BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7886_g2_i1 len=877 path=[3575:0-0 456:1-24 480:25-876]

Length=877
                                                                      Score     E

ref|XP_011002827.1|  PREDICTED: ethylene-responsive transcription...    153   2e-41   
ref|XP_002324785.1|  hypothetical protein POPTR_0018s08320g             148   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_002308508.1|  hypothetical protein POPTR_0006s23480g             148   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011019312.1|  PREDICTED: ethylene-responsive transcription...    147   5e-39   
ref|XP_009615403.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   
ref|XP_009780019.1|  PREDICTED: ethylene-responsive transcription...    138   3e-35   
ref|XP_002516165.1|  Transcriptional factor TINY, putative              135   5e-34   Ricinus communis
emb|CDP17886.1|  unnamed protein product                                133   1e-33   
gb|AFV60734.1|  ethylene-responsive transcription factor 2              132   1e-33   
gb|ABQ62995.1|  RAP2-like protein                                       132   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006381587.1|  AP2 domain-containing transcription factor f...    132   3e-33   
ref|XP_010273875.1|  PREDICTED: ethylene-responsive transcription...    132   3e-33   
ref|XP_004241075.1|  PREDICTED: ethylene-responsive transcription...    132   3e-33   
ref|XP_010099089.1|  Ethylene-responsive transcription factor           130   8e-33   
ref|XP_009337182.1|  PREDICTED: ethylene-responsive transcription...    131   9e-33   
gb|KDP33947.1|  hypothetical protein JCGZ_07518                         129   2e-32   
ref|XP_010261769.1|  PREDICTED: ethylene-responsive transcription...    129   4e-32   
ref|XP_009359712.1|  PREDICTED: ethylene-responsive transcription...    129   4e-32   
ref|XP_006356706.1|  PREDICTED: ethylene-responsive transcription...    129   6e-32   
ref|XP_011039944.1|  PREDICTED: ethylene-responsive transcription...    128   9e-32   
ref|XP_008344047.1|  PREDICTED: ethylene-responsive transcription...    128   1e-31   
gb|ABU84809.1|  putative dehydration-responsive element binding p...    127   1e-31   Broussonetia papyrifera [aka]
gb|ADE41099.1|  AP2 domain class transcription factor                   128   1e-31   
ref|XP_010687541.1|  PREDICTED: ethylene-responsive transcription...    127   3e-31   
ref|XP_004287662.1|  PREDICTED: ethylene-responsive transcription...    126   4e-31   
gb|KDP34005.1|  hypothetical protein JCGZ_07576                         126   5e-31   
ref|XP_006474695.1|  PREDICTED: ethylene-responsive transcription...    125   9e-31   
gb|KDO73836.1|  hypothetical protein CISIN_1g029068mg                   125   1e-30   
ref|XP_006452855.1|  hypothetical protein CICLE_v10009540mg             124   1e-30   
ref|XP_008337827.1|  PREDICTED: ethylene-responsive transcription...    124   3e-30   
emb|CDP03051.1|  unnamed protein product                                124   4e-30   
gb|AFJ14637.1|  dehydration-responsive element-binding protein (D...    124   4e-30   
gb|EYU21967.1|  hypothetical protein MIMGU_mgv1a023084mg                121   2e-29   
gb|KCW81819.1|  hypothetical protein EUGRSUZ_C03175                     121   2e-29   
ref|XP_008242271.1|  PREDICTED: ethylene-responsive transcription...    121   3e-29   
ref|XP_010687542.1|  PREDICTED: ethylene-responsive transcription...    121   3e-29   
ref|XP_009624342.1|  PREDICTED: ethylene-responsive transcription...    121   3e-29   
ref|XP_010051344.1|  PREDICTED: ethylene-responsive transcription...    121   8e-29   
ref|XP_010050433.1|  PREDICTED: ethylene-responsive transcription...    120   9e-29   
ref|XP_002280370.1|  PREDICTED: ethylene-responsive transcription...    119   1e-28   Vitis vinifera
emb|CAW30731.1|  TINY transcription factor                              119   1e-28   
ref|XP_008450955.1|  PREDICTED: ethylene-responsive transcription...    119   1e-28   
ref|NP_001238500.1|  dehydration-responsive element binding prote...    119   2e-28   
ref|XP_007204729.1|  hypothetical protein PRUPE_ppa011336mg             119   2e-28   
ref|XP_002516233.1|  conserved hypothetical protein                     117   2e-28   Ricinus communis
ref|XP_009759846.1|  PREDICTED: ethylene-responsive transcription...    119   2e-28   
ref|XP_004141440.1|  PREDICTED: ethylene-responsive transcription...    118   3e-28   
ref|XP_009106149.1|  PREDICTED: ethylene-responsive transcription...    118   4e-28   
ref|XP_009126865.1|  PREDICTED: ethylene-responsive transcription...    116   4e-28   
ref|XP_007012474.1|  Integrase-type DNA-binding superfamily prote...    118   5e-28   
ref|XP_010428490.1|  PREDICTED: ethylene-responsive transcription...    117   5e-28   
ref|XP_010535748.1|  PREDICTED: ethylene-responsive transcription...    118   7e-28   
ref|XP_010098396.1|  Ethylene-responsive transcription factor           119   8e-28   
ref|XP_009126515.1|  PREDICTED: ethylene-responsive transcription...    117   1e-27   
ref|XP_006302833.1|  hypothetical protein CARUB_v10020965mg             116   1e-27   
ref|XP_004488104.1|  PREDICTED: ethylene-responsive transcription...    116   2e-27   
ref|XP_006288608.1|  hypothetical protein CARUB_v10001903mg             116   2e-27   
gb|KCW79361.1|  hypothetical protein EUGRSUZ_C00780                     117   2e-27   
ref|XP_008452799.1|  PREDICTED: ethylene-responsive transcription...    115   2e-27   
ref|NP_680184.1|  ethylene-responsive transcription factor ERF016       116   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144051.1|  PREDICTED: ethylene-responsive transcription...    115   3e-27   
ref|XP_002887566.1|  hypothetical protein ARALYDRAFT_476631             115   3e-27   
ref|XP_009120702.1|  PREDICTED: ethylene-responsive transcription...    116   3e-27   
emb|CDX73125.1|  BnaC06g35730D                                          115   4e-27   
ref|XP_010471592.1|  PREDICTED: ethylene-responsive transcription...    115   4e-27   
ref|XP_011081953.1|  PREDICTED: ethylene-responsive transcription...    115   4e-27   
ref|XP_007012584.1|  AP2/ERF domain-containing transcription factor     115   5e-27   
ref|XP_004488106.1|  PREDICTED: ethylene-responsive transcription...    115   5e-27   
ref|XP_011093871.1|  PREDICTED: ethylene-responsive transcription...    115   5e-27   
ref|XP_002874038.1|  hypothetical protein ARALYDRAFT_910177             115   5e-27   
ref|XP_002276572.2|  PREDICTED: ethylene-responsive transcription...    115   6e-27   Vitis vinifera
emb|CDY45406.1|  BnaA07g31860D                                          114   6e-27   
ref|XP_009131845.1|  PREDICTED: ethylene-responsive transcription...    115   7e-27   
ref|XP_008466852.1|  PREDICTED: ethylene-responsive transcription...    115   7e-27   
ref|XP_006416528.1|  hypothetical protein EUTSA_v10009812mg             114   8e-27   
ref|XP_004488105.1|  PREDICTED: ethylene-responsive transcription...    114   8e-27   
ref|XP_006400701.1|  hypothetical protein EUTSA_v10015465mg             115   8e-27   
ref|NP_173355.3|  ethylene-responsive transcription factor ERF017       114   9e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010477124.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
gb|AAF82238.1|AC069143_14  Contains similarity to an AP2 domain c...    113   1e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459580.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_006474529.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_010420984.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_004144279.1|  PREDICTED: ethylene-responsive transcription...    114   1e-26   
ref|XP_010498330.1|  PREDICTED: ethylene-responsive transcription...    113   2e-26   
ref|XP_009613570.1|  PREDICTED: ethylene-responsive transcription...    114   2e-26   
ref|XP_003542371.2|  PREDICTED: ethylene-responsive transcription...    115   2e-26   
emb|CDX96673.1|  BnaA08g22160D                                          112   2e-26   
gb|AFK45531.1|  unknown                                                 113   3e-26   
ref|XP_009104737.1|  PREDICTED: ethylene-responsive transcription...    112   3e-26   
ref|XP_006306071.1|  hypothetical protein CARUB_v10011394mg             112   4e-26   
ref|XP_008784342.1|  PREDICTED: ethylene-responsive transcription...    112   4e-26   
ref|XP_010416351.1|  PREDICTED: ethylene-responsive transcription...    112   5e-26   
ref|XP_006345254.1|  PREDICTED: ethylene-responsive transcription...    113   6e-26   
ref|XP_004251702.1|  PREDICTED: ethylene-responsive transcription...    113   6e-26   
gb|EYU25826.1|  hypothetical protein MIMGU_mgv1a026977mg                110   7e-26   
gb|EYU28310.1|  hypothetical protein MIMGU_mgv1a014932mg                110   1e-25   
emb|CDX68158.1|  BnaA07g21980D                                          111   1e-25   
ref|XP_010496785.1|  PREDICTED: ethylene-responsive transcription...    112   1e-25   
ref|NP_177631.1|  ethylene-responsive transcription factor ERF018       111   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010910716.1|  PREDICTED: ethylene-responsive transcription...    111   1e-25   
emb|CBI27772.3|  unnamed protein product                                112   1e-25   
ref|XP_006452945.1|  hypothetical protein CICLE_v10010348mg             111   1e-25   
ref|XP_006390369.1|  hypothetical protein EUTSA_v10019652mg             110   2e-25   
ref|XP_002893033.1|  hypothetical protein ARALYDRAFT_472144             110   2e-25   
ref|XP_003595361.1|  Ethylene-responsive transcription factor RAP2-9    110   2e-25   
dbj|BAF47194.1|  embryonic element binding Factor 8                     109   5e-25   Daucus carota [carrots]
ref|XP_007138631.1|  hypothetical protein PHAVU_009G225000g             109   5e-25   
ref|XP_011039943.1|  PREDICTED: ethylene-responsive transcription...    109   6e-25   
ref|XP_010541700.1|  PREDICTED: ethylene-responsive transcription...    109   8e-25   
ref|XP_003595362.1|  Ethylene-responsive transcription factor           108   1e-24   
emb|CDX83779.1|  BnaC08g18660D                                          108   1e-24   
gb|KFK44061.1|  hypothetical protein AALP_AA1G210800                    108   1e-24   
gb|KEH39894.1|  ethylene-responsive transcription factor ERF018         109   1e-24   
emb|CDX81918.1|  BnaC08g36830D                                          108   1e-24   
gb|KFK41931.1|  hypothetical protein AALP_AA2G190400                    107   2e-24   
emb|CDY21678.1|  BnaA09g44290D                                          107   3e-24   
ref|XP_009117558.1|  PREDICTED: ethylene-responsive transcription...    107   3e-24   
ref|XP_009149397.1|  PREDICTED: ethylene-responsive transcription...    105   4e-24   
ref|XP_006843906.1|  hypothetical protein AMTR_s00007p00268460          107   4e-24   
ref|XP_006381586.1|  AP2 domain-containing transcription factor f...    106   5e-24   
gb|KEH39896.1|  ethylene-responsive transcription factor ERF018         107   6e-24   
ref|XP_003533795.1|  PREDICTED: ethylene-responsive transcription...    106   1e-23   
ref|XP_003603247.1|  Ethylene-responsive transcription factor RAP2-9    106   2e-23   
gb|ABK20977.1|  unknown                                                 104   2e-23   Picea sitchensis
gb|KEH39897.1|  ethylene-responsive transcription factor ERF018         106   2e-23   
gb|KEH39898.1|  ethylene-responsive transcription factor ERF018         105   3e-23   
ref|XP_003546516.1|  PREDICTED: ethylene-responsive transcription...    104   3e-23   
ref|XP_003595363.1|  Ethylene-responsive transcription factor RAP2-1    105   4e-23   
gb|EPS59347.1|  hypothetical protein M569_15461                         101   4e-23   
ref|XP_010273874.1|  PREDICTED: ethylene-responsive transcription...    103   6e-23   
emb|CDX85863.1|  BnaC06g22710D                                          103   6e-23   
ref|XP_003603244.1|  Ethylene-responsive transcription factor RAP2-9    103   1e-22   
gb|AES65612.2|  ethylene-responsive transcription factor ERF017-l...    103   1e-22   
ref|XP_004498968.1|  PREDICTED: ethylene-responsive transcription...    103   1e-22   
ref|XP_003527767.1|  PREDICTED: ethylene-responsive transcription...    103   2e-22   
gb|ABR17111.1|  unknown                                                 101   3e-22   Picea sitchensis
ref|XP_011078131.1|  PREDICTED: ethylene-responsive transcription...    101   5e-22   
ref|XP_003523659.1|  PREDICTED: ethylene-responsive transcription...    102   5e-22   
gb|KHN29661.1|  Ethylene-responsive transcription factor ERF018         102   6e-22   
gb|ABK26476.1|  unknown                                                 101   6e-22   Picea sitchensis
ref|XP_006843905.1|  hypothetical protein AMTR_s00007p00268280          101   6e-22   
gb|ABR17626.1|  unknown                                                 100   9e-22   Picea sitchensis
ref|XP_008792845.1|  PREDICTED: ethylene-responsive transcription...  99.8    1e-21   
ref|XP_007136913.1|  hypothetical protein PHAVU_009G084400g             100   3e-21   
gb|KHN05270.1|  Ethylene-responsive transcription factor ERF017         100   3e-21   
ref|XP_006596062.1|  PREDICTED: ethylene-responsive transcription...    100   3e-21   
gb|KDP33946.1|  hypothetical protein JCGZ_07517                       97.1    4e-21   
ref|XP_007161121.1|  hypothetical protein PHAVU_001G044500g           98.6    8e-21   
ref|XP_004501409.1|  PREDICTED: ethylene-responsive transcription...  98.2    9e-21   
ref|XP_008800510.1|  PREDICTED: ethylene-responsive transcription...  96.3    2e-20   
ref|XP_008786989.1|  PREDICTED: ethylene-responsive transcription...  95.9    4e-20   
ref|XP_007012585.1|  Integrase-type DNA-binding superfamily prote...  94.7    4e-20   
gb|EPS59984.1|  hypothetical protein M569_14820                       95.9    5e-20   
ref|XP_010099090.1|  Ethylene-responsive transcription factor         95.1    5e-20   
ref|XP_010940190.1|  PREDICTED: ethylene-responsive transcription...  94.7    5e-20   
ref|XP_010917441.1|  PREDICTED: ethylene-responsive transcription...  95.1    7e-20   
ref|XP_009389872.1|  PREDICTED: ethylene-responsive transcription...  94.4    9e-20   
ref|XP_006601199.1|  PREDICTED: ethylene-responsive transcription...  95.9    1e-19   
gb|KHN20149.1|  Ethylene-responsive transcription factor ERF017       95.5    1e-19   
ref|XP_010937366.1|  PREDICTED: ethylene-responsive transcription...  94.0    2e-19   
gb|AFG62416.1|  hypothetical protein UMN_5771_02                      90.9    3e-19   
ref|XP_004954129.1|  PREDICTED: ethylene-responsive transcription...  94.0    3e-19   
ref|XP_008647233.1|  PREDICTED: ethylene-responsive transcription...  92.8    3e-19   
ref|XP_009415650.1|  PREDICTED: ethylene-responsive transcription...  92.8    4e-19   
ref|XP_002277621.2|  PREDICTED: ethylene-responsive transcription...  92.0    4e-19   Vitis vinifera
ref|XP_009390429.1|  PREDICTED: ethylene-responsive transcription...  92.4    5e-19   
ref|XP_009389873.1|  PREDICTED: ethylene-responsive transcription...  93.2    6e-19   
ref|XP_011026594.1|  PREDICTED: ethylene-responsive transcription...  91.3    7e-19   
gb|AEK82609.1|  ethylene-responsive element binding protein 2         91.3    8e-19   
gb|EYU25827.1|  hypothetical protein MIMGU_mgv1a020481mg              89.7    9e-19   
gb|KEH21998.1|  ethylene response factor                              89.4    9e-19   
ref|XP_009381715.1|  PREDICTED: ethylene-responsive transcription...  91.7    1e-18   
ref|XP_002516234.1|  Transcriptional factor TINY, putative            90.1    1e-18   Ricinus communis
ref|XP_011039946.1|  PREDICTED: ethylene-responsive transcription...  90.9    1e-18   
ref|XP_006381588.1|  hypothetical protein POPTR_0006s14110g           90.1    2e-18   
gb|AFG62418.1|  hypothetical protein UMN_5771_02                      88.6    2e-18   
gb|ADE77618.1|  unknown                                               90.9    2e-18   
ref|XP_009620960.1|  PREDICTED: ethylene-responsive transcription...  90.5    2e-18   
gb|AFG43393.1|  hypothetical protein                                  88.2    2e-18   
ref|XP_002324813.1|  hypothetical protein POPTR_0018s00700g           89.7    2e-18   Populus trichocarpa [western balsam poplar]
gb|EPS73929.1|  hypothetical protein M569_00830                       88.2    3e-18   
ref|XP_011016480.1|  PREDICTED: ethylene-responsive transcription...  89.4    3e-18   
ref|XP_010236912.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-18   
ref|XP_010095211.1|  Ethylene-responsive transcription factor         90.1    4e-18   
gb|ABR16945.1|  unknown                                               90.5    4e-18   Picea sitchensis
gb|KCW81927.1|  hypothetical protein EUGRSUZ_C03297                   90.1    4e-18   
ref|XP_010051400.1|  PREDICTED: ethylene-responsive transcription...  90.1    5e-18   
ref|XP_006367885.1|  PREDICTED: ethylene-responsive transcription...  89.0    5e-18   
ref|XP_004243693.1|  PREDICTED: ethylene-responsive transcription...  89.0    6e-18   
ref|XP_004966650.1|  PREDICTED: ethylene-responsive transcription...  89.7    7e-18   
ref|XP_010050434.1|  PREDICTED: ethylene-responsive transcription...  89.0    8e-18   
ref|XP_009791847.1|  PREDICTED: ethylene-responsive transcription...  88.6    9e-18   
ref|XP_006452852.1|  hypothetical protein CICLE_v10009827mg           87.8    9e-18   
ref|XP_006851005.1|  hypothetical protein AMTR_s00025p00218200        89.0    9e-18   
ref|XP_008680656.1|  PREDICTED: dehydration-responsive element-bi...  89.7    9e-18   
ref|XP_010525826.1|  PREDICTED: ethylene-responsive transcription...  88.6    2e-17   
ref|XP_002308137.2|  hypothetical protein POPTR_0006s08000g           87.0    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_004966651.1|  PREDICTED: ethylene-responsive transcription...  87.4    4e-17   
ref|XP_010910750.1|  PREDICTED: ethylene-responsive transcription...  87.0    4e-17   
gb|ABK22932.1|  unknown                                               86.7    5e-17   Picea sitchensis
ref|XP_008801457.1|  PREDICTED: ethylene-responsive transcription...  87.0    5e-17   
ref|XP_010531255.1|  PREDICTED: ethylene-responsive transcription...  86.3    5e-17   
ref|XP_010937367.1|  PREDICTED: ethylene-responsive transcription...  88.2    6e-17   
ref|XP_009392013.1|  PREDICTED: ethylene-responsive transcription...  86.3    7e-17   
ref|XP_009405172.1|  PREDICTED: ethylene-responsive transcription...  87.0    7e-17   
ref|XP_004288858.1|  PREDICTED: ethylene-responsive transcription...  85.9    9e-17   
ref|XP_010937368.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
ref|XP_009108952.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
gb|EEC80171.1|  hypothetical protein OsI_22020                        84.3    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006412635.1|  hypothetical protein EUTSA_v10026328mg           85.1    2e-16   
ref|XP_008786978.1|  PREDICTED: ethylene-responsive transcription...  85.1    2e-16   
ref|XP_006284912.1|  hypothetical protein CARUB_v10006208mg           85.1    2e-16   
ref|NP_567867.1|  ethylene-responsive transcription factor ERF015     85.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18187.1|  putative protein                                     86.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAT44951.1|  putative AP2/EREBP transcription factor               84.7    2e-16   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD36632.1|  AP2 domain transcription factor-like                 83.2    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002869347.1|  hypothetical protein ARALYDRAFT_913363           84.7    3e-16   
emb|CDY23275.1|  BnaA08g12710D                                        85.5    3e-16   
ref|XP_002991098.1|  hypothetical protein SELMODRAFT_71661            84.0    3e-16   
gb|EAY87759.1|  hypothetical protein OsI_09177                        84.7    3e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_010445038.1|  PREDICTED: ethylene-responsive transcription...  84.3    3e-16   
dbj|BAD19440.1|  AP2 domain transcription factor-like                 84.7    3e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010436316.1|  PREDICTED: ethylene-responsive transcription...  84.3    4e-16   
ref|XP_002991657.1|  hypothetical protein SELMODRAFT_71659            83.6    4e-16   
dbj|BAD36633.1|  AP2 domain transcription factor-like                 84.3    5e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399647.1|  PREDICTED: ethylene-responsive transcription...  84.0    5e-16   
gb|EEC80179.1|  hypothetical protein OsI_22034                        84.0    6e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_001772779.1|  predicted protein                                80.9    6e-16   
ref|XP_004966648.1|  PREDICTED: ethylene-responsive transcription...  84.3    7e-16   
ref|XP_004966649.1|  PREDICTED: ethylene-responsive transcription...  83.6    8e-16   
ref|XP_001785538.1|  predicted protein                                80.1    8e-16   
ref|XP_009127267.1|  PREDICTED: ethylene-responsive transcription...  83.2    9e-16   
ref|XP_004494833.1|  PREDICTED: ethylene-responsive transcription...  82.8    9e-16   
ref|XP_011020355.1|  PREDICTED: ethylene-responsive transcription...  81.6    1e-15   
ref|XP_010451100.1|  PREDICTED: ethylene-responsive transcription...  82.8    1e-15   
ref|XP_001753243.1|  predicted protein                                80.1    2e-15   
ref|XP_006404817.1|  hypothetical protein EUTSA_v10000354mg           82.0    2e-15   
dbj|BAD35230.1|  AP2 domain transcription factor-like                 82.8    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009110164.1|  PREDICTED: ethylene-responsive transcription...  82.8    2e-15   
gb|EPS69379.1|  hypothetical protein M569_05389                       80.5    2e-15   
ref|XP_009385648.1|  PREDICTED: ethylene-responsive transcription...  82.0    2e-15   
ref|XP_008666566.1|  PREDICTED: ethylene-responsive transcription...  82.4    3e-15   
ref|XP_001763400.1|  predicted protein                                82.4    4e-15   
ref|NP_173609.1|  ethylene-responsive transcription factor ERF012     82.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303331.1|  hypothetical protein CARUB_v10010179mg           82.0    4e-15   
gb|AIB05873.1|  AP2-EREBP transcription factor                        82.0    4e-15   
gb|AAM63137.1|  TINY-like protein                                     82.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EMT28518.1|  Ethylene-responsive transcription factor ERF018       81.6    5e-15   
ref|XP_010477440.1|  PREDICTED: ethylene-responsive transcription...  81.6    5e-15   
ref|XP_010550358.1|  PREDICTED: ethylene-responsive transcription...  80.9    5e-15   
emb|CDY38828.1|  BnaC08g20020D                                        81.3    5e-15   
gb|EAZ00036.1|  hypothetical protein OsI_22036                        81.3    5e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002284933.1|  PREDICTED: ethylene-responsive transcription...  80.1    5e-15   Vitis vinifera
emb|CDX68719.1|  BnaC01g07340D                                        84.3    5e-15   
ref|XP_001754775.1|  predicted protein                                78.2    5e-15   
ref|XP_009138039.1|  PREDICTED: ethylene-responsive transcription...  80.9    6e-15   
emb|CDX75631.1|  BnaA01g00710D                                        80.9    6e-15   
ref|XP_006660184.1|  PREDICTED: ethylene-responsive transcription...  81.3    6e-15   
gb|AHJ08576.1|  DREB5-like protein                                    80.1    6e-15   
ref|XP_010498649.1|  PREDICTED: ethylene-responsive transcription...  81.6    6e-15   
ref|XP_010558753.1|  PREDICTED: ethylene-responsive transcription...  80.5    7e-15   
emb|CDX69283.1|  BnaC01g01700D                                        80.9    7e-15   
ref|XP_001762507.1|  predicted protein                                77.8    8e-15   
ref|XP_001780289.1|  predicted protein                                79.3    8e-15   
gb|EPS63096.1|  hypothetical protein M569_11692                       79.3    9e-15   
ref|XP_011094016.1|  PREDICTED: ethylene-responsive transcription...  80.1    1e-14   
emb|CDY28240.1|  BnaA01g06090D                                        83.6    1e-14   
gb|AHB33874.1|  ERF transcription factor 03                           78.2    1e-14   
ref|XP_009359912.1|  PREDICTED: ethylene-responsive transcription...  79.3    1e-14   
ref|XP_008452588.1|  PREDICTED: ethylene-responsive transcription...  79.0    1e-14   
emb|CDY62224.1|  BnaCnng39660D                                        79.7    1e-14   
ref|XP_004141277.1|  PREDICTED: ethylene-responsive transcription...  79.0    1e-14   
ref|XP_009138483.1|  PREDICTED: ethylene-responsive transcription...  79.7    1e-14   
emb|CDY29540.1|  BnaA03g53850D                                        79.7    2e-14   
ref|XP_003520876.1|  PREDICTED: ethylene-responsive transcription...  79.3    2e-14   
ref|XP_006291976.1|  hypothetical protein CARUB_v10018162mg           79.0    2e-14   
emb|CDY38938.1|  BnaA04g13590D                                        79.0    2e-14   
ref|XP_004973610.1|  PREDICTED: ethylene-responsive transcription...  80.1    2e-14   
gb|AEM63544.1|  dehydration-responsive element-binding protein DREB2  78.6    2e-14   
ref|XP_002889375.1|  hypothetical protein ARALYDRAFT_470149           79.3    2e-14   
ref|XP_002523328.1|  Transcriptional factor TINY, putative            79.7    2e-14   
gb|EYU38883.1|  hypothetical protein MIMGU_mgv1a014821mg              79.3    2e-14   
ref|XP_006279808.1|  hypothetical protein CARUB_v10027999mg           79.3    2e-14   
ref|XP_010432078.1|  PREDICTED: ethylene-responsive transcription...  79.3    2e-14   
gb|ADE75776.1|  unknown                                               79.3    2e-14   
emb|CDY12817.1|  BnaC07g16160D                                        78.6    2e-14   
emb|CDY01431.1|  BnaA07g12040D                                        78.6    2e-14   
ref|XP_001769646.1|  predicted protein                                76.6    2e-14   
emb|CDP08665.1|  unnamed protein product                              80.1    2e-14   
ref|XP_001760861.1|  predicted protein                                76.3    2e-14   
gb|AID51418.1|  ethylene response factor 13                           78.6    2e-14   
ref|XP_006354856.1|  PREDICTED: ethylene-responsive transcription...  78.2    2e-14   
gb|KFK32751.1|  hypothetical protein AALP_AA6G284000                  78.6    3e-14   
ref|XP_010451021.1|  PREDICTED: ethylene-responsive transcription...  79.0    3e-14   
ref|XP_004238136.1|  PREDICTED: ethylene-responsive transcription...  78.2    3e-14   
gb|KFK44293.1|  hypothetical protein AALP_AA1G239300                  79.7    3e-14   
emb|CDX81337.1|  BnaC09g07480D                                        78.2    3e-14   
emb|CDY18641.1|  BnaA09g07540D                                        78.2    3e-14   
gb|AAT44927.1|  putative AP2/EREBP transcription factor               79.0    3e-14   
ref|XP_002865019.1|  hypothetical protein ARALYDRAFT_919990           79.0    3e-14   
emb|CDY04682.1|  BnaC05g17200D                                        79.0    3e-14   
ref|XP_011069739.1|  PREDICTED: ethylene-responsive transcription...  77.8    3e-14   
ref|XP_006393917.1|  hypothetical protein EUTSA_v10004985mg           78.6    3e-14   
emb|CDX77012.1|  BnaC04g38070D                                        79.0    3e-14   
ref|XP_002878679.1|  hypothetical protein ARALYDRAFT_481204           78.2    3e-14   
ref|XP_009115658.1|  PREDICTED: ethylene-responsive transcription...  79.3    3e-14   
ref|NP_201520.1|  ethylene-responsive transcription factor ERF010     78.6    3e-14   
gb|KFK28412.1|  hypothetical protein AALP_AA8G511500                  78.6    3e-14   
gb|ABK28777.1|  unknown                                               78.6    3e-14   
ref|XP_001781164.1|  predicted protein                                75.5    3e-14   
emb|CDP02517.1|  unnamed protein product                              78.2    4e-14   
ref|XP_006345621.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
gb|KHN12801.1|  Ethylene-responsive transcription factor RAP2-1       77.4    4e-14   
ref|XP_010484534.1|  PREDICTED: ethylene-responsive transcription...  78.6    4e-14   
ref|XP_009112363.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
ref|XP_010464369.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
ref|XP_009140458.1|  PREDICTED: ethylene-responsive transcription...  78.2    4e-14   
gb|KFK30311.1|  hypothetical protein AALP_AA7G245400                  77.4    5e-14   
ref|XP_002320204.1|  AP2 domain-containing transcription factor f...  78.6    5e-14   
ref|NP_195408.1|  ethylene-responsive transcription factor RAP2-10    78.2    5e-14   
gb|AAF97326.1|AC023628_7  Similar to transcription factor TINY        78.2    5e-14   
ref|XP_010444933.1|  PREDICTED: ethylene-responsive transcription...  79.0    5e-14   
dbj|BAD09784.1|  AP2 domain transcription factor-like                 79.0    5e-14   
ref|XP_007017175.1|  AP2/ERF domain-containing transcription factor   77.4    5e-14   
ref|XP_009409641.1|  PREDICTED: ethylene-responsive transcription...  78.6    5e-14   
ref|XP_002866963.1|  hypothetical protein ARALYDRAFT_912628           78.2    5e-14   
ref|XP_002510182.1|  Dehydration-responsive element-binding prote...  77.4    5e-14   
ref|NP_563624.1|  ethylene-responsive transcription factor ERF023     78.2    6e-14   
gb|AAM63508.1|  transcription factor TINY, putative                   77.8    6e-14   
ref|XP_010937364.1|  PREDICTED: ethylene-responsive transcription...  77.8    6e-14   
ref|XP_010431584.1|  PREDICTED: ethylene-responsive transcription...  77.8    6e-14   
dbj|BAD36635.1|  AP2 domain transcription factor-like                 78.2    6e-14   
gb|EYU44425.1|  hypothetical protein MIMGU_mgv1a016214mg              76.6    6e-14   
ref|XP_010541156.1|  PREDICTED: ethylene-responsive transcription...  76.6    6e-14   
gb|EEE65253.1|  hypothetical protein OsJ_20451                        77.4    6e-14   
ref|XP_006416252.1|  hypothetical protein EUTSA_v10008639mg           78.6    6e-14   
emb|CDY30598.1|  BnaAnng03730D                                        77.4    7e-14   
gb|ABB54485.1|  cDREB                                                 75.1    7e-14   
ref|XP_009410362.1|  PREDICTED: ethylene-responsive transcription...  77.8    7e-14   
emb|CDX89561.1|  BnaC04g35800D                                        77.4    7e-14   
gb|AGC51783.1|  ERF/AP2 domain-containing transcription factor        77.0    7e-14   
ref|NP_179915.1|  ERF/AP2 transcription factor DEAR3                  77.4    7e-14   
ref|NP_190595.1|  ethylene-responsive transcription factor ERF011     77.0    8e-14   
ref|XP_009796242.1|  PREDICTED: ethylene-responsive transcription...  77.0    8e-14   
ref|XP_010472334.1|  PREDICTED: ethylene-responsive transcription...  77.4    8e-14   
emb|CDY17756.1|  BnaC08g21640D                                        77.0    8e-14   
ref|XP_010679510.1|  PREDICTED: ethylene-responsive transcription...  77.4    8e-14   
ref|XP_008444599.1|  PREDICTED: ethylene-responsive transcription...  76.6    8e-14   
ref|XP_004142875.1|  PREDICTED: ethylene-responsive transcription...  76.6    8e-14   
ref|XP_009115697.1|  PREDICTED: ethylene-responsive transcription...  77.0    8e-14   
ref|XP_003550331.1|  PREDICTED: ethylene-responsive transcription...  77.4    8e-14   
ref|XP_010515388.1|  PREDICTED: ethylene-responsive transcription...  77.0    8e-14   
ref|XP_008659247.1|  PREDICTED: ethylene-responsive transcription...  77.4    8e-14   
ref|XP_007051526.1|  Integrase-type DNA-binding superfamily protein   77.4    8e-14   
ref|XP_009413344.1|  PREDICTED: ethylene-responsive transcription...  77.0    9e-14   
ref|XP_006282466.1|  hypothetical protein CARUB_v10005767mg           77.8    9e-14   
ref|NP_001147519.1|  dehydration responsive element binding protein   77.4    9e-14   
ref|XP_009614221.1|  PREDICTED: ethylene-responsive transcription...  76.6    9e-14   
gb|AAQ08000.1|  dehydration responsive element binding protein        76.6    9e-14   
gb|EYU34565.1|  hypothetical protein MIMGU_mgv1a015596mg              76.6    9e-14   
ref|XP_010417086.1|  PREDICTED: ethylene-responsive transcription...  77.4    1e-13   
ref|XP_002960451.1|  hypothetical protein SELMODRAFT_73155            74.3    1e-13   
emb|CDM82108.1|  unnamed protein product                              77.8    1e-13   
ref|XP_006374902.1|  dehydration responsive element binding famil...  76.6    1e-13   
dbj|BAJ34079.1|  unnamed protein product                              77.4    1e-13   
ref|NP_001235779.1|  dehydration responsive element binding protein   77.0    1e-13   
ref|XP_008440304.1|  PREDICTED: ethylene-responsive transcription...  77.0    1e-13   
ref|XP_004141907.1|  PREDICTED: ethylene-responsive transcription...  77.0    1e-13   
ref|XP_011029523.1|  PREDICTED: ethylene-responsive transcription...  76.6    1e-13   
ref|XP_002890471.1|  AP2 domain-containing transcription factor f...  77.8    1e-13   
ref|XP_007156777.1|  hypothetical protein PHAVU_002G016700g           77.0    1e-13   
ref|XP_006295124.1|  hypothetical protein CARUB_v10024198mg           76.6    1e-13   
ref|XP_009790153.1|  PREDICTED: ethylene-responsive transcription...  77.0    1e-13   
emb|CDY01307.1|  BnaA07g10800D                                        77.8    1e-13   
ref|XP_002301414.2|  hypothetical protein POPTR_0002s17320g           76.6    1e-13   
ref|XP_006425956.1|  hypothetical protein CICLE_v10026687mg           76.3    1e-13   
ref|XP_002876019.1|  ATERF#011/CEJ1                                   76.3    1e-13   
ref|XP_006411914.1|  hypothetical protein EUTSA_v10026288mg           77.0    1e-13   
ref|XP_002444464.1|  hypothetical protein SORBIDRAFT_07g022265        77.8    1e-13   
gb|KDP41701.1|  hypothetical protein JCGZ_16108                       76.3    1e-13   
ref|XP_006494469.1|  PREDICTED: ethylene-responsive transcription...  76.3    1e-13   
ref|XP_003611687.1|  Ethylene-responsive transcription factor RAP...  76.6    1e-13   
ref|XP_006387557.1|  hypothetical protein POPTR_0855s00200g           76.6    1e-13   
ref|XP_010315978.1|  PREDICTED: ethylene-responsive transcription...  76.6    1e-13   
ref|XP_010444682.1|  PREDICTED: ethylene-responsive transcription...  76.6    1e-13   
gb|AAC49776.1|  AP2 domain containing protein RAP2.10                 77.8    1e-13   
gb|ACU24203.1|  unknown                                               76.6    1e-13   
gb|KEH24686.1|  AP2 domain class transcription factor                 76.6    1e-13   
gb|ABK96506.1|  unknown                                               76.6    1e-13   
ref|XP_007219742.1|  hypothetical protein PRUPE_ppa026139mg           76.6    2e-13   
gb|AFK44949.1|  unknown                                               76.6    2e-13   
ref|XP_011023164.1|  PREDICTED: ethylene-responsive transcription...  76.6    2e-13   
gb|KEH18632.1|  AP2 domain class transcription factor                 76.6    2e-13   
ref|XP_004288012.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-13   
ref|XP_006339868.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|XP_004510664.1|  PREDICTED: ethylene-responsive transcription...  76.6    2e-13   
gb|EPS59817.1|  hypothetical protein M569_14989                       75.5    2e-13   
gb|AEQ61579.1|  dehydration-responsive element binding protein 2      75.5    2e-13   
gb|ABX58043.1|  dehydration responsive element-binding protein 1      76.3    2e-13   
ref|XP_003539348.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|XP_010426571.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-13   
ref|XP_006491479.1|  PREDICTED: ethylene-responsive transcription...  76.6    2e-13   
emb|CDY00404.1|  BnaC07g14220D                                        77.0    2e-13   
gb|ABX58051.1|  dehydration responsive element-binding protein 1      76.3    2e-13   
ref|XP_009392127.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|XP_010503696.1|  PREDICTED: ethylene-responsive transcription...  75.9    2e-13   
gb|AEQ61578.1|  dehydration-responsive element binding protein 2      75.5    2e-13   
gb|AEQ61581.1|  dehydration-responsive element binding protein 2      75.5    2e-13   
gb|ACJ66376.1|  dehydration responsive element binding protein        76.3    2e-13   
ref|XP_008777348.1|  PREDICTED: dehydration-responsive element-bi...  77.0    2e-13   
ref|XP_006305645.1|  hypothetical protein CARUB_v10010347mg           76.6    2e-13   
ref|XP_003548354.1|  PREDICTED: ethylene-responsive transcription...  76.6    2e-13   
gb|KFK34280.1|  hypothetical protein AALP_AA5G124800                  75.9    2e-13   
ref|XP_007047346.1|  DREB and EAR motif protein 2, putative           76.3    2e-13   
ref|XP_006386629.1|  hypothetical protein POPTR_0002s17330g           76.3    2e-13   
ref|XP_007135267.1|  hypothetical protein PHAVU_010G114900g           76.3    2e-13   
gb|KDO51723.1|  hypothetical protein CISIN_1g045327mg                 75.9    2e-13   
gb|EAZ07208.1|  hypothetical protein OsI_29453                        77.0    2e-13   
ref|XP_008233130.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|XP_004308302.1|  PREDICTED: ethylene-responsive transcription...  76.3    2e-13   
ref|XP_009367373.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
ref|XP_003528789.1|  PREDICTED: ethylene-responsive transcription...  76.3    3e-13   
ref|XP_011074400.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
gb|EYU25454.1|  hypothetical protein MIMGU_mgv1a015510mg              75.5    3e-13   
ref|XP_010100723.1|  Ethylene-responsive transcription factor         76.6    3e-13   
gb|KDP28475.1|  hypothetical protein JCGZ_14246                       76.3    3e-13   
ref|XP_006478270.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
ref|XP_010474716.1|  PREDICTED: ethylene-responsive transcription...  76.3    3e-13   
emb|CDP01305.1|  unnamed protein product                              75.5    3e-13   
ref|XP_009118804.1|  PREDICTED: ethylene-responsive transcription...  76.3    3e-13   
ref|XP_010480467.1|  PREDICTED: ethylene-responsive transcription...  76.3    3e-13   
ref|XP_008340308.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
ref|NP_001288046.1|  ethylene-responsive transcription factor ERF...  75.5    3e-13   
ref|XP_002534341.1|  DNA binding protein, putative                    74.7    3e-13   
ref|XP_009372427.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
gb|AAL15314.1|  AT4g36900/C7A10_460                                   76.3    3e-13   
ref|XP_009600167.1|  PREDICTED: ethylene-responsive transcription...  75.9    3e-13   
gb|AET99100.1|  dehydration-responsive element-binding protein DREB3  75.5    3e-13   
ref|XP_004291085.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
ref|NP_001268123.1|  drought responsive element binding protein       75.1    3e-13   
ref|XP_010457145.1|  PREDICTED: ethylene-responsive transcription...  75.9    3e-13   
ref|XP_009599928.1|  PREDICTED: ethylene-responsive transcription...  75.5    3e-13   
ref|XP_009617210.1|  PREDICTED: ethylene-responsive transcription...  75.1    3e-13   
ref|XP_010064855.1|  PREDICTED: ethylene-responsive transcription...  75.1    3e-13   
ref|XP_003551002.1|  PREDICTED: ethylene-responsive transcription...  75.1    3e-13   
ref|XP_006444825.1|  hypothetical protein CICLE_v10022410mg           75.9    3e-13   
gb|KDO84105.1|  hypothetical protein CISIN_1g041516mg                 74.3    4e-13   
ref|XP_007160870.1|  hypothetical protein PHAVU_001G023700g           75.5    4e-13   
ref|XP_007223577.1|  hypothetical protein PRUPE_ppa012302mg           75.5    4e-13   
ref|XP_010070562.1|  PREDICTED: ethylene-responsive transcription...  75.1    4e-13   
ref|XP_006361741.1|  PREDICTED: ethylene-responsive transcription...  75.5    4e-13   
emb|CAN64037.1|  hypothetical protein VITISV_021556                   75.1    4e-13   
ref|XP_004229130.1|  PREDICTED: ethylene-responsive transcription...  73.9    4e-13   
gb|AAY89658.1|  DREB protein                                          75.1    4e-13   
ref|XP_002969964.1|  hypothetical protein SELMODRAFT_73157            72.4    4e-13   
ref|XP_003603078.1|  Ethylene-responsive transcription factor RAP2-1  75.1    4e-13   
gb|AHI96435.1|  DREB group protein                                    75.1    4e-13   
ref|XP_003525804.1|  PREDICTED: ethylene-responsive transcription...  74.7    4e-13   
gb|KDP44735.1|  hypothetical protein JCGZ_01235                       75.1    4e-13   
ref|XP_008354031.1|  PREDICTED: ethylene-responsive transcription...  75.5    4e-13   
ref|NP_001237254.1|  dehydration-responsive element binding prote...  74.7    5e-13   
ref|XP_002963984.1|  hypothetical protein SELMODRAFT_73146            72.4    5e-13   
gb|AFI08637.1|  AP2/ERF type transcription factor                     75.5    5e-13   
ref|XP_009791248.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...  75.1    5e-13   
gb|ACR44231.1|  drought responsive element binding protein 2          74.7    5e-13   
ref|XP_009780503.1|  PREDICTED: ethylene-responsive transcription...  75.1    5e-13   
ref|XP_006305842.1|  hypothetical protein CARUB_v10010891mg           74.7    5e-13   
ref|XP_002310127.2|  hypothetical protein POPTR_0007s10750g           75.1    5e-13   
gb|ABK93385.1|  unknown                                               75.1    5e-13   
ref|XP_007206034.1|  hypothetical protein PRUPE_ppa012516mg           74.7    5e-13   
gb|EEE57915.1|  hypothetical protein OsJ_08611                        75.1    5e-13   
ref|XP_011000066.1|  PREDICTED: ethylene-responsive transcription...  75.1    5e-13   
emb|CDU32445.1|  DREB2 factor                                         74.7    5e-13   
ref|XP_003523959.1|  PREDICTED: ethylene-responsive transcription...  74.7    5e-13   
ref|XP_006337962.1|  PREDICTED: ethylene-responsive transcription...  73.9    5e-13   
gb|AFU07644.1|  ethylene-responsive element binding factor 2          75.1    5e-13   
ref|XP_006434725.1|  hypothetical protein CICLE_v10002733mg           74.7    6e-13   
emb|CDO19441.1|  transcription factor DREB2 protein                   74.7    6e-13   
ref|XP_007147322.1|  hypothetical protein PHAVU_006G114100g           75.1    6e-13   
ref|XP_009767328.1|  PREDICTED: ethylene-responsive transcription...  74.3    6e-13   
gb|KFK42509.1|  hypothetical protein AALP_AA1G003100                  75.1    6e-13   
ref|XP_003553792.1|  PREDICTED: ethylene-responsive transcription...  75.1    6e-13   
ref|XP_010266557.1|  PREDICTED: ethylene-responsive transcription...  75.1    6e-13   
emb|CDO19438.1|  transcription factor DREB2 protein                   74.7    6e-13   
ref|XP_010500233.1|  PREDICTED: ethylene-responsive transcription...  74.3    6e-13   
ref|XP_010094641.1|  Ethylene-responsive transcription factor         75.1    6e-13   
ref|XP_006473291.1|  PREDICTED: ethylene-responsive transcription...  74.7    6e-13   
ref|XP_008352509.1|  PREDICTED: ethylene-responsive transcription...  74.3    6e-13   
ref|XP_009103276.1|  PREDICTED: ethylene-responsive transcription...  75.5    6e-13   
ref|XP_006578035.1|  PREDICTED: ethylene-responsive transcription...  74.7    7e-13   
gb|ADE41138.1|  AP2 domain class transcription factor                 74.3    7e-13   
ref|XP_009375406.1|  PREDICTED: ethylene-responsive transcription...  74.7    7e-13   
ref|XP_011017174.1|  PREDICTED: ethylene-responsive transcription...  74.3    7e-13   
ref|XP_002301169.1|  dehydration responsive element binding famil...  74.3    7e-13   
ref|XP_004511898.1|  PREDICTED: ethylene-responsive transcription...  74.3    7e-13   
dbj|BAJ53197.1|  JHL03K20.6                                           75.1    7e-13   
ref|XP_010236021.1|  PREDICTED: ethylene-responsive transcription...  75.5    7e-13   
ref|XP_010061728.1|  PREDICTED: ethylene-responsive transcription...  74.3    7e-13   
ref|XP_007140279.1|  hypothetical protein PHAVU_008G098900g           74.3    8e-13   



