BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7886_g1_i1 len=1413 path=[25:0-80 105:81-431 456:432-455
3599:456-1412]

Length=1413
                                                                      Score     E

ref|XP_007040122.1|  Integrase-type DNA-binding superfamily protein     161   1e-42   
ref|XP_006477389.1|  PREDICTED: ethylene-responsive transcription...    161   2e-42   
gb|KDO63569.1|  hypothetical protein CISIN_1g030591mg                   157   2e-41   
ref|XP_006440530.1|  hypothetical protein CICLE_v10023840mg             158   2e-41   
ref|XP_011033804.1|  PREDICTED: ethylene-responsive transcription...    152   7e-40   
ref|XP_010278525.1|  PREDICTED: ethylene-responsive transcription...    149   2e-38   
ref|XP_010662529.1|  PREDICTED: ethylene-responsive transcription...    150   2e-38   
ref|XP_002276184.1|  PREDICTED: ethylene-responsive transcription...    148   3e-38   Vitis vinifera
ref|XP_002304466.1|  AP2 domain-containing family protein               148   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006301753.1|  hypothetical protein CARUB_v10022214mg             147   4e-37   
ref|XP_011081034.1|  PREDICTED: ethylene-responsive transcription...    147   5e-37   
ref|XP_010255544.1|  PREDICTED: ethylene-responsive transcription...    145   1e-36   
gb|EYU38993.1|  hypothetical protein MIMGU_mgv1a019138mg                146   2e-36   
gb|AID51420.1|  ethylene response factor 15                             143   2e-36   
ref|XP_007038584.1|  Integrase-type DNA-binding superfamily prote...    146   2e-36   
ref|XP_004298779.1|  PREDICTED: ethylene-responsive transcription...    145   3e-36   
ref|XP_011014148.1|  PREDICTED: ethylene-responsive transcription...    142   4e-36   
gb|KFK40547.1|  hypothetical protein AALP_AA2G010100                    147   5e-36   
emb|CDY50740.1|  BnaC09g51170D                                          142   5e-36   
ref|XP_011014149.1|  PREDICTED: ethylene-responsive transcription...    141   8e-36   
ref|XP_002298066.1|  AP2 domain-containing family protein               141   8e-36   Populus trichocarpa [western balsam poplar]
emb|CDY45465.1|  BnaC09g12830D                                          143   1e-35   
ref|XP_007210477.1|  hypothetical protein PRUPE_ppa026499mg             140   1e-35   
ref|XP_008238782.1|  PREDICTED: ethylene-responsive transcription...    143   2e-35   
ref|XP_002889943.1|  DNA binding protein                                141   2e-35   
ref|XP_009112987.1|  PREDICTED: ethylene-responsive transcription...    142   3e-35   
ref|XP_009764333.1|  PREDICTED: ethylene-responsive transcription...    142   3e-35   
emb|CDP05248.1|  unnamed protein product                                142   3e-35   
emb|CDY49203.1|  BnaA09g10750D                                          142   3e-35   
ref|XP_006391788.1|  hypothetical protein EUTSA_v10023678mg             141   3e-35   
gb|ABB45861.1|  DRE-binding protein 3b                                  140   4e-35   Gossypium hirsutum [American cotton]
ref|XP_009112986.1|  PREDICTED: ethylene-responsive transcription...    141   4e-35   
ref|XP_002889951.1|  hypothetical protein ARALYDRAFT_888596             139   5e-35   
ref|XP_002509704.1|  Dehydration-responsive element-binding prote...    141   6e-35   Ricinus communis
ref|XP_004245652.1|  PREDICTED: ethylene-responsive transcription...    141   7e-35   
ref|XP_002510845.1|  Dehydration-responsive element-binding prote...    140   8e-35   Ricinus communis
ref|XP_010473532.1|  PREDICTED: ethylene-responsive transcription...    140   1e-34   
ref|XP_009113026.1|  PREDICTED: ethylene-responsive transcription...    140   1e-34   
ref|XP_010430381.1|  PREDICTED: ethylene-responsive transcription...    140   2e-34   
ref|XP_009591034.1|  PREDICTED: ethylene-responsive transcription...    140   2e-34   
emb|CDY45971.1|  BnaA09g12950D                                          139   2e-34   
ref|XP_004308116.1|  PREDICTED: ethylene-responsive transcription...    139   2e-34   
emb|CDP09812.1|  unnamed protein product                                138   2e-34   
ref|XP_006421847.1|  hypothetical protein CICLE_v10005869mg             138   2e-34   
ref|XP_002862682.1|  predicted protein                                  138   2e-34   
ref|XP_002318847.2|  AP2 domain-containing family protein               140   3e-34   Populus trichocarpa [western balsam poplar]
gb|ABB45860.1|  DRE-binding protein 3a                                  138   3e-34   Gossypium hirsutum [American cotton]
ref|XP_010418311.1|  PREDICTED: ethylene-responsive transcription...    139   3e-34   
ref|XP_002887983.1|  predicted protein                                  139   3e-34   
ref|XP_010546017.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    137   4e-34   
sp|Q9CAN9.1|ERF26_ARATH  RecName: Full=Ethylene-responsive transc...    138   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004240742.1|  PREDICTED: ethylene-responsive transcription...    136   5e-34   
ref|XP_010418310.1|  PREDICTED: ethylene-responsive transcription...    138   6e-34   
ref|XP_006358864.1|  PREDICTED: ethylene-responsive transcription...    135   1e-33   
ref|XP_011072131.1|  PREDICTED: ethylene-responsive transcription...    136   2e-33   
ref|XP_009398861.1|  PREDICTED: ethylene-responsive transcription...    136   3e-33   
ref|XP_011076239.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    134   3e-33   
gb|KDP25513.1|  hypothetical protein JCGZ_20669                         135   4e-33   
ref|XP_009377922.1|  PREDICTED: ethylene-responsive transcription...    135   7e-33   
ref|XP_006340524.1|  PREDICTED: ethylene-responsive transcription...    133   8e-33   
ref|XP_010458692.1|  PREDICTED: ethylene-responsive transcription...    132   2e-32   
ref|XP_010476233.1|  PREDICTED: ethylene-responsive transcription...    132   2e-32   
ref|XP_002865890.1|  AP2 domain-containing protein                      133   3e-32   
ref|XP_009341264.1|  PREDICTED: ethylene-responsive transcription...    133   3e-32   
ref|XP_009339653.1|  PREDICTED: ethylene-responsive transcription...    134   4e-32   
ref|XP_008381395.1|  PREDICTED: ethylene-responsive transcription...    133   4e-32   
ref|XP_009364170.1|  PREDICTED: ethylene-responsive transcription...    134   5e-32   
ref|XP_008377078.1|  PREDICTED: ethylene-responsive transcription...    132   6e-32   
ref|XP_009371279.1|  PREDICTED: ethylene-responsive transcription...    132   7e-32   
ref|XP_010494434.1|  PREDICTED: ethylene-responsive transcription...    130   7e-32   
gb|KDP22329.1|  hypothetical protein JCGZ_26160                         131   1e-31   
gb|EYU25053.1|  hypothetical protein MIMGU_mgv1a021752mg                130   2e-31   
ref|XP_009629720.1|  PREDICTED: ethylene-responsive transcription...    129   2e-31   
gb|ADE41109.1|  AP2 domain class transcription factor                   130   2e-31   
ref|XP_009389122.1|  PREDICTED: ethylene-responsive transcription...    129   3e-31   
emb|CDY00511.1|  BnaA10g07620D                                          130   3e-31   
ref|XP_008373991.1|  PREDICTED: ethylene-responsive transcription...    131   3e-31   
emb|CDY31924.1|  BnaC09g28200D                                          129   5e-31   
ref|XP_006600809.1|  PREDICTED: ethylene-responsive transcription...    128   5e-31   
ref|XP_008376523.1|  PREDICTED: ethylene-responsive transcription...    129   5e-31   
ref|XP_004143932.1|  PREDICTED: ethylene-responsive transcription...    130   6e-31   
ref|NP_200015.1|  ethylene-responsive transcription factor ERF025       129   6e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21059.1|  BnaA08g24660D                                          127   1e-30   
gb|ADE41147.1|  AP2 domain class transcription factor                   128   1e-30   
ref|XP_010025136.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
ref|XP_003525731.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
ref|XP_009398079.1|  PREDICTED: ethylene-responsive transcription...    127   2e-30   
ref|XP_009792399.1|  PREDICTED: ethylene-responsive transcription...    126   2e-30   
ref|XP_010054789.1|  PREDICTED: ethylene-responsive transcription...    128   3e-30   
ref|XP_007155566.1|  hypothetical protein PHAVU_003G212700g             125   3e-30   
ref|XP_010669007.1|  PREDICTED: ethylene-responsive transcription...    125   3e-30   
ref|XP_006401877.1|  hypothetical protein EUTSA_v10014566mg             127   4e-30   
ref|XP_004515795.1|  PREDICTED: ethylene-responsive transcription...    125   4e-30   
gb|KEH31700.1|  ethylene response factor                                125   5e-30   
ref|XP_009110631.1|  PREDICTED: ethylene-responsive transcription...    125   5e-30   
ref|XP_008437210.1|  PREDICTED: ethylene-responsive transcription...    127   6e-30   
ref|XP_009106951.1|  PREDICTED: ethylene-responsive transcription...    126   7e-30   
gb|KCW90742.1|  hypothetical protein EUGRSUZ_A02817                     126   9e-30   
gb|ABQ62980.1|  TINY-like protein                                       125   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008795369.1|  PREDICTED: ethylene-responsive transcription...    125   2e-29   
ref|XP_009767038.1|  PREDICTED: ethylene-responsive transcription...    124   2e-29   
ref|XP_008803287.1|  PREDICTED: ethylene-responsive transcription...    125   2e-29   
ref|XP_011041634.1|  PREDICTED: ethylene-responsive transcription...    125   2e-29   
ref|XP_002321876.1|  hypothetical protein POPTR_0015s13840g             125   3e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004140856.1|  PREDICTED: ethylene-responsive transcription...    123   3e-29   
gb|AFV60733.1|  ethylene-responsive transcription factor 1              123   4e-29   
gb|ADJ67430.1|  ethylene response factor 1                              124   6e-29   
ref|XP_009389544.1|  PREDICTED: ethylene-responsive transcription...    123   6e-29   
ref|XP_007220719.1|  hypothetical protein PRUPE_ppa022719mg             123   6e-29   
gb|EYU29843.1|  hypothetical protein MIMGU_mgv1a021100mg                123   9e-29   
ref|XP_009591044.1|  PREDICTED: ethylene-responsive transcription...    121   1e-28   
dbj|BAK09567.1|  AP2/ERF domain-containing protein                      124   1e-28   
ref|XP_010038425.1|  PREDICTED: ethylene-responsive transcription...    120   2e-28   
ref|XP_003535627.1|  PREDICTED: ethylene-responsive transcription...    120   3e-28   
gb|AAF75817.1|AC011000_20  Contains similarity to transcriptional...    121   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127261.1|  PREDICTED: ethylene-responsive transcription...    121   4e-28   
ref|XP_008234297.1|  PREDICTED: ethylene-responsive transcription...    122   4e-28   
gb|KFK26808.1|  hypothetical protein AALP_AA8G296100                    121   4e-28   
ref|XP_008439163.1|  PREDICTED: ethylene-responsive transcription...    120   4e-28   
ref|XP_008448976.1|  PREDICTED: ethylene-responsive transcription...    119   4e-28   
ref|XP_006606090.1|  PREDICTED: ethylene-responsive transcription...    120   4e-28   
gb|KHN14123.1|  Ethylene-responsive transcription factor ERF025         119   5e-28   
gb|AID51419.1|  ethylene response factor 14                             120   5e-28   
ref|XP_009400452.1|  PREDICTED: ethylene-responsive transcription...    120   6e-28   
ref|XP_010482549.1|  PREDICTED: ethylene-responsive transcription...    120   6e-28   
ref|XP_010919217.1|  PREDICTED: ethylene-responsive transcription...    120   7e-28   
gb|KCW46383.1|  hypothetical protein EUGRSUZ_K00220                     118   9e-28   
ref|XP_010086541.1|  Ethylene-responsive transcription factor           120   1e-27   
ref|XP_006281020.1|  hypothetical protein CARUB_v10027037mg             120   1e-27   
ref|XP_010036724.1|  PREDICTED: ethylene-responsive transcription...    119   1e-27   
ref|XP_010442714.1|  PREDICTED: ethylene-responsive transcription...    120   1e-27   
ref|XP_004171678.1|  PREDICTED: ethylene-responsive transcription...    117   1e-27   
ref|XP_004151047.1|  PREDICTED: ethylene-responsive transcription...    117   2e-27   
ref|XP_010242644.1|  PREDICTED: ethylene-responsive transcription...    119   2e-27   
ref|XP_010444260.1|  PREDICTED: ethylene-responsive transcription...    119   2e-27   
gb|KCW48357.1|  hypothetical protein EUGRSUZ_K02071                     118   2e-27   
ref|XP_007210670.1|  hypothetical protein PRUPE_ppa022712mg             117   2e-27   
ref|XP_009621025.1|  PREDICTED: ethylene-responsive transcription...    118   3e-27   
ref|XP_002528595.1|  Dehydration-responsive element-binding prote...    117   5e-27   Ricinus communis
ref|XP_004496613.1|  PREDICTED: ethylene-responsive transcription...    117   7e-27   
ref|XP_010940895.1|  PREDICTED: ethylene-responsive transcription...    116   7e-27   
emb|CBI30255.3|  unnamed protein product                                116   1e-26   
gb|EPS66754.1|  hypothetical protein M569_08021                         116   1e-26   
ref|XP_008809497.1|  PREDICTED: ethylene-responsive transcription...    115   1e-26   
ref|XP_009132569.1|  PREDICTED: ethylene-responsive transcription...    115   2e-26   
ref|XP_008238801.1|  PREDICTED: ethylene-responsive transcription...    114   4e-26   
ref|XP_007158457.1|  hypothetical protein PHAVU_002G154000g             114   4e-26   
ref|XP_004976542.1|  PREDICTED: ethylene-responsive transcription...    114   4e-26   
ref|XP_002283401.3|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    116   4e-26   Vitis vinifera
emb|CAN71903.1|  hypothetical protein VITISV_035581                     117   6e-26   Vitis vinifera
ref|XP_006358390.1|  PREDICTED: ethylene-responsive transcription...    114   9e-26   
ref|XP_007155698.1|  hypothetical protein PHAVU_003G223600g             114   1e-25   
emb|CDY32604.1|  BnaC03g15720D                                          113   2e-25   
ref|NP_172723.2|  dehydration-responsive element-binding protein A-4    112   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482362.1|  PREDICTED: ethylene-responsive transcription...    112   3e-25   
ref|XP_006430287.1|  hypothetical protein CICLE_v10012757mg             112   3e-25   
ref|XP_011094407.1|  PREDICTED: ethylene-responsive transcription...    112   3e-25   
gb|KDO61042.1|  hypothetical protein CISIN_1g039696mg                   112   3e-25   
ref|XP_007027629.1|  Integrase-type DNA-binding superfamily protein     113   3e-25   
gb|AAF88080.1|AC025417_8  T12C24.16                                     111   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28393.1|  unknown                                                 111   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382289.1|  PREDICTED: ethylene-responsive transcription...    112   5e-25   
ref|XP_008238800.1|  PREDICTED: ethylene-responsive transcription...    110   7e-25   
gb|KFK43528.1|  hypothetical protein AALP_AA1G137900                    109   3e-24   
ref|XP_011001062.1|  PREDICTED: ethylene-responsive transcription...    109   5e-24   
ref|XP_007203383.1|  hypothetical protein PRUPE_ppa020711mg             108   7e-24   
ref|XP_008442806.1|  PREDICTED: ethylene-responsive transcription...    108   7e-24   
ref|XP_004138009.1|  PREDICTED: ethylene-responsive transcription...    107   8e-24   
ref|XP_002307914.1|  hypothetical protein POPTR_0006s02180g             108   9e-24   Populus trichocarpa [western balsam poplar]
ref|XP_003537044.2|  PREDICTED: ethylene-responsive transcription...    108   1e-23   
ref|XP_009353175.1|  PREDICTED: ethylene-responsive transcription...    107   1e-23   
ref|XP_008391810.1|  PREDICTED: ethylene-responsive transcription...    107   1e-23   
gb|AFK49383.1|  unknown                                                 107   1e-23   
ref|XP_009793202.1|  PREDICTED: ethylene-responsive transcription...    107   2e-23   
ref|XP_007210653.1|  hypothetical protein PRUPE_ppa021384mg             107   2e-23   
ref|XP_007162859.1|  hypothetical protein PHAVU_001G187100g             106   3e-23   
ref|XP_009764158.1|  PREDICTED: ethylene-responsive transcription...    107   3e-23   
ref|XP_006339312.1|  PREDICTED: ethylene-responsive transcription...    106   3e-23   
ref|XP_003541448.1|  PREDICTED: ethylene-responsive transcription...    106   3e-23   
ref|XP_004246896.1|  PREDICTED: ethylene-responsive transcription...    106   4e-23   
ref|XP_011004457.1|  PREDICTED: ethylene-responsive transcription...    106   4e-23   
ref|XP_009627498.1|  PREDICTED: ethylene-responsive transcription...    106   5e-23   
ref|XP_002322550.1|  hypothetical protein POPTR_0016s02010g             106   5e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008241430.1|  PREDICTED: ethylene-responsive transcription...    106   5e-23   
ref|XP_003553587.1|  PREDICTED: ethylene-responsive transcription...    105   7e-23   
ref|XP_009793989.1|  PREDICTED: ethylene-responsive transcription...    105   8e-23   
ref|XP_007145242.1|  hypothetical protein PHAVU_007G222600g             105   9e-23   
ref|XP_009590884.1|  PREDICTED: ethylene-responsive transcription...    105   1e-22   
gb|EAY88292.1|  hypothetical protein OsI_09748                          105   1e-22   Oryza sativa Indica Group [Indian rice]
gb|KDP42687.1|  hypothetical protein JCGZ_23627                         105   2e-22   
ref|XP_003546972.1|  PREDICTED: ethylene-responsive transcription...    104   2e-22   
ref|XP_004953436.1|  PREDICTED: ethylene-responsive transcription...    106   2e-22   
ref|XP_007210022.1|  hypothetical protein PRUPE_ppa016829mg             104   2e-22   
gb|EYU38617.1|  hypothetical protein MIMGU_mgv1a021879mg                104   2e-22   
ref|XP_008359485.1|  PREDICTED: ethylene-responsive transcription...    104   3e-22   
ref|XP_007210605.1|  hypothetical protein PRUPE_ppa017269mg             103   3e-22   
ref|XP_008238802.1|  PREDICTED: ethylene-responsive transcription...    103   3e-22   
ref|XP_004305361.1|  PREDICTED: ethylene-responsive transcription...    103   4e-22   
ref|XP_010061462.1|  PREDICTED: dehydration-responsive element-bi...    103   4e-22   
ref|NP_001048769.1|  Os03g0117900                                       103   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006851572.1|  hypothetical protein AMTR_s00040p00196580          103   5e-22   
ref|XP_009365379.1|  PREDICTED: ethylene-responsive transcription...    103   6e-22   
gb|EYU19512.1|  hypothetical protein MIMGU_mgv1a025309mg                103   1e-21   
ref|XP_006857915.1|  hypothetical protein AMTR_s00069p00140780          103   1e-21   
emb|CDP15372.1|  unnamed protein product                                103   2e-21   
ref|XP_008665817.1|  PREDICTED: ethylene-responsive transcription...    101   2e-21   
ref|XP_004244718.1|  PREDICTED: ethylene-responsive transcription...    101   2e-21   
gb|KDP25515.1|  hypothetical protein JCGZ_20671                         102   2e-21   
ref|XP_004494908.1|  PREDICTED: ethylene-responsive transcription...    101   3e-21   
ref|XP_004985962.1|  PREDICTED: ethylene-responsive transcription...    101   3e-21   
gb|ACB45091.1|  CBF1-2 fusion protein                                   101   4e-21   Solanum pimpinellifolium [currant tomato]
ref|XP_004249787.1|  PREDICTED: ethylene-responsive transcription...    100   5e-21   
ref|XP_002299565.1|  hypothetical protein POPTR_0001s08710g             100   5e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010236849.1|  PREDICTED: ethylene-responsive transcription...    102   5e-21   
ref|XP_006573759.1|  PREDICTED: ethylene-responsive transcription...    100   6e-21   
gb|AGB07591.1|  ethylene-responsive transcription factor 8              100   8e-21   
ref|XP_009141595.1|  PREDICTED: ethylene-responsive transcription...  99.8    8e-21   
gb|ABP64695.1|  putative C-repeat binding protein 4                     100   1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_002298067.2|  dehydration responsive element binding prote...    100   1e-20   Populus trichocarpa [western balsam poplar]
gb|ABO48363.1|  C-repeat binding facor 1                              99.4    1e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010038424.1|  PREDICTED: ethylene-responsive transcription...  99.0    1e-20   
ref|XP_008437209.1|  PREDICTED: dehydration-responsive element-bi...    100   1e-20   
gb|KCW90748.1|  hypothetical protein EUGRSUZ_A02824                   99.4    2e-20   
gb|AAY43213.1|  CRT/DRE binding factor 1                              99.8    2e-20   Hevea brasiliensis [jebe]
gb|EYU19514.1|  hypothetical protein MIMGU_mgv1a026630mg              99.8    2e-20   
ref|XP_004171792.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...  99.4    2e-20   
ref|NP_181186.1|  ethylene-responsive transcription factor ERF024     98.6    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234123.1|  CBF1 protein                                     99.0    2e-20   
gb|ABK28526.1|  unknown                                               98.6    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143933.1|  PREDICTED: dehydration-responsive element-bi...  99.4    3e-20   
ref|XP_008439162.1|  PREDICTED: dehydration-responsive element-bi...  99.0    3e-20   
gb|AIQ82398.1|  CBF3                                                  98.6    3e-20   
ref|XP_004140794.1|  PREDICTED: dehydration-responsive element-bi...  98.6    3e-20   
ref|XP_002318846.1|  hypothetical protein POPTR_0012s13870g           99.4    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006410822.1|  hypothetical protein EUTSA_v10017537mg           98.2    4e-20   
gb|AIQ82399.1|  CBF3                                                  98.2    4e-20   
gb|AIQ82400.1|  CBF3                                                  98.2    4e-20   
ref|XP_010061439.1|  PREDICTED: dehydration-responsive element-bi...  97.8    5e-20   
gb|ACF15447.1|  C-repeat binding factor 1d                            97.8    5e-20   Eucalyptus gunnii
emb|CBJ94884.1|  CBF2 protein                                         97.8    7e-20   Populus balsamifera [balsam poplar]
gb|AIU92947.1|  C-repeat/dehydration-responsive element-binding f...  98.6    7e-20   
gb|AIQ82369.1|  CBF3                                                  97.4    7e-20   
gb|AIQ82376.1|  CBF3                                                  97.4    7e-20   
