYLVGMPVAILIGFVLKMGFAGLWLGLLAAQASCALLMLYVLCRTDWIVQVERAKEL  497



>ref|XP_009764157.1| PREDICTED: MATE efflux family protein 5-like [Nicotiana sylvestris]
Length=517

 Score =   372 bits (956),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 314/476 (66%), Gaps = 21/476 (4%)
 Frame = -3

Query  1771  NQQEEKMAAKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgsle  1592
             NQ EE        + +T+   + E + +     PMI +GL+ Y ++MI ++ +GRLG L 
Sbjct  14    NQNEES-----KTEQNTLFLAISETKSIATIALPMIFIGLLLYSRSMISMLFLGRLGELS  68

Query  1591  laggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPI  1412
             LAGG+LAIGF NITGYS+LSGLA+GMEPI  QAFG+K   I+ L+LQRTI +LL+ S+PI
Sbjct  69    LAGGSLAIGFANITGYSILSGLAMGMEPICGQAFGAKRFKILGLSLQRTILLLLLVSIPI  128

Query  1411  GLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWS  1232
               +W N+K ++++  QD +I   A  +  ++IPDL A S LHPLRIYLR +    PL + 
Sbjct  129   SFMWCNMKKILIFCGQDHEIATQAQSYIIYSIPDLFALSFLHPLRIYLRSQSIIMPLTYC  188

Query  1231  TLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLA  1052
               +A ++H+PI ++L   L LGI+G+A+S    NF  +  L+ YI+ +            
Sbjct  189   AALAILVHIPINYFLVIVLNLGIKGVALSGVWTNFNLVGSLIAYIIVSGVHK--------  240

Query  1051  TNLKSSTSIGEE----WVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAI  884
                K+ ++I +E    W  LL LA+PSC++VCLEWWWYE M LL G L+ P+ ++A+  I
Sbjct  241   ---KTWSAISKECFKGWKTLLNLAIPSCISVCLEWWWYEIMILLCGLLLNPKASVASMGI  297

Query  883   VIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLG  704
             +IQTTSL+Y  PS+LS  +S+RVGNELGA RP +A++A  I +  +F+     +    L 
Sbjct  298   LIQTTSLIYIFPSSLSFGVSTRVGNELGANRPNQAKIAAIIGLCYSFIFGLLALSFAILV  357

Query  703   REVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFY  524
             R +W  ++T D E++ LT  +LPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FY
Sbjct  358   RNIWASMYTQDQEIIALTSIILPIIGLCELGNCPQTTGCGVLRGTARPKLGANINLGCFY  417

Query  523   LMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIY-RTDWEKESARAKDL  359
             L+G P+AI + F    +F+GL  GLLAAQ +C ++ML++I  RT+WE ++ RAK+L
Sbjct  418   LVGMPIAIYLGFFRGFDFEGLWIGLLAAQASCAVTMLLIILARTNWEDQAKRAKEL  473



>ref|XP_008378671.1| PREDICTED: MATE efflux family protein 5-like [Malus domestica]
Length=547

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 217/462 (47%), Positives = 304/462 (66%), Gaps = 7/462 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             K+  +  T+ E ++E++ +     P    GL+ Y + MI ++ +G LG L+LAGG+L+IG
Sbjct  43    KELXRWPTLSEAVQEIKAIGKISGPSTMTGLLLYSRAMISMLFLGYLGELZLAGGSLSIG  102

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYSV+SGLA+GMEPI  QA+G+K + ++ LTLQRT+ +LL  SLPI  +WFN+K 
Sbjct  103   FANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLTLQRTVLLLLSTSLPISFMWFNMKR  162

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++LW  QD +I  +A  F  F+ PDL   S+LHPLRIYLR +  T P+ + + I+ +LH+
Sbjct  163   VLLWFGQDEEISSVAHTFILFSTPDLFFLSLLHPLRIYLRTQNITLPVTYCSAISVLLHI  222

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             P+ F L    ++GI G+AI+    N    + L  +  ++N   ++   P A  L+     
Sbjct  223   PLNFLLVVKFQMGISGVAIAMVWTNLNLFILLFSFTYFSNVYKDSWVCPSADCLRG----  278