>ref|XP_011002827.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Populus euphratica]
Length=198

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 115/187 (61%), Gaps = 26/187 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY+ P+KAARAFD A YCLRG  A+FNFPD+PPD+ GG+ L
Sbjct  29   GKWVSEIRLPNSRKRIWLGSYDTPQKAARAFDAASYCLRGSGAKFNFPDNPPDIVGGQSL  88

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            S  EIQ +AA   N+                     + + HV   NDTS+SS  G G   
Sbjct  89   SSQEIQEVAARFANE----------EPTSSSIAMRGESSEHVE--NDTSSSSDAGAG---  133

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFH------GDVYV---PPNDYEIEYGDDGESIGHFSQ  514
            + IDWSFL+ LD+   ++D FGL+H      GD Y    PP++Y I  GDD       SQ
Sbjct  134  DTIDWSFLNLLDSSEGASD-FGLYHGLDHMGGDYYAPPPPPSEYSIG-GDDHNGDEACSQ  191

Query  515  QSFLWNF  535
            QSFLWNF
Sbjct  192  QSFLWNF  198



>ref|XP_002324785.1| hypothetical protein POPTR_0018s08320g [Populus trichocarpa]
 gb|EEF03350.1| hypothetical protein POPTR_0018s08320g [Populus trichocarpa]
Length=198

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 118/186 (63%), Gaps = 24/186 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ P KAARAFD A YCLRG  A+FNFPD+PPD+ GG+ L
Sbjct  29   GKWVSEIRLPNSRERIWLGSYDTPLKAARAFDAALYCLRGSGAKFNFPDNPPDIVGGQSL  88

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            S  EIQ +AA   N+   +P   +       T T  + + HV   NDTS+SS  G G   
Sbjct  89   SSQEIQEVAARFANE---EPTSSS-------TATRGESSEHVE--NDTSSSSDGGAG---  133

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEI-----EY---GDDGESIGHFSQQ  517
            + IDWSFL+ LD+   ++D FGL+HG  ++  + Y       EY   GDD      +SQQ
Sbjct  134  DTIDWSFLNLLDSSEGASD-FGLYHGLDHMGGDYYPPPPPPSEYSIGGDDHNGDEAYSQQ  192

Query  518  SFLWNF  535
            SFLWNF
Sbjct  193  SFLWNF  198



>ref|XP_002308508.1| hypothetical protein POPTR_0006s23480g [Populus trichocarpa]
 gb|ABQ62997.1| RAP2-like protein [Populus trichocarpa]
 gb|EEE92031.1| hypothetical protein POPTR_0006s23480g [Populus trichocarpa]
Length=206

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 110/186 (59%), Gaps = 21/186 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PPD+ GGR L
Sbjct  34   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGSGAKFNFPDNPPDIVGGRSL  93

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P E+Q +AA   N+   +P       G   +          VE   +S+S    G    
Sbjct  94   TPQEVQEVAARFANE---EPTSSTAMGGESSSH---------VENYTSSSSDCGAGQMDS  141

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEY--------GDDGESIGHFSQQ  517
            + IDWSFL+ LD+   ++D FGL+HG  ++  + Y            GDD      FS Q
Sbjct  142  DTIDWSFLNLLDSNEGASD-FGLYHGLDHMGGDYYPPPTPPPPPDYNGDDNNGDETFSHQ  200

Query  518  SFLWNF  535
            SFLWNF
Sbjct  201  SFLWNF  206



>ref|XP_011019312.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Populus 
euphratica]
Length=207

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 110/186 (59%), Gaps = 20/186 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PPD+ GGR L
Sbjct  34   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGSGAKFNFPDNPPDIVGGRSL  93

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P E+Q +AA   N    +P   +   G   +          VE   +S+S    G    
Sbjct  94   TPQEVQEVAARFANK---EPTSSSTAMGGESSSR--------VENYTSSSSECGAGQMDS  142

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEY--------GDDGESIGHFSQQ  517
            + IDWSFL+ LD+   ++D FGL+HG  ++  + Y            GDD      +S Q
Sbjct  143  DTIDWSFLNLLDSNEGASD-FGLYHGLDHMGGDYYPPPTPPPPPDYNGDDNNGDETYSHQ  201

Query  518  SFLWNF  535
            SFLWNF
Sbjct  202  SFLWNF  207



>ref|XP_009615403.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Nicotiana tomentosiformis]
Length=250

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 115/229 (50%), Gaps = 57/229 (25%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY+  EKAARAFD AQ+CLRGP A+FNFP++PPD+PGG+ L
Sbjct  28   GKWVSEVRLPNSRERIWLGSYDTAEKAARAFDTAQFCLRGPNAKFNFPENPPDIPGGQRL  87

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ +AA   N+Y             + T       THV+++ +  TS +      L
Sbjct  88   SPAEIQVVAAQFANEYVYP------QTATQETPPSHVQNTHVLKMENEETSQSSTCNHDL  141

Query  362  EG-----------IDWSFLDNLD-------AP------------------FTSNDYFGLF  433
             G            DWSFLD L+       AP                   T+N  FG +
Sbjct  142  MGQMDNTTTITTAADWSFLDMLENYPNNAAAPPPHISSLPPAAAPPSPAVGTNNFDFGYY  201

Query  434  HGDVYVPPNDY---------------EIEYGDDGESIGHFSQQSFLWNF  535
             G   +  N Y               E  Y D G    HFSQ S+LWNF
Sbjct  202  PGLETLSSNLYSPLHFPTRTTTGNGDEHVYQDSGNGDEHFSQHSYLWNF  250



>ref|XP_009780019.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Nicotiana sylvestris]
Length=252

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 117/229 (51%), Gaps = 57/229 (25%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY+  EKAARAFD AQ+CLRGP A+FNFP++PPD+ GG+ L
Sbjct  30   GKWVSEVRLPNSRERIWLGSYDTAEKAARAFDAAQFCLRGPNAKFNFPENPPDISGGQRL  89

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ +AA   N+Y + P         + T       THV+++ +  TS +      L
Sbjct  90   SPAEIQVVAAQFANEY-VYP-----QTTTQETPPSHVQNTHVLKMENEETSQSSTCDHDL  143

Query  362  EG-------IDWSFLDNLDAPF-----------------------------TSNDYFGLF  433
             G       +DWSFLD L+                                T+N  FG +
Sbjct  144  IGHMGNTTTVDWSFLDMLENYPNNAAAAAAAPPPHISSLPPAAAPPSPAIGTNNFDFGYY  203

Query  434  HG------DVYVP---------PNDYEIEYGDDGESIGHFSQQSFLWNF  535
             G      ++Y P          N  E  Y D G    HFSQ S+LWNF
Sbjct  204  PGLDTLSSNLYSPLHFPTRTTNSNGDEHGYEDSGNGDEHFSQHSYLWNF  252



>ref|XP_002516165.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF46167.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=275

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 114/199 (57%), Gaps = 23/199 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A YCLRGP+ARFNFPD+PPD+ GG  L
Sbjct  79   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALYCLRGPSARFNFPDNPPDIAGGESL  138

Query  182  SPAEIQGIAASSGNDYR-LKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
            SP EIQ  AA   N+ R +   P  +      + +  + ++  ++    S SSA  G  Q
Sbjct  139  SPQEIQVAAARFANETRSITATPTANSSTTSTSTSMPELSSQFMDHYYASASSASDGAIQ  198

Query  359  LE------GIDWSFLDNLDAPFTSNDYFGLF------HGDVYVPP--------NDYEIEY  478
            ++      GIDWSFLD LD        FGL+      + D Y PP         D   + 
Sbjct  199  VDNASDRTGIDWSFLDVLD--LNEGSEFGLYPSLGNNYSDYYPPPPSIFDDGTRDNNDDD  256

Query  479  GDDGESIGHFSQQSFLWNF  535
              + +    +SQ SFLWNF
Sbjct  257  DHENDGNEAYSQPSFLWNF  275



>emb|CDP17886.1| unnamed protein product [Coffea canephora]
Length=228

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 114/200 (57%), Gaps = 27/200 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG  A+FNF D PPD+ GGR L
Sbjct  34   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGKNAKFNFADIPPDLVGGRSL  93

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +PAEIQ +A+   N Y  K   +  G+G+ G   DD          DTS  S+   GA L
Sbjct  94   TPAEIQAVASEYANRYGNKEKQQQQGEGLIGEKEDDPLQFD----QDTSPISSNSDGA-L  148

Query  362  EGIDWSFLDNLD-----APFTSN--DY------FGLFHGDVYVPPN-----DYEIEYGDD  487
            + +DWSFL  L+        TSN  DY          H D+Y+ P+     D +  +   
Sbjct  149  QNVDWSFLGMLEPNGAATGATSNAPDYDLMLSSLDNLHEDMYMTPHVGTKVDVDHNFNGQ  208

Query  488  GESIGH----FSQQSFLWNF  535
             E   H    +S QSFLWNF
Sbjct  209  HEDYQHLDENYSHQSFLWNF  228



>gb|AFV60734.1| ethylene-responsive transcription factor 2 [Carica papaya]
Length=210

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 111/192 (58%), Gaps = 19/192 (10%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRGP A+FNFP++PP++ GGR +
Sbjct  24   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGPQAKFNFPENPPEIEGGRSM  83

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ-  358
            SP +IQ +A+   N+    P+  +      GT   D+ +   +E + +S S    G  + 
Sbjct  84   SPQQIQLVASRFANEEPQPPVHHHHHHHQDGTDGGDNSSRANIETSSSSVSDGTIGQVES  143

Query  359  -----------LEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYG--DDGESI  499
                       +  IDWS+ + LD+  T+ D+     G V  PP     + G  DD    
Sbjct  144  DMNNVFYETCDVNHIDWSYWNMLDSGVTACDF-----GFVPPPPEPTIFDNGDDDDITPE  198

Query  500  GHFSQQSFLWNF  535
              FS QSFLWNF
Sbjct  199  DDFSNQSFLWNF  210



>gb|ABQ62995.1| RAP2-like protein [Populus trichocarpa]
Length=209

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 102/184 (55%), Gaps = 7/184 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG  A+FNFP++PP++ GGR L
Sbjct  27   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRVAKFNFPENPPNIAGGRSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ  AA   N    +  P+        + ++    +    +    T    GG    
Sbjct  87   SPAEIQEAAARFANSEPQRSQPDRFETDQSVSVSESRAESPCPSVVSDGTVQMEGGELMW  146

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHG------DVYVPPNDYEIEYGDDGESIGHFSQQSF  523
            +G     L N  +   S +Y G+F G      D + P     ++YG++    G   Q SF
Sbjct  147  DGPFLDMLMNTGSCNHSTEY-GIFQGFDDLYNDFFPPSLIPNLDYGEETNLDGVLEQGSF  205

Query  524  LWNF  535
            LWNF
Sbjct  206  LWNF  209



>ref|XP_006381587.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ERP59384.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=209

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 102/184 (55%), Gaps = 7/184 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG  A+FNFP++PP++ GGR L
Sbjct  27   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRVAKFNFPENPPNIAGGRSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ  AA   N    +  P+        + ++    +    +    T    GG    
Sbjct  87   SPAEIQEAAARFANSEPQRSQPDRFETDQSVSVSESRAESPCPSVVSDGTVQMEGGELMW  146