gb|AIU92963.1|  C-repeat/dehydration-responsive element-binding f...  98.6    7e-20   
gb|AIU92948.1|  C-repeat/dehydration-responsive element-binding f...  98.6    7e-20   
gb|AGY31292.1|  C-repeat binding factor 4c                            97.8    8e-20   
ref|XP_011029177.1|  PREDICTED: dehydration-responsive element-bi...  97.8    8e-20   
ref|XP_007209556.1|  hypothetical protein PRUPE_ppa010909mg           97.8    8e-20   
ref|XP_011029176.1|  PREDICTED: dehydration-responsive element-bi...  98.2    9e-20   
gb|AGY31291.1|  C-repeat binding factor 4b                            98.2    9e-20   
ref|XP_011014147.1|  PREDICTED: dehydration-responsive element-bi...  97.8    9e-20   
emb|CBJ94893.1|  CBF2 protein                                         97.4    9e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010516867.1|  PREDICTED: ethylene-responsive transcription...  96.7    1e-19   
gb|AGY31293.1|  C-repeat binding factor 2                             97.8    1e-19   
ref|XP_002976278.1|  hypothetical protein SELMODRAFT_26594            96.3    1e-19   
ref|XP_004143375.1|  PREDICTED: ethylene-responsive transcription...  96.7    1e-19   
gb|KGN48237.1|  hypothetical protein Csa_6G450420                     97.4    1e-19   
ref|XP_010248418.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    101   1e-19   
ref|XP_010089407.1|  Ethylene-responsive transcription factor         97.1    1e-19   
gb|ABO48365.1|  C-repeat binding facor 3                              97.4    1e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010317563.1|  PREDICTED: CBF1 protein isoform X1               96.7    1e-19   
gb|AIU92958.1|  C-repeat/dehydration-responsive element-binding f...  97.4    2e-19   
ref|XP_010049794.1|  PREDICTED: ethylene-responsive transcription...  96.3    2e-19   
ref|XP_006417215.1|  hypothetical protein EUTSA_v10009659mg           96.3    2e-19   
gb|ACB45080.1|  CRT binding factor 2                                  96.7    2e-19   Solanum habrochaites
gb|AIU92956.1|  C-repeat/dehydration-responsive element-binding f...  97.4    2e-19   
ref|XP_010684005.1|  PREDICTED: ethylene-responsive transcription...  96.3    2e-19   
ref|XP_004234350.1|  PREDICTED: dehydration-responsive element-bi...  96.7    2e-19   
gb|AIU92967.1|  C-repeat/dehydration-responsive element-binding f...  97.1    3e-19   
ref|XP_010509470.1|  PREDICTED: ethylene-responsive transcription...  95.5    3e-19   
gb|ACB45082.1|  CRT binding factor 5                                  95.9    3e-19   Solanum tuberosum [potatoes]
ref|XP_010061486.1|  PREDICTED: dehydration-responsive element-bi...  96.3    3e-19   
ref|XP_010061567.1|  PREDICTED: dehydration-responsive element-bi...  96.3    3e-19   
ref|XP_008377096.1|  PREDICTED: dehydration-responsive element-bi...  96.3    3e-19   
ref|XP_006304750.1|  hypothetical protein CARUB_v10012147mg           96.3    3e-19   
gb|ABK95675.1|  unknown                                               97.1    3e-19   Populus trichocarpa [western balsam poplar]
gb|ABB51637.1|  C-repeat binding facor 1a                             96.3    3e-19   Eucalyptus gunnii
ref|XP_010554937.1|  PREDICTED: ethylene-responsive transcription...  95.9    3e-19   
gb|ADE41123.1|  AP2 domain class transcription factor                 95.9    4e-19   
ref|XP_010505192.1|  PREDICTED: ethylene-responsive transcription...  95.1    4e-19   
ref|XP_010462671.1|  PREDICTED: ethylene-responsive transcription...  93.2    5e-19   
gb|AIQ82333.1|  CBF2                                                  94.7    5e-19   
gb|ABC79626.1|  CBF1                                                  95.9    5e-19   
gb|AIQ82365.1|  CBF2                                                  94.7    5e-19   
ref|XP_009133086.1|  PREDICTED: ethylene-responsive transcription...  94.7    5e-19   
ref|XP_011030036.1|  PREDICTED: dehydration-responsive element-bi...  96.3    5e-19   
gb|KCW90754.1|  hypothetical protein EUGRSUZ_A02831                   95.1    5e-19   
gb|AIQ82363.1|  CBF2                                                  94.7    5e-19   
ref|XP_002468636.1|  hypothetical protein SORBIDRAFT_01g049400        96.3    5e-19   
ref|XP_010061533.1|  PREDICTED: dehydration-responsive element-bi...  95.5    6e-19   
gb|AIQ82339.1|  CBF2                                                  94.7    6e-19   
gb|AIQ82360.1|  CBF2                                                  94.7    6e-19   
gb|ACB45088.1|  CRT binding factor 2                                  95.5    6e-19   
gb|KCW90751.1|  hypothetical protein EUGRSUZ_A02827                   94.7    6e-19   
ref|XP_008234474.1|  PREDICTED: dehydration-responsive element-bi...  96.3    6e-19   
gb|ABB51638.1|  C-repeat binding facor 1b                             95.5    6e-19   
gb|AAR88363.1|  DREB-like protein 1                                   95.1    6e-19   
gb|AIU92964.1|  C-repeat/dehydration-responsive element-binding f...  95.9    7e-19   
gb|AIQ82361.1|  CBF2                                                  94.4    7e-19   
emb|CAH67055.1|  OSIGBa0127A14.7                                      95.1    7e-19   
ref|XP_002881444.1|  AP2 domain-containing protein                    94.4    7e-19   
gb|ACI42860.1|  dehydration-responsive element-binding protein 1B     95.5    7e-19   
gb|AAQ88400.1|  CaCBF1B                                               95.1    7e-19   
gb|ACB45087.1|  CRT binding factor 1                                  95.1    8e-19   
gb|EEC77827.1|  hypothetical protein OsI_17041                        94.7    8e-19   
ref|NP_001280599.1|  dehydration-responsive element-binding prote...  95.1    9e-19   
ref|XP_010061399.1|  PREDICTED: dehydration-responsive element-bi...  95.1    9e-19   
ref|XP_010061496.1|  PREDICTED: dehydration-responsive element-bi...  95.1    9e-19   
ref|XP_010061558.1|  PREDICTED: dehydration-responsive element-bi...  94.7    1e-18   
gb|AIQ82342.1|  CBF2                                                  94.0    1e-18   
dbj|BAE17131.1|  LhCBF1                                               94.7    1e-18   
gb|AHN65437.1|  dehydration-responsive element binding protein        94.7    1e-18   
gb|EEE61533.1|  hypothetical protein OsJ_15841                        94.4    1e-18   
gb|ADY17814.1|  CBF4 transcription factor                             94.7    1e-18   
gb|ACB45079.1|  CRT binding factor 1                                  94.7    1e-18   
gb|AFA50331.1|  dehydration-responsive element-binding protein 1      94.4    1e-18   
ref|XP_007218312.1|  hypothetical protein PRUPE_ppa010935mg           94.7    1e-18   
gb|ACJ63287.1|  C-repeat binding factor 1                             93.6    1e-18   
ref|XP_008462542.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-18   
ref|XP_006295828.1|  hypothetical protein CARUB_v10024954mg           93.6    2e-18   
ref|XP_003580357.1|  PREDICTED: ethylene-responsive transcription...  93.6    2e-18   
gb|AIU92957.1|  C-repeat/dehydration-responsive element-binding f...  94.7    2e-18   
gb|AIU92946.1|  C-repeat/dehydration-responsive element-binding f...  94.7    2e-18   
gb|AIU92965.1|  C-repeat/dehydration-responsive element-binding f...  94.7    2e-18   
gb|EYU19515.1|  hypothetical protein MIMGU_mgv1a026372mg              94.0    2e-18   
gb|AIU92962.1|  C-repeat/dehydration-responsive element-binding f...  94.7    2e-18   
gb|AAQ98869.2|  putative dehydration responsive element binding p...  94.0    2e-18   
gb|ABD65473.1|  DREB1-like transcription factor                       94.0    2e-18   
gb|AIQ82354.1|  CBF2                                                  93.2    2e-18   
gb|AGH33881.1|  DREB70                                                94.4    2e-18   
gb|AIU92952.1|  C-repeat/dehydration-responsive element-binding f...  94.4    2e-18   
gb|ABQ62974.1|  TINY-like protein                                     94.7    2e-18   
gb|AIQ82367.1|  CBF2                                                  92.8    2e-18   
gb|AAP83936.3|  putative dehydration responsive element binding p...  93.6    2e-18   
gb|AIU92950.1|  C-repeat/dehydration-responsive element-binding f...  94.4    2e-18   
gb|KCW90755.1|  hypothetical protein EUGRSUZ_A02832                   93.2    2e-18   
gb|AFL48190.1|  C-repeat binding factor 1                             94.0    2e-18   
gb|AIU92953.1|  C-repeat/dehydration-responsive element-binding f...  94.4    2e-18   
ref|XP_011101172.1|  PREDICTED: dehydration-responsive element-bi...  93.2    2e-18   
gb|AIU92949.1|  C-repeat/dehydration-responsive element-binding f...  94.4    2e-18   
ref|XP_007210989.1|  hypothetical protein PRUPE_ppa021197mg           94.0    3e-18   
gb|AET87124.1|  DREB1C                                                93.6    3e-18   
ref|XP_011029370.1|  PREDICTED: ethylene-responsive transcription...  90.9    3e-18   
gb|AIL00822.1|  C-repeat binding factor 4                             93.2    3e-18   
ref|XP_011016474.1|  PREDICTED: ethylene-responsive transcription...  94.0    3e-18   
gb|ABN58746.1|  C-repeat binding factor                               93.2    3e-18   
gb|ADE62311.1|  dehydration-responsive element-binding protein 1A     93.2    3e-18   
gb|ABI95805.1|  C-repeat binding factor                               93.2    3e-18   
gb|KDP25514.1|  hypothetical protein JCGZ_20670                       93.2    4e-18   
gb|AIL00764.1|  C-repeat binding factor 4                             93.2    4e-18   
gb|AAW58104.1|  CBF-like transcription factor                         92.8    4e-18   
gb|AIL00823.1|  C-repeat binding factor 4                             92.8    4e-18   
gb|AIL00783.1|  C-repeat binding factor 4                             92.8    4e-18   
ref|XP_002280097.1|  PREDICTED: dehydration-responsive element-bi...  92.8    5e-18   
gb|AIL00794.1|  C-repeat binding factor 4                             92.8    5e-18   
gb|AFQ59977.1|  CRT/DRE binding factor 1                              93.2    5e-18   
ref|NP_001274894.1|  AP2 domain CBF protein                           92.8    5e-18   
gb|AFA50332.1|  dehydration-responsive element-binding protein 2      92.8    5e-18   
gb|AIL00786.1|  C-repeat binding factor 4                             92.8    5e-18   
gb|KDP22330.1|  hypothetical protein JCGZ_26161                       92.8    5e-18   
ref|XP_002301249.2|  hypothetical protein POPTR_0002s14210g           93.6    6e-18   
gb|EYU19513.1|  hypothetical protein MIMGU_mgv1a020585mg              92.8    6e-18   
gb|AHN65457.1|  dehydration-responsive element binding protein        93.2    6e-18   
gb|ADZ23480.1|  CBF transcription factor 2                            92.4    6e-18   
gb|AHN13908.1|  dehydration-responsive element binding factor         93.2    6e-18   
gb|ABF70207.1|  C-repeat binding factor                               92.4    6e-18   
gb|AHN65439.1|  dehydration-responsive element binding protein        93.2    6e-18   
gb|AHN65438.1|  dehydration-responsive element binding protein        93.2    6e-18   
ref|XP_009784267.1|  PREDICTED: dehydration-responsive element-bi...  92.4    7e-18   
ref|XP_010061546.1|  PREDICTED: dehydration-responsive element-bi...  92.4    7e-18   
gb|AFB83707.1|  CBF1                                                  92.4    7e-18   
gb|AHN65494.1|  dehydration-responsive element binding protein        92.8    7e-18   
gb|ACY79411.1|  CRT-binding factor 1                                  92.0    8e-18   
gb|AAZ20446.1|  CBF1                                                  92.0    8e-18   
gb|AIY26287.1|  CRT/DRE-binding factor                                92.4    9e-18   
ref|XP_002509702.1|  Dehydration-responsive element-binding prote...  92.4    9e-18   
ref|XP_010444203.1|  PREDICTED: dehydration-responsive element-bi...  92.0    9e-18   
gb|AIU39990.1|  dehydration responsive element-binding protein        92.4    9e-18   
gb|AHN65441.1|  dehydration-responsive element binding protein        92.4    1e-17   
gb|AIL00787.1|  C-repeat binding factor 4                             92.0    1e-17   
gb|AIU92971.1|  C-repeat/dehydration-responsive element-binding f...  92.4    1e-17   
gb|ABP98987.1|  CBF/DREB1 transcription factor 1                      91.7    1e-17   
ref|XP_010278524.1|  PREDICTED: dehydration-responsive element-bi...  92.0    1e-17   
ref|XP_009623988.1|  PREDICTED: dehydration-responsive element-bi...  91.7    1e-17   
gb|KCW90750.1|  hypothetical protein EUGRSUZ_A02826                   91.7    1e-17   
ref|XP_010482546.1|  PREDICTED: dehydration-responsive element-bi...  91.7    1e-17   
gb|AIU92955.1|  C-repeat/dehydration-responsive element-binding f...  92.4    1e-17   
ref|XP_008376515.1|  PREDICTED: dehydration-responsive element-bi...  91.7    1e-17   
gb|AGH33879.1|  DREB68                                                92.0    1e-17   
ref|XP_004976543.1|  PREDICTED: ethylene-responsive transcription...  90.5    1e-17   
ref|XP_002987168.1|  hypothetical protein SELMODRAFT_26604            90.5    2e-17   
ref|XP_010442711.1|  PREDICTED: dehydration-responsive element-bi...  91.3    2e-17   
ref|NP_001289653.1|  dehydration-responsive element-binding prote...  91.3    2e-17   
gb|ACB45084.1|  CRT binding factor 4                                  90.5    2e-17   
gb|ABV82985.1|  cold responsive transcription factor                  90.9    2e-17   
ref|NP_001287933.1|  uncharacterized protein LOC103337407             90.9    3e-17   
ref|XP_002446959.1|  hypothetical protein SORBIDRAFT_06g025890        90.5    3e-17   
gb|AFZ94953.1|  C-repeat binding factor 3                             90.5    3e-17   
emb|CDX84123.1|  BnaC04g08850D                                        89.7    3e-17   
gb|ABP98988.1|  CBF/DREB1 transcription factor 2                      90.1    3e-17   
ref|XP_002510847.1|  Dehydration-responsive element-binding prote...  90.9    3e-17   
ref|XP_007150099.1|  hypothetical protein PHAVU_005G126600g           90.5    3e-17   
gb|AEK94313.1|  C-repeat binding factor 4                             89.7    4e-17   
gb|AHN65456.1|  dehydration-responsive element binding protein        90.5    4e-17   
gb|ADF43035.2|  CBF/DREB1-like protein c                              90.1    5e-17   
ref|XP_008238783.1|  PREDICTED: dehydration-responsive element-bi...  90.1    5e-17   
ref|XP_006832878.1|  hypothetical protein AMTR_s00095p00096190        90.5    5e-17   
gb|KCW90753.1|  hypothetical protein EUGRSUZ_A02830                   89.7    6e-17   
dbj|BAC20183.1|  dehydratiion responsive element binding protein ...  89.7    6e-17   
gb|AHH86060.1|  CRT/DRE-binding factor 2                              89.7    7e-17   
ref|NP_001287934.1|  dehydration-responsive element-binding prote...  89.7    7e-17   
gb|ACY79412.1|  CRT-binding factor 1                                  89.4    8e-17   
emb|CBI31845.3|  unnamed protein product                              90.1    9e-17   
gb|ABV27149.1|  C-repeat binding factor 3                             89.0    9e-17   
ref|XP_010061450.1|  PREDICTED: dehydration-responsive element-bi...  88.6    1e-16   
ref|XP_009759325.1|  PREDICTED: dehydration-responsive element-bi...  89.4    1e-16   
ref|XP_007210188.1|  hypothetical protein PRUPE_ppa017761mg           89.0    1e-16   
gb|AFL48191.1|  C-repeat binding factor 2                             89.0    1e-16   
gb|KGN55972.1|  hypothetical protein Csa_3G042390                     87.4    1e-16   
ref|XP_010438876.1|  PREDICTED: dehydration-responsive element-bi...  88.6    2e-16   
ref|XP_011076240.1|  PREDICTED: dehydration-responsive element-bi...  88.6    2e-16   
ref|XP_009614214.1|  PREDICTED: dehydration-responsive element-bi...  88.2    2e-16   
gb|KCW90746.1|  hypothetical protein EUGRSUZ_A02822                   88.2    2e-16   
gb|KFK27825.1|  hypothetical protein AALP_AA8G434600                  87.4    3e-16   
ref|XP_011090115.1|  PREDICTED: dehydration-responsive element-bi...  87.0    3e-16   
ref|XP_003611338.1|  Ethylene-responsive transcription factor TINY    87.0    3e-16   
ref|XP_002867607.1|  hypothetical protein ARALYDRAFT_492279           87.4    3e-16   
ref|NP_001147542.1|  ap2/EREBP transcription factor                   87.4    3e-16   
emb|CAH10191.1|  avirulence-like protein 1                            87.8    3e-16   
ref|XP_004983870.1|  PREDICTED: ethylene-responsive transcription...  86.7    3e-16   
ref|XP_010264429.1|  PREDICTED: ethylene-responsive transcription...  87.8    3e-16   
gb|ABV27138.1|  C-repeat binding factor 3                             87.4    4e-16   
gb|AHZ90672.1|  CBF/DREB1 transcription factor 1                      87.4    4e-16   
gb|ABV27122.1|  C-repeat binding factor 3                             87.4    4e-16   
ref|XP_006399666.1|  hypothetical protein EUTSA_v10015895mg           87.8    4e-16   
ref|XP_009781787.1|  PREDICTED: dehydration-responsive element-bi...  87.0    4e-16   
ref|XP_010448427.1|  PREDICTED: dehydration-responsive element-bi...  87.0    5e-16   
ref|XP_006491857.1|  PREDICTED: dehydration-responsive element-bi...  86.7    5e-16   
ref|XP_007209547.1|  hypothetical protein PRUPE_ppa010800mg           87.4    5e-16   
ref|XP_006394830.1|  hypothetical protein EUTSA_v10004870mg           87.0    5e-16   
gb|AAG43549.1|AF211531_1  Avr9/Cf-9 rapidly elicited protein 111B     87.0    5e-16   
emb|CDY27089.1|  BnaA02g11090D                                        86.3    5e-16   
ref|XP_006285403.1|  hypothetical protein CARUB_v10006809mg           87.0    5e-16   
gb|ACI15606.1|  DRE/CRT-binding factor 2                              87.0    6e-16   
gb|AAG43548.1|AF211530_1  Avr9/Cf-9 rapidly elicited protein 111A     86.3    6e-16   
gb|ABV27132.1|  C-repeat binding factor 3                             86.7    6e-16   
ref|NP_196720.1|  dehydration-responsive element-binding protein 3    87.0    6e-16   
ref|XP_004228864.1|  PREDICTED: dehydration-responsive element-bi...  85.9    6e-16   
ref|XP_002509703.1|  Dehydration-responsive element-binding prote...  87.0    6e-16   
gb|ABD65969.1|  DREB1A                                                86.7    7e-16   
dbj|BAN51850.2|  putative C-repeat binding factor 2                   87.0    7e-16   
gb|ACF15446.1|  C-repeat binding factor 1c                            86.7    7e-16   
gb|ABV27100.1|  C-repeat binding factor 2                             86.7    7e-16   
ref|XP_010419734.1|  PREDICTED: dehydration-responsive element-bi...  87.0    7e-16   
ref|XP_007024262.1|  Integrase-type DNA-binding superfamily protein   87.0    7e-16   
ref|XP_002873522.1|  hypothetical protein ARALYDRAFT_487996           87.0    7e-16   
gb|KFK25419.1|  hypothetical protein AALP_AA8G112500                  86.7    8e-16   
gb|ABV27118.1|  C-repeat binding factor 2                             86.3    8e-16   
ref|XP_009339654.1|  PREDICTED: dehydration-responsive element-bi...  86.7    8e-16   
gb|AAC99371.1|  CRT/DRE binding factor 2                              86.3    9e-16   
ref|NP_567719.1|  dehydration-responsive element-binding protein 1C   86.3    9e-16   
gb|ACZ37077.1|  CRT/DRE binding factor                                86.3    9e-16   
gb|AFU54609.1|  C-repeat binding factor                               86.7    1e-15   
gb|ADU03762.1|  C-repeat binding factor                               86.7    1e-15   
gb|EYU35139.1|  hypothetical protein MIMGU_mgv1a019198mg              85.1    1e-15   
ref|XP_010234077.1|  PREDICTED: dehydration-responsive element-bi...  84.3    1e-15   
ref|XP_006289586.1|  hypothetical protein CARUB_v10003136mg           86.3    1e-15   
ref|XP_006289163.1|  hypothetical protein CARUB_v10002601mg           86.3    1e-15   
gb|AEM97872.1|  AP2 class transcription factor                        86.3    1e-15   
ref|XP_009759409.1|  PREDICTED: dehydration-responsive element-bi...  85.9    1e-15   
gb|AEB69782.1|  CBF                                                   86.3    1e-15   
ref|XP_006421846.1|  hypothetical protein CICLE_v10007068mg           85.9    1e-15   
emb|CDX69746.1|  BnaA10g20950D                                        86.3    1e-15   
gb|ABV27191.1|  C-repeat binding factor 3                             85.9    1e-15   
ref|XP_009390140.1|  PREDICTED: dehydration-responsive element-bi...  86.3    1e-15   
gb|AFU81298.1|  C-repeat binding factor 1                             85.9    1e-15   
gb|ABV27154.1|  C-repeat binding factor 3                             85.9    1e-15   
gb|ADZ23479.1|  CBF transcription factor 1                            85.5    1e-15   
gb|ACI42859.1|  dehydration-responsive element-binding protein 1A     85.9    1e-15   
ref|XP_009121933.1|  PREDICTED: dehydration-responsive element-bi...  86.3    1e-15   
ref|NP_567720.1|  dehydration-responsive element-binding protein 1A   85.9    1e-15   
gb|AAR35030.1|  CBF25                                                 85.9    1e-15   
gb|ABM21468.1|  DREB1A                                                85.9    1e-15   
gb|ACZ37079.1|  CRT/DRE binding factor                                85.9    1e-15   
gb|AIM48890.1|  CBF-like transcription factor b                       86.3    1e-15   
ref|XP_010493837.1|  PREDICTED: ethylene-responsive transcription...  85.9    1e-15   
ref|XP_007209842.1|  hypothetical protein PRUPE_ppa014628mg           85.9    1e-15   
gb|KCW90749.1|  hypothetical protein EUGRSUZ_A02825                   85.1    1e-15   
ref|XP_010454922.1|  PREDICTED: ethylene-responsive transcription...  85.9    1e-15   
ref|NP_182021.1|  ethylene-responsive transcription factor ERF034     86.7    1e-15   
gb|AIM48889.1|  CBF-like transcription factor a                       85.9    1e-15   
gb|AHH86061.1|  CRT/DRE-binding factor 3                              85.9    1e-15   
gb|AAM64613.1|  putative AP2 domain transcription factor              86.7    1e-15   
ref|NP_197953.1|  ethylene-responsive transcription factor TINY       85.5    1e-15   
gb|AAV80414.1|  putative transcription factor CBF3                    85.5    2e-15   
ref|XP_010056415.1|  PREDICTED: ethylene-responsive transcription...  86.7    2e-15   
emb|CAQ52596.1|  dehydration responsible element binding factor 1A    85.5    2e-15   
gb|KDO65655.1|  hypothetical protein CISIN_1g029015mg                 85.1    2e-15   
ref|XP_009151103.1|  PREDICTED: ethylene-responsive transcription...  85.5    2e-15   
gb|AIQ82473.1|  CBF4                                                  85.5    2e-15   