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
                W  LL LA+P+C++VCLEWWWYEFM +L G L  P+ T+++  I+IQTTSL+Y  PS
Sbjct  279   ---WSSLLALAIPTCISVCLEWWWYEFMIMLCGLLANPKATISSMGILIQTTSLVYVFPS  335

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS ++S+RVGNELGA RP +AR++  +++  +       +L TT  R  W + FT D E
Sbjct  336   SLSLAVSTRVGNELGANRPSRARISMIVSLGCSVALGLLAMLFTTFMRHQWGRFFTNDAE  395

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             +L+LT   LPI GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P+A++M FV
Sbjct  396   ILKLTAIALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAMLMGFV  455

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
              K+ F GL  GLLAAQ +C + M  V+  TDW  +  RA DL
Sbjct  456   VKMGFAGLWLGLLAAQGSCALLMFYVLCTTDWNLQVKRANDL  497



>ref|XP_009412273.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412274.1| PREDICTED: MATE efflux family protein 5-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   372 bits (955),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 217/469 (46%), Positives = 300/469 (64%), Gaps = 7/469 (1%)
 Frame = -3

Query  1747  AKQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalai  1568
              +   +  T  EV+EE+R +     P    GL+ Y + M+  + +G LG LELA G+L+I
Sbjct  10    GRDLHRCPTASEVVEEMRAIGAISVPAALTGLVLYSRAMVSTLFLGYLGELELASGSLSI  69

Query  1567  GFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLK  1388
             GF NITGYSVLSGLA+GMEPI  QAFG+K   ++ LTLQR I +LL AS+PI  LW N++
Sbjct  70    GFANITGYSVLSGLAMGMEPICGQAFGAKQRKLLGLTLQRAILLLLSASVPISFLWRNMR  129

Query  1387  PLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLH  1208
              ++ W  QD +I   A +F  FAIPDL   S LHPLR+YLR +  T+P+   ++++ +LH
Sbjct  130   RILSWCGQDEQIASAAHVFITFAIPDLFLLSFLHPLRVYLRSQNVTFPVTCCSVVSVVLH  189

Query  1207  LPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTS  1028
             +P+ + L   L++GI G+A++    N    + LL ++L +    ++  +P  T L+    
Sbjct  190   IPLNYLLVVRLRMGIAGVALAMVWTNLNLFVCLLLFVLCSGACKDSWVRPSMTCLRG---  246

Query  1027  IGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLP  848
                 W  LL+LA+PSC++VCLEWWWYE M LL+G L  P+  +A+  I+IQTTSL+Y  P
Sbjct  247   ----WSALLKLAVPSCVSVCLEWWWYELMILLSGLLPNPKAAVASMGILIQTTSLVYVFP  302

Query  847   SALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdt  668
             SALS  +S+RVGN LGA  P KAR AT +++  A +     +  TT  R  W ++FT D 
Sbjct  303   SALSFGVSARVGNVLGANHPAKARTATMVSLACALVLGLTAMAFTTSMRHRWGRLFTDDA  362

Query  667   evleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAF  488
             E+L+LT   LPI GLCEL NCPQTT CGVLRGSARP  GA IN  SFYL+G P+A+++ F
Sbjct  363   EILKLTTLALPIAGLCELGNCPQTTGCGVLRGSARPTTGANINLGSFYLVGTPVAVLLGF  422

Query  487   VWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRE  341
               ++ F GL  GLLAAQ +C   M   + RTDW  E+ +A++L   S  
Sbjct  423   FRRMGFPGLWLGLLAAQASCATLMAYALARTDWMVEAEKARELTKTSNS  471



>gb|EYU36423.1| hypothetical protein MIMGU_mgv1a019568mg [Erythranthe guttata]
Length=557

 Score =   373 bits (958),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 221/463 (48%), Positives = 303/463 (65%), Gaps = 13/463 (3%)
 Frame = -3

Query  1714  EVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiGFTNITGYSVL  1535
             E +EE++++     P    GLI Y + MI ++ +G LG LELAGG+L+IG  NITGYSV+
Sbjct  46    EALEEMKEIGKISGPTAITGLILYSRAMISMLFLGYLGELELAGGSLSIGVANITGYSVI  105