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHG------DVYVPPNDYEIEYGDDGESIGHFSQQSF  523
            +G     L N  +   S +Y G+F G      D + P     ++YG++    G   Q SF
Sbjct  147  DGPFLDMLMNTGSCNHSTEY-GIFQGFDDLYSDFFPPSLIPNLDYGEETNLDGVLEQGSF  205

Query  524  LWNF  535
            LWNF
Sbjct  206  LWNF  209



>ref|XP_010273875.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Nelumbo nucifera]
Length=207

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 104/194 (54%), Gaps = 28/194 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRG  A+FNFPD+PPD+P GR L
Sbjct  26   GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGCNAKFNFPDNPPDIPCGRSL  85

Query  182  SPAEIQGIAA--SSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGA  355
            +P EIQ  AA  ++G +   K  P                      +   S SS   GGA
Sbjct  86   TPPEIQAAAARFANGENETHKAPPAQLRTQTDTL------------LEYPSPSSVSDGGA  133

Query  356  QLE---GIDWSFLDNLD--------APFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIG  502
              +    IDWSF D L         + F +   F  + GD +  P    ++Y D+    G
Sbjct  134  PADSDVSIDWSFFDMLTTVGSEDSVSEFGAFSGFDDYSGDYFPAPATSVVDYEDENSGSG  193

Query  503  ---HFSQQSFLWNF  535
               ++ Q SFLWNF
Sbjct  194  DYQYYPQHSFLWNF  207



>ref|XP_004241075.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Solanum lycopersicum]
Length=237

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 117/217 (54%), Gaps = 39/217 (18%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSR+RIWLGSY++ EKAARAFD AQ+CLRGP A+FNFPD PPD+ GG+ L
Sbjct  21   GKWVSEVRLPNSRDRIWLGSYDSAEKAARAFDAAQFCLRGPKAKFNFPDSPPDISGGQRL  80

Query  182  SPAEIQGIAASSGNDYRLKPLPE--NdgdgvrgtgtddddttHVV-----EINDTSTSS-  337
            SPAEIQ +AA   NDY    + E   D       G   +  +HV+     EI+ ++TS  
Sbjct  81   SPAEIQAVAARFANDYSPSVVQEIRRDDHHHDHEGNIGNINSHVINMEKDEISLSTTSCD  140

Query  338  ---APGGGAQLEGIDWSFLDNLDAPFTSN------DYFG----------------LFHGD  442
                 G    +  +DW+F +++   ++ N      +YF                     +
Sbjct  141  RVVQMGTSNTVAEMDWAFHNDMMENYSYNASGPPPEYFCDPYYIVGGGGGAGVLDNLSSN  200

Query  443  VYVPPNDYE------IEYGDDGESIGHFSQQSFLWNF  535
            +Y PP+  +       +         H+SQQSFLWNF
Sbjct  201  LYSPPHFPQRTTPSYDDDDTGNGDDEHYSQQSFLWNF  237



>ref|XP_010099089.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25975.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB76737.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=211

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 112/193 (58%), Gaps = 28/193 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRG TA+FNFP++PP++ GGR L
Sbjct  32   GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGRTAKFNFPENPPEIAGGRSL  91

Query  182  SPAEIQGIAASSGN-----DYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG  346
            SPAEIQ  AA   N         +P+PE   +    + +       V    D+  ++   
Sbjct  92   SPAEIQSAAARFANSEDPMKRSDRPVPELRMESETPSPSPSVSEGSVTVQLDSELTT---  148

Query  347  GGAQLEGIDWSFLD---NLDAPFTSNDYFGLF------HGDVYVPPNDYEIEYGDDGESI  499
                    D SF+D   N+     ++DY GLF       GD ++PP    I+YG++  ++
Sbjct  149  --------DGSFMDMFTNIGLGNYASDY-GLFPGFDDLSGDFFMPPPP-TIDYGEENYNV  198

Query  500  -GHFSQQSFLWNF  535
               F Q+SFLWNF
Sbjct  199  DAVFPQESFLWNF  211



>ref|XP_009337182.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Pyrus 
x bretschneideri]
Length=234

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 107/199 (54%), Gaps = 28/199 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG TA+FNFPD+PPD+PGGR L
Sbjct  43   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGRTAKFNFPDNPPDIPGGRSL  102

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ  AA   N      +P +              +   ++    S S + G G   
Sbjct  103  SPAEIQVEAARFAN----SEIPRSHQSMSAPQAECQSLSE--LQAESQSPSLSEGSGTAF  156

Query  362  EGIDWSFLDN-----LDAPFTSNDY---FGLF------HGDVYVPPN-------DYEIEY  478
               D+    N     L   F S +Y   +GLF      +G  + P +       DY  E 
Sbjct  157  MDTDFQVTPNESFSDLFGTFGSGNYATEYGLFPGFDEMNGQFFSPASAAPTPAVDYYAEE  216

Query  479  GDDGESIGHFSQQSFLWNF  535
              DG+     +Q+SFLWNF
Sbjct  217  NLDGQFFNP-AQESFLWNF  234



>gb|KDP33947.1| hypothetical protein JCGZ_07518 [Jatropha curcas]
Length=198

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 105/187 (56%), Gaps = 23/187 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG TA+FNFPD+PP++ GGR L
Sbjct  26   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRTAKFNFPDNPPEIAGGRSL  85

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SP EIQ  AA   N Y  +   EN       T    +     V     S  +A   G++L
Sbjct  86   SPPEIQAAAARFANSYPSRKQLENSSTDQSVTELQAESPCPSV----VSDLTAQIDGSEL  141

Query  362  EGIDWSFLDNLDAPFTSNDYFGLF------HGDVYVP---PNDYEIEYGDDGESIGHFSQ  514
              +D  FLD L     +N  +G+F      H D + P   P    +E   D    G  +Q
Sbjct  142  M-MDIPFLDLL-----ANTDYGIFPGFDDLHNDFFSPLTGPGPDLVEENLD----GVVAQ  191

Query  515  QSFLWNF  535
             SFLWNF
Sbjct  192  DSFLWNF  198



>ref|XP_010261769.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Nelumbo nucifera]
Length=199

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 102/184 (55%), Gaps = 17/184 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRG  A+FNFP++PP++P GR L
Sbjct  27   GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGRNAKFNFPENPPEIPRGRSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EIQ  AA   N+      P +                     + +S S  P      
Sbjct  87   TPPEIQAAAARFANEDPQNKEPSDHLPTETTLEYP----------SPSSVSDGPVPADSD  136

Query  362  EGIDWSFLDN-LDAPFTSNDYFGLFHG-----DVYVPPNDYEIEYGDDGESIGHFSQQSF  523
              IDWSF D  L     S   FG+F G       Y P +   ++YG++  S G ++QQSF
Sbjct  137  VSIDWSFFDMFLVGSEDSVSDFGVFSGFDDYSADYFPSSLDSLDYGEEI-SNGDYNQQSF  195

Query  524  LWNF  535
            LWNF
Sbjct  196  LWNF  199



>ref|XP_009359712.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Pyrus x bretschneideri]
Length=207

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 107/201 (53%), Gaps = 42/201 (21%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+APEKAARAFD A +CLRG TA+FNFPD PP++ GGR L
Sbjct  26   GKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRGRTAKFNFPDSPPEISGGRSL  85

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ  AA   N      LP +                 + E+   S S +   G+  
Sbjct  86   SPAEIQTEAARFANS----ELPRS--------------HQSMSELQAESASPSVSEGSGT  127

Query  362  EGIDWSFL----DNLDAPFT---SNDY---FGLFHG-------------DVYVPPNDYEI  472
              +D  FL    D+   PF+   S +Y   +GLF G              V  P  DY  
Sbjct  128  VFVDSEFLVTPNDSFSDPFSTFGSGNYSTEYGLFPGFDEMNYQFFSPAEAVPTPDVDYYA  187

Query  473  EYGDDGESIGHFSQQSFLWNF  535
            E   D +     ++QSFLWNF
Sbjct  188  EENLDSQFFSP-AEQSFLWNF  207



>ref|XP_006356706.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Solanum tuberosum]
Length=243

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 116/225 (52%), Gaps = 49/225 (22%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSR+RIWLGSY++ EKAARAFD AQ+CLRGP A+FNFPD PPD+ GG+ L
Sbjct  21   GKWVSEVRLPNSRDRIWLGSYDSAEKAARAFDAAQFCLRGPKAKFNFPDSPPDISGGQRL  80

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVV-----EINDTSTSSA--  340
            SPAEIQ +AA   NDY   P    +       G   +  +HV+     EI+ ++TSS   
Sbjct  81   SPAEIQAVAARFANDY--SPSVVQEIQRDDHEGNIGNINSHVINMEKDEISLSTTSSCDV  138

Query  341  -----PGGGAQLEGIDWSFLDNL--DAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESI  499
                   G + +  +DW+F +++  + P+ ++     F  D Y P        G  G  +
Sbjct  139  PPMVVQMGTSTVAEMDWAFYNDMMENYPYNASGPPPEFFCDPYYPGAGIGAGAGAGGGGV  198

Query  500  ---------------------------------GHFSQQSFLWNF  535
                                              H+SQQSFLWNF
Sbjct  199  LDINLSSNLYSPPHFPQRTTPNYDDDDTGNGGDEHYSQQSFLWNF  243



>ref|XP_011039944.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Populus euphratica]
Length=208

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 103/184 (56%), Gaps = 8/184 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY++ EKAARAFD A +CLRG  A+FNFP++PP++ GGR L
Sbjct  27   GKWVSEIRLPNSRDRIWLGSYDSAEKAARAFDAALFCLRGRVAKFNFPENPPNIAGGRSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ  AA   N    +  P+        + ++    +    +    T    GG    
Sbjct  87   SPAEIQEAAARFANSEPQRSRPDRFETDQSVSVSESRAESPCPSVASDGTVQMEGGELMW  146

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHG------DVYVPPNDYEIEYGDDGESIGHFSQQSF  523
            +G     L N  +   S +Y G+F G      D + P     ++YG++  ++    Q SF
Sbjct  147  DGPFLDMLMNTGSCSHSTEY-GIFQGFDDLYNDFFPPSLIPNLDYGEE-TNLDVLEQDSF  204

Query  524  LWNF  535
            LWNF
Sbjct  205  LWNF  208



>ref|XP_008344047.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Malus domestica]
Length=235

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 107/197 (54%), Gaps = 25/197 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPN RERIWLGSY+ PEKAARAFD A +CLRG TA+FNFPD+PPD+PGGR L
Sbjct  45   GKWVSEIRLPNCRERIWLGSYDTPEKAARAFDAALFCLRGRTAKFNFPDNPPDIPGGRSL  104

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SPAEIQ  AA   N      +P +              +   ++    S S + G G   
Sbjct  105  SPAEIQVEAARFAN----SEIPRSHQSMSAPQAECQSMSE--LQAESQSPSLSEGSGTAF  158

Query  362  EGIDWSF-----LDNLDAPFTSNDY---FGLF------HGDVYVPPNDY---EIEYGDDG  490
               D+       L +L   F S +Y   +GLF      +G  + P +      ++Y ++ 
Sbjct  159  MDTDFQVTPNESLSDLFGSFGSGNYATEYGLFPGFDEMNGQFFSPASAAPTPAVDYAEEN  218

Query  491  ESIGHF--SQQSFLWNF  535
                 F  +Q+SFLWNF
Sbjct  219  LDGQFFNPAQESFLWNF  235



>gb|ABU84809.1| putative dehydration-responsive element binding protein [Broussonetia 
papyrifera]
Length=210

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 113/193 (59%), Gaps = 28/193 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY+  EKAARAFD A +CLRG TA+FNFP++PP++ GGR L
Sbjct  31   GKWVSEIRLPNSRDRIWLGSYDTAEKAARAFDAALFCLRGRTAKFNFPENPPEITGGRSL  90

Query  182  SPAEIQGIAA-----SSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG  346
            SPAEIQ  AA      + N +  + +PE   +    + +       V    D+  ++   
Sbjct  91   SPAEIQTAAARFANSENPNSHPGRTVPEMQMESPSPSLSQSVSEGSVTVHIDSEVTT---  147

Query  347  GGAQLEGIDWSFLDNLDAPFTSNDY---FGLF------HGDVYVPPNDYEIEYGDDGESI  499
                    D SF+D + A   S +Y   +GLF       GD ++PP    ++YG++  ++
Sbjct  148  --------DGSFMD-MFANIGSGNYTADYGLFPGFDDLAGDFFMPPLP-TVDYGEENYNV  197

Query  500  -GHFSQQSFLWNF  535
             G   Q+SFLWNF
Sbjct  198  DGVIPQESFLWNF  210



>gb|ADE41099.1| AP2 domain class transcription factor [Malus domestica]
Length=235

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 104/197 (53%), Gaps = 25/197 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPN RERIWLGSY  PEKAARAFD A +CLRG TA+FNFPD+PPD+PGGR L
Sbjct  45   GKWVSEIRLPNCRERIWLGSYGTPEKAARAFDAALFCLRGRTAKFNFPDNPPDIPGGRSL  104

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGG---  352
            SPAEIQ  AA   N      +P +              +    E    S S   G     
Sbjct  105  SPAEIQVEAARFANS----EIPRSHQSMSAPQAECQSMSELQAESQSPSLSEGSGTAFMD  160

Query  353  AQLEGIDWSFLDNLDAPFTSNDY---FGLF------HGDVYVPPN-------DYEIEYGD  484
              L+      L +L   F S +Y   +GLF      +G  + P +       DY +E   
Sbjct  161  TDLQVTPNESLSDLFGSFGSGNYATEYGLFPGFDEMNGQFFSPASAAPTPAVDY-VEENL  219

Query  485  DGESIGHFSQQSFLWNF  535
            DG+     +Q+SFLWNF
Sbjct  220  DGQFFNP-AQESFLWNF  235



>ref|XP_010687541.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Beta vulgaris subsp. vulgaris]
Length=225

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD AQYCLRG +A FNFPD+PPD+ GGR +
Sbjct  28   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAAQYCLRGKSANFNFPDNPPDIAGGRSM  87

Query  182  SPAEIQGIAASSGN  223
            +PAEIQ  AA   N
Sbjct  88   TPAEIQAAAARFAN  101



>ref|XP_004287662.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Fragaria vesca subsp. vesca]
Length=216

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 111/193 (58%), Gaps = 21/193 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG TA+FNFPD+PP++ GGR L
Sbjct  30   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGRTAKFNFPDNPPEISGGRSL  89

Query  182  SPAEIQGIAASSGNDYR--LKPLPE--NdgdgvrgtgtddddttHVVEINDT-STSSAPG  346
            SPAEIQ  AA   N+    L P P+       +  +    +++  V E + T    SA  
Sbjct  90   SPAEIQAEAARFANNEADPLIPPPQVPRSHSDLSMSEQRTEESPSVSEGSGTLVMDSASD  149

Query  347  GGAQLEGIDWSFLDNLDAPFTSNDY---FGLF------HGDVYVP-PNDYEIEYGDDGES  496
                +   + SF D L   F S +Y   +GLF      +G  + P P     +Y ++   
Sbjct  150  FSVTVNQTEESFSD-LFRTFGSGNYASEYGLFPGFDDLNGQFFSPAPQTPADDYAEES--  206

Query  497  IGHFSQQSFLWNF  535
                +Q+SFLWNF
Sbjct  207  ---LAQESFLWNF  216



>gb|KDP34005.1| hypothetical protein JCGZ_07576 [Jatropha curcas]
Length=210

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 102/197 (52%), Gaps = 39/197 (20%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD-VPGGRW  178
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PPD + GG+ 
Sbjct  33   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGRGAKFNFPDNPPDNIDGGQS  92

Query  179  LSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAP-----  343
            LSP EIQ +A+   N+    P P                      ++ T  SS+      
Sbjct  93   LSPQEIQAVASRYANE---NPNPN----------------ATTTRMSRTGESSSQAMDQY  133

Query  344  GGGAQLEGIDWSFLDNLDA-------------PFTSNDYFGLFHGDVYVPPNDYEIEYGD  484
               ++   IDWSFL++L +                 N+YF       +    D+     D
Sbjct  134  ASSSEDNAIDWSFLNSLGSNEGVSKFELYSVLDNMGNEYFPPPPPPPFDDGEDHNTG-ND  192

Query  485  DGESIGHFSQQSFLWNF  535
            D      +SQQSFLWNF
Sbjct  193  DHNGDEDYSQQSFLWNF  209



>ref|XP_006474695.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Citrus sinensis]
Length=199

 Score =   125 bits (313),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 103/187 (55%), Gaps = 22/187 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR RIWLGSY+  EKAARAFD A +CLRG +A+FNFPD+PPD+ GGR L
Sbjct  26   GKYVSEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSAKFNFPDNPPDISGGRSL  85

Query  182  SPAEIQGIAASSGNDYRLKPL-PENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
             P+EIQ +AA   N   L+   PE     ++        +   V+++             
Sbjct  86   KPSEIQAVAAQFANSEPLRSQSPEQSVSELQTEYLSPSISEATVQLDSDGV---------  136

Query  359  LEGIDWSFLDNLDAPFTSN--DYFGLFHG------DVYVPPNDYEIEYGDDGESIGHFSQ  514
                D S LD L A  +SN    +G+F G      D++  P    +++ D+       +Q
Sbjct  137  ---FDGSLLDLLTASSSSNYPSEYGIFPGFDDLSNDIFA-PQLPAVDFADENFDGLLLNQ  192

Query  515  QSFLWNF  535
             SFLWNF
Sbjct  193  DSFLWNF  199



>gb|KDO73836.1| hypothetical protein CISIN_1g029068mg [Citrus sinensis]
Length=199

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 105/188 (56%), Gaps = 24/188 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR RIWLGSY+  EKAARAFD A +CLRG +A+FNFPD+PPD+ GGR L
Sbjct  26   GKYVSEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSAKFNFPDNPPDISGGRSL  85

Query  182  SPAEIQGIAASSGNDYRLKPL-PENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
             P+EIQ +AA   N   L+   PE     ++        +   V+++             
Sbjct  86   KPSEIQAVAAQFANSEPLRSQSPEQSVSELQTEYLSPSISEATVQLDSDGV---------  136

Query  359  LEGIDWSFLDNLDAPFTSNDY---FGLFHG------DVYVPPNDYEIEYGDDGESIGHFS  511
                D S LD L A  +SN+Y   +G+F G      D++  P    +++ D+       +
Sbjct  137  ---FDGSLLDLLTAS-SSNNYPSEYGIFPGFDDLSNDIFT-PQLPAVDFADENFDGLLLN  191

Query  512  QQSFLWNF  535
            Q SFLWNF
Sbjct  192  QDSFLWNF  199



>ref|XP_006452855.1| hypothetical protein CICLE_v10009540mg [Citrus clementina]
 gb|ESR66095.1| hypothetical protein CICLE_v10009540mg [Citrus clementina]
Length=199

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 105/188 (56%), Gaps = 24/188 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR RIWLGSY+  EKAARAFD A +CLRG +A+FNFPD+PPD+ GGR L
Sbjct  26   GKYVSEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRSAKFNFPDNPPDISGGRSL  85

Query  182  SPAEIQGIAASSGNDYRLKPL-PENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
             P+EIQ +AA   N   L+   PE     ++        +   V+++             
Sbjct  86   KPSEIQAVAAQFANSEPLRSQSPEQSVSELQTEYLSPSISEATVQLDSDGV---------  136

Query  359  LEGIDWSFLDNLDAPFTSNDY---FGLFHG------DVYVPPNDYEIEYGDDGESIGHFS  511
                D S LD L A  +SN+Y   +G+F G      D++  P    +++ D+       +
Sbjct  137  ---FDGSLLDLLTAS-SSNNYPSEYGIFPGFDDLSNDIFT-PQLPAVDFADENFDGLLLN  191

Query  512  QQSFLWNF  535
            Q SFLWNF
Sbjct  192  QDSFLWNF  199



>ref|XP_008337827.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Malus 
domestica]
 gb|ADE41149.1| AP2 domain class transcription factor [Malus domestica]
Length=237

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 115/213 (54%), Gaps = 36/213 (17%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+APEKAARAFD A +CLRG TA+FNFPD+PP++ GGR L
Sbjct  26   GKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRGHTAKFNFPDNPPEISGGRSL  85

Query  182  SPAEIQGIAASSGN-----------DYRLKPLPENdgdgvrgtgtddddttH-VVEINDT  325
            S A+IQ  AA   N           +++ +    ++      + ++    +  + E+   
Sbjct  86   SAAQIQTEAARFANSELPRSHQSMSEFQAESQSMSELQAESQSMSELQAESQSMSELQAE  145

Query  326  STSSAPGGGAQLEGIDWSFL----DNLDAPFT---SNDY---FGLFHG------------  439
            S S +   G+    ++  FL    D+   PF+   S +Y   +GLF G            
Sbjct  146  SRSPSVSEGSGTVFVESEFLVTPNDSFSDPFSTFGSGNYATEYGLFAGFDEMNYQFFSPA  205

Query  440  -DVYVPPNDYEIEYGDDGESIGHFSQQSFLWNF  535
              V  P  DY  E   DG+     +Q+SFLWNF
Sbjct  206  AAVPTPVVDYYAEENLDGQFFSP-AQESFLWNF  237



>emb|CDP03051.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   124 bits (310),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 107/187 (57%), Gaps = 22/187 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRG +A+FNFPD+PP++  GR +
Sbjct  45   GKYVSEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGKSAKFNFPDNPPEIVNGRSM  104

Query  182  SPAEIQGIAASSGN-DYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
            +PAEIQ  AA   N ++RL   P    + V    +    +  +    ++   S   G  Q
Sbjct  105  TPAEIQVAAAQFANSEHRLIGEPARIDNLVSDNSSSSISSLELQA--ESPCPSVSDGVVQ  162

Query  359  LEG------IDWSFLDNLDAPFTSNDYFGLFHG--DVYVPPNDYEIEYGDDGESIGHFSQ  514
            LE       +D +FL          D FG+F G  D +VPP    ++   +    G+FSQ
Sbjct  163  LESELPEIPLDNAFL----------DMFGIFPGFDDFFVPPMP-TVDLDGEENYEGYFSQ  211

Query  515  QSFLWNF  535
             S LWNF
Sbjct  212  DSTLWNF  218



>gb|AFJ14637.1| dehydration-responsive element-binding protein (DREB5), partial 
[Malus domestica]
Length=237

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 109/217 (50%), Gaps = 44/217 (20%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+APEKAARAFD A +CLRG TA+FNFPD+PP++ GGR L
Sbjct  26   GKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAALFCLRGHTAKFNFPDNPPEISGGRSL  85

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtdddd----------------ttHVVE  313
            S A+IQ  AA   N      LP +                              +  + E
Sbjct  86   SAAQIQTEAARFANS----ELPRSHQSMSEFQAESQSMSELQAESQSMSELRAESQSMSE  141

Query  314  INDTSTSSAPGGGAQLEGIDWSFL----DNLDAPFT---SNDY---FGLFHG--------  439
            +   S S +   G+    ++  FL    D+   PF+   S +Y   +GLF G        
Sbjct  142  LQAESRSPSVSEGSGTVFVESEFLVTPNDSFSDPFSTFGSGNYATEYGLFAGFDEMNYQF  201

Query  440  -----DVYVPPNDYEIEYGDDGESIGHFSQQSFLWNF  535
                  V  P  DY  E   DG+     +Q+SFLWNF
Sbjct  202  FSPAAAVPTPVVDYYAEENLDGQFFSP-AQESFLWNF  237



>gb|EYU21967.1| hypothetical protein MIMGU_mgv1a023084mg, partial [Erythranthe 
guttata]
Length=193

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 97/190 (51%), Gaps = 41/190 (22%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY+  EKAARAFD A +CLRGPTA FNFPDDPP +PGG+ L
Sbjct  33   GKYVSEIRLPNSRDRIWLGSYDTAEKAARAFDAALFCLRGPTANFNFPDDPPRIPGGQAL  92

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EIQ +A    N       P                    VE+ D S  S+       
Sbjct  93   APTEIQAVAQHYANSSGGDNPPA------------------AVELEDASPPSS-------  127

Query  362  EGIDWSFLDNLDAPFTSNDY----------FGLFH--GDVYVPPNDYEIEYGDDGESIGH  505
              IDWSFLD LD    +N            +GLFH   ++Y+           D     H
Sbjct  128  NSIDWSFLDLLDNSDGTNTTGGGNAGHVSDYGLFHDPAEMYI----PPPPPIPDDNDDDH  183

Query  506  FSQQSFLWNF  535
                SFLWNF
Sbjct  184  GIVPSFLWNF  193



>gb|KCW81819.1| hypothetical protein EUGRSUZ_C03175 [Eucalyptus grandis]
Length=207

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 96/188 (51%), Gaps = 18/188 (10%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG  A+FNFPD PPD+ G + L
Sbjct  28   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGRQAQFNFPDSPPDIAGAQGL  87

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EI+ +AA   N       PE  G   R                     +  G     
Sbjct  88   TPQEIRAVAARFANQ-----GPEGSGRSRRNDDGHGHGHGASSMAAREGGDNGNGNDGGG  142

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYV-------PPNDYEIEYGDD---GESIGHFS  511
              +DWSFL+ LD     +  FGL+ G  YV       PP      Y  D   G   G + 
Sbjct  143  SSMDWSFLNALDVDCDGSG-FGLYDGLDYVGGSQLEPPPEASSTTYNADDENGGGNGFYC  201

Query  512  QQSFLWNF  535
             Q  LWNF
Sbjct  202  HQ--LWNF  207



>ref|XP_008242271.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Prunus 
mume]
Length=219

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG TA+FNFPD+PPD+ GGR L
Sbjct  28   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRTAKFNFPDNPPDISGGRTL  87

Query  182  SPAEIQGIAASSGN  223
            SP EIQ  AA   N
Sbjct  88   SPTEIQAEAARFAN  101



>ref|XP_010687542.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Beta vulgaris subsp. vulgaris]
Length=227

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY++PEKAARAFD AQYCLRG +A FNFPD+PP++PG   +
Sbjct  28   GKWVSEVRLPNSRERIWLGSYDSPEKAARAFDAAQYCLRGKSANFNFPDNPPNIPGRLSM  87

Query  182  SPAEIQGIAASSGN  223
            +PAEIQ  A+   N
Sbjct  88   TPAEIQAAASKFAN  101



>ref|XP_009624342.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Nicotiana 
tomentosiformis]
Length=220

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 106/197 (54%), Gaps = 24/197 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY+ PEKAARAFD A +CLRG TA FNFP++PP++  GR +
Sbjct  29   GKWVSEVRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGKTANFNFPENPPEIVNGRSM  88

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P+EIQ  AA   N       P           +D   ++  +   ++ + S   G   L
Sbjct  89   TPSEIQVAAAQFANS---DSDPRVSNWANPRENSDPSSSSSEMFCAESPSVSVSNGLVGL  145

Query  362  EG------IDWSFLDNLDAPFTSNDY--FGLF------HGDVYVPP-----NDYEIEYGD  484
            E       +D  F+D   +  T+ND   FG+F       G+ YVPP     N  E  Y +
Sbjct  146  ESEKTEMTLDNGFVDMFSSMGTTNDMSDFGIFPGFDDLSGEYYVPPLPNLDNTAEENYMN  205

Query  485  DGESIGHFSQQSFLWNF  535
              E   H    SFLWNF
Sbjct  206  YDEF--HLQGSSFLWNF  220



>ref|XP_010051344.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Eucalyptus grandis]
Length=248

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 96/188 (51%), Gaps = 18/188 (10%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG  A+FNFPD PPD+ G + L
Sbjct  69   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGRQAQFNFPDSPPDIAGAQGL  128

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EI+ +AA   N       PE  G   R                     +  G     
Sbjct  129  TPQEIRAVAARFANQG-----PEGSGRSRRNDDGHGHGHGASSMAAREGGDNGNGNDGGG  183

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYV-------PPNDYEIEYGDD---GESIGHFS  511
              +DWSFL+ LD     +  FGL+ G  YV       PP      Y  D   G   G + 
Sbjct  184  SSMDWSFLNALDVDCDGSG-FGLYDGLDYVGGSQLEPPPEASSTTYNADDENGGGNGFYC  242

Query  512  QQSFLWNF  535
             Q  LWNF
Sbjct  243  HQ--LWNF  248



>ref|XP_010050433.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Eucalyptus grandis]
Length=215

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 104/191 (54%), Gaps = 25/191 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD AQ+CLRG  ARFNFPDDPPD+ GGR L
Sbjct  37   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAAQFCLRGRNARFNFPDDPPDIAGGRSL  96