>ref|XP_007040122.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY24623.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=231

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 139/182 (76%), Gaps = 6/182 (3%)
 Frame = +1

Query  337  PRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaa  516
            P  A +   A++SS     GKHP YRG+R RSGKWVSEIREPRKTTRIWLGTYPTPEMAA
Sbjct  56   PPTAPKSNMASSSS-----GKHPMYRGIRCRSGKWVSEIREPRKTTRIWLGTYPTPEMAA  110

Query  517  aaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS  696
            AAYDVAALAL+  EAV+NFP   A YP+P S+ +ADIR+AAA+AA + K E++S    G+
Sbjct  111  AAYDVAALALKGGEAVVNFPGSVASYPLPASTSSADIRKAAAAAALLKKAETTSEINLGT  170

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLW  876
              + K++     EY+DE+ L ++ NLLVDMA G++VSPPRI SS P+DDSPENSD E+LW
Sbjct  171  GHQAKNEEMTTQEYVDEDALLNLPNLLVDMAEGLLVSPPRI-SSTPSDDSPENSDGESLW  229

Query  877  NY  882
            +Y
Sbjct  230  SY  231



>ref|XP_006477389.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Citrus sinensis]
Length=229

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 133/190 (70%), Gaps = 7/190 (4%)
 Frame = +1

Query  322  ENLLSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPT  501
            ENL  P       AAA SS T    KHP YRG+R R+ KWVSEIREPRK+TRIWLGTYPT
Sbjct  43   ENLAHPSSNTSTMAAAPSSSTK---KHPSYRGIRCRNSKWVSEIREPRKSTRIWLGTYPT  99