Query  1534  SGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKPLMLWLHQDAK  1355
             SGLA+GM+PI  QA+G+K + ++ LTLQRT+ +LL  S+PI  +W N+K ++LW +QD +
Sbjct  106   SGLAMGMDPICGQAYGAKQMKLLGLTLQRTVLLLLTTSIPISFMWLNMKRILLWCNQDEE  165

Query  1354  IIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHLPIVFYLTFSL  1175
             I  +A  F  FAIPDL   S LHPLRIYLR +G T PL   + ++ +LH+P+ F L    
Sbjct  166   ISTVAQTFIVFAIPDLFFLSFLHPLRIYLRTQGVTLPLTCCSTVSVVLHVPLNFLLVRYF  225

Query  1174  KLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSIGEEWVILLRL  995
              +G+ G+A++  + N   ++ L  Y+ ++    E+   P    L+        W  LL L
Sbjct  226   GMGVSGVALAMALTNLNLVVLLCLYVYFSGVYRESWVAPSGDCLRG-------WSALLSL  278

Query  994   ALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPSALSNSISSRV  815
             A+P+C++VCLEWWWYE M +L G L  P+ T+A+  I+IQTTSL+Y  PS+LS  +S+RV
Sbjct  279   AVPTCVSVCLEWWWYELMIMLCGLLANPRATIASMGILIQTTSLVYVFPSSLSLGVSTRV  338

Query  814   GNELGAGRPGKARLATAIAIVLAFLASAFGI---LLTTLGREVWVKIFttdtevleltvt  644
              NELGA RP +AR++    IV  F A+A G+       L R  W ++FT D ++LELT  
Sbjct  339   SNELGARRPARARVSM---IVSMFCAAALGVGAMAFAVLMRHRWGRLFTADAQILELTTA  395

Query  643   vLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFVWKLEFKG  464
              LPI GLCEL NCPQTT CGVLRGSARP IGA IN  SFYL+G P+A +M FV K+ F G
Sbjct  396   ALPIAGLCELGNCPQTTGCGVLRGSARPTIGANINLGSFYLVGMPVAFLMGFVLKMGFAG  455

Query  463   LCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETS  335
             L  GLLAAQ +C + ML+V+ RTDW  +  RAK+L    +  S
Sbjct  456   LWVGLLAAQASCAVLMLVVLCRTDWSVQVERAKELTATHQSPS  498



>ref|XP_002510841.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF51443.1| multidrug resistance pump, putative [Ricinus communis]
Length=553

 Score =   373 bits (957),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 229/502 (46%), Positives = 328/502 (65%), Gaps = 15/502 (3%)
 Frame = -3

Query  1771  NQQEEKMAAKQTQKHSTIPEVMEELRKMIDTC---FPMIAMGLISYMKNMILVVCMgrlg  1601
              QQ++K+  ++  +      +   +R+ I       PMI  GL+ Y ++MI ++ +GRLG
Sbjct  46    KQQQQKLVPQEEIQEPNKTHLSLAIREGISIAKIALPMILTGLVLYSRSMISMLFLGRLG  105

Query  1600  slelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMAS  1421
              L LAGG+LA+GF NITGYS+LSGLA+GMEPI  QAFG++  +++ L+LQRTI +L++ S
Sbjct  106   ELALAGGSLAMGFANITGYSILSGLAMGMEPICGQAFGAQKHSLLGLSLQRTILLLILTS  165

Query  1420  LPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPL  1241
             LPI  LW N+K ++L+  QD  I   A  F  +++PDL+A S LHPLRIYLR +    PL
Sbjct  166   LPITFLWLNMKRILLFCGQDLDIATEAQSFLLYSLPDLLAQSFLHPLRIYLRTQSINLPL  225

Query  1240  LWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYK  1061
              +   ++ +LH+PI ++L   L LGI+G+A+S    NF  +  L+ YIL +      ++K
Sbjct  226   TFCATLSILLHVPINYFLVTHLNLGIKGVALSGVWTNFNLVASLIIYILIS-----GVHK  280

Query  1060  PLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIV  881
                  L  S    +EW  LL LA+PSC++VCLEWWWYE MTLL G L+ P+ T+A   I+
Sbjct  281   RTWGGL--SMECFKEWKALLNLAIPSCISVCLEWWWYEIMTLLCGLLLNPRATVAAMGIL  338