Query  182  SPAEIQ-------------GIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEIND  322
            +P EIQ                  +G++ R +       DG         D      + D
Sbjct  97   TPPEIQVAAAQFANSAAPAPSYPPAGSELRAESASPPMSDGTPMDCDLGMDMDMNEPLMD  156

Query  323  TSTSSAPGGGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIG  502
               S+  G G+   G D+      D PFT+ND++G  H  +   PN   + +GD  E+  
Sbjct  157  LLRSNV-GMGSGNYGADFGLYPGYD-PFTTNDFYG--HATI---PN---VGFGD--ENFD  204

Query  503  HFSQQSFLWNF  535
                Q FLWNF
Sbjct  205  GLPVQDFLWNF  215



>ref|XP_002280370.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Vitis 
vinifera]
 emb|CBI20746.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 95/178 (53%), Gaps = 20/178 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG  A+FNFPD+PPD+PG   L
Sbjct  34   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGHGAKFNFPDNPPDIPGRESL  93

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P+EIQ +AA   N+   K   E        +     ++ H       S S        +
Sbjct  94   TPSEIQLVAARFANEEPPKECSE------LESQHSQSESHHYNYTPSCSLSEQLENETIM  147

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIGHFSQQSFLWNF  535
            +G  WS            DY  +  G + + P     E G  GE    F Q SFLWNF
Sbjct  148  DGSFWSI----------RDYSYIDGGGLGISPPSPMDESG--GEEF--FQQSSFLWNF  191



>emb|CAW30731.1| TINY transcription factor [Arachis hypogaea]
 emb|CAW30737.1| TINY transcription factor [Arachis hypogaea]
 emb|CAW30741.1| TINY transcription factor [Arachis hypogaea]
 emb|CAW30742.1| TINY transcription factor [Arachis hypogaea]
Length=208

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 98/189 (52%), Gaps = 21/189 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY+  EKAARAFD A +CLRG  A+FNFP  PP++ GGR++
Sbjct  30   GKYVSEIRLPNSRQRIWLGSYDTAEKAARAFDAAMFCLRGAAAKFNFPGAPPEIAGGRYM  89

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttH--------VVEINDTSTSS  337
            +P +IQ  AA   N   ++P   +       +                 V    +   ++
Sbjct  90   TPPQIQAAAARYANSDPVRPCSTSTETSTMLSEETKTVMPASPSPSPSDVTLQTECDVTA  149

Query  338  APGGGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPN---DYEIEYGDDGESIGHF  508
              G G+ L     S   N D+ FT  D FG   GD Y+P     DYE E  D     G  
Sbjct  150  MNGSGSDLFTTIGSV--NHDSIFTGFDDFG---GDFYLPEMPSYDYEEENLD-----GLI  199

Query  509  SQQSFLWNF  535
               +FLW+F
Sbjct  200  IDDTFLWSF  208



>ref|XP_008450955.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis melo]
Length=209

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 97/184 (53%), Gaps = 9/184 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG +ARFNFPD+PPD+PG   L
Sbjct  29   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGDSARFNFPDNPPDIPGASLL  88

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgt---gtddddttHVVEINDTS--TSSAPG  346
            S +EIQ  AA   N     P  E        +       + TT V+E ++ S        
Sbjct  89   SRSEIQSAAAQFANSDPTIPSSEFHRPTTADSPSPSVVSEMTTSVIECDERSPFFDLHTA  148

Query  347  GGAQLEGIDWSFLDNLDA-PFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIGHFSQQSF  523
             G++    D+         PF +  +         +P  DY   YGD+     H    S+
Sbjct  149  MGSENYVTDFGLFPEYSYNPFYNEMFINSSSSSSTIPCYDY---YGDENFEATHQDDSSY  205

Query  524  LWNF  535
            LWNF
Sbjct  206  LWNF  209



>ref|NP_001238500.1| dehydration-responsive element binding protein 3 [Glycine max]
 gb|ABB36646.1| dehydration-responsive element binding protein 3 [Glycine max]
Length=198

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 102/186 (55%), Gaps = 22/186 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY+ PEKAARAFD A +CLRG  A+FNFPD+PPD+ GG  +
Sbjct  27   GKWVSEIRLPNSRQRIWLGSYDTPEKAARAFDAAMFCLRGRNAKFNFPDNPPDIAGGTSM  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P++IQ  AA   N       P     G       +  +  V E    + S  P     L
Sbjct  87   TPSQIQIAAAQFAN-----AGPHEGHSGRPEHPPMESPSPSVSEGTIQTDSDVP----TL  137

Query  362  EGIDWSFLDNLDAPFTSNDY-----FGLFHGDVYVP--PNDYEIEYGDD-GESIGHFSQQ  517
             G        + +   ++DY     F  F GD YVP  PN   + YG++ GE  G    +
Sbjct  138  NGSVTDLFTPVGSSGYASDYGIFPGFDDFSGDFYVPEMPN---VNYGEENGE--GFIVDE  192

Query  518  SFLWNF  535
            SFLWNF
Sbjct  193  SFLWNF  198



>ref|XP_007204729.1| hypothetical protein PRUPE_ppa011336mg [Prunus persica]
 gb|EMJ05928.1| hypothetical protein PRUPE_ppa011336mg [Prunus persica]
Length=215

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG TA+FNFPD+PPD+ GGR L
Sbjct  28   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRTAKFNFPDNPPDISGGRTL  87

Query  182  SPAEIQGIAASSGN  223
            S AEIQ  AA   N
Sbjct  88   SRAEIQAEAARFAN  101



>ref|XP_002516233.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46235.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG +A+FNFPDDPP++ GGR L
Sbjct  28   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRSAKFNFPDDPPNIAGGRSL  87

Query  182  SPAEIQGIAA  211
            SP+EIQ  AA
Sbjct  88   SPSEIQAAAA  97



>ref|XP_009759846.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Nicotiana 
sylvestris]
Length=223

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 107/198 (54%), Gaps = 26/198 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY+  EKAARAFD A +CLRG TA FNFP++PP++  GR +
Sbjct  32   GKWVSEVRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGKTANFNFPENPPEILNGRSM  91

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +PAEIQ  AA   N       P           +D   ++  +   ++ + S   G A L
Sbjct  92   TPAEIQVAAAQFANS---DSDPRVGNWVNPRENSDPSSSSSEMFCAESPSVSVSNGLAGL  148

Query  362  EG------IDWSFLDNLDAPFTSNDY--FGLF------HGDVYVPP-----NDYEIEYGD  484
            E       +D  F+D   +  T+ND   FG+F       G+ YVPP     N  E  Y +
Sbjct  149  ESEKTEMTLDNGFVDMFSSMGTTNDMSNFGIFPGFDDLSGEYYVPPLPNLDNTAEENYMN  208

Query  485  -DGESIGHFSQQSFLWNF  535
             DG    H    SFLWNF
Sbjct  209  YDG---FHLQGSSFLWNF  223



>ref|XP_004141440.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Cucumis sativus]
 ref|XP_004157410.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Cucumis sativus]
 gb|KGN55392.1| hypothetical protein Csa_4G649620 [Cucumis sativus]
Length=186

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 93/180 (52%), Gaps = 27/180 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY+ PEKAARAFD AQ+CLRGP A+FNFPD PP++ GG  L
Sbjct  29   GKWVSEIRLPNSRDRIWLGSYDKPEKAARAFDAAQFCLRGPQAKFNFPDSPPEIDGGDRL  88

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            S  EIQ  AA    ++  + +                        N     +  GGG   
Sbjct  89   SAQEIQAAAAKYAEEHGEEGVG-----------------------NHDEGVTVEGGGVWP  125

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGD-DGESIGHFSQQ-SFLWNF  535
            +  D +     +  F  N    ++ GD+     D  +E  D D     HF  + +FLWNF
Sbjct  126  DNWDMTMDGGWEFGFGGNAM--IYGGDISFGVQDENMEKEDFDNNGGNHFCHEPNFLWNF  183



>ref|XP_009106149.1| PREDICTED: ethylene-responsive transcription factor ERF018 [Brassica 
rapa]
Length=200

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 99/185 (54%), Gaps = 23/185 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGS++ PEKAARAFD AQ+CLRG  + FNFPD+PP + GGR L
Sbjct  32   GKWVSEIRLPNSRDRIWLGSFDTPEKAARAFDAAQFCLRGRQSGFNFPDNPPSISGGRSL  91

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EI+  AA   N        ++    +     +   +    E   TS S      A  
Sbjct  92   TPPEIREAAARYAN-------AQDGDIIISTGEEESVLSETRPESPSTSVSEVAVSSATT  144

Query  362  EGIDWSFLDNLDAPF----TSNDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQS  520
               D SFLD L + F      +D+   F GD +   +P  DY       G+ I  F +  
Sbjct  145  VDYDLSFLDTLPSDFGMFSVFDDFSDGFSGDQFTEVLPVEDY-------GDVI--FDESL  195

Query  521  FLWNF  535
            FLW+F
Sbjct  196  FLWDF  200



>ref|XP_009126865.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Brassica rapa]
Length=149

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS++  EKAARAFD A YCLRGP ARFNFPD+PP++PGGR L
Sbjct  16   GKWVAEIRLPNSRERIWLGSFDTAEKAARAFDAALYCLRGPGARFNFPDNPPEIPGGRSL  75

Query  182  SPAEIQGIAA  211
            +P +IQ +A+
Sbjct  76   TPQQIQVVAS  85



>ref|XP_007012474.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY30093.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=234

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A YCLRG  A+FNFP++PP++ GGR L
Sbjct  36   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALYCLRGRDAKFNFPENPPEIVGGRSL  95

Query  182  SPAEIQGIAASSGND  226
            SP EIQ +AA   N+
Sbjct  96   SPQEIQAVAARFANE  110



>ref|XP_010428490.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Camelina sativa]
Length=200

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 97/185 (52%), Gaps = 23/185 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  A FNFPD+PP + GGR L
Sbjct  32   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGRDAGFNFPDNPPSISGGRSL  91

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EIQ  AA   N+   +   E          +     +  +     STS++       
Sbjct  92   TPPEIQEAAARFANNTTTQDQEEE--------ESGLVLGSEEIRPESPSTSASVATTTST  143

Query  362  EGIDWSFLDNLDAPFTS----NDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQS  520
               D SFLD L   F       D+   F GD +   +P  DY       G+S+    Q  
Sbjct  144  VDYDLSFLDLLPMDFGVFPEFYDFSDDFSGDRFTEILPIEDY------GGDSL--LEQSL  195

Query  521  FLWNF  535
             LW+F
Sbjct  196  LLWDF  200



>ref|XP_010535748.1| PREDICTED: ethylene-responsive transcription factor ERF016 [Tarenaya 
hassleriana]
Length=224

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGS+   EKAARAFD AQYCLRGP A FNFP +PP++PGGR L
Sbjct  21   GKWVSEIRLPNSRERIWLGSFETAEKAARAFDAAQYCLRGPGASFNFPANPPEIPGGRSL  80

Query  182  SPAEIQGIAASSGND  226
            +P EIQ +A+   N+
Sbjct  81   TPPEIQAVASRFANE  95



>ref|XP_010098396.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25974.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB74920.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=280

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD AQ+CLRG  A FNFP+ PP++PGGR L
Sbjct  37   GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAAQFCLRGGYAHFNFPESPPNIPGGRSL  96

Query  182  SPAEIQGIAA  211
            SP EIQ +AA
Sbjct  97   SPQEIQVVAA  106



>ref|XP_009126515.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Brassica rapa]
Length=216

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS++  EKAARAFD A YCLRGP ARFNFPD+PP++PGGR L
Sbjct  16   GKWVAEIRLPNSRERIWLGSFDTAEKAARAFDAALYCLRGPGARFNFPDNPPEIPGGRSL  75

Query  182  SPAEIQGIAA  211
            +P +IQ +A+
Sbjct  76   TPQQIQVVAS  85



>ref|XP_006302833.1| hypothetical protein CARUB_v10020965mg [Capsella rubella]
 gb|EOA35731.1| hypothetical protein CARUB_v10020965mg [Capsella rubella]
Length=203

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 94/161 (58%), Gaps = 8/161 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  A FNFPD+PP + GG  L
Sbjct  32   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGGDADFNFPDNPPSISGGMSL  91

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHV--VEINDTSTSSAPGGGA  355
            +P EIQ  AA   ND   +   +N    V+G   D++++  V   EI   S S++     
Sbjct  92   TPPEIQEAAARFANDTTTQ---DNVVVLVKGEEEDEEESGLVPGSEIRPESPSTSASVAT  148

Query  356  QLEGIDWSFLDNLDAPFTSNDYFGLFHGDVY---VPPNDYE  469
                 D SF D L   F     F  F GD +   +P  DYE
Sbjct  149  STLDFDLSFFDLLPMDFGIFPGFDDFSGDRFTEILPIEDYE  189



>ref|XP_004488104.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cicer arietinum]
Length=204

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 96/183 (52%), Gaps = 10/183 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY++  KAARAFD A +CLRG  A+FNFPDDPPD+ GGR +
Sbjct  27   GKWVSEIRLPNSRQRIWLGSYDSAVKAARAFDAATFCLRGGGAKFNFPDDPPDIAGGRSM  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P++IQ  AA   N  R    P         T     ++      + T  + +   G   
Sbjct  87   TPSQIQDAAARFANSVRPVNTPIETPSSSVRTTLLPMESPSPALSDGTFQTDS---GVAE  143

Query  362  EGIDWSFLDNLDAPFTSNDY-----FGLFHGDVYVPPNDYEIEYGDDGESIGHFSQQSFL  526
             G     +    + +   DY     F  F GD YVP      +YGD+    G     SFL
Sbjct  144  NGCFKEMVSVNGSGYCVPDYSIFPGFDYFGGDFYVPELP-SYDYGDENID-GLIIHNSFL  201

Query  527  WNF  535
            WNF
Sbjct  202  WNF  204



>ref|XP_006288608.1| hypothetical protein CARUB_v10001903mg [Capsella rubella]
 gb|EOA21506.1| hypothetical protein CARUB_v10001903mg [Capsella rubella]
Length=224

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS+++ EKAARAFD A YCLRGP ARFNFP++PP++PGGR L
Sbjct  16   GKWVAEIRLPNSRERIWLGSFDSAEKAARAFDAALYCLRGPGARFNFPENPPEIPGGRSL  75

Query  182  SPAEIQGIAASSGNDYRLKP  241
            +P +IQ +A    ++  + P
Sbjct  76   TPQQIQAVANRFASEEEILP  95



>gb|KCW79361.1| hypothetical protein EUGRSUZ_C00780 [Eucalyptus grandis]
Length=240

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD AQ+CLRG  ARFNFPDDPPD+ GGR L
Sbjct  40   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAAQFCLRGRNARFNFPDDPPDIAGGRSL  99

Query  182  SPAEIQ  199
            +P EIQ
Sbjct  100  TPPEIQ  105



>ref|XP_008452799.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis melo]
Length=192

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY+ PEKAARAFD AQ+CLRGP A+FNFPD PP++ GG  L
Sbjct  34   GKWVSEIRLPNSRDRIWLGSYDKPEKAARAFDAAQFCLRGPQAKFNFPDSPPEIDGGDRL  93

Query  182  SPAEIQGIAASSGNDY  229
            S  EIQ  AA    ++
Sbjct  94   SAQEIQAAAAKYAEEH  109



>ref|NP_680184.1| ethylene-responsive transcription factor ERF016 [Arabidopsis 
thaliana]
 sp|Q9C591.1|ERF16_ARATH RecName: Full=Ethylene-responsive transcription factor ERF016 
[Arabidopsis thaliana]
 emb|CAC34489.1| putative protein [Arabidopsis thaliana]
 gb|AAO73898.1| AP2 domain transcription factor, putative [Arabidopsis thaliana]
 gb|AAS46630.1| At5g21960 [Arabidopsis thaliana]
 gb|AAS76730.1| At5g21960 [Arabidopsis thaliana]
 gb|AAT44933.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AED92961.1| ethylene-responsive transcription factor ERF016 [Arabidopsis 
thaliana]
Length=216

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSR+RIWLGS+++ EKAARAFD A YCLRGP ARFNFPD+PP++PGGR L
Sbjct  16   GKWVAEIRLPNSRDRIWLGSFDSAEKAARAFDAALYCLRGPGARFNFPDNPPEIPGGRSL  75

Query  182  SPAEIQGIAASSGNDYRLKP  241
            +P +IQ +A+    +  L P
Sbjct  76   TPQQIQVVASRFACEEELLP  95



>ref|XP_004144051.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis sativus]
 ref|XP_004167797.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis sativus]
 gb|KGN66326.1| hypothetical protein Csa_1G597730 [Cucumis sativus]
Length=203

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 99/185 (54%), Gaps = 15/185 (8%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++ EKAARAFD A +CLRG +ARFNFP +PP++P    L
Sbjct  27   GKWVSEIRLPNSRERIWLGSYDSAEKAARAFDAALFCLRGRSARFNFPQNPPEIPDATLL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgt-----gtddddttHVVEINDTS--TSSA  340
            S +EIQ +AA   N     P+P ++      T         + TT V+E ++ S      
Sbjct  87   SRSEIQSVAAQFANS---DPIPSSEFHRPTTTDSPSPSLVSEMTTSVIECDERSLFLDLH  143

Query  341  PGGGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIGHFSQQS  520
               G+   G D+      + PF +  +         +P  D    YGD+     H    S
Sbjct  144  TAMGSDNYGTDFGLFPEYN-PFYNELFINSSSSSSTIPCYD----YGDEIFEATHQDDSS  198

Query  521  FLWNF  535
            +LWNF
Sbjct  199  YLWNF  203



>ref|XP_002887566.1| hypothetical protein ARALYDRAFT_476631 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63825.1| hypothetical protein ARALYDRAFT_476631 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  A FNFPD+PP + GGR L
Sbjct  30   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGGDANFNFPDNPPSISGGRSL  89

Query  182  SPAEIQGIAASSGN  223
            +P EIQ  AA   N
Sbjct  90   TPPEIQEAAARFAN  103



>ref|XP_009120702.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Brassica rapa]
Length=228

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS+++ EKAARAFD A YCLRGP ARFNFPD+PP++PGGR L
Sbjct  17   GKWVAEIRLPNSRERIWLGSFDSAEKAARAFDAALYCLRGPGARFNFPDNPPEIPGGRSL  76

Query  182  SPAEIQGIA  208
            +P +IQ +A
Sbjct  77   TPQQIQVVA  85



>emb|CDX73125.1| BnaC06g35730D [Brassica napus]
Length=198

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 99/185 (54%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGS++ PEKAARAFD AQ+CLRG  + FNFPD+PP + GGR L
Sbjct  33   GKWVSEIRLPNSRERIWLGSFDTPEKAARAFDAAQFCLRGCQSGFNFPDNPPSISGGRSL  92

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SP EI+  AA   N      L          T  +++           ST+S       L
Sbjct  93   SPPEIREAAARYANAQDDGIL---------ITTGEEESVLSETRPESPSTTSVSEADTSL  143

Query  362  EGIDWSFLDNLDAPF----TSNDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQS  520
            +  D SFLD L   F      +D+   F GD +   +P  DY       G+ I  F +  
Sbjct  144  D-CDLSFLDTLPNDFGMFSVFDDFSDGFSGDQFTEVLPVEDY-------GDVI--FDESL  193

Query  521  FLWNF  535
            FLW+F
Sbjct  194  FLWDF  198



>ref|XP_010471592.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Camelina sativa]
Length=203

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 101/187 (54%), Gaps = 25/187 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  A FNFPD+PP + GGR L
Sbjct  33   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGRDAGFNFPDNPPSISGGRSL  92

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EIQ  AA   N+        N    V+G   ++       EI   S S++       
Sbjct  93   TPPEIQEAAARFANN--------NQDSVVKGEEEEESGIVPGSEIRPESPSTSASVATTT  144

Query  362  EGIDW--SFLDNLDAPFTS----NDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQ  514
              +D+  SFLD L   F       D+   F GD +   +P  DY       G+S+    Q
Sbjct  145  STVDYDLSFLDLLPMDFGVFPGFYDFSDDFAGDRFTEILPIEDY------GGDSL--LEQ  196

Query  515  QSFLWNF  535
               LW+F
Sbjct  197  SLLLWDF  203



>ref|XP_011081953.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Sesamum indicum]
Length=229

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 98/164 (60%), Gaps = 12/164 (7%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRGP A+FNFPDDPP++ GG+ L
Sbjct  35   GKYVSEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGPNAKFNFPDDPPNISGGQAL  94

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEIN-DTSTSSAPGGGA-  355
            +PAEIQ +A    N Y       +  +    +   + D      ++ DTS SS    GA 
Sbjct  95   NPAEIQTVAHHYANTYNYSGSSSSSNNNQPHSQAPNVDQFGAPAMDEDTSPSSTHSEGAG  154

Query  356  QLEGIDWSFLDNLDAPFTSN-------DYFGLFH--GDVYVPPN  460
             ++ IDWS  D  D+    N       DY  LFH    +Y+PP+
Sbjct  155  PMDLIDWSAWDMWDSSSGGNAAGDHVLDYV-LFHEPSYMYMPPH  197



>ref|XP_007012584.1| AP2/ERF domain-containing transcription factor [Theobroma cacao]
 gb|EOY30203.1| AP2/ERF domain-containing transcription factor [Theobroma cacao]
Length=197

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRG +A+FNFPD+PPD+ GGR L
Sbjct  27   GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAALFCLRGGSAKFNFPDNPPDIDGGRSL  86

Query  182  SPAEIQGIAA  211
            +P EIQ  AA
Sbjct  87   TPPEIQAAAA  96



>ref|XP_004488106.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cicer arietinum]
Length=213

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 99/190 (52%), Gaps = 17/190 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY++  KAARAFD A +CLRG  A+FNFPDDPPD+ GGR +
Sbjct  27   GKWVSEIRLPNSRQRIWLGSYDSAVKAARAFDAAMFCLRGSGAKFNFPDDPPDIAGGRSM  86

Query  182  SPAEIQGIAASSGN-----DYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG  346
            +P++IQ  AA   N     +Y  +P             T              +T    G
Sbjct  87   TPSQIQAAAARFANSEHPKEYSGRPDNNAMESSCSSEVTALLPMESPSPALSDATVQMDG  146

Query  347  GGAQLEGIDWSFLDN---LDAPFTSNDYFGL--FHGDVYVP--PNDYEIEYGDDGESIGH  505
              AQ       F  N   +  P  SN + G   F GD YVP  PN    +YG++    G 
Sbjct  147  EFAQTGLFSELFSVNGSGICGPDYSN-FMGFDDFGGDFYVPELPN---YDYGEENMD-GL  201

Query  506  FSQQSFLWNF  535
                SFLWNF
Sbjct  202  IINDSFLWNF  211



>ref|XP_011093871.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Sesamum indicum]
Length=224

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 106/201 (53%), Gaps = 32/201 (16%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPN RERIWLGSY+  EKAARAFD A +CLRG  A+FNFPD+PPD+  GR L
Sbjct  33   GKYVSEIRLPNCRERIWLGSYDTAEKAARAFDAALFCLRGGNAKFNFPDNPPDIVNGRSL  92

Query  182  SPAEIQGIAAS---SGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG--  346
            +PAEIQ  AA    SG+D    PL       V        D+    E+   + S  P   
Sbjct  93   TPAEIQAAAARFAHSGSD----PLATGSSGRVENPDISLSDSLSSSEVLQHAESPCPSVS  148

Query  347  -GGAQLEG------IDWSFLDNLDAPFTSNDY--FGLFHG---------DVYVPPNDYEI  472
             G  Q +       +D +F+D   +  T N+   FGLF G            +P  DY  
Sbjct  149  DGQPQPDSEVTEMPLDNAFMDQFLSMGTENNVPDFGLFPGFDDFPGDYMAPLLPSADY--  206

Query  473  EYGDDGESIGHFSQQSFLWNF  535
             Y D+ E     SQ SFLWNF
Sbjct  207  -YPDNNEEFP--SQDSFLWNF  224



>ref|XP_002874038.1| hypothetical protein ARALYDRAFT_910177 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50297.1| hypothetical protein ARALYDRAFT_910177 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS+++ EKAARAFD A YCLRGP ARFNFP++PP++PGGR L
Sbjct  16   GKWVAEIRLPNSRERIWLGSFDSAEKAARAFDAALYCLRGPGARFNFPENPPEIPGGRSL  75

Query  182  SPAEIQGIAA  211
            +P +IQ +A+
Sbjct  76   TPQQIQVVAS  85



>ref|XP_002276572.2| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Vitis vinifera]
Length=205

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 98/186 (53%), Gaps = 17/186 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A YCLRG TA+FNFP++PP + GG  L
Sbjct  29   GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAALYCLRGRTAKFNFPENPPKIAGGGSL  88

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            + +EI+  AA   N+        +    +     +    +   E     T S       L
Sbjct  89   TRSEIRAAAAKFANEDSSTASTSHSSHSMPELQVESPSPSVSGETTQVETDSE----INL  144

Query  362  EGIDWSFLDNLDAPFTSNDY---FGLFHG-----DVYVPPNDYEIEYGDDGESIGHFSQQ  517
            EG     L  L     SN Y   +G+F G     D + PP     +YG++  +   FS  
Sbjct  145  EGS----LSELFTSIGSNSYVPDYGIFPGFDDLSDNFFPPAMPTDDYGEEDMN-ALFSHD  199

Query  518  SFLWNF  535
            +FLWNF
Sbjct  200  TFLWNF  205



>emb|CDY45406.1| BnaA07g31860D [Brassica napus]
Length=196

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 99/185 (54%), Gaps = 27/185 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGS++ PEKAARAFD AQ+CLRG  + FNFPD+PP + GGR L
Sbjct  32   GKWVSEIRLPNSRDRIWLGSFDTPEKAARAFDAAQFCLRGRQSGFNFPDNPPSISGGRSL  91

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EI+  AA   N                   +  ++ + + E    S S++    A  
Sbjct  92   TPPEIREAAARYAN-----------AQDGDIIISTGEEESVLSETRPESPSTSVSEAAMS  140

Query  362  EGIDWSFLDNLDAPFTS----NDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQS  520
               D SFLD L   F      +D+   F GD +   +P  DY       G+ I  F +  
Sbjct  141  LDCDLSFLDTLPNDFGMFSGFDDFSDGFSGDQFTEVLPVEDY-------GDVI--FDESL  191

Query  521  FLWNF  535
            FLW+F
Sbjct  192  FLWDF  196



>ref|XP_009131845.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Brassica rapa]
Length=212

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS+++ EKAARAFD A YCLRG  ARFNFPD+PP++PGGR L
Sbjct  16   GKWVAEIRLPNSRERIWLGSFDSAEKAARAFDAALYCLRGSGARFNFPDNPPEIPGGRSL  75

Query  182  SPAEIQGIAASSGNDYRLKPLPEN  253
            +P EIQ  A    ++  L P P  
Sbjct  76   TPQEIQVAANRFASEELLPPPPRQ  99



>ref|XP_008466852.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis melo]
Length=212

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 105/198 (53%), Gaps = 30/198 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDP-PDVPGGRW  178
            GKWV+EIRLPNSR+RIWLGSY++PEKAARAFD A +CLRGP A+FNFP+ P PD+     
Sbjct  25   GKWVAEIRLPNSRDRIWLGSYDSPEKAARAFDAALFCLRGPHAKFNFPEQPLPDILNAHS  84

Query  179  LSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
            L+  +IQ  AA   N+Y      +ND             TT   E N           + 
Sbjct  85   LTAHQIQEFAAKFANEYDCH---QNDVVDDVAPPPTTTTTTTTAEDN----CGNSPSSSN  137

Query  359  LEGIDWSFLDNLD-----APFTSNDYFGLFH--------GDVYVP-----PND-YEIEYG  481
               +DWSFLD +       P +S+++F L++         D Y        ND Y+   G
Sbjct  138  YNNVDWSFLDEIHDHHNPNPHSSSNFFPLYNDHFDNILTNDFYQSSTTNNTNDLYDAVSG  197

Query  482  DDGESIGHFSQQSFLWNF  535
            DD ++   FS Q FLWNF
Sbjct  198  DDDDT---FSNQPFLWNF  212



>ref|XP_006416528.1| hypothetical protein EUTSA_v10009812mg [Eutrema salsugineum]
 gb|ESQ34881.1| hypothetical protein EUTSA_v10009812mg [Eutrema salsugineum]
Length=191

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 95/180 (53%), Gaps = 12/180 (7%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG  A+FNFPD+PP + GGR L
Sbjct  22   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGGGAKFNFPDNPPTISGGRNL  81