Query  502  PEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssG  681
            PEMAAAAYDVAALAL+ ++AVLNFP + + YPVP SS + DIR AAA+AAA      +  
Sbjct  100  PEMAAAAYDVAALALKGSDAVLNFPNFVSTYPVPASSSSVDIRNAAAAAAASCARRKAES  159

Query  682  DGGGSRQERKDDPSVNT---EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE  852
                   +R +    N    E++DE+ L +M NLLVDMA GMMVSPPRINSS P+DDSPE
Sbjct  160  VSDPDENQRMEQSRSNDVIGEFVDEDALLNMPNLLVDMAEGMMVSPPRINSS-PSDDSPE  218

Query  853  NSDAETLWNY  882
            NSD E LW+Y
Sbjct  219  NSDGERLWSY  228



>gb|KDO63569.1| hypothetical protein CISIN_1g030591mg [Citrus sinensis]
Length=175

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            A++P+    KHP YRG+R R+ KWVSEIREPRK+TRIWLGTYPTPEMAAAAYDVAALAL+
Sbjct  2    AAAPSSSTKKHPSYRGIRCRNSKWVSEIREPRKSTRIWLGTYPTPEMAAAAYDVAALALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVN  729
             ++AVLNFP + + YPVP SS + DIR AAA+AAA      +         +R +    N
Sbjct  62   GSDAVLNFPNFVSTYPVPASSSSVDIRNAAAAAAASCARRKAESVSDPDENQRMEQSRSN  121

Query  730  T---EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                E++DE+ L +M NLLVDMA GMMVSPPR+NSS P+DDSPENSD E LW+Y
Sbjct  122  DVIGEFVDEDALLNMPNLLVDMAEGMMVSPPRLNSS-PSDDSPENSDGERLWSY  174



>ref|XP_006440530.1| hypothetical protein CICLE_v10023840mg [Citrus clementina]
 gb|ESR53770.1| hypothetical protein CICLE_v10023840mg [Citrus clementina]
Length=229

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 133/190 (70%), Gaps = 7/190 (4%)
 Frame = +1

Query  322  ENLLSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPT  501
            ENL  P       AAA SS T    KHP YRG+R R+ KWVSE+REPRK+TRIWLGTYPT
Sbjct  43   ENLAHPSSNTSTMAAAPSSSTK---KHPLYRGIRCRNSKWVSEVREPRKSTRIWLGTYPT  99

Query  502  PEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssG  681
            PEMAAAAYDVAALAL+ ++AVLNFP + + YPVP SS + DIR AAA+AAA      +  
Sbjct  100  PEMAAAAYDVAALALKGSDAVLNFPNFVSTYPVPASSSSVDIRNAAAAAAASCARRKAES  159

Query  682  DGGGSRQERKDDPSVNT---EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE  852
                   +R +    N    E++DE+ L +M NLLVDMA GMMVSPPR+NSS P+DDSPE
Sbjct  160  VSDPDENQRMEQSRSNDVIGEFVDEDALLNMPNLLVDMAEGMMVSPPRLNSS-PSDDSPE  218

Query  853  NSDAETLWNY  882
            NSD E LW+Y
Sbjct  219  NSDGERLWSY  228



>ref|XP_011033804.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Populus euphratica]
Length=176

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 126/169 (75%), Gaps = 10/169 (6%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+RSRSGKWVSEIREPRKTTRIWLGT+P PEMAAAAYDVA LAL+  +AVLNFP
Sbjct  10   RHPLYRGIRSRSGKWVSEIREPRKTTRIWLGTFPKPEMAAAAYDVAVLALKGTDAVLNFP  69

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT-------E  735
                 YPVP S+   DIR AA +AAA+ K E S  +     ++R++D +V T       E
Sbjct  70   NSVGTYPVPASTSPTDIRNAANAAAALKKAEMSYNE--ALDEQRRNDCAVGTFLESGGEE  127

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEE LFDM NLLVDMAGGM++SPPRI SS P+DDS   SD E+LW+Y
Sbjct  128  FVDEEALFDMPNLLVDMAGGMLLSPPRITSS-PSDDSQGTSDGESLWSY  175



>ref|XP_010278525.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Nelumbo nucifera]
Length=187

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 129/182 (71%), Gaps = 8/182 (4%)
 Frame = +1

Query  358  QAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaa  537
             A  ASS     GKHP YRG+R RSGKWVSEIREPRK+TRIWLGT+PTPEMAA AYDVAA
Sbjct  6    SAPGASSHQPVAGKHPIYRGIRCRSGKWVSEIREPRKSTRIWLGTFPTPEMAATAYDVAA  65

Query  538  lalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGD-------GGGS  696
            LAL+ ++AVLNFP   + YP+P S+  +DIR AAA+AAA   P++ S D       G   
Sbjct  66   LALKGSDAVLNFPETVSSYPIPASASPSDIRAAAAAAAASRLPKTESIDDQPFSHLGNVE  125

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLW  876
                 + P+   E+IDEE LFDM  LLV+MA GM++SPPR+N    +DDSPENSD E+LW
Sbjct  126  LDTDSNPPTSREEFIDEEALFDMPKLLVNMAEGMLLSPPRMN-PRTSDDSPENSDGESLW  184

Query  877  NY  882
            +Y
Sbjct  185  SY  186



>ref|XP_010662529.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Vitis 
vinifera]
Length=237

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 8/170 (5%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+HP YRG+R R  KWVSEIREPRKTTRIWLGTYPTPEMAA AYDVAALAL+  +A LNF
Sbjct  68   GRHPFYRGIRCRGNKWVSEIREPRKTTRIWLGTYPTPEMAATAYDVAALALKGTDATLNF  127

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT-------  732
            P     YP+P S+ A+DIR AAA AA   + +  S +   + Q +K++ + ++       
Sbjct  128  PNSVLSYPIPKSTSASDIRAAAARAAEAQQAKPESSESPNTTQPKKEETTESSSLAAGED  187

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++IDEEEL +M NLLVDMA GM+VSPPR+  S P+DDSPENSD+++LW+Y
Sbjct  188  QFIDEEELLNMPNLLVDMAEGMLVSPPRLK-SQPSDDSPENSDSDSLWSY  236



>ref|XP_002276184.1| PREDICTED: ethylene-responsive transcription factor ERF026 [Vitis 
vinifera]
Length=186

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 132/188 (70%), Gaps = 15/188 (8%)
 Frame = +1

Query  346  AEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaay  525
            A  G +A   SP    G+HP YRG+RSRSGKWVSEIREPRKTTRIWLGT+PT EMAAAAY
Sbjct  4    ASAGGSAKQPSP----GRHPMYRGIRSRSGKWVSEIREPRKTTRIWLGTFPTAEMAAAAY  59

Query  526  dvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQE  705
            DVAALAL+  EAVLNFP +   YPVP S   +DIR AAA+AAA+ K ++  G    SR+E
Sbjct  60   DVAALALKGTEAVLNFPDFVHSYPVPASGSPSDIRSAAAAAAALKKAQTDDGSAAHSRRE  119

Query  706  RKDDPSVNT--------EYIDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDSPENS  858
                  V+T        E++DEE LFDM NLLVDMA GM+V+PPRIN  S P   +PEN 
Sbjct  120  DDGRFDVHTNTNTTSEGEFVDEEALFDMPNLLVDMAEGMLVTPPRINVPSSPY--TPENY  177

Query  859  DAETLWNY  882
            D ++LW+Y
Sbjct  178  DGDSLWSY  185



>ref|XP_002304466.1| AP2 domain-containing family protein [Populus trichocarpa]
 gb|EEE79445.1| AP2 domain-containing family protein [Populus trichocarpa]
Length=176

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 126/169 (75%), Gaps = 10/169 (6%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+RSRSGKWVSEIREPRKTTRIWLGT+P PEMAAAAYDVA LAL+ A+AVLNFP
Sbjct  10   RHPMYRGIRSRSGKWVSEIREPRKTTRIWLGTFPKPEMAAAAYDVAVLALKGADAVLNFP  69

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT-------E  735
            +    YPVP S+   DIR AA +AAA+ K E S  +     ++ ++D +V T       E
Sbjct  70   SSVGTYPVPASTSPTDIRNAANAAAALKKAEMSYNEA--LVEQPRNDCAVGTFLASGGEE  127

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEE LFDM NLLVDMAGGM++SPPRI  S P+DDS   SD E+LW+Y
Sbjct  128  FVDEEALFDMPNLLVDMAGGMLLSPPRITPS-PSDDSQGTSDGESLWSY  175



>ref|XP_006301753.1| hypothetical protein CARUB_v10022214mg [Capsella rubella]
 gb|EOA34651.1| hypothetical protein CARUB_v10022214mg [Capsella rubella]
Length=257

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 125/170 (74%), Gaps = 7/170 (4%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + VLN
Sbjct  89   RKKHPLYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGGDTVLN  148

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssG----DGGGSRQERKDD--PSVNT  732
            FP     YP+P+SS AA IR AAA+AAA     +++      GG  ++E   D   S NT
Sbjct  149  FPDSVGSYPIPLSSSAAHIRCAAAAAAAAAGACAATSAAAVKGGEKKEEEVCDGAGSSNT  208

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +++DEEEL +M  LL DMA GMMV+PP +  S P+DDSPENSD E LW+Y
Sbjct  209  QFVDEEELLNMPGLLADMAKGMMVAPPWMG-SPPSDDSPENSDGERLWSY  257



>ref|XP_011081034.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Sesamum indicum]
Length=252

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 124/171 (73%), Gaps = 10/171 (6%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+RSRSGKWVSEIREP+KTTRIWLGTYP+PEMAAAAYDVAALAL+  + +LNF
Sbjct  83   GKHPLYRGIRSRSGKWVSEIREPKKTTRIWLGTYPSPEMAAAAYDVAALALKGGDTLLNF  142

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT-------  732
            P     YPVP  S +    R AA++AA +    SSG+      ++  D SV+        
Sbjct  143  PDRVGTYPVPA-SPSPTDIRRAAASAAALMKPESSGEAAADGGQQGHDESVSNEETLTSG  201

Query  733  -EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E+IDEE LF M NLL+DMA GM+VSPPR+ +S P+DDSP+NSDAE LW+Y
Sbjct  202  HEFIDEEALFHMPNLLMDMAEGMLVSPPRM-ASPPSDDSPDNSDAENLWSY  251



>ref|XP_010255544.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Nelumbo nucifera]
Length=236

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 130/180 (72%), Gaps = 8/180 (4%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            +++++P    GKHP YRG+R RSGKWVSEIREPRKTTRIWLGT+PTPEMAAAAYDVAALA
Sbjct  57   SSSAAPPPIAGKHPIYRGIRCRSGKWVSEIREPRKTTRIWLGTFPTPEMAAAAYDVAALA  116

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG-------GGSRQ  702
            L+  ++VLNFP   + YP+P S+  +DIR AAA+AAA   P+  S D         G   
Sbjct  117  LKGNDSVLNFPETISSYPIPASASPSDIRAAAAAAAASRLPKPESIDDPVPLLGQSGDVD  176

Query  703  ERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             +   P+   E+IDEE LF+M  LL +MA GM++SPPRI+S   +DDSPENSD E+LW+Y
Sbjct  177  TQSTRPTTAEEFIDEEALFEMPKLLANMAEGMLLSPPRIDSGI-SDDSPENSDGESLWSY  235



>gb|EYU38993.1| hypothetical protein MIMGU_mgv1a019138mg [Erythranthe guttata]
Length=265

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 128/200 (64%), Gaps = 14/200 (7%)
 Frame = +1

Query  322  ENLLSPRLAEQ---GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGT  492
            E L SP+  ++   G + +A+ P  G GKH  YRG+RSRSGKWVSEIREP+KTTRIWLGT
Sbjct  64   ETLPSPKKVKKTAAGTSTSATRPAAGAGKHAVYRGIRSRSGKWVSEIREPKKTTRIWLGT  123

Query  493  YPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVP-------Vsseaadirraaasaa  651
            YP+PEMAAAAYDVAALAL+  + +LNFP  A+RYP P       +   AA         +
Sbjct  124  YPSPEMAAAAYDVAALALKGGDTLLNFPDRASRYPTPDSPSPQDIRRAAAAAAAMMKPES  183

Query  652  ammkpesssGDGGGSRQERKDDPSVNT---EYIDEEELFDMHNLLVDMAGGMMVSPPRIN  822
               +    +       +   +  ++ T   +++DEE LF M NLL+ MA GM+VSPPR+ 
Sbjct  184  GGDEAPPEAAAAAAGGEPPPNAEALTTGHDQFVDEEALFHMPNLLLSMAEGMLVSPPRMG  243

Query  823  SSHPADDSPENSDAETLWNY  882
             S P DDSPENSDAE+LW+Y
Sbjct  244  -SRPLDDSPENSDAESLWSY  262



>gb|AID51420.1| ethylene response factor 15 [Diospyros kaki]
Length=182

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 124/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAA AYDVAA AL+ +EAVLNF
Sbjct  16   GKHPVYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAATAYDVAAFALKGSEAVLNF  75

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR----QERKDDPSVNTEYI  741
            P +   YPVP SS  ADIR AAA+AAA    ++  G+   +            +   E+I
Sbjct  76   PDHVYSYPVPSSSSPADIRAAAAAAAAATAIKAEEGEKPAAEPGGGDGGGSASAAGDEFI  135

Query  742  DEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            DEE LFDM NLLVDMAGGM++SPPR+ S  P+ DSPENS+ E+LW+Y
Sbjct  136  DEEALFDMPNLLVDMAGGMLMSPPRMKSP-PSGDSPENSEGESLWSY  181



>ref|XP_007038584.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY23085.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=291

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 130/189 (69%), Gaps = 13/189 (7%)
 Frame = +1

Query  352  QGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydv  531
            Q    ++SS   G G+HP YRG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAA AYDV
Sbjct  103  QSPGRSSSSALPGSGRHPTYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAATAYDV  162

Query  532  aalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERK  711
            AA+AL+  +  LNFP     YP   S+ A+DIR AAASAAA   P+  +G    S+Q++ 
Sbjct  163  AAIALKGPDTDLNFPDMILSYPKAASTSASDIRAAAASAAASRLPKPDTGSSKDSKQDQG  222

Query  712  DDPSVNT------------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPEN  855
            +  +  T            E+IDEE L +  NLLV+MA GM++SPPRIN S P+DDSPE+
Sbjct  223  EPENEGTTSGSCMESGSGQEFIDEEALLNFPNLLVNMAEGMLISPPRIN-SPPSDDSPED  281

Query  856  SDAETLWNY  882
            SD E+LW Y
Sbjct  282  SDVESLWTY  290



>ref|XP_004298779.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Fragaria vesca subsp. vesca]
Length=279

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 129/206 (63%), Gaps = 20/206 (10%)
 Frame = +1

Query  325  NLLSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTP  504
             L +P+ A   Q  +    +   GKHP+YRG+R R  KWVSEIREPRKT RIWLGT+PTP
Sbjct  73   QLETPKEATAQQGKSTPMASSSSGKHPRYRGIRCRGEKWVSEIREPRKTKRIWLGTFPTP  132

Query  505  EMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGD  684
            EMAAAAYDVAALAL+  +A+LNFP     YPVP S  A DIR AA +AA     E++   
Sbjct  133  EMAAAAYDVAALALKREDAILNFPGSIKSYPVPASMSALDIRAAATAAATAAAAETTLKT  192

Query  685  GG---------GSRQERKDD----------PSVNTEYIDEEELFDMHNLLVDMAGGMMVS  807
             G         G +Q+  DD           SV  +++DEEE+F M NLLVDMA GM+VS
Sbjct  193  SGSRESTPSSVGQQQKEYDDMLSINSSALASSVGADFMDEEEIFGMPNLLVDMAEGMLVS  252

Query  808  PPRINSSHPADDSPENSD-AETLWNY  882
            PPRINS     DSPE SD  E+LWNY
Sbjct  253  PPRINSPPSDYDSPEYSDGGESLWNY  278



>ref|XP_011014148.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Populus euphratica]
Length=177

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+RSR GKWVSEIREPRKTTRIWLGT+P PEMAAAAYDVAALAL+   AVLNFP
Sbjct  10   RHPMYHGIRSRGGKWVSEIREPRKTTRIWLGTFPKPEMAAAAYDVAALALKGNGAVLNFP  69

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD------PSVNTEY  738
            + A  YPVP ++ + DIR AAA+AAA  K E S  +    +     +       S   E+
Sbjct  70   SSAGTYPVPATASSTDIRNAAAAAAAFKKAELSYNEALVDQPGNDHNAIGAYLASSGEEF  129