Query  880   IQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGR  701
             IQTTSL+Y  PS+L  S+S+RVGNELGA +P KA+LA  + +  +F+     +  T   R
Sbjct  339   IQTTSLIYIFPSSLGFSVSTRVGNELGANQPKKAKLAAIVGLAFSFILGFSALSFTVTVR  398

Query  700   EVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYL  521
             ++W  +FT D E++ LT  VLPIIGLCEL NCPQTT CGVLRG+ARP +GA IN   FYL
Sbjct  399   KIWATMFTQDKEIIALTSLVLPIIGLCELGNCPQTTGCGVLRGTARPKVGANINLGCFYL  458

Query  520   MGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVG----  353
             +G P+AI +AF    +F+GL  GL+AAQ +CV++ML+V+  TDW+ ++ RAK+L G    
Sbjct  459   VGTPVAIWLAFFAGFDFEGLWLGLVAAQGSCVVTMLVVLGCTDWDFQAQRAKELTGSVGI  518

Query  352   -ESRETSFEDPMIKFKEGEEFR  290
              +  +   + P  + KE   ++
Sbjct  519   IDDVDGENKPPKDEIKEDSFYK  540



>ref|XP_004240795.1| PREDICTED: MATE efflux family protein 5-like [Solanum lycopersicum]
Length=520

 Score =   371 bits (953),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 223/484 (46%), Positives = 324/484 (67%), Gaps = 9/484 (2%)
 Frame = -3

Query  1744  KQTQKHSTIPEVMEELRKMIDTCFPMIAMGLISYMKNMILVVCMgrlgslelaggalaiG  1565
             K T  H T+  +  E + + +  FPMI   L+ Y +++I ++ +G+LG L LAGG+LA+G
Sbjct  36    KNTTTHFTL--IFIEAKSIANIAFPMILTALLLYSRSLISMLFLGQLGGLALAGGSLAVG  93

Query  1564  FTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTISMLLMASLPIGLLWFNLKP  1385
             F NITGYS+LSGLA+GMEPI  QAFG+K   ++ LTLQRTI +LL+ S PI LLW N+K 
Sbjct  94    FANITGYSILSGLAMGMEPICGQAFGAKKYNLLGLTLQRTILLLLLTSFPIALLWINMKN  153

Query  1384  LMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCKGTTWPLLWSTLIATMLHL  1205
             ++++  QD  I   A  +  +++PDL A S+LHPLRIYLR +  T PL +  +++  LH+
Sbjct  154   ILVYCGQDEDIATEAQSYLIYSLPDLFAQSLLHPLRIYLRTQSITLPLTFCAIVSISLHV  213

Query  1204  PIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQNEALYKPLATNLKSSTSI  1025
             PI + L   L LG++GIA+S+   N   ++ L+ YI+ +      ++K    NL  ST  
Sbjct  214   PINYLLVTKLNLGVKGIALSSVWTNLNLVISLIIYIIIS-----GVHKKTWENL--STEC  266

Query  1024  GEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTLATAAIVIQTTSLMYTLPS  845
              + W  LL LA+PSC++VCLEWWWYE M L+ G L+ P+ T+A+  I+IQTTSL+Y  PS
Sbjct  267   LKGWKELLNLAIPSCISVCLEWWWYEIMILVCGVLINPRATVASMGILIQTTSLIYIFPS  326

Query  844   ALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGILLTTLGREVWVKIFttdte  665
             +LS S+S+RVGNELGA  P KA++A  + +  +F+     +      R++W K+FT D +
Sbjct  327   SLSFSVSTRVGNELGAREPKKAKIAAIVGLAGSFVLGFSALFFAVTVRKIWAKMFTNDQD  386

Query  664   vleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACINFYSFYLMGAPLAIIMAFV  485
             +L LT  VLPIIGLCE+ NCPQTT CGVLRGSARP +GA IN   FYL+G P+A++++F 
Sbjct  387   ILTLTSLVLPIIGLCEIGNCPQTTGCGVLRGSARPKVGANINLVCFYLVGMPVAVVLSFY  446