Query  182  SPAEIQGIAASSGN--DYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGA  355
            S +EI+  AA   N  +  +    E+       T          +EI+    S  P  G+
Sbjct  82   SRSEIREAAARFANSSEENIVSEKESMEQESPSTSVASSSMMMTMEIDSEFLSMLPSVGS  141

Query  356  QLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIGHFSQQSFLWNF  535
                 D+      D    S++Y G    +   P   Y   YG++     +F    +LWNF
Sbjct  142  GNFASDFGLFPGFDD--FSDEYSGDRFSEELSPTRGY---YGEE-----NFDGSVYLWNF  191



>ref|XP_004488105.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cicer arietinum]
Length=199

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY++  KAARAFD A +CLRG  A+FNFPDDPPD+ GGR +
Sbjct  27   GKWVSEIRLPNSRQRIWLGSYDSAVKAARAFDAAMFCLRGSGAKFNFPDDPPDIAGGRSM  86

Query  182  SPAEIQGIAASSGNDYR  232
            +P++IQ  AA   N  R
Sbjct  87   TPSQIQAAAARFANSGR  103



>ref|XP_006400701.1| hypothetical protein EUTSA_v10015465mg [Eutrema salsugineum]
 gb|ESQ42154.1| hypothetical protein EUTSA_v10015465mg [Eutrema salsugineum]
Length=226

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSR+RIWLGS+++ EKAARAFD A YCLRGP ARFNFP++PP++PGGR L
Sbjct  18   GKWVAEIRLPNSRDRIWLGSFDSAEKAARAFDAALYCLRGPGARFNFPENPPEIPGGRSL  77

Query  182  SPAEIQGIA  208
            +P +IQ +A
Sbjct  78   TPQQIQVVA  86



>ref|NP_173355.3| ethylene-responsive transcription factor ERF017 [Arabidopsis 
thaliana]
 sp|Q84QC2.1|ERF17_ARATH RecName: Full=Ethylene-responsive transcription factor ERF017 
[Arabidopsis thaliana]
 gb|AAP06820.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEE29818.1| ethylene-responsive transcription factor ERF017 [Arabidopsis 
thaliana]
Length=185

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PP + GGR L
Sbjct  21   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPDNPPVISGGRNL  80

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  81   SRSEIREAAARFAN  94



>ref|XP_010477124.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Camelina sativa]
Length=192

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PP + GGR L
Sbjct  23   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPDNPPVISGGRNL  82

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  83   SRSEIREAAARFAN  96



>gb|AAF82238.1|AC069143_14 Contains similarity to an AP2 domain containing protein RAP2.10 
mRNA from Arabidopsis thaliana gb|AF003103 and contains an 
AP2 PF|00847 domain. EST gb|AI996763 comes from this gene 
[Arabidopsis thaliana]
 gb|AAG48785.1|AF332422_1 putative AP2 domain transcription factor [Arabidopsis thaliana]
Length=178

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PP + GGR L
Sbjct  14   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPDNPPVISGGRNL  73

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  74   SRSEIREAAARFAN  87



>ref|XP_010459580.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Camelina sativa]
Length=191

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PP + GGR L
Sbjct  23   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPDNPPVISGGRNL  82

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  83   SRSEIREAAARFAN  96



>ref|XP_006474529.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Citrus sinensis]
Length=224

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 106/198 (54%), Gaps = 29/198 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD-----VP  166
            GKWVSEIRLPNSRERIWLGSY  PEKAARAFD A +CLRG  A+FNFP++PP      VP
Sbjct  36   GKWVSEIRLPNSRERIWLGSYETPEKAARAFDAALFCLRGRDAKFNFPENPPSELDVTVP  95

Query  167  G-----GRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTST  331
            G      R L+P EIQ IAA   N        E             ++  +    N+ ++
Sbjct  96   GPEGARARSLTPQEIQAIAARFAN--------EEPPRSSVDHANSSNNNNNNNNNNNCTS  147

Query  332  SSAPGGGAQLEG---IDWSFLDNLDAPFTSNDYFGLFHG-----DVYVPPNDYEIEYGD-  484
            SS+ GG   ++    IDWSF D LD+   ++D FG + G     D   P    E    D 
Sbjct  148  SSSDGGAVHVDSDSTIDWSFWDMLDSNEGASD-FGFYSGMDHMSDELYPSATAEPTIDDI  206

Query  485  DGESIGHFSQ-QSFLWNF  535
            + E    FSQ  SFLWNF
Sbjct  207  NEEDQNAFSQTSSFLWNF  224



>ref|XP_010420984.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Camelina sativa]
Length=220

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS+ + EKAARAFD A YCLRGP ARFNFPD+PP +PGGR L
Sbjct  17   GKWVAEIRLPNSRERIWLGSFESAEKAARAFDAALYCLRGPGARFNFPDNPPVIPGGRSL  76

Query  182  SPAEIQGIAA  211
            +P +IQ +A+
Sbjct  77   TPQQIQVVAS  86



>ref|XP_004144279.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis sativus]
 ref|XP_004172714.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Cucumis sativus]
 gb|KGN47571.1| hypothetical protein Csa_6G361330 [Cucumis sativus]
Length=213

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 103/210 (49%), Gaps = 53/210 (25%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDP-PDVPGGRW  178
            GKWV+EIRLPNSR+RIWLGSY++PEKAARAFD A +CLRGP A+FNFPD P PD+     
Sbjct  25   GKWVAEIRLPNSRDRIWLGSYDSPEKAARAFDAALFCLRGPHAKFNFPDQPLPDILNAHS  84

Query  179  LSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEIN---DTSTSSAPGG  349
            L+  +IQ  AA   N+Y      +                  VV++     T+T+    G
Sbjct  85   LTAHQIQEFAAKFANEYECHQNDD------------------VVDVAPPPTTTTAEEKCG  126

Query  350  ----GAQLEGIDWSFLDNLDA------------------PFTSNDYFGLFHGDVY----V  451
                 +    +DWSFLD +                    P  ++ +  +   D Y     
Sbjct  127  ISPSSSNYNNMDWSFLDEIHDHHYPNPNPHSSSSSSNFFPLYNDHFDNILTNDFYQSSTT  186

Query  452  PPND--YEIEYGDDGESIGHFSQQSFLWNF  535
              ND  Y+   GDD ++   FS Q FLWNF
Sbjct  187  NNNDDLYDAVSGDDDDT---FSNQPFLWNF  213



>ref|XP_010498330.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
isoform X1 [Camelina sativa]
 ref|XP_010498331.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
isoform X2 [Camelina sativa]
Length=190

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PP + GGR L
Sbjct  22   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPDNPPVISGGRNL  81

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  82   SRSEIRESAARFAN  95



>ref|XP_009613570.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Nicotiana tomentosiformis]
Length=220

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY+  EKAARAFD AQ+CLRG  A+ NFPD+PPD+  GR +
Sbjct  31   GKWVSEVRLPNSRERIWLGSYDTAEKAARAFDAAQFCLRGEAAKLNFPDNPPDILNGRSM  90

Query  182  SPAEIQGIAASSGN  223
            S AEIQ  AA   N
Sbjct  91   SAAEIQMAAARFAN  104



>ref|XP_003542371.2| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Glycine max]
Length=285

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 101/191 (53%), Gaps = 32/191 (17%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGS++ PEKAARAFD A +CLRG  A+FNFPD+PPD+ GG  +
Sbjct  114  GKWVSEIRLPNSRQRIWLGSFDTPEKAARAFDAAMFCLRGRNAKFNFPDNPPDIAGGESM  173

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVE---INDTSTSSAPGGG  352
            +P++IQ  AA   N       P     G          +  V E   + D+  ++  G  
Sbjct  174  TPSQIQVAAAQFAN-----AGPHEGHSGRPEHSPMQSLSPSVSEGTVLTDSDVTTLNGS-  227

Query  353  AQLEGIDWSFLDNLDAPFTSNDY---FGL------FHGDVYVPPNDYEIEYGDD-GESIG  502
                      L +L  P  S+ Y   +G+      F G  YV P      YG++ GE  G
Sbjct  228  ----------LTDLFTPVGSSGYASDYGIFPGVDDFSGGFYV-PEMLNFNYGEENGE--G  274

Query  503  HFSQQSFLWNF  535
                +SFLWNF
Sbjct  275  FIVDESFLWNF  285



>emb|CDX96673.1| BnaA08g22160D [Brassica napus]
Length=176

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG  A+FNFPD+PP + GGR +
Sbjct  19   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGSGAKFNFPDNPPAISGGRNM  78

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  79   SRSEIREAAARFAN  92



>gb|AFK45531.1| unknown [Medicago truncatula]
 gb|KEH37603.1| ethylene-responsive transcription factor ERF017-like protein 
[Medicago truncatula]
Length=214

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++ EKAARAFD A +CLRG  A+FNFP+DPP++ GGR +
Sbjct  28   GKYVSEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGAKFNFPNDPPNIAGGRTM  87

Query  182  SPAEIQGIAASSGN  223
            +P+EIQ  AA   N
Sbjct  88   TPSEIQAAAARFAN  101



>ref|XP_009104737.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Brassica rapa]
Length=194

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 94/186 (51%), Gaps = 30/186 (16%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  + FNFPD+PP + GGR L
Sbjct  31   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGDGSAFNFPDNPPSISGGRSL  90

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEI-----NDTSTSSAPG  346
            +  EI+  AA   N                   +   + + + EI     + TS S    
Sbjct  91   TATEIREAAARFAN-------------AQDDVISVRGEESGLSEIRPESPSSTSVSEMDT  137

Query  347  GGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQ  517
              A     D S  D L A F     F  F GD +   +P  DY       GE I  F   
Sbjct  138  SSATTLDCDLSLFDLLPADFGMFPGFDGFSGDGFTEILPIEDY-------GEEI--FDGS  188

Query  518  SFLWNF  535
             FLW+F
Sbjct  189  FFLWDF  194



>ref|XP_006306071.1| hypothetical protein CARUB_v10011394mg [Capsella rubella]
 gb|EOA38969.1| hypothetical protein CARUB_v10011394mg [Capsella rubella]
Length=188

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFP++PP + GGR L
Sbjct  22   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPENPPAINGGRNL  81

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  82   SRSEIREAAARFAN  95



>ref|XP_008784342.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Phoenix 
dactylifera]
Length=197

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 97/191 (51%), Gaps = 33/191 (17%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY++P+KAARAFD A  CLRG   R NFPD PP + GG+ L
Sbjct  27   GRWVSEIRLPNSRERIWLGSYDSPDKAARAFDAAVVCLRGRRGRLNFPDSPPRIAGGQSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
             P +IQG+AA   +        + D D                E  D  T+ + G     
Sbjct  87   GPRQIQGLAAHHAH--------KADSDAAAIAADAPAPKMSPSETADALTAESEG-----  133

Query  362  EGIDWSFLDNLDAPFTSNDYFGL-------------FHGDVYVPPNDYEIEYGDDGESIG  502
              +DWSF+D L +P    D  G+             F  D + PP     +  +D   +G
Sbjct  134  -VVDWSFMDMLSSP----DGVGMDFPPAVAEAAMDDFSYD-FFPPATAPPDVAEDNGGVG  187

Query  503  HFSQQSFLWNF  535
             F   SFLW+F
Sbjct  188  -FGANSFLWSF  197



>ref|XP_010416351.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Camelina sativa]
Length=204

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CL G  A FNFPD+PP + GGR L
Sbjct  33   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLHGRDAGFNFPDNPPSISGGRSL  92

Query  182  SPAEIQGIAASSGND  226
            +P EIQ  AA   N+
Sbjct  93   TPPEIQEAAARFANN  107



>ref|XP_006345254.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Solanum tuberosum]
Length=250

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAA+AFD A +CLRG  A FNFP++PP++  GR +
Sbjct  30   GKWVSEIRLPNSRERIWLGSYDTPEKAAKAFDAALFCLRGKGANFNFPENPPEIMNGRSM  89

Query  182  SPAEIQGIAASSGND  226
            +P+EIQ  AA   N+
Sbjct  90   TPSEIQSAAAQFANN  104



>ref|XP_004251702.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Solanum 
lycopersicum]
Length=248

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAA+AFD A +CLRG  A FNFP++PP++  GR +
Sbjct  29   GKWVSEIRLPNSRERIWLGSYDTPEKAAKAFDAALFCLRGKGANFNFPENPPEIRNGRTM  88

Query  182  SPAEIQGIAASSGND  226
            +P+EIQ  AA   N+
Sbjct  89   TPSEIQSAAAQFANN  103



>gb|EYU25826.1| hypothetical protein MIMGU_mgv1a026977mg, partial [Erythranthe 
guttata]
Length=145

 Score =   110 bits (275),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPN R+RIWLGSY+  EKAARAFD A +CLRG  A+FNFPD+PP +P GR +
Sbjct  35   GKYVSEIRLPNCRDRIWLGSYDTAEKAARAFDAALFCLRGKNAKFNFPDNPPQIPNGRSM  94

Query  182  SPAEIQGIAASSGN  223
            SPAEIQ  AA   N
Sbjct  95   SPAEIQVAAARFAN  108



>gb|EYU28310.1| hypothetical protein MIMGU_mgv1a014932mg [Erythranthe guttata]
Length=173

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 2/84 (2%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSRERIWLGS++  EKAARAFD A +CLRG  A+FNFPD PP++ GGR +
Sbjct  43   GKYVSEIRLPNSRERIWLGSFDTAEKAARAFDAALFCLRGANAKFNFPDSPPEIAGGRSM  102

Query  182  SPAEIQGIAASSGNDYRLKPLPEN  253
            +P EIQ   A+SG+  R   L  N
Sbjct  103  TPVEIQ--VAASGSHMRRSRLKFN  124



>emb|CDX68158.1| BnaA07g21980D [Brassica napus]
Length=194

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 97/181 (54%), Gaps = 20/181 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  + FNFPD+PP + GGR L
Sbjct  31   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGGGSAFNFPDNPPSISGGRSL  90

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +  EI+  AA   N          +  G+     +   +T V E++ +S ++        
Sbjct  91   TATEIREAAARFANAQDDVISVRGEESGLSEIRPESPSSTSVSEVDTSSATTLD------  144

Query  362  EGIDWSFLDNLDAPFTSNDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQSFLWN  532
               D S  D L A F +   F  F  D +   +P  DY       GE I  F    FLW+
Sbjct  145  --CDLSLFDMLPADFGTFPGFDDFSCDGFTEILPIEDY-------GEEI--FDGSFFLWD  193

Query  533  F  535
            F
Sbjct  194  F  194



>ref|XP_010496785.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Camelina sativa]
Length=223

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 100/208 (48%), Gaps = 31/208 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIRLPNSRERIWLGS+ + EKAARAFD A YCLRGP ARFNFPD+PP + GGR L
Sbjct  17   GKWVAEIRLPNSRERIWLGSFESAEKAARAFDAALYCLRGPGARFNFPDNPPVITGGRSL  76

Query  182  SPAEIQGIAA----SSGNDYRLKPLP-----ENdgdgvrgtgtddddttHVVEINDTSTS  334
            +P +IQ +A+        D  + P P     +   +                        
Sbjct  77   TPQQIQVVASRFACEEEEDQLVPPQPSPPRGDQKTEEEEEEEIISARGGMSGGNGGPMLG  136

Query  335  SAPGGGAQLEGID--------WSFL---DNLDAPFTSNDYFGLFHGD----VYVPPNDYE  469
                G    EG +        W F+   +NL  P TS D FG F  D    +Y P    +
Sbjct  137  QVEQGNNNNEGTNSSNDTSSYWPFIWENENLVGPQTSGD-FGFFTDDDSTNLYFPTQQPQ  195

Query  470  IE-----YGDDGESIGHFSQQSF-LWNF  535
             +     Y DDG     FS  S  LWNF
Sbjct  196  QQLSSDFYYDDGACEDDFSHYSINLWNF  223



>ref|NP_177631.1| ethylene-responsive transcription factor ERF018 [Arabidopsis 
thaliana]
 sp|Q9S7L5.1|ERF18_ARATH RecName: Full=Ethylene-responsive transcription factor ERF018 
[Arabidopsis thaliana]
 gb|AAD55283.1|AC008263_14 Similar to gb|X94698 TINY from Arabidopsis thaliana and contains 
a PF|00847 AP2 domain. EST gb|F15362 comes from this gene 
[Arabidopsis thaliana]
 gb|AAG51936.1|AC013258_30 putative AP2 domain transcription factor; 59128-58541 [Arabidopsis 
thaliana]
 gb|AAM91512.1| AP2 domain containing protein, putative [Arabidopsis thaliana]
 gb|AAO29966.1| AP2 domain containing protein, putative [Arabidopsis thaliana]
 gb|AEE35652.1| ethylene-responsive transcription factor ERF018 [Arabidopsis 
thaliana]
Length=195

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 100/185 (54%), Gaps = 26/185 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP+SRERIWLGSY+ PEKAARAFD AQ+CLRG  A FNFP++PP +   + L
Sbjct  30   GKWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAQFCLRGGDANFNFPNNPPSISVEKSL  89

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +P EIQ  AA   N ++     E +   V G+           EI   S S++       
Sbjct  90   TPPEIQEAAARFANTFQDIVKGEEESGLVPGS-----------EIRPESPSTSASVATST  138

Query  362  EGIDWSFLDNLDAPFT----SNDYFGLFHGDVY---VPPNDYEIEYGDDGESIGHFSQQS  520
               D+SFLD L   F     S+D+ G   GD +   +P  DY       GES+    +  
Sbjct  139  VDYDFSFLDLLPMNFGFDSFSDDFSGFSGGDRFTEILPIEDY------GGESL--LDESL  190

Query  521  FLWNF  535
             LW+F
Sbjct  191  ILWDF  195



>ref|XP_010910716.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Elaeis guineensis]
Length=198

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 97/194 (50%), Gaps = 39/194 (20%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY++ EKAARAFD A  CLRG   R NFP+ PP + GG+ L
Sbjct  28   GRWVSEIRLPNSRERIWLGSYDSAEKAARAFDAAVVCLRGRRGRLNFPNSPPRIAGGQSL  87

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SP +IQ +AA   +        +++ D                E +D  T+ +       
Sbjct  88   SPRQIQALAARHAH--------KDNSDAATTAADVVAPVMSSSEASDAPTTESE------  133

Query  362  EGIDWSFLDNLDAPFTSNDYFGL-----------FHGDVYVP-----PNDYEIEYGDDGE  493
            E +DWSF+D L +P    D  G+           F  D + P     P D   E G  G 
Sbjct  134  EVLDWSFMDILSSP----DVVGMDFPTAAAAMDDFSYDFFAPSMAAAPPDVAEENGGVG-  188

Query  494  SIGHFSQQSFLWNF  535
                F   SFLW+F
Sbjct  189  ----FGGNSFLWSF  198



>emb|CBI27772.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A YCLRG TA+FNFP++PP + GG  L
Sbjct  101  GKWVSEIRLPNSRERIWLGSYDTAEKAARAFDAALYCLRGRTAKFNFPENPPKIAGGGSL  160

Query  182  SPAEIQGIAASSGND  226
            + +EI+  AA   N+
Sbjct  161  TRSEIRAAAAKFANE  175



>ref|XP_006452945.1| hypothetical protein CICLE_v10010348mg [Citrus clementina]
 gb|ESR66185.1| hypothetical protein CICLE_v10010348mg [Citrus clementina]
Length=219

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 107/198 (54%), Gaps = 32/198 (16%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPP---DVPG-  169
            GKWVSEIRLPNSRERIWLGSY  PEKAARAFD A +CLRG  A+FNFP++PP   DV G 
Sbjct  34   GKWVSEIRLPNSRERIWLGSYETPEKAARAFDAALFCLRGRDAKFNFPENPPSELDVTGP  93

Query  170  ------GRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTST  331
                   R L+P EIQ IAA   N+   +P P +  D    +  ++++       +D   
Sbjct  94   GPEGARARSLTPQEIQVIAARFANE---EP-PRSSVDHHANSSNNNNNNNCTSSSSD---  146

Query  332  SSAPGGGAQLEG---IDWSFLDNLDAPFTSNDYFGLFHG-----DVYVPPNDYEIEYGD-  484
                GG   L+    IDWS  D LD+   ++D FG + G     D   P    E    D 
Sbjct  147  ----GGAVHLDSDSTIDWSLWDMLDSNEGASD-FGFYSGMDHMSDELYPSATAEPTIDDI  201

Query  485  DGESIGHFSQ-QSFLWNF  535
            + E    FSQ  SFLWNF
Sbjct  202  NEEDQNAFSQTSSFLWNF  219



>ref|XP_006390369.1| hypothetical protein EUTSA_v10019652mg [Eutrema salsugineum]
 gb|ESQ27655.1| hypothetical protein EUTSA_v10019652mg [Eutrema salsugineum]
Length=199

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPN R+RIWLGSY+ PEKAARAFD AQ+CLRG  A FNFPD PP + GGR L
Sbjct  30   GKWVSEIRLPNCRDRIWLGSYDTPEKAARAFDAAQFCLRGGNAGFNFPDHPPSISGGRSL  89

Query  182  SPAEIQGIAASSGN  223
            +P+EI+  AA   N
Sbjct  90   TPSEIREAAARYAN  103



>ref|XP_002893033.1| hypothetical protein ARALYDRAFT_472144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69292.1| hypothetical protein ARALYDRAFT_472144 [Arabidopsis lyrata subsp. 
lyrata]
Length=186

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A YCLRG  A+FNFPD+PP +  GR L
Sbjct  22   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALYCLRGNNAKFNFPDNPPVINDGRNL  81

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  82   SRSEIREAAARFAN  95



>ref|XP_003595361.1| Ethylene-responsive transcription factor RAP2-9 [Medicago truncatula]
Length=203

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++  KAARAFD A +CLRG  A+FNFP+DPPD+ GGR +
Sbjct  28   GKYVSEIRLPNSRQRIWLGSYDSAVKAARAFDAAMFCLRGSGAKFNFPNDPPDIAGGRSM  87

Query  182  SPAEIQGIAASSGNDYRLK  238
            + +EI+  AAS  N  +L+
Sbjct  88   THSEIKTAAASFANSGQLE  106



>dbj|BAF47194.1| embryonic element binding Factor 8 [Daucus carota]
Length=192

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/70 (73%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSRERIWLGSY++  KAARAFD A YCLRGP A+FNFP++PP++PGGR L
Sbjct  14   GKFVSEIRLPNSRERIWLGSYDSAVKAARAFDAALYCLRGPDAKFNFPENPPEIPGGRSL  73

Query  182  SPAEIQGIAA  211
            +P +IQ  AA
Sbjct  74   TPPQIQVEAA  83



>ref|XP_007138631.1| hypothetical protein PHAVU_009G225000g [Phaseolus vulgaris]
 gb|ESW10625.1| hypothetical protein PHAVU_009G225000g [Phaseolus vulgaris]
Length=208

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++ EKAARAFD A +CLRG  A+FNFP DPP++ GGR +
Sbjct  28   GKYVSEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGAKFNFPSDPPNIAGGRTM  87

Query  182  SPAEIQGIAASSGN  223
            +P++IQ  AA   N
Sbjct  88   TPSQIQIAAARFAN  101



>ref|XP_011039943.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Populus euphratica]
Length=209

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 99/187 (53%), Gaps = 13/187 (7%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY++ EKAA AFD A +CLRG T +FNF ++PP++ GG  L
Sbjct  27   GRWVSEIRLPNSRERIWLGSYDSAEKAAHAFDAALFCLRGNTMKFNFSENPPNIAGGGSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SP+EIQ  AA   N    +            + ++    +  +      T  + GG    
Sbjct  87   SPSEIQEAAARFANSEPQRGQSGKLEADQSTSVSESRPESPCLSAASDGTVRSDGG----  142

Query  362  EGI-DWSFLDNLDAPFTSN--DYFGLF------HGDVYVPPNDYEIEYGDDGESIGHFSQ  514
            E I D  F D + +  +SN    +G+F      H   + P     +++G+     G   +
Sbjct  143  ELIRDMPFFDMVMSTGSSNHPKEYGIFPGFDDLHSGFFAPSLLPNLDHGEGVNLDGVLEE  202

Query  515  QSFLWNF  535
             SFLWNF
Sbjct  203  DSFLWNF  209



>ref|XP_010541700.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Tarenaya hassleriana]
Length=219

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGS++  EKAARAFD A YCLRGP A FNFP +PP++PGG  L
Sbjct  20   GKWVSEIRLPNSRERIWLGSFDTAEKAARAFDAALYCLRGPGASFNFPANPPEIPGGCSL  79

Query  182  SPAEIQGIAASSGND  226
            +P EIQ  A+   N+
Sbjct  80   TPPEIQAGASRFANE  94



>ref|XP_003595362.1| Ethylene-responsive transcription factor [Medicago truncatula]
 gb|AES65613.1| ethylene-responsive transcription factor ERF017-like protein 
[Medicago truncatula]
Length=202

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 99/183 (54%), Gaps = 13/183 (7%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++  KAARAFD A +CLRG  A+FNFP+DPP + GGR +
Sbjct  28   GKYVSEIRLPNSRQRIWLGSYDSAVKAARAFDAAMFCLRGSGAKFNFPNDPPYIAGGRSM  87

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSA---PGGG  352
            + AEI+  AAS  N  +    PEN       +      T   +E+   + S         
Sbjct  88   THAEIKTAAASFANSGQ----PENTPFETPSSSEGTATTLLSMELLSPALSDVTVQTDCN  143

Query  353  AQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPP-NDYE-IEYGDDGESIGHFSQQSFL  526
            ++  G+         + ++    F  F GD YVP  +D++ +E   DG  I       FL
Sbjct  144  SKENGLFSDMFSETGSGYSMFPGFDDFCGDFYVPEMSDFDYVEENMDGLVIPDL----FL  199

Query  527  WNF  535
            WNF
Sbjct  200  WNF  202



>emb|CDX83779.1| BnaC08g18660D [Brassica napus]
Length=177

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG   +FNFPD+PP + GG  +
Sbjct  19   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGSGTKFNFPDNPPAISGGGNM  78

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  79   SRSEIRDAAARFAN  92



>gb|KFK44061.1| hypothetical protein AALP_AA1G210800 [Arabis alpina]
Length=183

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIR+PNSRERIWLGSY+ PEKAARAFD A +CLRG +A+FNFP++PP + GGR L
Sbjct  23   GKWVAEIRIPNSRERIWLGSYDTPEKAARAFDAALFCLRGSSAKFNFPENPPVISGGRNL  82

Query  182  SPAEIQGIAA  211
            S +EI+  AA
Sbjct  83   SRSEIREAAA  92



>gb|KEH39894.1| ethylene-responsive transcription factor ERF018 [Medicago truncatula]
Length=231

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 99/193 (51%), Gaps = 25/193 (13%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVP-----  166
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A YCLRGP A FNFP+ P  +      
Sbjct  47   GKWVSEIRLPNSRERIWLGSYDTQEKAARAFDAALYCLRGPHASFNFPNTPLTINVAVNH  106

Query  167  --GGRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSA  340
              G + LSP EIQ IAA   N        E+          D    +  +E  + + S+A
Sbjct  107  GVGHQSLSPEEIQEIAAKFAN--------ESSPPIELTQEEDHQVPSDPLESQNDTNSNA  158

Query  341  -----PGGGAQLEGIDWSF---LDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGES  496
                       L  +DW+F    ++++     +D++GL +     PP  +E +  D  E 
Sbjct  159  YSYPLDNDIGDLRRMDWTFDDMFEDMNGVANGSDFYGLQNMQYSTPP--FEEDNVDQIEC  216

Query  497  IGHFSQQSFLWNF  535
               F+  S LWN+
Sbjct  217  EDTFTNHSTLWNW  229



>emb|CDX81918.1| BnaC08g36830D [Brassica napus]
Length=191

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG  A FNFPD+PP + GG  +
Sbjct  21   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGSNANFNFPDNPPAISGGGNM  80

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  81   SRSEIREAAARFAN  94



>gb|KFK41931.1| hypothetical protein AALP_AA2G190400 [Arabis alpina]
Length=205

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY  PEKAARAFD AQ+CLRG    +NFPD PP + GG+ L
Sbjct  33   GKWVSEIRLPNSRERIWLGSYETPEKAARAFDAAQFCLRGGDGNYNFPDRPPFISGGKSL  92

Query  182  SPAEIQGIAASSGN  223
            +P+ IQ  AA   N
Sbjct  93   TPSAIQEAAARFAN  106



>emb|CDY21678.1| BnaA09g44290D [Brassica napus]
Length=206

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG  A FNFPD+PP + GG  +
Sbjct  21   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGSNANFNFPDNPPAISGGGNM  80

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  81   SRSEIREAAARFAN  94



>ref|XP_009117558.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Brassica rapa]
Length=191