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +DEE LFDM NLLVDMAGGM++SPPRI +S P+DDS  NSD E+LW+Y
Sbjct  130  VDEEALFDMPNLLVDMAGGMLLSPPRI-TSPPSDDSQGNSDGESLWSY  176



>gb|KFK40547.1| hypothetical protein AALP_AA2G010100 [Arabis alpina]
Length=382

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            A  S    GR KHP YRG+R RSGKWVSEIREP+KTTR+WLGTY T EMAAAAYDV ALA
Sbjct  210  ATDSGTNSGRQKHPLYRGIRCRSGKWVSEIREPKKTTRVWLGTYRTQEMAAAAYDVGALA  269

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD--  717
            L+  EAVLNFP     YP+PVSS AA IR AA      +   ++   G   ++E   D  
Sbjct  270  LKGGEAVLNFPESVGTYPLPVSSAAAHIRIAAXXXXXAVGAAAAV-KGSEKKEEGVFDVA  328

Query  718  PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             S   E++DEEEL +M  LLVDMA GMMV+PP I S  P+DDSPENSD E+LW+Y
Sbjct  329  ESSTMEFVDEEELLNMPGLLVDMAKGMMVAPPWIGSP-PSDDSPENSDGESLWSY  382


 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 98/150 (65%), Gaps = 9/150 (6%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            K   YRG+R R+GKWV+EIR P+K  RIWLGTYPTP MAA A+DVAALAL+  EA+LNFP
Sbjct  29   KQHVYRGIRYRNGKWVTEIRVPKKNKRIWLGTYPTPVMAATAHDVAALALKGREALLNFP  88

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT------EY  738
              A  YP+P S+  A I+ AA +AAA + P + +  G  +  E+ +D   +       E+
Sbjct  89   DSAQFYPLPCSNSDAHIKTAATAAAAAVAPAAIA-IGEVTGDEKNEDGVCDAVGYSTREF  147

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRINSS  828
            ++EEE  +MH L+VD+   MMV PP   S+
Sbjct  148  LEEEE--NMHTLIVDLERAMMVDPPLSGSA  175



>emb|CDY50740.1| BnaC09g51170D [Brassica napus]
Length=180

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 124/171 (73%), Gaps = 8/171 (5%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAALAL+  EAVLN
Sbjct  11   RKKHPFYRGIRCRSGKWVSEIREPKKTTRVWLGTYSTPEMAAAAYDVAALALKGGEAVLN  70

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssG-----DGGGSRQERKDD--PSVN  729
            FP     YP+PVSS AA IR AAA AAA +   +++       GG  ++E+  D   S  
Sbjct  71   FPESIGSYPLPVSSSAAHIRTAAAKAAATVGAAAAAAVNAAMKGGEKKEEKVCDGAGSSA  130

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E++DEEEL +M  LL DMA GMMV+PP +    P+DDSPENSD E+LW+Y
Sbjct  131  VEFVDEEELLNMPGLLEDMAKGMMVAPPWMGCP-PSDDSPENSDGESLWSY  180



>ref|XP_011014149.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Populus euphratica]
 ref|XP_011014150.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Populus euphratica]
Length=177

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 124/168 (74%), Gaps = 7/168 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+RSR GKWVSEIREPRKTTRIWLGT+P PEMAAAAYDVAALAL+   AVLNFP
Sbjct  10   RHPMYHGIRSRGGKWVSEIREPRKTTRIWLGTFPKPEMAAAAYDVAALALKGNGAVLNFP  69

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD------PSVNTEY  738
            + A  YPVP ++ + DIR+AAA+AAA+ K E S  +    +     +       S   E+
Sbjct  70   SSAGTYPVPATASSTDIRKAAAAAAAVKKAELSYNEALVDQPGNDHNAIGAYLASSGEEF  129

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +DEE LFDM NLLVDMAGGM++SPPRI +S P+DDS  NSD E+LW+Y
Sbjct  130  VDEEALFDMPNLLVDMAGGMLLSPPRI-TSPPSDDSQGNSDGESLWSY  176



>ref|XP_002298066.1| AP2 domain-containing family protein [Populus trichocarpa]
 gb|EEE82871.1| AP2 domain-containing family protein [Populus trichocarpa]
Length=177

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 9/169 (5%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+R R GKWVSEIREPRKTTRIWLGT+P PEMAAAAYDVAALAL+   AVLNFP
Sbjct  10   RHPMYHGIRCRGGKWVSEIREPRKTTRIWLGTFPKPEMAAAAYDVAALALKGNGAVLNFP  69

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT-------E  735
            +    YPVP ++ + DIR AAA+AAA+ K E S  +     Q R D  ++         E
Sbjct  70   SSVGTYPVPATASSTDIRNAAAAAAALKKAELSYNE-ALVDQPRNDHNAIGAYLASSGEE  128

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEE LFDM NLLVDMAGGM++SPPRI +S P+DDS  NSD E+LW+Y
Sbjct  129  FVDEEALFDMPNLLVDMAGGMLLSPPRI-TSPPSDDSQGNSDGESLWSY  176



>emb|CDY45465.1| BnaC09g12830D [Brassica napus]
Length=248

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 118/182 (65%), Gaps = 9/182 (5%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            A   + PT  R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAAL
Sbjct  68   ATTEAGPTPRRKKHPIYRGIRCRSGKWVSEIREPKKTTRVWLGTYTTPEMAAAAYDVAAL  127

Query  541  alrsaEAVLNFPAYAARYPVPVsseaa--------dirraaasaaammkpesssGDGGGS  696
            AL+  EAVLNFP     YP+PVSS AA              A AAA     +  G     
Sbjct  128  ALKGREAVLNFPESVGSYPLPVSSSAAHIRMAAATAAATVGAEAAAAAANAAVKGREKEV  187

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLW  876
             +  +   S   E++DEEEL +MH LL +MA GMMV+PP I S  P+DDSPENS  E+LW
Sbjct  188  EEVAEVVGSSAMEFVDEEELLNMHGLLEEMAKGMMVAPPWIGSP-PSDDSPENSQEESLW  246

Query  877  NY  882
            +Y
Sbjct  247  SY  248



>ref|XP_007210477.1| hypothetical protein PRUPE_ppa026499mg [Prunus persica]
 gb|EMJ11676.1| hypothetical protein PRUPE_ppa026499mg [Prunus persica]
Length=184

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 127/178 (71%), Gaps = 15/178 (8%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+R R GKWVSEIREPRKT RIWLGT+PT EMAAAAYDVAALAL+ A+ VLNF
Sbjct  7    GKHPTYRGIRCRGGKWVSEIREPRKTKRIWLGTFPTAEMAAAAYDVAALALKGADVVLNF  66

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQ-ERKDDPSVNT------  732
            P +   YPVP S+ A DIR AAA+AAA ++    S +  G RQ + KDD +V+       
Sbjct  67   PGFIGSYPVPASTSAQDIRSAAAAAAATLRKNDDSRESPGQRQTDDKDDMTVSNSISLAS  126

Query  733  ----EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DDSPENSDA--ETLWNY  882
                +++DEEELF M NLL+DMA GM+VSPPR+N S P+  DDSP NSD     LW+Y
Sbjct  127  SSVGDFMDEEELFGMPNLLMDMAEGMLVSPPRMNDSPPSDYDDSPGNSDGGESLLWSY  184



>ref|XP_008238782.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Prunus mume]
Length=275

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 126/178 (71%), Gaps = 15/178 (8%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+R R GKWVSEIREPRKT RIWLGT+PT EMAAAAYDVAALAL+ A+ VLNF
Sbjct  98   GKHPTYRGIRCRGGKWVSEIREPRKTKRIWLGTFPTAEMAAAAYDVAALALKGADVVLNF  157

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQ-ERKDDPSVNT------  732
            P +   YPVP S+ A DI  AAA+AAA ++    S +  G RQ + KDD +V+       
Sbjct  158  PGFIGSYPVPASTSAQDICSAAAAAAATLRKNGDSRESPGQRQKDDKDDVTVSNSINLES  217

Query  733  ----EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DDSPENSDA--ETLWNY  882
                +++DEEELF M NLL+DMA GM+VSPPR+N S P+  DDSP NSD     LW+Y
Sbjct  218  SSVGDFMDEEELFGMPNLLMDMAEGMLVSPPRMNDSPPSDYDDSPGNSDGGESLLWSY  275



>ref|XP_002889943.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66202.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=192

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 124/187 (66%), Gaps = 16/187 (9%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            ASS  G R K P YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAAAAYDVAALAL+
Sbjct  6    ASSGLGSRRKDPAYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAYDVAALALK  65

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGD------GGGSRQERK  711
               AVLNFP  A  YPVP S  AADIR AAA+AAAM   E    +         S Q R 
Sbjct  66   GRGAVLNFPGSAQSYPVPESKSAADIRTAAAAAAAMKGCEEGEEEKEATEMNSSSSQLRA  125

Query  712  DDPSVN----------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
             +  VN          TE++DEEE+ +M NLL +MA GMMV+PP    S P+DDSPENS+
Sbjct  126  RESHVNNDVASSSWCGTEFMDEEEVLNMPNLLANMAEGMMVAPPSWMGSRPSDDSPENSN  185

Query  862  AETLWNY  882
             E LW Y
Sbjct  186  DEDLWGY  192



>ref|XP_009112987.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Brassica rapa]
Length=250

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 123/171 (72%), Gaps = 8/171 (5%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R  HP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAALAL+  EAVLN
Sbjct  81   RKNHPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYSTPEMAAAAYDVAALALKGGEAVLN  140

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssG-----DGGGSRQERKDD--PSVN  729
            FP     YP+PVSS AA IR AAA AAA +   +++       GG  ++E+  D   S  
Sbjct  141  FPESIGSYPLPVSSSAAHIRTAAAKAAATVGAAAAAAVNAAMKGGEKKEEKVCDGAGSSA  200

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E++DEEEL +M  LL DMA GMMV+PP +    P+DDSPE+SD E+LW+Y
Sbjct  201  VEFVDEEELLNMPGLLEDMAKGMMVAPPWMG-CPPSDDSPEDSDGESLWSY  250



>ref|XP_009764333.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Nicotiana sylvestris]
Length=267

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 120/178 (67%), Gaps = 14/178 (8%)
 Frame = +1

Query  379  PTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaE  558
            PTGG  KH  +RG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALAL+  +
Sbjct  94   PTGG--KHAVFRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALALKGGD  151

Query  559  AVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT--  732
            AV+NFP     Y   +    +      A+A+A    +  +G+G    Q   DD S  +  
Sbjct  152  AVINFPGNLTSY-PSLPPSPSPADIRKAAASAAALMKPQTGEGTMPTQPGNDDQSSGSAQ  210

Query  733  --------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                    EYIDEE LFDM NLLVDMA  MMVSPPR+NS  P+ DSP NSDAE+LW+Y
Sbjct  211  MISTDGGNEYIDEEALFDMPNLLVDMAEAMMVSPPRMNSPPPS-DSPGNSDAESLWSY  267



>emb|CDP05248.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 131/192 (68%), Gaps = 20/192 (10%)
 Frame = +1

Query  364  AAASSPTGGRG---KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            A   SPTG  G   +HP +RGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYD A
Sbjct  56   ATIPSPTGSGGPSRRHPHFRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDAA  115

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssG--DGGGSRQER  708
             LAL+  +A+LNFP  A  YP+P S  AAD+R AAASAAA  +P       D   +   R
Sbjct  116  TLALKGPDAILNFPELAPTYPIPASLSAADVRAAAASAAAAREPPQEPAVLDQAPATSPR  175

Query  709  -----KDDPSVNT---------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDS  846
                  +D + +T         +++DEEELFDM NLLVDMA GM+VSPPR+  +  + +S
Sbjct  176  DPVEINEDVNASTSGDNQMGQDQFVDEEELFDMPNLLVDMAEGMLVSPPRMKPAV-SGES  234

Query  847  PENSDAETLWNY  882
            PENSDA+ LW+Y
Sbjct  235  PENSDADNLWSY  246



>emb|CDY49203.1| BnaA09g10750D [Brassica napus]
Length=250

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R  HP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAALAL+  EAVLN
Sbjct  81   RKNHPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYSTPEMAAAAYDVAALALKGGEAVLN  140

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssG-----DGGGSRQERKDD--PSVN  729
            FP     YP+PVSS AA IR  AA AAA +   +++       GG  ++E+  D   S  
Sbjct  141  FPESIGSYPLPVSSSAAHIRTTAAKAAATVGAAAAAAVNAAMKGGEKKEEKVCDGAGSSA  200

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E++DEEEL +M  LL DMA GMMV+PP +    P+DDSPE+SD E+LW+Y
Sbjct  201  VEFVDEEELLNMPGLLEDMAKGMMVAPPWMG-CPPSDDSPEDSDGESLWSY  250



>ref|XP_006391788.1| hypothetical protein EUTSA_v10023678mg [Eutrema salsugineum]
 gb|ESQ29074.1| hypothetical protein EUTSA_v10023678mg [Eutrema salsugineum]
Length=224

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 125/179 (70%), Gaps = 7/179 (4%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            A  S     R KHP YRG+R R GKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALA
Sbjct  47   ATTSGTISRRKKHPVYRGIRCRGGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALA  106

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD---  714
            L+  +AVLNFP     YP PVSS AA IR AAA+AAA +   +++    G  ++ ++   
Sbjct  107  LKGGKAVLNFPDSVGSYPFPVSSSAAHIRIAAATAAATVGAAAANAAVKGGEKKGEETVC  166

Query  715  ---DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                 S   E++DEEEL +M  LL DMA GMMV+PP + S  P+DDSPENSD E+LW+Y
Sbjct  167  DVAGSSAYMEFVDEEELLNMPGLLADMAKGMMVAPPWMGSP-PSDDSPENSDGESLWSY  224



>gb|ABB45861.1| DRE-binding protein 3b [Gossypium hirsutum]
Length=221

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 117/179 (65%), Gaps = 18/179 (10%)
 Frame = +1

Query  388  GRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVL  567
            G G+H  YRG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAA AYDVAA+AL+  +  L
Sbjct  46   GSGRHSSYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAATAYDVAAIALKGPDTDL  105

Query  568  NFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQER---KDDPSVNT--  732
            NFP     YP      +       A+AA+         D G S+Q++   +++ + +T  
Sbjct  106  NFPDMILSYP---KVASTSAADIRAAAASAAASRLPMPDTGSSKQDQGNLQNEGTASTFS  162

Query  733  ---------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                     EYIDEEEL +  NL+VDMAGGM+V+PPRINS   +DDSPE SD E+LW Y
Sbjct  163  TCMESGSGQEYIDEEELLNFPNLMVDMAGGMLVTPPRINSLA-SDDSPEISDIESLWTY  220



>ref|XP_009112986.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Brassica rapa]
Length=250

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 122/171 (71%), Gaps = 8/171 (5%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R  HP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAALAL+  EAVLN
Sbjct  81   RKNHPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYSTPEMAAAAYDVAALALKGGEAVLN  140

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssG-----DGGGSRQERKDD--PSVN  729
            FP     YP+PVSS AA  R AAA AAA +   +++       GG  ++E+  D   S  
Sbjct  141  FPESIGSYPLPVSSSAAHTRPAAAKAAATVGAAAAAAVNAAMKGGEKKEEKVCDGAGSSA  200

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E++DEEEL +M  LL DMA GMMV+PP +    P+DDSPE+SD E+LW+Y
Sbjct  201  VEFVDEEELLNMPGLLEDMAKGMMVAPPWMG-CPPSDDSPEDSDGESLWSY  250



>ref|XP_002889951.1| hypothetical protein ARALYDRAFT_888596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66210.1| hypothetical protein ARALYDRAFT_888596 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 125/187 (67%), Gaps = 16/187 (9%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
             SS  G R K P YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAAAAYDVAALAL+
Sbjct  2    GSSSLGSRRKDPAYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAYDVAALALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaamm------kpesssGDGGGSRQERK  711
               AVLNFP  A  YPVP S  AADIR AAA+AAAM       + + ++     S Q R 
Sbjct  62   GRGAVLNFPGSAQSYPVPESKSAADIRTAAAAAAAMKGCEEGEEEKEATEKNSSSSQFRA  121