Query  484   WKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDLVGESRETSFEDPMIKFKE  305
                +F+GL  GLLAAQ +C+++ML+V+ RTDW+ ++ RAK L G +     ++  I   +
Sbjct  447   AGFDFEGLWLGLLAAQASCMVTMLMVLLRTDWDLQAERAKHLTGTTLLYGVDENEINIDQ  506

Query  304   GEEF  293
              ++ 
Sbjct  507   SKQL  510



>ref|XP_011074298.1| PREDICTED: MATE efflux family protein 5 [Sesamum indicum]
Length=562

 Score =   372 bits (956),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 231/480 (48%), Positives = 306/480 (64%), Gaps = 8/480 (2%)
 Frame = -3

Query  1795  HKHTRANTNQQEEKMAAKQTQKHSTIP-EVMEELRKMIDTCFPMIAMGLISYMKNMILVV  1619
             +K    N N+  + +   Q       P E +EE++++     P    GLI Y + MI ++
Sbjct  17    NKSHLLNPNKTMDLLIDDQELHRWPNPSEALEEIKEIGKISGPTAITGLILYSRAMISML  76

Query  1618  CMgrlgslelaggalaiGFTNITGYSVLSGLALGMEPISSQAFGSKNLTIVSLTLQRTIS  1439
              +G LG LELAGG+L+IG  NITGYSV+SGLA+GMEPI  QA+G+K + ++ L LQRTI 
Sbjct  77    FLGYLGELELAGGSLSIGVANITGYSVISGLAMGMEPICGQAYGAKQMKLLGLALQRTIL  136

Query  1438  MLLMASLPIGLLWFNLKPLMLWLHQDAKIIHIASLFCQFAIPDLVANSILHPLRIYLRCK  1259
             +LL  S+PI  +WFN+K ++LW +QD +I  +A  F  FAIPDL   S+LHPLRIYLR +
Sbjct  137   LLLTTSIPISFMWFNMKRILLWCNQDEEISSVAQTFILFAIPDLFFLSLLHPLRIYLRTQ  196

Query  1258  GTTWPLLWSTLIATMLHLPIVFYLTFSLKLGIQGIAISTFVANfigllfllgyilYTNEQ  1079
             G T PL + + I+ +LH+P+ F L     +GI G+A++  + N   +L L  YI ++   
Sbjct  197   GITLPLTYCSSISVLLHVPLNFLLVKYFNMGIAGVALAMALTNLNLVLLLCSYIYFSGVY  256

Query  1078  NEALYKPLATNLKSSTSIGEEWVILLRLALPSCLAVCLEWWWYEFMTLLAGYLVRPQVTL  899
               +   P    LK        W  LL LA+P+C++VCLEWWWYE M +L G L  P+ T+
Sbjct  257   KGSWVAPSLDCLKG-------WSSLLSLAIPTCISVCLEWWWYELMIMLCGLLSNPKATI  309

Query  898   ATAAIVIQTTSLMYTLPSALSNSISSRVGNELGAGRPGKARLATAIAIVLAFLASAFGIL  719
             A+  I+IQTTSL+Y  PS+LS  +S+RV NELGA RP KAR++  +++  A       +L
Sbjct  310   ASMGILIQTTSLVYVFPSSLSLGVSTRVSNELGARRPAKARISMIVSLFCAVALGVAAML  369

Query  718   LTTLGREVWVKIFttdtevleltvtvLPIIGLCELANCPQTTCCGVLRGSARPNIGACIN  539
              TTL R  W + FT D E+LELT   LPI GLCEL NCPQTT CGVLRGSARP IGA IN
Sbjct  370   FTTLMRHRWGRFFTGDAEILELTTVALPIAGLCELGNCPQTTGCGVLRGSARPTIGANIN  429

Query  538   FYSFYLMGAPLAIIMAFVWKLEFKGLCYGLLAAQVACVISMLIVIYRTDWEKESARAKDL  359
               SFYL+G P+A  M F  KL F GL  GLLAAQ  C + ML V+ RTDW  +  RAK+L
Sbjct  430   LGSFYLVGMPVAFFMGFGLKLGFAGLWLGLLAAQGCCALLMLFVLCRTDWILQVERAKEL  489



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5681893186740