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG  A FNFPD+PP + GG  +
Sbjct  21   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGSGANFNFPDNPPAISGGGNM  80

Query  182  SPAEIQGIAASSGN  223
            S +EI+  AA   N
Sbjct  81   SRSEIREAAARFAN  94



>ref|XP_009149397.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Brassica rapa]
Length=155

 Score =   105 bits (263),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CLRG  A FNFPD+PP + GG+ +
Sbjct  24   GKWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALFCLRGSGANFNFPDNPPVIAGGQNM  83

Query  182  SPAEIQGIAASSGN  223
            S  EI+  AA   N
Sbjct  84   SRTEIREAAARFAN  97



>ref|XP_006843906.1| hypothetical protein AMTR_s00007p00268460 [Amborella trichopoda]
 gb|ERN05581.1| hypothetical protein AMTR_s00007p00268460 [Amborella trichopoda]
Length=213

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLPNSRERIWLGSY+APEKAARA+D A +CLRGP+A+ NFP +PP++     L
Sbjct  40   GKWVAEVRLPNSRERIWLGSYDAPEKAARAYDAAVFCLRGPSAKLNFPANPPEISAAGSL  99

Query  182  SPAEIQGIAA  211
            SPA+IQ +AA
Sbjct  100  SPAQIQLVAA  109



>ref|XP_006381586.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
 gb|ABQ62996.1| RAP2-like protein [Populus trichocarpa]
 gb|ERP59383.1| AP2 domain-containing transcription factor family protein [Populus 
trichocarpa]
Length=201

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 96/186 (52%), Gaps = 19/186 (10%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY++ EKAA AFD A +CLRG T +FNF ++PP++ GG  L
Sbjct  27   GRWVSEIRLPNSRERIWLGSYDSAEKAAHAFDAALFCLRGNTMKFNFSENPPNIAGGGSL  86

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            SP+EIQ  AA   N       P+    G          +    E      S+A  G  + 
Sbjct  87   SPSEIQEAAARFANSE-----PQRGQSGKLEADQSTSVSESRPE--SPCLSAASDGTVR-  138

Query  362  EGIDWSFLDNLDAPFTSND--YFGLF------HGDVYVPPNDYEIEYGDDGESIGHFSQQ  517
               D  F D   +  +SN    +G+F      H   + P     +++G+     G   + 
Sbjct  139  ---DMPFFDMAMSTSSSNHPTEYGIFPGFDDLHSGFFAPSFLPNLDHGEGFNLDGVLEED  195

Query  518  SFLWNF  535
            SFLWNF
Sbjct  196  SFLWNF  201



>gb|KEH39896.1| ethylene-responsive transcription factor ERF018 [Medicago truncatula]
Length=219

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 96/192 (50%), Gaps = 28/192 (15%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV------  163
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A YCLRGP A FNFP+ P  +      
Sbjct  40   GKWVSEIRLPNSRERIWLGSYDTQEKAARAFDAALYCLRGPHASFNFPNTPLTINLVFHH  99

Query  164  -PGGRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSS-  337
                  LSP EIQ IAA   N+  ++   E D      +             ND +++S 
Sbjct  100  SVSHNSLSPQEIQEIAAKFANELPIELTQEEDQQVPSESQ------------NDANSNSY  147

Query  338  ---APGGGAQLEGIDWSF---LDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESI  499
                      L  +DW F    D+++     ++++GL   ++      +E +  D  E  
Sbjct  148  SYPLDNDIGDLRRMDWRFEDMFDDMNRVANCSNFYGL--QNMQYSTQLFEEDNVDQIECE  205

Query  500  GHFSQQSFLWNF  535
              FS  S LWN+
Sbjct  206  DTFSNHSILWNW  217



>ref|XP_003533795.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Glycine max]
Length=214

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 106/193 (55%), Gaps = 24/193 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++ EKAARAFD A +CLRG  A+FNFP DPP++ GG  +
Sbjct  31   GKYVSEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGAKFNFPSDPPNIAGGGNM  90

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            + ++IQ  AA   N    +P  E     V    +D++  +  V I+DT TSS P      
Sbjct  91   TSSQIQIAAARFANS---EPRNERSDQPVESLTSDEETASFPV-ISDTDTSSPPLSDVTF  146

Query  362  ----EGIDWSFLDNLDAPFTSNDY---------FGLFHGDVYVPPNDYEIEYGDDGES--  496
                E +  SF D   + F S D+         F  F  D ++    +E+   + GE   
Sbjct  147  QNDAELVTGSFPDMF-SDFGSGDFVPDFSDFPSFDDFSRDFFL----HELPGFNFGEENL  201

Query  497  IGHFSQQSFLWNF  535
             G   Q SFLWNF
Sbjct  202  DGLIIQDSFLWNF  214



>ref|XP_003603247.1| Ethylene-responsive transcription factor RAP2-9 [Medicago truncatula]
 gb|AES73498.1| ethylene-responsive transcription factor ERF018 [Medicago truncatula]
Length=244

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 108/209 (52%), Gaps = 43/209 (21%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVP----G  169
            GKWVSEIRLPNSRERIWLGSY++ EKAA+AFD A YCLRG  A FNF D P ++      
Sbjct  46   GKWVSEIRLPNSRERIWLGSYDSAEKAAKAFDAALYCLRGRHANFNFLDTPLNLDINAVS  105

Query  170  GRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEI-NDTSTSSAPG  346
               L+P +I+ +AA+  N         N+G+              V EI   +ST++   
Sbjct  106  NNSLTPQQIREVAANFANKNPPIIDNNNNGNNSNVQSNM------VTEIGGSSSTTTMYN  159

Query  347  GGAQLEGIDWSFLDNL------DAPFTSNDYFGLFHGDV-----------YVPP----ND  463
             G+    IDW+FL+ L      DA F  +DY GL + D+            +PP     D
Sbjct  160  NGST---IDWTFLNMLDGSNTHDANFVGSDY-GLLYSDLDKMMHSGELMYSIPPPPLFED  215

Query  464  YEI-----EYGDDGESIGHFSQQSFLWNF  535
            Y+      EY DD      FS QSFLWN+
Sbjct  216  YQNLSSVEEYDDDNGDP--FSHQSFLWNW  242



>gb|ABK20977.1| unknown [Picea sitchensis]
Length=178

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR+PNSR +IWLGSY++PEKAARA+D A YCLRG  A FNFPD PP +P    L
Sbjct  33   GKWVSEIRMPNSRAKIWLGSYDSPEKAARAYDFAVYCLRGSKAAFNFPDSPPQIPCASSL  92

Query  182  SPAEIQGIAAS-SGNDYR  232
            SP +IQ  AA  +  D+R
Sbjct  93   SPPQIQAAAARFATEDFR  110



>gb|KEH39897.1| ethylene-responsive transcription factor ERF018 [Medicago truncatula]
Length=265

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 82/153 (54%), Gaps = 8/153 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV----PG  169
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A YCLRGP A FNFP+ P  +     G
Sbjct  36   GKWVSEIRLPNSRERIWLGSYDTQEKAARAFDAALYCLRGPHASFNFPNTPFTINVAFHG  95

Query  170  GRWLSPAEIQGIAASSGND---YRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSA  340
             + LSP EIQ +AA   N+     L    ++           + + ++   ++D      
Sbjct  96   YQSLSPQEIQEVAAKYANESPPIELTQEQDHQVSSESQNDATNSNNSYSCSLSDNDGREQ  155

Query  341  PGGGAQLEGIDWSFLDNLDAPFTSNDYFGLFHG  439
               G  L  +DW+F D         + F LF+G
Sbjct  156  VDYG-DLRMMDWTFKDMFVEMNGVANCFELFYG  187



>gb|KEH39898.1| ethylene-responsive transcription factor ERF018 [Medicago truncatula]
Length=219

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 94/188 (50%), Gaps = 15/188 (8%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV------  163
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A YCLRGP A FNFP+ P  +      
Sbjct  31   GKWVSEIRLPNSRERIWLGSYDTQEKAARAFDAALYCLRGPHASFNFPNTPLTINVAVNH  90

Query  164  -PGGRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVE--INDTSTS  334
              G + LSP EIQ +AA   N+     L   D   V     +D  + H     +ND    
Sbjct  91   GVGHQSLSPEEIQDVAAKFANESPPIELTHEDDQQVPSEAQNDTISNHSYSCPLNDNDGR  150

Query  335  SAPGGGAQLEGIDWSF---LDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIGH  505
                 G  L  +DW F    D+L+     ++ +G    ++       E +  D  E    
Sbjct  151  VQVDYG-DLRRMDWKFEDMFDDLNGVANCSNLYG--QENMQYSTQLVEEDNVDQIECEDT  207

Query  506  FSQQSFLW  529
            FS  SFLW
Sbjct  208  FSDHSFLW  215



>ref|XP_003546516.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Glycine 
max]
Length=213

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++ EKAARAFD A +CLRG  A FNFP D P++ GGR +
Sbjct  31   GKYVSEIRLPNSRQRIWLGSYDSAEKAARAFDAAMFCLRGSGANFNFPSDRPNIAGGRNM  90

Query  182  SPAEIQGIAASSGN  223
            +P++IQ  AA   N
Sbjct  91   TPSQIQIAAARFAN  104



>ref|XP_003595363.1| Ethylene-responsive transcription factor RAP2-1 [Medicago truncatula]
 gb|AES65614.1| TINY transcription factor [Medicago truncatula]
Length=230

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++  KAARAFD A +CLRG  A+FNFP+DPP++ GGR +
Sbjct  28   GKYVSEIRLPNSRQRIWLGSYDSDVKAARAFDAAMFCLRGSGAKFNFPNDPPEIAGGRSM  87

Query  182  SPAEIQGIAASSGN  223
            + +EI+  AA   N
Sbjct  88   THSEIKTAAARFAN  101



>gb|EPS59347.1| hypothetical protein M569_15461, partial [Genlisea aurea]
Length=92

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+V+EIR+PN R+RIWLGSY+  E+AARAFD AQYCLRG  ARFNFPDDPP++  G  +
Sbjct  18   GKFVAEIRMPNCRDRIWLGSYDTAEEAARAFDAAQYCLRGRGARFNFPDDPPEIANGESM  77

Query  182  SPAEIQGIAA  211
            +P EI+  AA
Sbjct  78   TPEEIRDAAA  87



>ref|XP_010273874.1| PREDICTED: ethylene-responsive transcription factor RAP2-9-like 
[Nelumbo nucifera]
Length=204

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLP SR+RIWLGSY+ P+KAARA+D A +CLRGP+ + NFP  PPD+P    L
Sbjct  38   GKWVAEVRLPKSRDRIWLGSYDTPDKAARAYDAAVFCLRGPSCKLNFPTTPPDIPSAGDL  97

Query  182  SPAEIQGIAASSGNDYRLKP  241
            +P++IQ  AAS  +   + P
Sbjct  98   TPSQIQAAAASYAHQVPIAP  117



>emb|CDX85863.1| BnaC06g22710D [Brassica napus]
Length=197

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLP SRERIWLGSY+ PEKAARAFD AQ+CLRG  + F+FP +PP + GGR L
Sbjct  31   GKWVSEIRLPRSRERIWLGSYDTPEKAARAFDAAQFCLRGGDSAFSFPYNPPSISGGRSL  90

Query  182  SPAEIQGIAASSGN  223
            +  EI+  AA   N
Sbjct  91   TAPEIREAAARFAN  104



>ref|XP_003603244.1| Ethylene-responsive transcription factor RAP2-9 [Medicago truncatula]
 gb|AES73495.1| ethylene-responsive transcription factor ERF018 [Medicago truncatula]
Length=230

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 103/197 (52%), Gaps = 27/197 (14%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV----PG  169
            GKWVSEIRLPNSRERIWLGSY++ EKAA+AFD A YCLRG  A FNF D P ++      
Sbjct  40   GKWVSEIRLPNSRERIWLGSYDSAEKAAKAFDAALYCLRGRHANFNFLDTPLNLDINAVS  99

Query  170  GRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGG  349
               L+P +I+ +AA+  N         N+G+              V EI  +S+++    
Sbjct  100  NNSLTPQQIREVAANFANKNPPIIDNNNNGNNSNVQSNM------VTEIGGSSSTTTMYN  153

Query  350  GAQLEGIDWSFLDNL------DAPFTSNDYFGLFHGD---VYVPPNDYEI------EYGD  484
                  IDW+FL+ L      DA F  ++  G F+ D   +Y     Y I      E+ D
Sbjct  154  NRS--TIDWTFLNMLDGSNTHDADFVGSENIGGFYSDLEKLYSGELMYSIAPPLIEEHDD  211

Query  485  DGESIGHFSQQSFLWNF  535
            D +    FS QSFLWN+
Sbjct  212  DDDDNDPFSHQSFLWNW  228



>gb|AES65612.2| ethylene-responsive transcription factor ERF017-like protein 
[Medicago truncatula]
Length=203

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR+RIWLGSY++  KAARA + A +CLRG  A+FN P+DPP++ GGR +
Sbjct  28   GKYVSEIRLPNSRQRIWLGSYDSAVKAARALEAAMFCLRGSGAKFNLPNDPPEIAGGRSM  87

Query  182  SPAEIQGIAASSGNDYRLK  238
            + +EI+  AAS  N  +L+
Sbjct  88   THSEIKTAAASFANSGQLE  106



>ref|XP_004498968.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Cicer arietinum]
Length=223

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 96/193 (50%), Gaps = 21/193 (11%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV----PG  169
            GKWVSEIRLPNSRERIWLGSY+  EKAARAFD A +CLRG  A FNFP+ P  +     G
Sbjct  35   GKWVSEIRLPNSRERIWLGSYDTQEKAARAFDAALFCLRGRHAGFNFPNTPLSINVPFHG  94

Query  170  GRWLSPAEIQGIAASSGND--YRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAP  343
               LSP EIQ +A+   ND    L    ++    +       +        +  +  S  
Sbjct  95   HNSLSPQEIQEVASKFANDPPIELTQEDQDQQVPLESQNNSVNSNNSNSLYDHNNDGSVQ  154

Query  344  GGGAQLEGIDWSFLDNLD-----APFTSNDYFGL----FHGDVYVPPNDYEIEYGDDGES  496
                 L  +DW F D LD     A   S  Y GL    +   ++   N Y+IE G+D   
Sbjct  155  VDYGDLRMMDWRFDDMLDDLNEVACSDSGLYSGLEKMQYSTQLFEEDNVYQIE-GEDA--  211

Query  497  IGHFSQQSFLWNF  535
               FS  SFLW++
Sbjct  212  ---FSNHSFLWSW  221



>ref|XP_003527767.1| PREDICTED: ethylene-responsive transcription factor ERF036 [Glycine 
max]
 gb|KHN37224.1| Ethylene-responsive transcription factor ERF018 [Glycine soja]
Length=285

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV------  163
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG  A FNFP+ P ++      
Sbjct  49   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGRHANFNFPNTPCNMDTATNA  108

Query  164  PGGRWLSPAEIQGIAASSGNDYRLKPL  244
            P  + L+P EIQ +AA   N  ++ PL
Sbjct  109  PPNQSLTPQEIQEVAAKFAN--QVSPL  133



>gb|ABR17111.1| unknown [Picea sitchensis]
Length=165

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WVSEIR+P SR++IWLGSY  PE+AARA+D A YCLRGP A+FNFPD  P++P    L
Sbjct  34   GIWVSEIRMPRSRQKIWLGSYKTPEQAARAYDAAMYCLRGPNAKFNFPDSVPNIPSASSL  93

Query  182  SPAEIQGIA  208
            SP +IQ  A
Sbjct  94   SPKQIQHAA  102



>ref|XP_011078131.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Sesamum indicum]
Length=219

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 99/188 (53%), Gaps = 16/188 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+VSEIRLPNSR RIWLGSY+  EKAARAFD A +CLRG  A+FNFPD PPD+  GR L
Sbjct  38   GKYVSEIRLPNSRARIWLGSYDTAEKAARAFDAALFCLRGRKAKFNFPDSPPDILNGRSL  97

Query  182  SPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQL  361
            +PA  +   +  G+    +    ++ D    + +  +   HV     + +      G + 
Sbjct  98   TPAAARFAHSEPGSRSSGR---IDNLDSQSDSLSSSELLQHVESPCPSVSDGTAQPGMEF  154

Query  362  EGI--DWSFLDNLDAPFTSNDY--FGL------FHGDVYVPPNDYEIEYGDDGESIGHFS  511
              I  D +FLD +    T N+   FGL      F GD  +PP    ++Y  D      FS
Sbjct  155  TNIPLDNAFLDQILTTGTENNVTDFGLFPGFDDFSGDFLMPPPLPNVDYWPDNNEELLFS  214

Query  512  QQSFLWNF  535
            +   LW+F
Sbjct  215  E---LWSF  219



>ref|XP_003523659.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Glycine max]
Length=288

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGG---  172
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG  A FNFP+ P ++      
Sbjct  49   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGRHANFNFPNTPCNMDTTNAP  108

Query  173  -RWLSPAEIQGIAASSGNDYRLKPLPE  250
             + L+P EIQ +AA+  N   L   P+
Sbjct  109  HQSLTPQEIQEVAANFANQAPLLQKPQ  135



>gb|KHN29661.1| Ethylene-responsive transcription factor ERF018 [Glycine soja]
Length=286

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGG---  172
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A YCLRG  A FNFP+ P ++      
Sbjct  47   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGRHANFNFPNTPCNMDTTNAP  106

Query  173  -RWLSPAEIQGIAASSGNDYRLKPLPE  250
             + L+P EIQ +AA+  N   L   P+
Sbjct  107  HQSLTPQEIQEVAANFANQAPLLQKPQ  133



>gb|ABK26476.1| unknown [Picea sitchensis]
Length=213

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WVSEIR+P SR++IWLGSY  PE+AARA+D A YCLRGP A+FNFPD  P++P    L
Sbjct  34   GIWVSEIRMPRSRQKIWLGSYKTPEQAARAYDAAMYCLRGPNAKFNFPDSVPNIPSASSL  93

Query  182  SPAEIQGIA  208
            SP +IQ  A
Sbjct  94   SPKQIQHAA  102



>ref|XP_006843905.1| hypothetical protein AMTR_s00007p00268280 [Amborella trichopoda]
 gb|ERN05580.1| hypothetical protein AMTR_s00007p00268280 [Amborella trichopoda]
Length=202

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSE+RLPNSRERIWLGSY+  EKAARA+D A +CLRGPTA FNFP + P +     L
Sbjct  36   GKWVSEVRLPNSRERIWLGSYDTAEKAARAYDAAVFCLRGPTAHFNFPANHPKIQSSGRL  95

Query  182  SPAEIQGIAASSGND  226
            +  EI+ +AA   N+
Sbjct  96   TADEIRAVAAQFANE  110



>gb|ABR17626.1| unknown [Picea sitchensis]
Length=189

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR+PNSR++IWLGSY+ PEKAARA+D A YCLRG  A+FNFP+  P++P    L
Sbjct  33   GKWVSEIRMPNSRDKIWLGSYDTPEKAARAYDFAVYCLRGSKAKFNFPEFLPEIPCASSL  92

Query  182  SPAEIQGIAAS-SGNDYRL  235
            SP +IQ  A+  +  +++L
Sbjct  93   SPPQIQAAASKFAAEEFQL  111



>ref|XP_008792845.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Phoenix dactylifera]
Length=183

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY +PEKAARAFD A +CLRG   R NFPD PP + GGR L
Sbjct  23   GRWVSEIRLPNSRERIWLGSYESPEKAARAFDAAVFCLRGRRGRLNFPDAPPRISGGRSL  82

Query  182  S  184
            S
Sbjct  83   S  83



>ref|XP_007136913.1| hypothetical protein PHAVU_009G084400g [Phaseolus vulgaris]
 gb|ESW08907.1| hypothetical protein PHAVU_009G084400g [Phaseolus vulgaris]
Length=267

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 65/92 (71%), Gaps = 9/92 (10%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDP----PDVPG  169
            GKWVSEIRLPNSRERIWLGSY++PEKAARAFD A +CLRG  A FNFP+ P     +VP 
Sbjct  33   GKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALFCLRGRNANFNFPNTPCSMDTNVPL  92

Query  170  G--RWLSPAEIQGIAASSGND---YRLKPLPE  250
               + L+P EIQ +AA   N+    + KPL +
Sbjct  93   AAPQSLTPHEIQEVAAKFANEDPLLQKKPLTQ  124



>gb|KHN05270.1| Ethylene-responsive transcription factor ERF017 [Glycine soja]
Length=249

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 109/216 (50%), Gaps = 44/216 (20%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDP---------  154
            GKWVSEIRLPNSRERIWLGSY+   KAARAFDVA YCLRG +A FNFPD P         
Sbjct  38   GKWVSEIRLPNSRERIWLGSYDTQVKAARAFDVALYCLRGKSASFNFPDTPRHLEINMVL  97

Query  155  PDVPGGRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTST-  331
            P     + LS  EIQ IA+   N+  + PL E      +      +  +   +  +T T 
Sbjct  98   PCDIQQQPLSHPEIQEIASKFANNDHV-PLEEESAFQEQEQDPSMESQSDESKSANTITE  156

Query  332  -SSAPG---GGA-------QLEG----IDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDY  466
             S+ P    GG        QL+G    +DW+F + LD    S+  FGL+ G   + P ++
Sbjct  157  MSNFPNIYDGGTHTNVQVDQLQGDWDSMDWTFFNMLDDLNGSD--FGLYLGPDKLHPGEF  214

Query  467  -------------EIEYGDDGESIGHFSQQSFLWNF  535
                         EIE  DD ++   FS  S LW++
Sbjct  215  LCPTQAPMLFHEDEIEGDDDHDA---FSNHSLLWSW  247



>ref|XP_006596062.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Glycine max]
Length=254

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 109/216 (50%), Gaps = 44/216 (20%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDP---------  154
            GKWVSEIRLPNSRERIWLGSY+   KAARAFDVA YCLRG +A FNFPD P         
Sbjct  43   GKWVSEIRLPNSRERIWLGSYDTQVKAARAFDVALYCLRGKSASFNFPDTPRHLEINMVL  102

Query  155  PDVPGGRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTST-  331
            P     + LS  EIQ IA+   N+  + PL E      +      +  +   +  +T T 
Sbjct  103  PCDIQQQPLSHPEIQEIASKFANNDHV-PLEEESAFQEQEQDPSMESQSDESKSANTITE  161

Query  332  -SSAPG---GGA-------QLEG----IDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDY  466
             S+ P    GG        QL+G    +DW+F + LD    S+  FGL+ G   + P ++
Sbjct  162  MSNFPNIYDGGTHTNVQVDQLQGDWDSMDWTFFNMLDDLNGSD--FGLYLGPDKLHPGEF  219

Query  467  -------------EIEYGDDGESIGHFSQQSFLWNF  535
                         EIE  DD ++   FS  S LW++
Sbjct  220  LCPTQAPMLFHEDEIEGDDDHDA---FSNHSLLWSW  252



>gb|KDP33946.1| hypothetical protein JCGZ_07517 [Jatropha curcas]
Length=130

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIR PNSR RIWLGSYN  E+AARA+D A +CLRGP+A  NFP +PPD+P    L
Sbjct  22   GKWVAEIRQPNSRGRIWLGSYNTAEEAARAYDAALFCLRGPSAILNFPMNPPDIPSATDL  81

Query  182  SPAEIQGIA  208
            SP++I+ +A
Sbjct  82   SPSQIRDVA  90



>ref|XP_007161121.1| hypothetical protein PHAVU_001G044500g [Phaseolus vulgaris]
 gb|ESW33115.1| hypothetical protein PHAVU_001G044500g [Phaseolus vulgaris]
Length=229

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 95/193 (49%), Gaps = 30/193 (16%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSRERIWLGSY   EKAARAFD A YCLRG  A FNFPD P  +      
Sbjct  48   GKWVSEIRLPNSRERIWLGSYETQEKAARAFDAALYCLRGKAASFNFPDTPQHMEMAAVE  107

Query  182  SPA---EIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGG  352
             P    EIQ +AA   N   +    E      +   T              + ++ PG  
Sbjct  108  IPCSHQEIQEVAAKFANKEGVLAEEEEARSESKSNDTT------------DTNTTFPGTN  155

Query  353  --AQL--EGIDWSFLDNLDAPFTSNDYFGLF---HGDVYVPPNDYEIEY--GDDGESIGH  505
              AQ+  + +DW+F++ LD    S+  FGLF     +   P     + +  GD+ E   H
Sbjct  156  NHAQVDQDTMDWTFMNMLDDLNVSD--FGLFGAEKAEFLCPTTQTPLLFHNGDEIEVDDH  213

Query  506  ----FSQQSFLWN  532
                FS  SFLW+
Sbjct  214  DHDAFSNHSFLWS  226



>ref|XP_004501409.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Cicer arietinum]
Length=216

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 76/201 (38%), Positives = 100/201 (50%), Gaps = 45/201 (22%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDP-----PDVP  166
            GKWVSEIRLPNSRERIWLGS+++ EKAARAFD A YCLRG  A FNFPD P         
Sbjct  36   GKWVSEIRLPNSRERIWLGSHDSAEKAARAFDAALYCLRGRHANFNFPDTPFNLVNNVNN  95

Query  167  GGRWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG  346
                L+P +IQ IA++  N+    P                        +++ + ++A  
Sbjct  96   YNNSLTPQQIQQIASNFANNINQPP---------------------TNVVDNNNHNNAAS  134

Query  347  GGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDV----------YVPP-------NDYEIE  475
              +    IDW+FL+ LDA  T +  F   +GD+           +PP       N  +IE
Sbjct  135  SSSNTSTIDWTFLNALDAS-TEDANFIHNYGDLEKMHSGELLYSIPPPFFEDDNNRNQIE  193

Query  476  YG-DDGESIGHFSQQSFLWNF  535
               D G+    FS  SFLWN+
Sbjct  194  ANIDAGDYDDPFSHPSFLWNW  214



>ref|XP_008800510.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Phoenix dactylifera]
Length=174

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLPNSRERIWLGSY+  EKAARA+D A YCLRG  A  NFP DPPD+P    L
Sbjct  26   GKWVAEVRLPNSRERIWLGSYDTAEKAARAYDAASYCLRGTQAVVNFPADPPDIPSPGRL  85

Query  182  SPAEIQGIAASSGND  226
            +  EI+  A+   ++
Sbjct  86   TRDEIRAAASRHAHE  100



>ref|XP_008786989.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Phoenix dactylifera]
Length=187

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLPNSRERIWLGSY+  EKAARA+D A YCLRG  A  NFP DPP++P    L
Sbjct  26   GKWVAEVRLPNSRERIWLGSYDTAEKAARAYDAASYCLRGSRAALNFPADPPNIPSPGRL  85

Query  182  SPAEIQGIAASS  217
            +  EI+ +AASS
Sbjct  86   TRDEIR-VAASS  96



>ref|XP_007012585.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY30204.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=149

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+R PNSR RIWLGSY   E+AARA+D A +CLRG + + NFPD+PPD+     L
Sbjct  29   GKWVAEVRQPNSRRRIWLGSYKTAEEAARAYDAAVFCLRGSSGKLNFPDNPPDIADASEL  88

Query  182  SPAEIQGIA  208
            +PA+IQ  A
Sbjct  89   TPAQIQEAA  97



>gb|EPS59984.1| hypothetical protein M569_14820 [Genlisea aurea]
Length=204

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GK+V+EIRLPNSRERIWLG+Y++PE AARAFD A YCLRGP A FNFP DPP     R L
Sbjct  28   GKYVTEIRLPNSRERIWLGTYDSPEVAARAFDAASYCLRGPNASFNFPHDPPRFEIPRQL  87

Query  182  SPAEIQGIAASSGNDY  229
            S  +I   A +  N +
Sbjct  88   SHEQILTAAQNYANAF  103



>ref|XP_010099090.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25976.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB76738.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=171

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WV+E+R PNSR+RIWLGSYN P++AA A+D A +CLRGP+   NFP+ PP++P    L
Sbjct  37   GRWVAEVRQPNSRKRIWLGSYNTPQEAALAYDAAVFCLRGPSVLLNFPETPPEIPSAGDL  96

Query  182  SPAEIQGIAASSGNDY  229
            SP++IQ  A    + +
Sbjct  97   SPSQIQEAACRHSHSF  112



>ref|XP_010940190.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Elaeis 
guineensis]
Length=169

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLPNSRERIWLGSY+  EKAARAFD A YCL G  A  NFP DPP++P    L
Sbjct  26   GKWVAEVRLPNSRERIWLGSYDTAEKAARAFDAASYCLCGTQAVVNFPADPPNIPSPGRL  85