Query  712  DDPSVN----------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
             +  VN          TE++DEEE+ +M NLL +MA GMMV+PP    S P+DDSPENS+
Sbjct  122  RENHVNNEVASSSWCGTEFMDEEEVLNMPNLLANMAEGMMVAPPSWMGSRPSDDSPENSN  181

Query  862  AETLWNY  882
             E LW Y
Sbjct  182  DEDLWGY  188



>ref|XP_002509704.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
 gb|EEF51091.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
Length=245

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 127/190 (67%), Gaps = 21/190 (11%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            A A++ +    +HP YRG+RSRSGKWVSEIREPRKTTRIWLGT+ TPEMAAAAYDVAALA
Sbjct  59   AMATTSSAPNKRHPFYRGIRSRSGKWVSEIREPRKTTRIWLGTFATPEMAAAAYDVAALA  118

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD--  717
            L+  +A+LNFP     YPVP SS + DIR AA +AAA  + E +S +  G  Q R DD  
Sbjct  119  LKGGDAILNFPGSVGSYPVPASSSSTDIRNAAIAAAAFKRNEMNSQE-LGQLQARMDDHN  177

Query  718  ---------------PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE  852
                           P+ +  ++DEE LF M NLLVDMA GM++SPPRI SS   DDSP 
Sbjct  178  HTRTSSTTNLMSTTGPASDQGFVDEEALFHMPNLLVDMAEGMLLSPPRITSS---DDSPG  234

Query  853  NSDAETLWNY  882
             SD E LW+Y
Sbjct  235  TSDGENLWSY  244



>ref|XP_004245652.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Solanum lycopersicum]
Length=264

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 118/172 (69%), Gaps = 10/172 (6%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKH  +RG+R RSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAA+AL+  +AV+NF
Sbjct  94   GKHAVFRGIRCRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAAMALKGNDAVINF  153

Query  574  PAYAARYPV----PVsseaadirraaasaaammkpesssGDGGGSRQERKDD-----PSV  726
            P     YP     P +++       AA+   +   E++SG   G+   R         + 
Sbjct  154  PGNINSYPSLPPSPAAADIRKAAATAAALMKIESGETTSGTQPGTDDHRSLGNVHMMETR  213

Query  727  NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            + EYIDEE LFDM NLLVDMA  MMVSPPR++S   +DDSPE+SDAE LW+Y
Sbjct  214  DHEYIDEEALFDMPNLLVDMAEAMMVSPPRMSSPR-SDDSPEHSDAENLWSY  264



>ref|XP_002510845.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
 gb|EEF51447.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
Length=224

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 121/178 (68%), Gaps = 12/178 (7%)
 Frame = +1

Query  382  TGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEA  561
            +G  G+HP YRG+R RSGKWVSEIREPRKTTRIWLGTY TPEMAAAAYDVAALAL+  + 
Sbjct  47   SGQTGRHPIYRGIRCRSGKWVSEIREPRKTTRIWLGTYTTPEMAAAAYDVAALALKGPDT  106

Query  562  VLNFPAYAARYPVPVsseaad-irraaasaaammkpesssGDGGGSRQERKDDPSVNT--  732
             LNFP     YP+P+S+ A D    AA++AAA    + +  +  G R E K   + ++  
Sbjct  107  ALNFPESILSYPIPISTSATDIRAAAASAAAARQPNQETVSNPDGGRDEAKWKAATSSSG  166

Query  733  --------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                    E+IDEE   +  NLLVDMAG MMVSPPRIN+   +DDSP NSDAE LW+Y
Sbjct  167  TSRFESDQEFIDEEAFLNFPNLLVDMAGAMMVSPPRINTPS-SDDSPRNSDAEGLWSY  223



>ref|XP_010473532.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Camelina sativa]
 ref|XP_010473533.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Camelina sativa]
Length=255

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 114/177 (64%), Gaps = 22/177 (12%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + VLN
Sbjct  87   RKKHPLYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGRDTVLN  146

Query  571  FPAYAARYPVPVsseaa-------------dirraaasaaammkpesssGDGGGSRQERK  711
            FP     YP+P+SS AA                  A +     + E  + DG GS   + 
Sbjct  147  FPDSVGSYPIPLSSSAAHIRCAAAAAAAARGAGTGATAVKGGEEKEEEACDGAGSSNTQ-  205

Query  712  DDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                    ++DEEEL +M  LL DMA GMMV+PP + S  P+DDSPENSD E+LW+Y
Sbjct  206  -------HFVDEEELLNMPGLLADMAKGMMVAPPWMGSP-PSDDSPENSDGESLWSY  254



>ref|XP_009113026.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Brassica rapa]
Length=248

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            A   + PT  R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAAL
Sbjct  68   ATTEAGPTPRRKKHPIYRGIRCRSGKWVSEIREPKKTTRVWLGTYTTPEMAAAAYDVAAL  127

Query  541  alrsaEAVLNFPAYAARYPVPVsseaa--------dirraaasaaammkpesssGDGGGS  696
            AL+  EAVLNFP     YP+PVSS AA              A AAA     +        
Sbjct  128  ALKGREAVLNFPESVGSYPLPVSSSAAHIRMAAATAAATVGAEAAAAAANAAVKEGEKEV  187

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLW  876
             +  +   S   E++DEEEL +MH LL +MA GMMV+PP + S  P+DDSPENS  E+LW
Sbjct  188  EEVAEVVGSSAMEFVDEEELLNMHGLLEEMAKGMMVAPPWMGSP-PSDDSPENSQEESLW  246

Query  877  NY  882
            +Y
Sbjct  247  SY  248



>ref|XP_010430381.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Camelina sativa]
Length=256

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 124/169 (73%), Gaps = 6/169 (4%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + VLN
Sbjct  88   RKKHPLYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGRDTVLN  147

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDP----SVNTE-  735
            FP     YP+P+SS AA IR AAA+AAA     + +    G  ++ ++      S NT+ 
Sbjct  148  FPDSVGSYPIPLSSSAAHIRCAAAAAAAARGAGTGAAAVKGGEKKEEEACDGAGSSNTQH  207

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEEEL +M  LL DMA GMMV+PP + S  P+DDSPENSD E+LW+Y
Sbjct  208  FVDEEELLNMPGLLADMAKGMMVAPPWMGSP-PSDDSPENSDGESLWSY  255



>ref|XP_009591034.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Nicotiana tomentosiformis]
Length=268

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 117/173 (68%), Gaps = 12/173 (7%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP +RG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALAL+  +AV+NF
Sbjct  98   GKHPVFRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALALKGGDAVINF  157

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVN--------  729
            P     YP  +    +      A+A+A    +  +G+G    Q    D   +        
Sbjct  158  PGNLTSYPS-LPPSPSPADIRKAAASAAALMKPQTGEGTMLTQPGNVDDQTSGSGQMIST  216

Query  730  --TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
               EYIDEE LFDM NLLVDMA  MMVSPPR+NS  P+ DSP NSDAE+LW+Y
Sbjct  217  GGAEYIDEEALFDMPNLLVDMAEAMMVSPPRMNSP-PSSDSPGNSDAESLWSY  268



>emb|CDY45971.1| BnaA09g12950D [Brassica napus]
Length=248

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            A   + PT  R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAAL
Sbjct  68   ATTEAGPTPRRKKHPIYRGIRCRSGKWVSEIREPKKTTRVWLGTYTTPEMAAAAYDVAAL  127

Query  541  alrsaEAVLNFPAYAARYPVPVsseaa--------dirraaasaaammkpesssGDGGGS  696
            AL+  EAVLNFP     YP+PVSS AA              A AAA     +        
Sbjct  128  ALKGREAVLNFPESVGSYPLPVSSSAAHIRMAAATAAATVGAEAAAAAANAAVKEGEKEV  187

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLW  876
             +  +   S   E++DEEEL +MH LL +MA GMMV+PP + S  P+DDSPENS  E+LW
Sbjct  188  EEVAEVVGSSAMEFVDEEELLNMHGLLEEMAKGMMVAPPWMGSP-PSDDSPENSQEESLW  246

Query  877  NY  882
            +Y
Sbjct  247  SY  248



>ref|XP_004308116.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Fragaria vesca subsp. vesca]
Length=235

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 130/205 (63%), Gaps = 27/205 (13%)
 Frame = +1

Query  316  DIENLLSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTY  495
            D+  L SP     G  + +SSP   RG+HP YRG+RSRSGKWVSEIREPRK+TRIWLGTY
Sbjct  42   DLSGLRSP----TGGGSVSSSP---RGRHPLYRGIRSRSGKWVSEIREPRKSTRIWLGTY  94

Query  496  PTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpess  675
              PEMAAAAYDVAA+AL+  +  LNFP+    YP+P SS A+DIR AAA AAA       
Sbjct  95   AMPEMAAAAYDVAAIALKGPDTALNFPSALITYPIPTSSAASDIRAAAARAAASRAEVIR  154

Query  676  sGD---GGGSRQ-------------ERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVS  807
             G+    GG                   DD   + E++DEE L +M NLL DMA GM+VS
Sbjct  155  QGESSSAGGVENVDRSGGGRGRRAAVTSDDGGGSQEFMDEEALLNMPNLLADMAEGMLVS  214

Query  808  PPRINSSHPADDSPENSDAETLWNY  882
            PPR     PA+DSPENSD E+LW+Y
Sbjct  215  PPR----GPANDSPENSDGESLWSY  235



>emb|CDP09812.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 118/179 (66%), Gaps = 18/179 (10%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            KHP YRG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAA+AL+ ++  LNFP
Sbjct  17   KHPMYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAAIALKGSDIALNFP  76

Query  577  AYAARYPVPVs-seaadirraaasaaammkpesssGDGGGSRQERKDDPSVN--------  729
               + YP P S S +     AA +A  M +  +  GD  G     ++ P  +        
Sbjct  77   DRVSSYPAPASPSPSDIRSAAAGAAEMMKEKTAGGGDDDGKFPHDQNQPGSSDHQELAFD  136

Query  730  --------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                     E+ID E L DM NLLVDMA GM+VSPPRI+S  P+ DSPE+SD ++LW+Y
Sbjct  137  QDRGLAGEDEFIDVEALIDMPNLLVDMAEGMLVSPPRIHSP-PSSDSPEHSDVDSLWSY  194



>ref|XP_006421847.1| hypothetical protein CICLE_v10005869mg [Citrus clementina]
 ref|XP_006490322.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Citrus sinensis]
 gb|ESR35087.1| hypothetical protein CICLE_v10005869mg [Citrus clementina]
 gb|KDO60104.1| hypothetical protein CISIN_1g028004mg [Citrus sinensis]
Length=215

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 120/167 (72%), Gaps = 4/167 (2%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            +G+HP YRG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALAL+  E  LN
Sbjct  49   KGRHPSYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALALKGPETPLN  108

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPS---VNTEYI  741
            FP     YP+P S+ A+DIR AAA AAA     S  G      +E +   S   +  E++
Sbjct  109  FPNMIISYPIPASTSASDIRAAAAQAAAARGSGSEPGPVQKESKESEGTSSSTCMGQEFV  168

Query  742  DEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            DE EL +M NLLVDMA GM+VSPPRI++   +DDS  NS  E+LW+Y
Sbjct  169  DEYELLNMPNLLVDMAEGMLVSPPRIDTPS-SDDSAGNSAEESLWSY  214



>ref|XP_002862682.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38940.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R K P YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAALAL+  + VLN
Sbjct  38   RKKRPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYTTPEMAAAAYDVAALALKGGDTVLN  97

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDP--SVNTEYID  744
            FP     YP P+SS AA IR AAA+AAA     +++  GG  ++E   D   S    ++D
Sbjct  98   FPDSVGSYPSPLSSSAAHIRCAAAAAAAARGAAAAAVKGGEKKEEEVCDTAGSSTMGFVD  157

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            EEEL +M  LL DMA GMMV+PP +  S P+DDSPENSD E+LW+Y
Sbjct  158  EEELLNMPGLLADMAKGMMVAPPWMG-SPPSDDSPENSDGESLWSY  202



>ref|XP_002318847.2| AP2 domain-containing family protein [Populus trichocarpa]
 gb|EEE97067.2| AP2 domain-containing family protein [Populus trichocarpa]
Length=282

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 121/172 (70%), Gaps = 10/172 (6%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+HP Y+G+R RSGKWVSEIREPRKTTR+WLGTYPTPEMAAAAYD AALAL+  +  LNF
Sbjct  111  GRHPSYKGIRLRSGKWVSEIREPRKTTRVWLGTYPTPEMAAAAYDAAALALKGPDTPLNF  170

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDG---------GGSRQERKDDPSV  726
            P     YP+P S+ ++DIR AAASAA+   P   +G           G S      D   
Sbjct  171  PESILSYPIPASASSSDIRAAAASAASSRSPRPEAGPNPERDRLETEGTSSSTTTADIQS  230

Query  727  NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
              E+IDEEEL ++ +LLVDMAGGM+VSPPRIN+   +DDSP NSDAE LW+Y
Sbjct  231  GQEFIDEEELLNLPSLLVDMAGGMLVSPPRINTPS-SDDSPGNSDAENLWSY  281



>gb|ABB45860.1| DRE-binding protein 3a [Gossypium hirsutum]
Length=226

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 115/166 (69%), Gaps = 9/166 (5%)
 Frame = +1

Query  409  YRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAA  588
            YRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAA AYDVAALAL+  +A LNFP    
Sbjct  61   YRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAATAYDVAALALKGPDAELNFPDMVH  120

Query  589  RYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT--------EYID  744
             YP  V S +A   RAAA++AA  +    S    GS  + +D  S           E+ID
Sbjct  121  SYPK-VGSTSATDIRAAAASAAASRLLPKSVTNTGSLSKNEDTTSTTAMEITCSGQEFID  179

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            EEEL +  NL+VDMAGGM+VSPP   +S P+DDSP+NSD +TLW Y
Sbjct  180  EEELLNFPNLVVDMAGGMLVSPPNWINSPPSDDSPDNSDVDTLWTY  225



>ref|XP_010418311.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
isoform X2 [Camelina sativa]
Length=259

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 116/178 (65%), Gaps = 24/178 (13%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + VLN
Sbjct  91   RKKHPLYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGRDTVLN  150

Query  571  FPAYAARYPVPVsse-------------aadirraaasaaammkpesssGDGGGSRQERK  711
            FP     YP+P+SS              A      AA+     + E  + DG GS     
Sbjct  151  FPDSVGSYPIPLSSSAAHIRCAAAAAAAARGACTGAAAVKGGEEKEEEACDGAGSS----  206

Query  712  DDPSVNTE-YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                 NT+ ++DEEEL +M  LL DMA GMMV+PP + S  P+DDSPENSD E+LW+Y
Sbjct  207  -----NTQLFVDEEELLNMPGLLADMAKGMMVAPPWMGSP-PSDDSPENSDGESLWSY  258



>ref|XP_002887983.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64242.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=248

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 120/166 (72%), Gaps = 3/166 (2%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R K P YRG+R RSGKWVSEIREP+KTTR+WLGTY TPEMAAAAYDVAALAL+  + VLN
Sbjct  84   RKKRPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYTTPEMAAAAYDVAALALKGGDTVLN  143

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDP--SVNTEYID  744
            FP     YP P+SS AA IR AAA+AAA     +++  GG  ++E   D   S    ++D
Sbjct  144  FPDSVGSYPSPLSSSAAHIRCAAAAAAAARGAAAAAVKGGEKKEEEVCDTAGSSTMGFVD  203

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            EEEL +M  LL DMA GMMV+PP + S  P+DDSPENSD E+LW+Y
Sbjct  204  EEELLNMPGLLADMAKGMMVAPPWMGSP-PSDDSPENSDGESLWSY  248



>ref|XP_010546017.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF027 [Tarenaya hassleriana]
Length=184

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 120/172 (70%), Gaps = 9/172 (5%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R +HP YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAA AYDVAALAL+  EAVLN
Sbjct  14   RKRHPVYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAATAYDVAALALKGGEAVLN  73

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGG----GSRQERKDDPSV---N  729
            FP  A   PVP SS AADIR AAA+AAA    +   G  G     +R+            
Sbjct  74   FPESATSSPVPGSSSAADIRIAAAAAAASAVVKKEEGKSGLASPAARESHGGGDQAAGPG  133

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD-AETLWNY  882
            TE++DEE + +MHNLL DMA GM+V PP +  S P+DDSPENSD  ++LW+Y
Sbjct  134  TEFVDEEAILNMHNLLADMAEGMLVPPPWM-VSPPSDDSPENSDGGDSLWSY  184



>sp|Q9CAN9.1|ERF26_ARATH RecName: Full=Ethylene-responsive transcription factor ERF026 
[Arabidopsis thaliana]
 gb|AAG51609.1|AC010795_13 transcription factor DREB1A, putative; 22554-23300 [Arabidopsis 
thaliana]
 gb|AAT44909.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
Length=248

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R K+P YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + +LN
Sbjct  84   RKKNPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGGDTLLN  143

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTE--YID  744
            FP     YP+P+SS AA IR AAA+AAA      ++   G  ++++  D + ++   ++D
Sbjct  144  FPDSLGSYPIPLSSSAAHIRCAAAAAAATRGAAGAAVKVGQKKEDKVYDTAESSTMGFVD  203

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            EEEL +M  LL DMA GMMV+PP +  S P+DDSPENSD E+LW+Y
Sbjct  204  EEELLNMPGLLADMAKGMMVAPPWMG-SPPSDDSPENSDGESLWSY  248



>ref|XP_004240742.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Solanum lycopersicum]
Length=178

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 121/174 (70%), Gaps = 18/174 (10%)
 Frame = +1

Query  376  SPTGGRG--KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            SPTGG    +HP +RG+R R+GKWVSEIREPRKTTRIWLGT+P PEMAA AYDVAALAL+
Sbjct  17   SPTGGGSSTRHPNFRGIRQRNGKWVSEIREPRKTTRIWLGTFPIPEMAAVAYDVAALALK  76

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammk---pesssGDGGGSRQERKDDP  720
              +A LNFP  A  YPVP S  AADIR AAA+AAA       E ++  GGG  QE     
Sbjct  77   GPDAQLNFPDRAYSYPVPASLSAADIRTAAANAAAARAPPLSEINTAAGGGQGQE-----  131

Query  721  SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                 ++DEEE+F M  LL DMA  M+VSPPR+   H  D+SPENSDA++LW Y
Sbjct  132  -----FVDEEEIFGMPKLLDDMAEAMLVSPPRM---HQYDESPENSDADSLWGY  177



>ref|XP_010418310.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
isoform X1 [Camelina sativa]
Length=254

 Score =   138 bits (348),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 116/178 (65%), Gaps = 24/178 (13%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R KHP YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + VLN
Sbjct  86   RKKHPLYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGRDTVLN  145

Query  571  FPAYAARYPVPVsse-------------aadirraaasaaammkpesssGDGGGSRQERK  711
            FP     YP+P+SS              A      AA+     + E  + DG GS     
Sbjct  146  FPDSVGSYPIPLSSSAAHIRCAAAAAAAARGACTGAAAVKGGEEKEEEACDGAGSS----  201

Query  712  DDPSVNTE-YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                 NT+ ++DEEEL +M  LL DMA GMMV+PP + S  P+DDSPENSD E+LW+Y
Sbjct  202  -----NTQLFVDEEELLNMPGLLADMAKGMMVAPPWMGSP-PSDDSPENSDGESLWSY  253



>ref|XP_006358864.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Solanum tuberosum]
Length=188

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 114/173 (66%), Gaps = 12/173 (7%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKH  +RG+R RSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAA+AL+  +AV+NF
Sbjct  18   GKHAVFRGIRCRSGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAAMALKGNDAVINF  77

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD----------PS  723
            P     YP  +    A      A+A A    +  +G+     Q   DD           +
Sbjct  78   PGNINSYPS-LPPSPAAADIRKAAATAAALMKIETGETTSGTQPGTDDHQSSGSVHMMET  136

Query  724  VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             + EYIDEE LFDM NLLVDMA  MMVSPPR++S   +DDSP +SDAE LW+Y
Sbjct  137  RDHEYIDEEALFDMPNLLVDMAEAMMVSPPRMSSPR-SDDSPGHSDAENLWSY  188



>ref|XP_011072131.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Sesamum 
indicum]
Length=233

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 135/192 (70%), Gaps = 20/192 (10%)
 Frame = +1

Query  331  LSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEM  510
            +SP ++  G   + S PT   GKHP YRG+RSRSGKWVSEIREPRKTTRIWLGTYP+PEM
Sbjct  53   ISPAISTGG---STSRPT--TGKHPIYRGIRSRSGKWVSEIREPRKTTRIWLGTYPSPEM  107

Query  511  aaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGG  690
            AAAAYDVAALAL+ ++AVLNFP +   YPVP S    DIRRAAA AA +M+ E    DG 
Sbjct  108  AAAAYDVAALALKGSDAVLNFPDHVGSYPVPSSPSPLDIRRAAAGAAELMRDE----DG-  162

Query  691  GSRQERKDDP--------SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDS  846
              R  RKD+         S + E+IDEE LF M NLL+DMA GM++SPPR+ S  P D+S
Sbjct  163  --RDYRKDETVGNAESMISGDDEFIDEEALFHMPNLLMDMAEGMLLSPPRMGSPPPWDES  220

Query  847  PENSDAETLWNY  882
            P N D E LW+Y
Sbjct  221  PANFDGERLWSY  232



>ref|XP_009398861.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Musa acuminata subsp. malaccensis]
Length=230

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 118/175 (67%), Gaps = 14/175 (8%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            KHP YRG+R RSGKWVSEIREPRK +RIWLGTYPT EMAA AYDVAA ALR  +AVLNFP
Sbjct  56   KHPSYRGIRYRSGKWVSEIREPRKASRIWLGTYPTAEMAAVAYDVAAYALRGRDAVLNFP  115

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-------------QERKDD  717
               A  PVP S+  A IR AAA AAA + P + +GDG  +                    
Sbjct  116  DEIASRPVPASASPAHIRMAAAEAAASLMPRTGAGDGSTAASHHHHQQQQQQVGSHSGSS  175

Query  718  PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            P    +Y+DEEE+FDM  LLV+MA GM++SPPR+ S H ++DSPE S+ E+LW+Y
Sbjct  176  PGTEGQYVDEEEIFDMPQLLVNMAEGMLMSPPRL-SPHGSEDSPEASEGESLWSY  229



>ref|XP_011076239.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF025 [Sesamum indicum]
Length=193

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 116/174 (67%), Gaps = 6/174 (3%)
 Frame = +1

Query  367  AASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalal  546
            A +SPT  R  HP YRG+R RSGKWVSEIREPRKTTR+WLGTYPTPEMAAAAYDVAALAL
Sbjct  23   AIASPTSRR--HPVYRGIRCRSGKWVSEIREPRKTTRVWLGTYPTPEMAAAAYDVAALAL  80

Query  547  rsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV  726
            +  +A++NFP  A+ YP+P S  A DI  AA  A      +      G         P  
Sbjct  81   KGPDALINFPGLASSYPLPASHSAGDIHAAAXLAPRSGGDQIQFQPPGNEASSSAQTP--  138

Query  727  NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD-DSPEN-SDAETLWNY  882
              E++DEE LFDM  LLVDMA GM+VSPPR+  S   D +SPEN S  ++LW+Y
Sbjct  139  GNEFVDEEALFDMPKLLVDMAEGMLVSPPRLMKSGAEDEESPENYSRNDSLWSY  192



>gb|KDP25513.1| hypothetical protein JCGZ_20669 [Jatropha curcas]
Length=226

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 117/166 (70%), Gaps = 7/166 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+RSRSGKWVSEIREPRKTTRIWLGTY TPEMAAAAYDVAALAL+  +AVLNFP
Sbjct  63   RHPIYRGIRSRSGKWVSEIREPRKTTRIWLGTYQTPEMAAAAYDVAALALKGGDAVLNFP  122

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssG----DGGGSRQERKDDPSVNTEYID  744
                 YPVP SS   DIR AAA+AAA    E +            +   +  + + E++D
Sbjct  123  NSVGSYPVPASSSPTDIRNAAAAAAAFKNAEMNQRPLILQARSDHELSANFTASDQEFVD  182

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            EE LFDM NLLVDMA GM++SPPRI SS   DDS   SD E+LW+Y
Sbjct  183  EEALFDMPNLLVDMAEGMLLSPPRITSS---DDSLGTSDGESLWSY  225



>ref|XP_009377922.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
 ref|XP_009344262.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
Length=265

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 129/195 (66%), Gaps = 15/195 (8%)
 Frame = +1

Query  343  LAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaa  522
            L  Q     A+  +   GKHP+YRG+R R GKWVSEIREPRKT RIWLGT+PTPEMAAAA
Sbjct  70   LQVQTLPKPATMASSSSGKHPRYRGIRCRGGKWVSEIREPRKTKRIWLGTFPTPEMAAAA  129

Query  523  ydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG---GG  693
            YDVAALAL+  +  LNFP+    YPVP S+ A DIR AA +AAA ++  S S +    G 
Sbjct  130  YDVAALALKGTDVALNFPSLIGSYPVPPSTSALDIRTAATTAAAALQKNSYSMESPKMGQ  189

Query  694  SRQERKDDPSVNTE--------YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DD  843
             ++   DD  +++         ++DEEELF M NLLVDMA GM+VSPPR+N S P+  DD
Sbjct  190  MQKHEVDDMMMSSTSLASSVGYFMDEEELFQMPNLLVDMAEGMLVSPPRMNDSLPSDYDD  249

Query  844  SPENSDAET--LWNY  882
            SP NSD     LW+Y
Sbjct  250  SPGNSDGREGRLWSY  264



>ref|XP_006340524.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Solanum tuberosum]
Length=192

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 111/173 (64%), Gaps = 6/173 (3%)
 Frame = +1

Query  376  SPTGGR----GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            SPTGG      +HP +RG+R R+GKWVSEIREPRKTTRIWLGT+P PEMAA AYDVAALA
Sbjct  21   SPTGGTLLSPRRHPNFRGIRQRNGKWVSEIREPRKTTRIWLGTFPNPEMAAVAYDVAALA  80

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPS  723
            L+  +A LNFP  A  YP+P     +     AA+A A         +   +         
Sbjct  81   LKGPDAQLNFPDCAYSYPIPA--SLSAADIRAAAANAAAARAPPLSEFSTAGGTAAAAAG  138

Query  724  VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
               E++DEEE+F M  LL DMA  M+VSPPR++ S   D+SPENSDA++LW+Y
Sbjct  139  GGQEFVDEEEIFGMPKLLDDMAEAMLVSPPRMHQSTSYDESPENSDADSLWSY  191



>ref|XP_010458692.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Camelina sativa]
Length=191

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 124/190 (65%), Gaps = 19/190 (10%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            ++S    R K P YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAAAAYDVAA+AL+
Sbjct  2    SASGLASRKKDPVYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAYDVAAMALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG------------  693
              EAVLNFP  A  YPVPVS+ AADIR AAA+AA++                        
Sbjct  62   GREAVLNFPESARSYPVPVSTSAADIRTAAAAAASVKGCTEEGEVEKEAKKKKSSSNSSK  121

Query  694  --SRQERKDDPS-----VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE  852
              +R+   D+ +       TE++DE+E+ +M NLL +MA GMM++PP    S P+DDSPE
Sbjct  122  SRARECHVDNDAGSSSWCGTEFMDEDEVLNMPNLLANMAEGMMLAPPSWMDSRPSDDSPE  181

Query  853  NSDAETLWNY  882
            NS+ E LW Y
Sbjct  182  NSNDEDLWGY  191



>ref|XP_010476233.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Camelina sativa]
Length=192

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 125/191 (65%), Gaps = 20/191 (10%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            ++S    R K P YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAAAAYDVAA+AL+
Sbjct  2    SASDLASRKKDPVYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAYDVAAMALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG------------  693
              EAVLNFP  A  YPVPVS+ AADIR AAA+AA++       G                
Sbjct  62   GREAVLNFPESARSYPVPVSTSAADIRTAAAAAASVKGCTEEVGKEEKEAKKKKSSSNSS  121

Query  694  ---SRQERKDDPS-----VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSP  849
               +R+   D+ +       TE++DE+E+ +M NLL +MA GMM++PP    S P+DDSP
Sbjct  122  KSRAREWHVDNDAGSSSWCGTEFMDEDEVLNMPNLLANMAEGMMLAPPSWMDSRPSDDSP  181

Query  850  ENSDAETLWNY  882
            ENS+ E LW Y
Sbjct  182  ENSNDEDLWGY  192



>ref|XP_002865890.1| AP2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42149.1| AP2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 123/179 (69%), Gaps = 8/179 (4%)
 Frame = +1

Query  367  AASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalal  546
            A  +PTG  GKH  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAALAL
Sbjct  51   ARRTPTGLSGKHSVFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVAALAL  110

Query  547  rsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGD------GGGSRQER  708
            +  +AVLNFP  A  Y  PV S +A   RAAAS AA MK     GD      G   ++E 
Sbjct  111  KGPDAVLNFPGLALTYVAPV-SNSAADIRAAASRAAEMKQPDPGGDEKVLEPGQPGKKEE  169

Query  709  KDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDSPENSDAETLWNY  882
            +++ S + E++DEE + +M  LL +MA GM++SPPR+  +    DDSPEN + + LW+Y
Sbjct  170  EEEVSCSLEFMDEEAMLNMPTLLTEMAEGMLMSPPRMMITPTVEDDSPENHEGDNLWSY  228



>ref|XP_009341264.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
Length=244

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 112/169 (66%), Gaps = 12/169 (7%)
 Frame = +1

Query  400  HPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPA  579
            HP YRG+R RSGKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAA+AL+     LNFP 
Sbjct  80   HPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPKPEMAAAAYDVAAIALKGPNTPLNFPN  139

Query  580  YAARYPVPVsseaadirraaasaaammkpess--------sGDGGGSRQERKDDPSVNTE  735
                YP+P SS A++IR AAA AA                  + GG   ER        E
Sbjct  140  SILTYPIPASSAASEIRSAAARAAQSRANMLVPRGRESGGRSEPGGVDNERGVVGQQEEE  199

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEE L +M NLLVDMA GM+VSPPRI+S    D+SPENS+ E LWNY
Sbjct  200  FMDEEALLNMPNLLVDMAEGMLVSPPRISS----DNSPENSNGENLWNY  244



>ref|XP_009339653.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
Length=284

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 125/182 (69%), Gaps = 15/182 (8%)
 Frame = +1

Query  382  TGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEA  561
            +   GKHP+Y G+R R GKWVSEIREPRKT RIWLGT+PTPEMAAAAYDVAAL+L+    
Sbjct  102  SSSSGKHPRYHGIRCRGGKWVSEIREPRKTKRIWLGTFPTPEMAAAAYDVAALSLKGTNI  161

Query  562  VLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG---GGSRQERKDDPSVNT  732
             LNFP++   YPVP S+ A DIR AAA+AAA ++  S   +    G  ++   DD  +++
Sbjct  162  ALNFPSFIGLYPVPPSTSAIDIRTAAATAAAALRKNSDPMESPKMGQMQKHEGDDMMMSS  221

Query  733  --------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DDSPENSDAET--LW  876
                    ++IDEEELF M NLLVDMA GM+VSPPR+N S P+  DDSP NSD     LW
Sbjct  222  TSLASSVGDFIDEEELFQMPNLLVDMAEGMLVSPPRMNDSPPSDYDDSPGNSDGGEGRLW  281

Query  877  NY  882
            +Y
Sbjct  282  SY  283



>ref|XP_008381395.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Malus domestica]
Length=264

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 126/195 (65%), Gaps = 15/195 (8%)
 Frame = +1

Query  343  LAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaa  522
            L  Q     A+  +   GKHP+YRG+R R GKWVSEIREPRKT RIWLGT+PTPEMAAAA
Sbjct  70   LQVQTLPKLATMASSSSGKHPRYRGIRCRGGKWVSEIREPRKTKRIWLGTFPTPEMAAAA  129

Query  523  ydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG---GG  693
            YDVAAL L+  +  LNFP+    YPVP S+ A DIR AA +AAA ++  S   +    G 
Sbjct  130  YDVAALTLKGTDVALNFPSLIGSYPVPPSTSALDIRTAATTAAAALRNNSDQMESPKMGQ  189

Query  694  SRQERKDDPSVNTE--------YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DD  843
             ++   DD  +++         ++DEEELF M NLLVDMA GM+VSPPR+N S P+  DD
Sbjct  190  MQKHEVDDMMMSSTSLASSVGYFMDEEELFQMPNLLVDMAEGMLVSPPRMNDSPPSDYDD  249