Query  182  SPAEIQGIAASSGND  226
            +  EI+ +A+   ++
Sbjct  86   TRNEIRAVASKHAHE  100



>ref|XP_010917441.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Elaeis guineensis]
Length=196

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGG  172
            G+WVSEIRLPNSRERIWLGSY++PEKAARAFD A  CLRG   R NFPD PP + GG
Sbjct  22   GRWVSEIRLPNSRERIWLGSYDSPEKAARAFDAAVVCLRGRRGRLNFPDAPPRISGG  78



>ref|XP_009389872.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Musa acuminata subsp. malaccensis]
Length=176

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WV+E+R PNSRER+WLGSY  PE+AARAFD A YCLRGP A  NFP+ PP +P    L
Sbjct  25   GSWVAEVRFPNSRERLWLGSYPTPEQAARAFDAAVYCLRGPGAALNFPEQPPHIPSASTL  84

Query  182  SPAEIQGIAASSGND  226
            +  EI+  A    +D
Sbjct  85   NREEIRAAAVRFAHD  99



>ref|XP_006601199.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Glycine max]
Length=256

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 90/183 (49%), Gaps = 31/183 (17%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRW-  178
            GKWVSEIRLPNSRERIWLGSY+   KAARAFD A YCLRG +A FNFPD P  +      
Sbjct  40   GKWVSEIRLPNSRERIWLGSYDTQVKAARAFDAALYCLRGQSATFNFPDTPRHLETNMVL  99

Query  179  --------LSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVE-------  313
                    LS  EIQ +A    N+    PL E +    +       + +   E       
Sbjct  100  SRDKQPQPLSHQEIQEVAVKFANNDD-HPLEEEECAFQKQEQERSLEESQSDESKSGNTI  158

Query  314  --------INDTSTSSAPGGGAQLEG----IDWSFLDNLDAPFTSNDYFGLFHGDVYVPP  457
                    I D  T +      QL+G    +DW+FL+ LD    S+  FGL+ G   + P
Sbjct  159  MEMSNFPSIYDGETHNNNVQVDQLKGDWDTMDWTFLNMLDDLNGSD--FGLYVGLDKMHP  216

Query  458  NDY  466
            +++
Sbjct  217  SEF  219



>gb|KHN20149.1| Ethylene-responsive transcription factor ERF017 [Glycine soja]
Length=251

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 90/183 (49%), Gaps = 31/183 (17%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRW-  178
            GKWVSEIRLPNSRERIWLGSY+   KAARAFD A YCLRG +A FNFPD P  +      
Sbjct  35   GKWVSEIRLPNSRERIWLGSYDTQVKAARAFDAALYCLRGQSATFNFPDTPRHLETNMVL  94

Query  179  --------LSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVE-------  313
                    LS  EIQ +A    N+    PL E +    +       + +   E       
Sbjct  95   SRDKQPQPLSHQEIQEVAVKFANNDD-HPLEEEECAFQKQEQERSLEESQSDESKSGNTI  153

Query  314  --------INDTSTSSAPGGGAQLEG----IDWSFLDNLDAPFTSNDYFGLFHGDVYVPP  457
                    I D  T +      QL+G    +DW+FL+ LD    S+  FGL+ G   + P
Sbjct  154  MEMSNFPSIYDGETHNNNVQVDQLKGDWDTMDWTFLNMLDDLNGSD--FGLYVGLDKMHP  211

Query  458  NDY  466
            +++
Sbjct  212  SEF  214



>ref|XP_010937366.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Elaeis guineensis]
Length=193

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLPNSRERIWLGSY+  EKAARA+D A YCLRG TA  NFP DPP++     L
Sbjct  26   GKWVAEVRLPNSRERIWLGSYDTAEKAARAYDAASYCLRGTTAALNFPADPPNIRSPGRL  85

Query  182  SPAEIQGIA  208
            +  EI+  A
Sbjct  86   TRDEIRAAA  94



>gb|AFG62416.1| hypothetical protein UMN_5771_02, partial [Pinus taeda]
 gb|AFG62417.1| hypothetical protein UMN_5771_02, partial [Pinus taeda]
Length=94

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR+PNS  RIWLGSY+ PEKAARA+D A YCLRG TA+ NFP  PP +    + 
Sbjct  33   GKWVSEIRIPNSSGRIWLGSYDTPEKAARAYDFAVYCLRGSTAKLNFPHSPPKISCASFQ  92

Query  182  SP  187
            SP
Sbjct  93   SP  94



>ref|XP_004954129.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Setaria italica]
Length=218

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTAR---FNFPDDPPDV-PG  169
            GKWVSEIRLPNSRERIWLGSY+APEKAARAFD A  CLRGP A     NFPD PP    G
Sbjct  23   GKWVSEIRLPNSRERIWLGSYDAPEKAARAFDAAFVCLRGPGAAGADLNFPDSPPPCRAG  82

Query  170  GRWLSPAEIQGIAASSGN  223
            G    P E+Q  A S  N
Sbjct  83   GCSSDPQEVQAAALSHAN  100



>ref|XP_008647233.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Zea mays]
Length=166

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 54/78 (69%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG---PTARFNFPDD-PPDVPG  169
            GKWVSEIRLPNSRERIWLGSY+AP+KAARAFD A  CLRG     A  NFPD  PP   G
Sbjct  27   GKWVSEIRLPNSRERIWLGSYDAPDKAARAFDAAFVCLRGRGAAGADLNFPDSPPPGRAG  86

Query  170  GRWLSPAEIQGIAASSGN  223
            GR   P E+Q  A S  N
Sbjct  87   GRSSDPREVQAAALSHAN  104



>ref|XP_009415650.1| PREDICTED: ethylene-responsive transcription factor ERF017 [Musa 
acuminata subsp. malaccensis]
Length=181

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WV+E+R PNSRER+WLGS+   E+AARA+D A YCLRG  A FNFPD PP +P    L
Sbjct  28   GSWVAEVRFPNSRERLWLGSHPTAEQAARAYDAAVYCLRGTRAAFNFPDQPPQIPSAERL  87

Query  182  SPAEIQGIAASSGNDYRLKPLPE  250
            S  EI+  A     +   +P  E
Sbjct  88   SKEEIRAAAMQFAQEEPRRPAGE  110



>ref|XP_002277621.2| PREDICTED: ethylene-responsive transcription factor ERF016 [Vitis 
vinifera]
Length=150

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WV+E+R PNSR+RIWLGSY  PE+AARA+D A  CLRG +A  NFP  PPD+P    L
Sbjct  28   GSWVAEVRQPNSRDRIWLGSYGKPEEAARAYDAAVLCLRGSSAILNFPSTPPDIPNAADL  87

Query  182  SPAEIQGIAAS  214
            SP EIQ +AAS
Sbjct  88   SPPEIQ-VAAS  97



>ref|XP_009390429.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Musa acuminata subsp. malaccensis]
Length=180

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+R PNSR+R+WLGSY  PE AARA+D A YCLRGP A FNFP  PP +P    L
Sbjct  27   GKWVAEVRFPNSRQRLWLGSYPTPEMAARAYDAAVYCLRGPGAAFNFPSHPPSIPSADKL  86

Query  182  SPAEIQGIA  208
            S  EI+  A
Sbjct  87   SRYEIREAA  95



>ref|XP_009389873.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Musa acuminata subsp. malaccensis]
Length=224

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WV+E+R PNSR+R+WLGSY  PE+AARAFD A YCLRG  AR NFP   PD+     L
Sbjct  34   GSWVAEVRFPNSRQRLWLGSYRTPEQAARAFDAAVYCLRGTGARCNFPGQLPDITPTHKL  93

Query  182  SPAEIQGIAASSGNDYRLKP  241
            SP EI+  A     D   +P
Sbjct  94   SPEEIRAAAMRFARDVPTRP  113



>ref|XP_011026594.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Populus euphratica]
Length=155

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGG--R  175
            GKWV+EIR PNSR RIWLGSYN  E+AARA+D A  CLRGP+A FNFP + P++P    +
Sbjct  24   GKWVAEIRQPNSRNRIWLGSYNTAEEAARAYDAAVLCLRGPSATFNFPTNIPEIPATTDQ  83

Query  176  WLSPAEIQGIAA  211
             LSP +I+ +A+
Sbjct  84   VLSPMQIREVAS  95



>gb|AEK82609.1| ethylene-responsive element binding protein 2 [Hevea brasiliensis]
 gb|AGL34966.1| ethylene-responsive transcription factor 7 [Hevea brasiliensis]
Length=159

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+EIR PNSR RIWLGSYN  E+AARA+D A +CLRGP+A  NFP +PPD+     L
Sbjct  25   GKWVAEIRQPNSRGRIWLGSYNTAEEAARAYDAALFCLRGPSATLNFPMNPPDIHLTTDL  84

Query  182  SPAEIQGIA  208
            SP +I+  A
Sbjct  85   SPLQIREAA  93



>gb|EYU25827.1| hypothetical protein MIMGU_mgv1a020481mg, partial [Erythranthe 
guttata]
Length=106

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 1/71 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+R PNSR+RIWLGSY+  E+AARA+D A  CLRG ++  NFPDDPPDV      
Sbjct  27   GKWVAEVRQPNSRDRIWLGSYDTAEEAARAYDAAVVCLRGSSSVLNFPDDPPDVISADGF  86

Query  182  SPAEIQGIAAS  214
            S ++IQ +AAS
Sbjct  87   SRSQIQ-VAAS  96



>gb|KEH21998.1| ethylene response factor [Medicago truncatula]
Length=94

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  5    KWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV  163
            KWVSEIRLPNSRERIWLGS++  EKAARAFD A YCLRGP A FNFP+ P  +
Sbjct  36   KWVSEIRLPNSRERIWLGSHDTQEKAARAFDAALYCLRGPHASFNFPNTPLTI  88



>ref|XP_009381715.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Musa acuminata subsp. malaccensis]
Length=186

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E R PNSRER+WLGS+  PE AARA+D A YCLRGP    NFPD PP++P    L
Sbjct  23   GKWVAEARYPNSRERLWLGSFATPEMAARAYDAAVYCLRGPGEALNFPDQPPNIPSADKL  82

Query  182  SPAEIQGIAASSGNDYRLKP  241
            S  EI+  A    ++   +P
Sbjct  83   SKYEIRAAAVRHAHEGAKRP  102



>ref|XP_002516234.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF46236.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=133

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDV-PGGRW  178
            GKWV+EIR PNSR RIWLGSYN  E+AARA+D A +CLRGP+   NFP +PPD+ P    
Sbjct  19   GKWVAEIRQPNSRGRIWLGSYNTAEEAARAYDAALFCLRGPSVTLNFPMNPPDINPAQTD  78

Query  179  LSPAEIQGIA  208
            LSP +I+ +A
Sbjct  79   LSPLQIREVA  88



>ref|XP_011039946.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Populus euphratica]
Length=154

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPG-GRW  178
            GKWV+EIR PNSR RIWLGSYN  E+AARA+D A  CLRGP+A FNFP + P++P     
Sbjct  24   GKWVAEIRQPNSRNRIWLGSYNTAEEAARAYDAAVLCLRGPSATFNFPSNVPEIPATTEI  83

Query  179  LSPAEIQGIA  208
            L PA+I+ +A
Sbjct  84   LPPAQIREVA  93



>ref|XP_006381588.1| hypothetical protein POPTR_0006s14110g [Populus trichocarpa]
 gb|ABQ62998.1| RAP2-like protein [Populus trichocarpa]
 gb|ERP59385.1| hypothetical protein POPTR_0006s14110g [Populus trichocarpa]
Length=154

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPG-GRW  178
            GKWV+EIR PNSR RIWLGSYN  E+AARA+D A  CLRGP+A FNFP + P++P     
Sbjct  24   GKWVAEIRQPNSRNRIWLGSYNTAEEAARAYDAAVLCLRGPSATFNFPSNVPEIPATTEI  83

Query  179  LSPAEIQGIA  208
            + PA+I+ +A
Sbjct  84   MPPAQIREVA  93



>gb|AFG62418.1| hypothetical protein UMN_5771_02, partial [Pinus taeda]
Length=94

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR+PNS  RIWLGSY+ PEKAARA+D A YCLRG TA+ NFP   P +    + 
Sbjct  33   GKWVSEIRIPNSSGRIWLGSYDTPEKAARAYDFAVYCLRGSTAKLNFPHSTPKISCASFQ  92

Query  182  SP  187
            SP
Sbjct  93   SP  94



>gb|ADE77618.1| unknown [Picea sitchensis]
Length=187

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 4/82 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WVSEIR+P +RE+IWLGSY   E+AARA+D A YCLRGP A+FNFPD    +P    L
Sbjct  5    GSWVSEIRMPKTREKIWLGSYKTAEQAARAYDAAVYCLRGPNAKFNFPDSVYSIPSVSSL  64

Query  182  SPAEIQGIAASSGNDYRLKPLP  247
            +  +IQ  AA     Y L  +P
Sbjct  65   TRQQIQVAAA----KYALGEIP  82



>ref|XP_009620960.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Nicotiana tomentosiformis]
Length=171

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 57/76 (75%), Gaps = 6/76 (8%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGG---  172
            GKWV+E+R P SRERIWLGSY+  E+AARA+D A  CLRGP+A  NFP++PP +P     
Sbjct  26   GKWVAEVRQPKSRERIWLGSYDTAEEAARAYDAAVVCLRGPSATINFPNNPPLIPSSAAN  85

Query  173  --RWLSPAEIQGIAAS  214
              + LSP++IQ +AAS
Sbjct  86   CDQQLSPSQIQ-VAAS  100



>gb|AFG43393.1| hypothetical protein, partial [Pinus taeda]
Length=102

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WVSEIR+P +RE+IWLGSY   E+AARA+D   YC+RGP A+FNFP+  P +P    L
Sbjct  35   GSWVSEIRIPKTREKIWLGSYKTAEQAARAYDAGIYCVRGPNAKFNFPNSVPAIPSASSL  94

Query  182  SPAEIQ  199
            S  +IQ
Sbjct  95   SRQQIQ  100



>ref|XP_002324813.1| hypothetical protein POPTR_0018s00700g [Populus trichocarpa]
 gb|ABQ62999.1| RAP2-like protein [Populus trichocarpa]
 gb|EEF03378.1| hypothetical protein POPTR_0018s00700g [Populus trichocarpa]
Length=155

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPG--GR  175
            GKWV+EIR PNSR+RIWLGSYN  E+AARA+D A  CLRGP+A F+FP + P++P    +
Sbjct  24   GKWVAEIRQPNSRDRIWLGSYNTAEEAARAYDAAVLCLRGPSATFHFPTNIPEIPAMTDQ  83

Query  176  WLSPAEIQGIAA  211
             LSP +I+ +A+
Sbjct  84   VLSPMQIREVAS  95



>gb|EPS73929.1| hypothetical protein M569_00830, partial [Genlisea aurea]
Length=103

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPG-GRW  178
            GKWV+E+R   SR+RIWLGSY   E+AARA+D A +CLRGP+A  NFPDDPP+  G    
Sbjct  24   GKWVAEVRQLQSRDRIWLGSYQTAEEAARAYDAAVFCLRGPSAVINFPDDPPEEIGSANE  83

Query  179  LSPAEIQGIAASSGN  223
            LSPA+I+ +AA+   
Sbjct  84   LSPAQIRVLAANHAR  98



>ref|XP_011016480.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Populus euphratica]
Length=155

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 2/72 (3%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGG--R  175
            GKWV+EIR  NSR+RIWLGSYN  E+AARA+D A  CLRGP+A FNFP + P++P    +
Sbjct  24   GKWVAEIRQRNSRDRIWLGSYNTAEEAARAYDAAVLCLRGPSATFNFPTNIPEIPASTDQ  83

Query  176  WLSPAEIQGIAA  211
             LSP +I+ +A+
Sbjct  84   VLSPMQIREVAS  95



>ref|XP_010236912.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Brachypodium distachyon]
Length=216

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 54/81 (67%), Gaps = 7/81 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG---PTARFNFPDDPPDVP--  166
            GKWVSEIRLPNSRER+WLGSY+AP+KAARAFD A  CLRG   P A  NFPD PP +   
Sbjct  34   GKWVSEIRLPNSRERVWLGSYDAPDKAARAFDAAFVCLRGAHAPGAELNFPDSPPPLTRR  93

Query  167  --GGRWLSPAEIQGIAASSGN  223
                  + P E+Q  A S  N
Sbjct  94   LDAAAAVDPQEVQAAALSHAN  114



>ref|XP_010095211.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25970.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB58672.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=188

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 3/72 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGGRW  178
            GKWVSEIR+P S ERIWLGSY+APEKAARA+D AQYC+RG    FNFP D  P +P G  
Sbjct  30   GKWVSEIRVPKSGERIWLGSYDAPEKAARAYDAAQYCIRGERGSFNFPADKRPVLPQGSM  89

Query  179  --LSPAEIQGIA  208
              LS  +IQ IA
Sbjct  90   VSLSKKDIQEIA  101



>gb|ABR16945.1| unknown [Picea sitchensis]
Length=216

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G WVSEIR+P +RE++WLGSY  PE+AARAFD A YCLRGP A+FNF    PD+P    L
Sbjct  34   GSWVSEIRIPRTREKLWLGSYTTPEQAARAFDAALYCLRGPNAKFNF--SVPDIPSASSL  91

Query  182  SPAEIQGIAA  211
            S  +IQ  A 
Sbjct  92   SRRQIQHAAV  101



>gb|KCW81927.1| hypothetical protein EUGRSUZ_C03297 [Eucalyptus grandis]
Length=190

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CL  P A+ NFP  PP++ G   L
Sbjct  33   GRWVSEIRLPNSRERIWLGSYDTPEKAARAFDAAAFCLGRPAAKLNFPGSPPEISGAASL  92

Query  182  SPAEIQGIAASSGN  223
            SP EIQ +AAS  N
Sbjct  93   SPDEIQSVAASYAN  106



>ref|XP_010051400.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Eucalyptus grandis]
Length=208

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            G+WVSEIRLPNSRERIWLGSY+ PEKAARAFD A +CL  P A+ NFP  PP++ G   L
Sbjct  33   GRWVSEIRLPNSRERIWLGSYDTPEKAARAFDAAAFCLGRPAAKLNFPGSPPEISGAASL  92

Query  182  SPAEIQGIAASSGN  223
            SP EIQ +AAS  N
Sbjct  93   SPDEIQSVAASYAN  106



>ref|XP_006367885.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Solanum tuberosum]
Length=160

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPG---G  172
            GKWV+E+R P SR+RIWLGSY+  E+AARA+D A  CLRG +A  NFPDDPP +      
Sbjct  26   GKWVAEVRQPKSRDRIWLGSYDTAEEAARAYDAAVVCLRGSSAMINFPDDPPVISCDGDH  85

Query  173  RWLSPAEIQGIAASSGNDYR  232
            + LSP+EIQ  A+      R
Sbjct  86   KLLSPSEIQVEASRHARSTR  105



>ref|XP_004243693.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Solanum lycopersicum]
Length=167

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPG---G  172
            GKWV+E+R P SR+RIWLGSY+  E+AARA+D A  CLRGP+A  NFPDDPP +      
Sbjct  26   GKWVAEVRQPKSRDRIWLGSYDTAEEAARAYDAAVVCLRGPSAMINFPDDPPLISCDADN  85

Query  173  RWLSPAEIQGIAA  211
              LSP+EIQ  A+
Sbjct  86   YKLSPSEIQVKAS  98



>ref|XP_004966650.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Setaria italica]
Length=203

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTAR--FNFPDDPPDVPGGR  175
            G+WVSEIRLP+SRERIWLGSY+ PEKAARAFD A  CLRGP      NFP  PPDV  GR
Sbjct  24   GRWVSEIRLPHSRERIWLGSYDTPEKAARAFDAAYLCLRGPAGVDGLNFPGSPPDV--GR  81

Query  176  WLSPAEIQGIAASSGN  223
               P E+   A S  +
Sbjct  82   TSDPNEVYAAAVSQAD  97



>ref|XP_010050434.1| PREDICTED: ethylene-responsive transcription factor RAP2-9-like 
[Eucalyptus grandis]
 gb|KCW79362.1| hypothetical protein EUGRSUZ_C00781 [Eucalyptus grandis]
Length=177

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVP  166
            GKWV+EIR PNSR+RIWLGSY   E+AARA+D A  CLRGPTA  NFPD PP++P
Sbjct  39   GKWVAEIRQPNSRDRIWLGSYATAEEAARAYDAAVLCLRGPTALLNFPDLPPEIP  93



>ref|XP_009791847.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Nicotiana sylvestris]
Length=171

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 56/77 (73%), Gaps = 7/77 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGR--  175
            GKWV+E+R P SR+RIWLGSY+  E+AARA+D A  CLRGP+A  NFP+DPP +P     
Sbjct  26   GKWVAEVRQPKSRDRIWLGSYDTAEEAARAYDAAVVCLRGPSATINFPNDPPLIPSSAPN  85

Query  176  ----WLSPAEIQGIAAS  214
                 LSP++IQ +AAS
Sbjct  86   CDQPQLSPSQIQ-VAAS  101



>ref|XP_006452852.1| hypothetical protein CICLE_v10009827mg [Citrus clementina]
 ref|XP_006452853.1| hypothetical protein CICLE_v10009827mg [Citrus clementina]
 ref|XP_006474696.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Citrus sinensis]
 gb|ESR66092.1| hypothetical protein CICLE_v10009827mg [Citrus clementina]
 gb|ESR66093.1| hypothetical protein CICLE_v10009827mg [Citrus clementina]
 gb|KDO73837.1| hypothetical protein CISIN_1g032258mg [Citrus sinensis]
Length=144

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+R PNSR RIWLGSY   ++AARA+D A  CLRG +A  NFPD+PP++P    +
Sbjct  24   GKWVAEVRQPNSRGRIWLGSYKTADEAARAYDAAVVCLRGSSATLNFPDNPPEIPLADEM  83

Query  182  SPAEIQGIA  208
            +P +IQ  A
Sbjct  84   TPVQIQEFA  92



>ref|XP_006851005.1| hypothetical protein AMTR_s00025p00218200 [Amborella trichopoda]
 gb|ERN12586.1| hypothetical protein AMTR_s00025p00218200 [Amborella trichopoda]
Length=179

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGGRW  178
            GKWVSEIR+P S+ RIWLGSY++PEKAARA+D A YCLRG    FNFP D  P++P    
Sbjct  27   GKWVSEIRMPKSQLRIWLGSYDSPEKAARAYDAALYCLRGSNCHFNFPGDKRPNLPLNFS  86

Query  179  LSPAEIQGIAASSGN  223
             S  +I+ IAA S +
Sbjct  87   PSILDIKAIAARSAS  101



>ref|XP_008680656.1| PREDICTED: dehydration-responsive element-binding protein 1G-like 
[Zea mays]
 gb|AFW64265.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
Length=234

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG---PTARFNFPDDPPDV-PG  169
            GKWVSEIRLPNSRERIWLGSY+AP+KAARAFD A  CLRG     A  NFPD PP    G
Sbjct  28   GKWVSEIRLPNSRERIWLGSYDAPDKAARAFDAAFVCLRGRGAAGADLNFPDSPPPCRAG  87

Query  170  GRWLSPAEIQGIAASSGN  223
            G    P E+Q  A S  N
Sbjct  88   GCSSDPREVQAAALSHAN  105



>ref|XP_010525826.1| PREDICTED: ethylene-responsive transcription factor ERF015 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525827.1| PREDICTED: ethylene-responsive transcription factor ERF015 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525830.1| PREDICTED: ethylene-responsive transcription factor ERF015 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525831.1| PREDICTED: ethylene-responsive transcription factor ERF015 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525832.1| PREDICTED: ethylene-responsive transcription factor ERF015 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525833.1| PREDICTED: ethylene-responsive transcription factor ERF015 isoform 
X1 [Tarenaya hassleriana]
Length=207

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 55/80 (69%), Gaps = 4/80 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGGRW  178
            GKWVSEIR+P + +RIWLGSY+APEKAARA+D A YC+RG    FNFP D  P +P G  
Sbjct  39   GKWVSEIRVPRTGKRIWLGSYDAPEKAARAYDAALYCIRGERGVFNFPTDKKPQLPEGSS  98

Query  179  LSP---AEIQGIAASSGNDY  229
            + P    +IQ IA S  + +
Sbjct  99   VQPLSRKDIQAIATSHASSH  118



>ref|XP_002308137.2| hypothetical protein POPTR_0006s08000g [Populus trichocarpa]
 gb|EEE91660.2| hypothetical protein POPTR_0006s08000g [Populus trichocarpa]
Length=178

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P + +RIWLGSY+APEKAARA+D AQYC+RG   +FNFP +  P +P G  
Sbjct  31   GKWVSEIRVPKTGQRIWLGSYDAPEKAARAYDAAQYCIRGERGQFNFPAERRPQLPSGPV  90

Query  173  RWLSPAEIQGIA  208
              LS  EI+ IA
Sbjct  91   DALSKKEIKAIA  102



>ref|XP_004966651.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Setaria italica]
Length=199

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 50/76 (66%), Gaps = 3/76 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTAR--FNFPDDPPDVPGGR  175
            G+W SEIRLPNSRERIWLGSY+ PEKAARAFD A  CLRGP      NFP  PP V  G 
Sbjct  32   GRWASEIRLPNSRERIWLGSYDTPEKAARAFDGAAVCLRGPGGADGLNFPGSPPAV-AGL  90

Query  176  WLSPAEIQGIAASSGN  223
               P E++  A S  N
Sbjct  91   TTDPEEVRAAAMSHAN  106



>ref|XP_010910750.1| PREDICTED: ethylene-responsive transcription factor ERF015, partial 
[Elaeis guineensis]
Length=186

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDD  151
            G+WVSEIR+P SR RIWLGSY+ PEKAARA+D A YCLRG  ARFNFP+D
Sbjct  46   GRWVSEIRVPKSRTRIWLGSYSTPEKAARAYDAAVYCLRGDQARFNFPED  95



>gb|ABK22932.1| unknown [Picea sitchensis]
Length=177

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR+P    RIWLGSY+ PEKAARA+D A +CLRG  A+ NFP   P +P    L
Sbjct  33   GKWVSEIRMPYCTGRIWLGSYDTPEKAARAYDFAAFCLRGSKAKLNFPLFTPKIPCASSL  92

Query  182  SPAEIQ  199
            SP +IQ
Sbjct  93   SPQQIQ  98



>ref|XP_008801457.1| PREDICTED: ethylene-responsive transcription factor ERF015 [Phoenix 
dactylifera]
Length=206

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 3/72 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPP-DVPGGRW  178
            G+WVSEIR+P SR RIWLGSY+ PEKAARA+D A YCLRG  ARFNFP+D    +P  + 
Sbjct  56   GRWVSEIRVPKSRTRIWLGSYSTPEKAARAYDAAVYCLRGDQARFNFPEDRGFHIPEEQR  115

Query  179  LSPA--EIQGIA  208
            L+ A  E++ IA
Sbjct  116  LALAAREVKAIA  127



>ref|XP_010531255.1| PREDICTED: ethylene-responsive transcription factor RAP2-10-like 
[Tarenaya hassleriana]
Length=171

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPD----DPPDVPG  169
            GKWV+EIR PN R RIWLGSY+ PE AARA+D A + LRGPTAR NFP+    D   V G
Sbjct  22   GKWVAEIREPNKRSRIWLGSYSTPEAAARAYDTAVFYLRGPTARLNFPEFLAGDVATVTG  81

Query  170  GRWLSPAEIQGIAASSG  220
            G  +S A I+  AA  G
Sbjct  82   GEDMSAAYIRRKAAEVG  98



>ref|XP_010937367.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Elaeis guineensis]
Length=310

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV E+RLP SR+++WLGSY   EKAARA+D A YCL+GP A  NFP+  PD+P    L
Sbjct  157  GKWVVEVRLPRSRKKLWLGSYADAEKAARAYDAAVYCLKGPDAVLNFPERRPDIPSASNL  216

Query  182  SPAEIQGIAASSGND  226
            S  EI+  A +  +D
Sbjct  217  SLPEIRAAAMAHAHD  231



>ref|XP_009392013.1| PREDICTED: ethylene-responsive transcription factor ERF016-like 
[Musa acuminata subsp. malaccensis]
Length=175

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 90/191 (47%), Gaps = 53/191 (28%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIRLPNSR+RIWLGSY++PEKAARAFD A  CLRGP AR NFPD PP     + L
Sbjct  25   GKWVSEIRLPNSRDRIWLGSYDSPEKAARAFDAAAVCLRGPRARLNFPDSPPPC-ATQPL  83

Query  182  SPAEIQGIAASSG----NDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGG  349
            SP +IQ  AA       +  RL P                             T+   G 
Sbjct  84   SPQQIQAAAARHAATPPSQPRLAP-----------------------------TAGEAGS  114

Query  350  GAQLEGIDWSFLDNLDA---------PFTSNDYFGLFHGDVYVPPNDYEIEYGDDGESIG  502
            G QL   DWSF+D   A         P   +DY   F      PP D   ++G       
Sbjct  115  GEQL---DWSFMDPQQAAASEEGTEFPAAMDDYMYDFFSP--APPADVVEDHG-----AV  164

Query  503  HFSQQSFLWNF  535
             F   SFLW+F
Sbjct  165  DFGSNSFLWSF  175



>ref|XP_009405172.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Musa acuminata subsp. malaccensis]
Length=231

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E R PNSRER+WLGS+ +PE AA A+D A YCLRGP    NFPD PP++P    L
Sbjct  92   GKWVAEARYPNSRERLWLGSFPSPEMAAMAYDAAVYCLRGPGEALNFPDHPPNIPSADRL  151

Query  182  SPAEIQGIAASSGND  226
            S  EI+  A     +
Sbjct  152  SRYEIRQAAVGHAEE  166



>ref|XP_004288858.1| PREDICTED: ethylene-responsive transcription factor ERF015-like 
[Fragaria vesca subsp. vesca]
Length=182

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 56/85 (66%), Gaps = 3/85 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGGRW  178
            GKWVSEIR+P S  RIWLGSY+APEKAARA+D A YC+ G   RFNFP D  P +P G  
Sbjct  30   GKWVSEIRVPKSGGRIWLGSYDAPEKAARAYDAALYCIYGECGRFNFPGDRRPVLPAGSA  89

Query  179  --LSPAEIQGIAASSGNDYRLKPLP  247
              LS  +IQ IA +  + Y    LP
Sbjct  90   VSLSKFDIQQIAMNFASSYVPVSLP  114



>ref|XP_010937368.1| PREDICTED: ethylene-responsive transcription factor RAP2-1-like 
[Elaeis guineensis]
Length=180

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLP SR+++WLGSY   EKAARA+D A  CL+GP A  NFP+  PD+P    L
Sbjct  32   GKWVAEVRLPRSRKKLWLGSYADAEKAARAYDAALCCLKGPNAVLNFPERRPDIPSASNL  91

Query  182  SPAEIQGIAASSGND  226
            S  EI+  A +  +D
Sbjct  92   SLLEIRAAAMAHAHD  106



>ref|XP_009108952.1| PREDICTED: ethylene-responsive transcription factor ERF015-like 
[Brassica rapa]
Length=176

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDD-PPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C++G    FNFP+D  P +P G  
Sbjct  33   GKWVSEIRVPRTGRRIWLGSYDAPEKAARAYDSALFCIKGEKGAFNFPNDKKPQLPEGSV  92

Query  173  RWLSPAEIQGIAASSGNDYRL  235
            R LS  +IQ IA     DY L
Sbjct  93   RPLSKHDIQTIA----TDYAL  109



>gb|EEC80171.1| hypothetical protein OsI_22020 [Oryza sativa Indica Group]
Length=150

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG--PTARFNFPDDPPDVPGGR  175
            GKWV+EIRLPNS +RIWLGSY++PEKAARAFD A  CLRG    A  NFP+ PP V   R
Sbjct  57   GKWVAEIRLPNSLKRIWLGSYDSPEKAARAFDAAFICLRGGEAIAGLNFPESPPTVV-AR  115

Query  176  WLSPAEIQGIAASSGN  223
               P E+   A S  N
Sbjct  116  TSDPREVLAYATSHAN  131



>ref|XP_006412635.1| hypothetical protein EUTSA_v10026328mg [Eutrema salsugineum]
 gb|ESQ54088.1| hypothetical protein EUTSA_v10026328mg [Eutrema salsugineum]
Length=187

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C+RG    FNFP D  P +P G  
Sbjct  36   GKWVSEIRVPRTGRRIWLGSYDAPEKAARAYDAALFCIRGERGVFNFPSDKKPQLPEGSV  95

Query  173  RWLSPAEIQGIAAS  214
            R LS  +IQ IA +
Sbjct  96   RPLSKHDIQTIATN  109



>ref|XP_008786978.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Phoenix dactylifera]
Length=185

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWV+E+RLP SR+++WLGSY   E+AARA D   YCL+GP A  NFPD PP++     L
Sbjct  33   GKWVAEVRLPRSRKKLWLGSYATAEEAARACDAVMYCLKGPGAALNFPDHPPNISSADKL  92

Query  182  SPAEIQGIAASSGND  226
            S  EI+  A     D
Sbjct  93   SRPEIKAAARKHARD  107



>ref|XP_006284912.1| hypothetical protein CARUB_v10006208mg [Capsella rubella]
 gb|EOA17810.1| hypothetical protein CARUB_v10006208mg [Capsella rubella]
Length=187

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P + +RIWLGSY+APEKAARA+D A +C+RG    FNFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGKRIWLGSYDAPEKAARAYDAALFCIRGEKGVFNFPTDKKPQLPEGSV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  +IQ I+ 
Sbjct  96   RPLSKHDIQTIST  108



>ref|NP_567867.1| ethylene-responsive transcription factor ERF015 [Arabidopsis 
thaliana]
 sp|Q6NLD5.1|ERF15_ARATH RecName: Full=Ethylene-responsive transcription factor ERF015 
[Arabidopsis thaliana]
 gb|AAS65945.1| At4g31060 [Arabidopsis thaliana]
 gb|AAS88789.1| At4g31060 [Arabidopsis thaliana]
 dbj|BAH30550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85852.1| ethylene-responsive transcription factor ERF015 [Arabidopsis 
thaliana]
Length=187

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C+RG    +NFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGRRIWLGSYDAPEKAARAYDAALFCIRGEKGVYNFPTDKKPQLPEGSV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  +IQ IA 
Sbjct  96   RPLSKLDIQTIAT  108



>emb|CAA18187.1| putative protein [Arabidopsis thaliana]
 emb|CAB79824.1| putative protein [Arabidopsis thaliana]
Length=259

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C+RG    +NFP D  P +P G  
Sbjct  108  GKWVSEIRVPKTGRRIWLGSYDAPEKAARAYDAALFCIRGEKGVYNFPTDKKPQLPEGSV  167

Query  173  RWLSPAEIQGIAAS  214
            R LS  +IQ IA +
Sbjct  168  RPLSKLDIQTIATN  181



>gb|AAT44951.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=187

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C+RG    +NFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGRRIWLGSYDAPEKAARAYDAALFCIRGEKGVYNFPTDKKPQLPEGSV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  +IQ IA 
Sbjct  96   RPLSKLDIQTIAT  108



>dbj|BAD36632.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
Length=124

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 51/76 (67%), Gaps = 3/76 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG--PTARFNFPDDPPDVPGGR  175
            GKWV+EIRLPNS +RIWLGSY++PEKAARAFD A  CLRG    A  NFP+ PP V   R
Sbjct  31   GKWVAEIRLPNSLKRIWLGSYDSPEKAARAFDAAFICLRGGEAIAGLNFPESPPTVV-AR  89

Query  176  WLSPAEIQGIAASSGN  223
               P E+   A S  N
Sbjct  90   TSDPREVLAYATSHAN  105



>ref|XP_002869347.1| hypothetical protein ARALYDRAFT_913363 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45606.1| hypothetical protein ARALYDRAFT_913363 [Arabidopsis lyrata subsp. 
lyrata]
Length=187

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C+RG    +NFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGRRIWLGSYDAPEKAARAYDAALFCIRGEKGVYNFPTDKKPQLPEGSV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  +IQ IA 
Sbjct  96   RPLSKLDIQTIAT  108



>emb|CDY23275.1| BnaA08g12710D [Brassica napus]
Length=242

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 7/81 (9%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDD-PPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+APEKAARA+D A +C++G    FNFP+D  P +P G  
Sbjct  99   GKWVSEIRVPRTGRRIWLGSYDAPEKAARAYDSALFCIKGEKGAFNFPNDKKPQLPEGSV  158

Query  173  RWLSPAEIQGIAASSGNDYRL  235
            R LS  +IQ IA     DY L
Sbjct  159  RPLSKHDIQTIA----TDYAL  175



>ref|XP_002991098.1| hypothetical protein SELMODRAFT_71661, partial [Selaginella moellendorffii]
 gb|EFJ07906.1| hypothetical protein SELMODRAFT_71661, partial [Selaginella moellendorffii]
Length=153

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR P  + RIWLGS+  PE AARA DVA  CLRG  A  NFPD    +P    L
Sbjct  14   GKWVSEIREPKKKNRIWLGSFPTPEMAARAHDVAALCLRGEDAHLNFPDSVHTLPRPERL  73

Query  182  SPAEIQGIAASSGNDYRLKPLP  247
            SP  IQ  A S+   ++ + LP
Sbjct  74   SPKCIQEAATSAAMSFQDRLLP  95



>gb|EAY87759.1| hypothetical protein OsI_09177 [Oryza sativa Indica Group]
Length=197

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG---PTARFNFPDDPPDVPGG  172
            GKWVSEIRLPNSR+RIWLGSY++PEKAARAFD A   LRG     A  NFPD PP     
Sbjct  14   GKWVSEIRLPNSRDRIWLGSYDSPEKAARAFDAAFVTLRGHGAAGADLNFPDSPPSC-DA  72

Query  173  RWLSPAEIQGIAASSGNDYRLKP  241
            R   P ++Q  A S  N   + P
Sbjct  73   RSSDPRQVQAAALSHANRAHVTP  95



>ref|XP_010445038.1| PREDICTED: ethylene-responsive transcription factor ERF015 [Camelina 
sativa]
Length=187

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P + +RIWLGSY+APEKAARA+D A +C++G    FNFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGKRIWLGSYDAPEKAARAYDAALFCIKGEKGVFNFPTDKKPQLPEGYV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  +IQ I+ 
Sbjct  96   RPLSKHDIQTIST  108



>dbj|BAD19440.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
Length=210

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG---PTARFNFPDDPPDVPGG  172
            GKWVSEIRLPNSR+RIWLGSY++PEKAARAFD A   LRG     A  NFPD PP     
Sbjct  27   GKWVSEIRLPNSRDRIWLGSYDSPEKAARAFDAAFVTLRGHGAAGADLNFPDSPPSC-DA  85

Query  173  RWLSPAEIQGIAASSGNDYRLKP  241
            R   P ++Q  A S  N   + P
Sbjct  86   RSSDPRQVQAAALSHANRAHVTP  108



>ref|XP_010436316.1| PREDICTED: ethylene-responsive transcription factor ERF015-like 
[Camelina sativa]
Length=187

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P + +RIWLGSY+APE AARA+D A +C++G    FNFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGKRIWLGSYDAPEMAARAYDAALFCIKGEKGVFNFPTDKKPQLPEGYV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  EIQ I+ 
Sbjct  96   RPLSKQEIQTIST  108



>ref|XP_002991657.1| hypothetical protein SELMODRAFT_71659, partial [Selaginella moellendorffii]
 gb|EFJ07228.1| hypothetical protein SELMODRAFT_71659, partial [Selaginella moellendorffii]
Length=161

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR P  + RIWLGS+  PE AARA DVA  CLRG  A  NFPD    +P    L
Sbjct  14   GKWVSEIREPKKKNRIWLGSFPTPEMAARAHDVAALCLRGEDAHLNFPDSVHTLPRPERL  73

Query  182  SPAEIQGIAASSGNDYRLKPLP  247
            SP  IQ  A S+   ++ + LP
Sbjct  74   SPKCIQEAATSAAMSFQDRLLP  95



>dbj|BAD36633.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
Length=209

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG--PTARFNFPDDPPDVPGGR  175
            GKWV+EIRLPNSR+RIWLGSY  PEKAARAFD A  CLRG    A  NF + PP V   R
Sbjct  25   GKWVAEIRLPNSRKRIWLGSYYTPEKAARAFDAAFICLRGGEAIAGLNFTESPPAVV-AR  83

Query  176  WLSPAEIQGIAASSGNDYRL  235
               P E+   A S  N   L
Sbjct  84   TTDPREVLAFATSHANLLSL  103



>ref|XP_009399647.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Musa acuminata subsp. malaccensis]
Length=191

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 91/192 (47%), Gaps = 38/192 (20%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDD-PPDVPGGRW  178
            G+WVSEIRLPNSRERIWLGSY +PEKAARAFD A  CLRG  AR NFPD  PP + GG W
Sbjct  24   GRWVSEIRLPNSRERIWLGSYESPEKAARAFDAAAVCLRGRRARLNFPDSPPPQITGGAW  83

Query  179  LSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGGAQ  358
                  Q I A++       P P      V                 D+  +S+P     
Sbjct  84   R--LTHQQIQAAAARHAAAAPGPTQPPTPV-----------------DSPAASSPASDGF  124

Query  359  LEG----IDWSFLD-NLDAPFTS--------NDYFGLFHGDVYVPPNDYEIEYGDDGESI  499
              G    +DWSF+D  L AP T         +D+   F   V   P D   ++G      
Sbjct  125  TAGSDDALDWSFMDPQLVAPLTVDGDFPAPFDDFMYDFSSSVPATPLDVADDHGG-----  179

Query  500  GHFSQQSFLWNF  535
              F   SFLW+F
Sbjct  180  VDFGSNSFLWSF  191



>gb|EEC80179.1| hypothetical protein OsI_22034 [Oryza sativa Indica Group]
 gb|EEE65255.1| hypothetical protein OsJ_20453 [Oryza sativa Japonica Group]
Length=191

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRG--PTARFNFPDDPPDVPGGR  175
            GKWV+EIRLPNSR+RIWLGSY  PEKAARAFD A  CLRG    A  NF + PP V   R
Sbjct  25   GKWVAEIRLPNSRKRIWLGSYYTPEKAARAFDAAFICLRGGEAIAGLNFTESPPAV-VAR  83

Query  176  WLSPAEIQGIAASSGNDYRL  235
               P E+   A S  N   L
Sbjct  84   TTDPREVLAFATSHANLLSL  103



>ref|XP_001772779.1| predicted protein [Physcomitrella patens]
 gb|EDQ62346.1| predicted protein [Physcomitrella patens]
Length=82

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 50/74 (68%), Gaps = 3/74 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPP-DVPGGRW  178
            GKWVSEIR P  R RIWLGS+   E AARA+D A  CLRGP+A  NFPD PP  +P    
Sbjct  11   GKWVSEIREPRKRSRIWLGSFPTAEMAARAYDAAVVCLRGPSAALNFPDSPPLSLPECH-  69

Query  179  LSPAEIQGIAASSG  220
             +P EIQ +AA++ 
Sbjct  70   -TPREIQVVAAAAA  82



>ref|XP_004966648.1| PREDICTED: ethylene-responsive transcription factor ERF013-like 
[Setaria italica]
Length=226

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTAR--FNFPDDPPDV  163
            G+WVSEIR+PNSR+RIWLGS++ PEKAARAFD A  CLRGP A    NFP  PPDV
Sbjct  35   GRWVSEIRVPNSRDRIWLGSFDTPEKAARAFDAALVCLRGPGAVHGLNFPGSPPDV  90



>ref|XP_004966649.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Setaria italica]
Length=192

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 41/56 (73%), Gaps = 2/56 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTAR--FNFPDDPPDV  163
            G WVSE+RLPNSRERIWLGSY  PEKAARAFD A  CLRGP      NFP  PP V
Sbjct  29   GSWVSEVRLPNSRERIWLGSYYTPEKAARAFDAASLCLRGPGGADGLNFPSSPPAV  84



>ref|XP_001785538.1| predicted protein [Physcomitrella patens]
 gb|EDQ49648.1| predicted protein [Physcomitrella patens]
Length=67

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD  160
            GKWVSEIR PN R RIWLGS+   E AARA+D+A  CLRGP+A  NFPD PP 
Sbjct  10   GKWVSEIREPNKRSRIWLGSFPTAEMAARAYDIAMVCLRGPSAVLNFPDSPPQ  62



>ref|XP_009127267.1| PREDICTED: ethylene-responsive transcription factor ERF015 [Brassica 
rapa]
Length=182

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P +  RIWLGSY+ PEKAARA+D A +C+RG    FNFP  + P +P G  
Sbjct  35   GKWVSEIRVPRTARRIWLGSYDDPEKAARAYDAALFCIRGEKGVFNFPTSEKPQLPEGSV  94

Query  173  RWLSPAEIQGIAASSGN  223
            R LS  +IQ IA +  +
Sbjct  95   RPLSKLDIQTIATNHAS  111



>ref|XP_004494833.1| PREDICTED: ethylene-responsive transcription factor ERF023-like 
[Cicer arietinum]
Length=170

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRWL  181
            GKWVSEIR P  + RIWLGS++ PE AARA+DVA YCL+G  A+ NFPD+   +P     
Sbjct  37   GKWVSEIREPKKKSRIWLGSFSVPEMAARAYDVAAYCLKGRKAQLNFPDEVEQLPLPATC  96

Query  182  SPAEIQGIAASSGNDYRLKP  241
            +  +IQ  A+ + +  +  P
Sbjct  97   TARDIQAAASKAASMVKASP  116



>ref|XP_011020355.1| PREDICTED: ethylene-responsive transcription factor ERF015-like 
[Populus euphratica]
Length=139

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 51/72 (71%), Gaps = 3/72 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P + +RIWLGSY+APEKAARA D  QYC+RG   +FNFP +  P +P G  
Sbjct  60   GKWVSEIRVPKTGQRIWLGSYDAPEKAARACDAIQYCIRGECGQFNFPAERRPQLPSGPV  119

Query  173  RWLSPAEIQGIA  208
              L   EI+ IA
Sbjct  120  DALFKKEIKAIA  131



>ref|XP_010451100.1| PREDICTED: ethylene-responsive transcription factor ERF015-like 
[Camelina sativa]
Length=187

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP-DDPPDVPGG--  172
            GKWVSEIR+P + +RIWLGSY+ PEKAARA+D A +C++G    FNFP D  P +P G  
Sbjct  36   GKWVSEIRVPKTGKRIWLGSYDEPEKAARAYDAALFCIKGEKGVFNFPTDKKPQLPEGYV  95

Query  173  RWLSPAEIQGIAA  211
            R LS  +IQ I+ 
Sbjct  96   RPLSKHDIQTIST  108



>ref|XP_001753243.1| predicted protein [Physcomitrella patens]
 gb|EDQ81872.1| predicted protein [Physcomitrella patens]
Length=89

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 49/73 (67%), Gaps = 3/73 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD-VPGGRW  178
            GKWVSEIR PN R RIWLGS+   E AARA+D A  CLRGP A  NFPD PP  +P    
Sbjct  19   GKWVSEIREPNKRSRIWLGSFPTAEMAARAYDAAVVCLRGPHAALNFPDSPPQSLPECH-  77

Query  179  LSPAEIQGIAASS  217
             SP +IQ  AA++
Sbjct  78   -SPKDIQVAAAAA  89



>ref|XP_006404817.1| hypothetical protein EUTSA_v10000354mg [Eutrema salsugineum]
 gb|ESQ46270.1| hypothetical protein EUTSA_v10000354mg [Eutrema salsugineum]
Length=168

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPD  148
            GKWV+EIR PN R RIWLGSY+ PE AARA+D A  CLRGP+AR NFP+
Sbjct  37   GKWVAEIREPNKRSRIWLGSYSTPEAAARAYDTAVLCLRGPSARLNFPE  85



>dbj|BAD35230.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD35234.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD36630.1| AP2 domain transcription factor-like [Oryza sativa Japonica Group]
 gb|EAZ00018.1| hypothetical protein OsI_22018 [Oryza sativa Indica Group]
Length=207

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 50/79 (63%), Gaps = 6/79 (8%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTAR----FNFPDDPPDVPG  169
            GKWVSEIRLPNSRERIWLGSY+ PE+AARAFD A  CLRG         NFP  PP V  
Sbjct  21   GKWVSEIRLPNSRERIWLGSYDTPEEAARAFDAAFVCLRGGGEAAGNGINFPGSPPAV--  78

Query  170  GRWLSPAEIQGIAASSGND  226
             R   P E+   A S  N+
Sbjct  79   ARTSDPQEVYAAAVSHANN  97



>ref|XP_009110164.1| PREDICTED: ethylene-responsive transcription factor ERF012-like 
[Brassica rapa]
 emb|CDY69265.1| BnaAnng29870D [Brassica napus]
Length=210

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 48/78 (62%), Gaps = 3/78 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD---VPGG  172
            G WVSEIR PN + RIWLGSY+  E AARA+DVA  CL+GP A  NFP        +   
Sbjct  41   GSWVSEIRAPNKKTRIWLGSYSTAEAAARAYDVALLCLKGPQANLNFPSSASSHLLLDEK  100

Query  173  RWLSPAEIQGIAASSGND  226
              LSP  IQ IAA + N+
Sbjct  101  THLSPKSIQKIAAQAANN  118



>gb|EPS69379.1| hypothetical protein M569_05389, partial [Genlisea aurea]
Length=116

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 51/75 (68%), Gaps = 5/75 (7%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPDVPGGRW-  178
            GKWV+EIR PN R RIWLGSY+ P  AARA+D A Y LRGPTA+ NFP+   ++  GR  
Sbjct  29   GKWVAEIREPNKRSRIWLGSYSTPVAAARAYDTAVYYLRGPTAKLNFPE---EISEGRLK  85

Query  179  -LSPAEIQGIAASSG  220
             LSP  I+  AA  G
Sbjct  86   DLSPGAIREKAAEVG  100



>ref|XP_009385648.1| PREDICTED: ethylene-responsive transcription factor ERF017-like 
[Musa acuminata subsp. malaccensis]
Length=189

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPP  157
            G+WVSEIRLPNSRERIWLGSY+ PEKAARAFD A   LRG  A+ N PD PP
Sbjct  23   GRWVSEIRLPNSRERIWLGSYDTPEKAARAFDAALVYLRGRRAQLNCPDAPP  74



>ref|XP_008666566.1| PREDICTED: ethylene-responsive transcription factor ERF018-like 
[Zea mays]
 tpg|DAA48811.1| TPA: putative AP2/EREBP transcription factor superfamily protein 
[Zea mays]
Length=230

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 82/165 (50%), Gaps = 6/165 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTA-RFNFPDDPPD---VPG  169
            G+WVSEIR+PNSRER+WLGSY + EKAARAFD A  CLRG  A   NFP+ PP+   VPG
Sbjct  34   GRWVSEIRMPNSRERVWLGSYESAEKAARAFDAAAVCLRGSRAGSLNFPESPPNVRYVPG  93

Query  170  GRWLSPAEIQGIAASSGNDYR-LKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG  346
               L+P +IQ  AA   N     +P+                     + +  T  SS   
Sbjct  94   A-LLTPEQIQAEAARHANQQLPSRPVASALQPAAAPPAGGPSSDRTTLSMPSTDYSSGAA  152

Query  347  GGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYG  481
                 E +DWSF+D L     ++   G+ +    VP    +  YG
Sbjct  153  VCGDDEALDWSFMDALPPMPPASSSVGMGNSAHTVPAAMDDFMYG  197



>ref|XP_001763400.1| predicted protein [Physcomitrella patens]
 gb|EDQ71930.1| predicted protein [Physcomitrella patens]
Length=248

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPP  157
            GKWVSEIR PN R RIWLGS+   E AARA+D A  CLRGPTA  NFPD PP
Sbjct  47   GKWVSEIREPNKRSRIWLGSFPTAEMAARAYDAALVCLRGPTASLNFPDSPP  98



>ref|NP_173609.1| ethylene-responsive transcription factor ERF012 [Arabidopsis 
thaliana]
 sp|Q9SFE4.1|ERF12_ARATH RecName: Full=Ethylene-responsive transcription factor ERF012 
[Arabidopsis thaliana]
 gb|AAF16532.1|AC013482_6 T26F17.14 [Arabidopsis thaliana]
 dbj|BAD44442.1| TINY like protein [Arabidopsis thaliana]
 gb|ABD43014.1| At1g21910 [Arabidopsis thaliana]
 gb|AEE30171.1| ethylene-responsive transcription factor ERF012 [Arabidopsis 
thaliana]
Length=230

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 48/83 (58%), Gaps = 7/83 (8%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD-------  160
            G WVSEIR PN + RIWLGSY+  E AARA+DVA  CL+GP A  NFP            
Sbjct  59   GSWVSEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQANLNFPTSSSSHHLLDNL  118

Query  161  VPGGRWLSPAEIQGIAASSGNDY  229
            +     LSP  IQ +AA + N +
Sbjct  119  LDENTLLSPKSIQRVAAQAANSF  141



>ref|XP_006303331.1| hypothetical protein CARUB_v10010179mg [Capsella rubella]
 gb|EOA36229.1| hypothetical protein CARUB_v10010179mg [Capsella rubella]
Length=233

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP--------DDPP  157
            G WVSEIR PN + RIWLGSY+  E AARA+DVA  CL+GP A  NFP        DD  
Sbjct  56   GSWVSEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQANLNFPTSSSHHLLDDIL  115

Query  158  DVPGGRWLSPAEIQGIAASSGNDYRL  235
            D      +SP  IQ +AA + N + L
Sbjct  116  D--EKTLMSPKSIQRVAAQAANSFDL  139



>gb|AIB05873.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=230

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 82/165 (50%), Gaps = 6/165 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTA-RFNFPDDPPD---VPG  169
            G+WVSEIR+PNSRER+WLGSY + EKAARAFD A  CLRG  A   NFP+ PP+   VPG
Sbjct  34   GRWVSEIRMPNSRERVWLGSYESAEKAARAFDAAAVCLRGSRAGSLNFPESPPNVRYVPG  93

Query  170  GRWLSPAEIQGIAASSGNDYR-LKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPG  346
               L+P +IQ  AA   N     +P+                     + +  T  SS   
Sbjct  94   A-LLTPEQIQAEAARHANQQLPSRPVASALQPAAAPPAGGPSSDRTTLSMPSTDYSSGAA  152

Query  347  GGAQLEGIDWSFLDNLDAPFTSNDYFGLFHGDVYVPPNDYEIEYG  481
                 E +DWSF+D L     ++   G+ +    VP    +  YG
Sbjct  153  VCGDDEALDWSFMDALPPMPPASSSVGMGNSAHTVPAAMDDFMYG  197



>gb|AAM63137.1| TINY-like protein [Arabidopsis thaliana]
Length=231

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 48/83 (58%), Gaps = 7/83 (8%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFPDDPPD-------  160
            G WVSEIR PN + RIWLGSY+  E AARA+DVA  CL+GP A  NFP            
Sbjct  60   GSWVSEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQANLNFPTSSSSHHLLDNL  119

Query  161  VPGGRWLSPAEIQGIAASSGNDY  229
            +     LSP  IQ +AA + N +
Sbjct  120  LDENTLLSPKSIQRVAAQAANSF  142



>gb|EMT28518.1| Ethylene-responsive transcription factor ERF018 [Aegilops tauschii]
Length=223

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 75/134 (56%), Gaps = 5/134 (4%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTA-RFNFPDDPPDVPG--G  172
            G+WVSEIR+PNSRERIWLGS+ + EKAARAFD A  CLRG  A   NFP+ PPDV    G
Sbjct  36   GRWVSEIRMPNSRERIWLGSHQSAEKAARAFDAAAVCLRGSRAGALNFPEFPPDVQHVPG  95

Query  173  RWLSPAEIQGIAASSGNDYRLKPLPENdgdgvrgtgtddddttHVVEINDTSTSSAPGGG  352
               +PA IQ  A    N  R  P+P      V       + T+    I   S+ SA    
Sbjct  96   IVPTPARIQAAATRHAN--RPYPIPAGRAMTVTTAMPSQEVTSTCNAIAVKSSPSAGNAA  153

Query  353  AQLEGIDWSFLDNL  394
            A  + +DWSF+D L
Sbjct  154  AYDDVLDWSFMDAL  167



>ref|XP_010477440.1| PREDICTED: ethylene-responsive transcription factor ERF012-like 
[Camelina sativa]
Length=234

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 51/86 (59%), Gaps = 10/86 (12%)
 Frame = +2

Query  2    GKWVSEIRLPNSRERIWLGSYNAPEKAARAFDVAQYCLRGPTARFNFP--------DDPP  157
            G WVSEIR PN + RIWLGSY+  E AARA+DVA  CL+GP A  NFP        DD  
Sbjct  60   GSWVSEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQANLNFPTSSSHHLLDDIL  119

Query  158  DVPGGRWLSPAEIQGIAASSGNDYRL  235
            D      +SP  IQ +AA + N + L
Sbjct  120  D--EKTLMSPKSIQRVAAQAANSFDL  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1774205954430