Query  844  SPENSDAET--LWNY  882
             P NSD     LW+Y
Sbjct  250  LPGNSDGREGRLWSY  264



>ref|XP_009364170.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
 ref|XP_009364177.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
Length=284

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 125/182 (69%), Gaps = 15/182 (8%)
 Frame = +1

Query  382  TGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEA  561
            +   GKHP+Y G+R R GKWVSEIREPRKT RIWLGT+PTPEMAAAAYDVAAL+L+    
Sbjct  102  SSSSGKHPRYHGIRCRGGKWVSEIREPRKTKRIWLGTFPTPEMAAAAYDVAALSLKGTNI  161

Query  562  VLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG---GGSRQERKDDPSVNT  732
             LNFP++   YPVP S+ A DIR AA++AAA ++  S   +    G  ++   DD  +++
Sbjct  162  ALNFPSFIGLYPVPPSTSAIDIRTAASTAAAALRKNSDPMESPKMGQMQKHEGDDMMMSS  221

Query  733  --------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSDAET--LW  876
                    ++IDEEELF M NLLVDMA GM+VSPPR+N S P+D  DSP NSD     LW
Sbjct  222  TSFASSVGDFIDEEELFQMPNLLVDMAEGMLVSPPRMNDSPPSDYGDSPGNSDGGEGRLW  281

Query  877  NY  882
            +Y
Sbjct  282  SY  283



>ref|XP_008377078.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Malus domestica]
Length=235

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 116/171 (68%), Gaps = 14/171 (8%)
 Frame = +1

Query  400  HPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPA  579
            HP YRG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAA+AL+  +  LNFP 
Sbjct  69   HPVYRGIRCRNGKWVSEIREPRKTTRIWLGTYPKPEMAAAAYDVAAIALKGPDTPLNFPN  128

Query  580  YAARYPVPVsseaadirraaasaaammkpesssGD---GGGSRQERKDDPSVN-------  729
                YP+P SS A+DIR AAA AA     +    +   GG S     D+  V        
Sbjct  129  SILTYPIPASSAASDIRSAAARAAQSRANKLVPRERESGGRSEPGSVDNEGVGGVVGQQE  188

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E++DEE L +M NLLVDMA GM+VSPPRI+S    D+SPENSD E LWNY
Sbjct  189  EEFMDEEALLNMPNLLVDMAEGMLVSPPRISS----DNSPENSDGENLWNY  235



>ref|XP_009371279.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Pyrus x bretschneideri]
Length=228

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 117/177 (66%), Gaps = 15/177 (8%)
 Frame = +1

Query  385  GGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAV  564
            G   +HP YRG+R RSGKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAA+AL+  +  
Sbjct  56   GSSRRHPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPKPEMAAAAYDVAAIALKGPDTP  115

Query  565  LNFPAYAARYPVPVsseaadirraaasaaammkpesssGD---GGGSRQERKDDPSV---  726
            LNFP     YP+P SS A+DIR AAA AA       +  +   GG S     D+      
Sbjct  116  LNFPNSILTYPIPASSAASDIRSAAARAAQSRADMLAPQERESGGRSAPSGVDNEGGGGG  175

Query  727  -----NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                   EY+DEEEL +M NLLVDMA GM+VSPPRI+S    D+SP NSD E LW+Y
Sbjct  176  VVSQQQEEYMDEEELLNMPNLLVDMAEGMLVSPPRISS----DNSPGNSDGENLWSY  228



>ref|XP_010494434.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Camelina 
sativa]
Length=191

 Score =   130 bits (328),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 125/190 (66%), Gaps = 19/190 (10%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            ++S    R K P YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAAAAYDVAA+AL+
Sbjct  2    SASGLASRKKDPVYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAYDVAAMALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG------------  693
              EAVLNFP  A  YPVPVS+ AADIR AAA+AA++        +               
Sbjct  62   GREAVLNFPESARSYPVPVSTSAADIRTAAAAAASVKGCTEEGEEEKEAKKKKSSSNSSK  121

Query  694  --SRQERKDDPS-----VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE  852
              +R+   D+ +       TE++DE+E+ +M NLL +MA GMM++PP    S P+DDSP+
Sbjct  122  SRARECHVDNDAGSSSWCGTEFMDEDEVLNMPNLLANMAEGMMLAPPSWMDSRPSDDSPD  181

Query  853  NSDAETLWNY  882
            NS+ E LW Y
Sbjct  182  NSNDEDLWGY  191



>gb|KDP22329.1| hypothetical protein JCGZ_26160 [Jatropha curcas]
Length=221

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 125/179 (70%), Gaps = 12/179 (7%)
 Frame = +1

Query  376  SPTG--GRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            SP+G    G+HP YRG+RSRSGKWVSEIREPRKTTRIWLGTY TPEMAAAAYDVAAL+L+
Sbjct  44   SPSGFPSTGRHPTYRGIRSRSGKWVSEIREPRKTTRIWLGTYSTPEMAAAAYDVAALSLK  103

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVN  729
              +A LNFP     YP+P S  A+DIR AAA+AA   +P+  SG    +     +  S +
Sbjct  104  GPDAALNFPESILSYPIPASMSASDIRAAAATAAMARQPKPESGSNPSTGPLEIEGTSSS  163

Query  730  --------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                     ++IDEEE+ +M NLLVDMA GM++SPPRIN+   +DDS  NSD E LW+Y
Sbjct  164  GISYVESGQKFIDEEEILNMPNLLVDMAEGMLLSPPRINTPS-SDDSAGNSD-EGLWSY  220



>gb|EYU25053.1| hypothetical protein MIMGU_mgv1a021752mg, partial [Erythranthe 
guttata]
Length=199

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 126/199 (63%), Gaps = 17/199 (9%)
 Frame = +1

Query  331  LSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEM  510
            LSP  + + Q    SSPT GR  HP YRG+R RSGKWVSEIR+PRKTTR+WLGTYPTPEM
Sbjct  2    LSPPPSLRRQQPPVSSPTSGR--HPVYRGIRYRSGKWVSEIRQPRKTTRVWLGTYPTPEM  59

Query  511  aaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGG  690
            AAAAYDVAALAL+  E  LNFP  A  YP+P S  AA IR AAA AAA +     +G  G
Sbjct  60   AAAAYDVAALALKGPETALNFPDLAQSYPIPDSHSAAGIRDAAAQAAAAVAAAPQTGGAG  119

Query  691  GSRQERKDDPSVNT-------------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSH  831
            G  +     PS N              E++DEE LF M  LL DMA GM+VSPPR+ S  
Sbjct  120  GHGRVVHAPPSENEAGSSSSGAPAPGHEFVDEEALFYMPKLLEDMAEGMLVSPPRMKSGA  179

Query  832  PAD-DSPE-NSDAETLWNY  882
             AD +SPE  S  + LW+Y
Sbjct  180  AADEESPEYYSRNDGLWSY  198



>ref|XP_009629720.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Nicotiana tomentosiformis]
Length=201

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 119/166 (72%), Gaps = 4/166 (2%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP +RG+R R+GKWVSEIREPRKTTRIWLGT+ TPEMAAAAYDVAALAL+  +A LNFP
Sbjct  35   RHPNFRGIRQRNGKWVSEIREPRKTTRIWLGTFSTPEMAAAAYDVAALALKGPDAPLNFP  94

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV----NTEYID  744
              A  YPVP S  A DIR AAA+AAA   P  S        + R  + ++     TE++D
Sbjct  95   DSAYLYPVPASLSAVDIRAAAANAAAARAPPISESSTEVLPETRNYEGTIAAQGQTEFVD  154

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            EEE+F M  LL +MA  M+VSPPR++ S   D+SPENSDA++LW+Y
Sbjct  155  EEEIFGMPKLLDEMAEAMLVSPPRMHQSTSYDESPENSDADSLWSY  200



>gb|ADE41109.1| AP2 domain class transcription factor [Malus domestica]
Length=228

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 116/180 (64%), Gaps = 15/180 (8%)
 Frame = +1

Query  376  SPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsa  555
            S +G   +HP YRG+R RSGKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAA+AL+  
Sbjct  53   STSGSSRRHPFYRGIRCRSGKWVSEIREPRKTTRIWLGTYPKPEMAAAAYDVAAIALKGP  112

Query  556  EAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGD-GGGSRQE---------  705
            +  LNFP     YP+P SS A+DIR AAA AA          +   G R E         
Sbjct  113  DTPLNFPNSILTYPIPASSAASDIRSAAARAAQSRADMLIPQERESGGRSEPGGVDNEGG  172

Query  706  -RKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                      EY+DEEEL +M NLLVDMA GM+VSPPRI+S    D+SP NSD E LW+Y
Sbjct  173  GGGVVSQQQEEYMDEEELLNMPNLLVDMAEGMLVSPPRISS----DNSPGNSDGENLWSY  228



>ref|XP_009389122.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Musa acuminata subsp. malaccensis]
Length=193

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 110/163 (67%), Gaps = 19/163 (12%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+R RSGKWVSEIREPRK +RIWLGTYPT EMAA AYDVAA ALR A+AVLNF
Sbjct  49   GKHPSYRGIRYRSGKWVSEIREPRKASRIWLGTYPTAEMAAVAYDVAASALRGADAVLNF  108

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
            P   A  P P S   + IR AAA AAA             S+Q+          Y+DEEE
Sbjct  109  PDDIASRPAPASPSPSHIRVAAAEAAAA------------SQQQL-------GRYVDEEE  149

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +FDM  LLV+MA GM++SPPR++     +DSPE S+ E+LW+Y
Sbjct  150  IFDMPQLLVNMAEGMLISPPRLSPQGCEEDSPEASEGESLWSY  192



>emb|CDY00511.1| BnaA10g07620D [Brassica napus]
Length=237

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 124/186 (67%), Gaps = 15/186 (8%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G ++   + TG  G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  56   GGSSTKRTTTGLSGRHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVA  115

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG-------  693
            ALAL+  +AVLNFP  A  Y  P S+ AADIR AAA AA   +P     D GG       
Sbjct  116  ALALKGPDAVLNFPGLALTYVAPASNSAADIRAAAARAAETKQP-----DPGGVEKVMEP  170

Query  694  ---SRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA  864
                R+E +     + E++DEE + DM NLL +MA GM++SPPR+ +    DDSPEN + 
Sbjct  171  GQPGREEEEKAMLSSLEFMDEEAMLDMPNLLTEMAEGMLMSPPRMINPTMEDDSPENHEG  230

Query  865  ETLWNY  882
            ++LW+Y
Sbjct  231  DSLWSY  236



>ref|XP_008373991.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Malus domestica]
Length=283

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 125/181 (69%), Gaps = 14/181 (8%)
 Frame = +1

Query  382  TGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEA  561
            +   GKHP+Y G+R R GKWVSEIREPRKT RIWLGT+PTPEMAAAAYDVAALAL+    
Sbjct  102  SSSSGKHPRYHGIRCRXGKWVSEIREPRKTKRIWLGTFPTPEMAAAAYDVAALALKGTNI  161

Query  562  VLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG---GGSRQERKDDPSVNT  732
             LNFP++   YPVP S+ A DIR AAA+AAA ++  S + +    G  ++   DD   +T
Sbjct  162  ALNFPSFIGLYPVPPSTSAIDIRTAAATAAAALRKNSDTMESPKMGQMQKHEGDDMMSST  221

Query  733  -------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DDSPENSD--AETLWN  879
                   ++IDEEELF M NLL DMA GM++SPPR+N+S P+  DDSP NSD     LW+
Sbjct  222  SLASSVRDFIDEEELFQMPNLLADMAEGMLMSPPRMNNSPPSDYDDSPGNSDRGEGRLWS  281

Query  880  Y  882
            Y
Sbjct  282  Y  282



>emb|CDY31924.1| BnaC09g28200D [Brassica napus]
Length=237

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 125/186 (67%), Gaps = 15/186 (8%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G ++   + TG  G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  56   GGSSTKRTTTGLSGRHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVA  115

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG-------  693
            ALAL+  +AVLNFP  A  Y  P S+ AADIR AAA AA M +P     D GG       
Sbjct  116  ALALKGPDAVLNFPGLALTYVAPASNSAADIRAAAARAAEMKQP-----DPGGVEKVMEP  170

Query  694  ---SRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA  864
                R+E +     + E++DEE + DM NLL +MA GM++SPPR+ +    DDSPEN + 
Sbjct  171  GQPGREEEEKAMLSSLEFMDEEAMLDMPNLLTEMAEGMLMSPPRMINPTMEDDSPENHEG  230

Query  865  ETLWNY  882
            ++LW+Y
Sbjct  231  DSLWSY  236



>ref|XP_006600809.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Glycine max]
Length=176

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 107/171 (63%), Gaps = 12/171 (7%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+R R GKWV+EIREPRKT RIWLGT+ TPEMAAAAYDVAALAL+  EAVLNFP
Sbjct  9    RHPLYHGIRCRGGKWVTEIREPRKTNRIWLGTFLTPEMAAAAYDVAALALKGNEAVLNFP  68

Query  577  AYAARYPVP-------VsseaadirraaasaaammkpesssGDGGGSRQERKDD--PSVN  729
                RYPVP       +   A          A      ++S     + Q   +D  PS  
Sbjct  69   DSVGRYPVPASNSPSDIRFAAIAAAELMKPEANNNNNVNASTTNNAAVQSDSNDVLPSFE  128

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            TE++DEE +F M +LLVDMAGGM++SPPR++   P  D+  N   ETLWN+
Sbjct  129  TEFMDEEAIFSMPSLLVDMAGGMLLSPPRMS---PPSDNESNYVGETLWNF  176



>ref|XP_008376523.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Malus domestica]
Length=228

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 113/173 (65%), Gaps = 15/173 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+R RSGKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAA+AL+  +  LNFP
Sbjct  60   RHPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPKPEMAAAAYDVAAIALKGPDTPLNFP  119

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGD-GGGSRQE----------RKDDPS  723
                 YP+P SS A+DIR AAA AA          +   G R E                
Sbjct  120  NSILTYPIPASSAASDIRSAAARAAQSRADMLIPQERESGGRSEPGGVDNEGGGGGVVSQ  179

Query  724  VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
               EY+DEEEL +M NLLVDMA GM+VSPPRI+S    D+SP NSD E LW+Y
Sbjct  180  QQEEYMDEEELLNMPNLLVDMAEGMLVSPPRISS----DNSPGNSDGENLWSY  228



>ref|XP_004143932.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Cucumis sativus]
 ref|XP_004166984.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Cucumis sativus]
 gb|KGN50145.1| hypothetical protein Csa_5G155560 [Cucumis sativus]
Length=252

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            KH  YRG+R RSGKWVSEIREPRKTTRIWLGT+PT EMAA AYDVAALALR  +AVLNFP
Sbjct  84   KHSLYRGIRCRSGKWVSEIREPRKTTRIWLGTFPTAEMAATAYDVAALALRGGDAVLNFP  143

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQE--RKDDPSVNT---EYI  741
            A    YPVP S+   DIR AA++AA     ++       S  +    +D S      E++
Sbjct  144  ASIPTYPVPASTSPVDIRTAASTAAIAAAAKAVKKVSSTSSVDVGTMEDCSKKMRIEEFV  203

Query  742  DEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA-ETLWNY  882
            DEEE+F M  LL DMA GMMVSPPR+NS   +DD  ENSD  E+LW+Y
Sbjct  204  DEEEIFGMPGLLADMAEGMMVSPPRMNSPPLSDDLMENSDGTESLWSY  251



>ref|NP_200015.1| ethylene-responsive transcription factor ERF025 [Arabidopsis 
thaliana]
 sp|Q9FJ90.1|ERF25_ARATH RecName: Full=Ethylene-responsive transcription factor ERF025 
[Arabidopsis thaliana]
 dbj|BAB11050.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63446.1| unknown [Arabidopsis thaliana]
 dbj|BAD44227.1| unknown protein [Arabidopsis thaliana]
 gb|AED96159.1| ethylene-responsive transcription factor ERF025 [Arabidopsis 
thaliana]
Length=232

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 126/187 (67%), Gaps = 21/187 (11%)
 Frame = +1

Query  367  AASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalal  546
            A  + TG  GKH  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAALAL
Sbjct  51   ARRTATGLSGKHSIFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVAALAL  110

Query  547  rsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS----------  696
            +  +AVLNFP  A  Y  PVS+ AADIR AA+ AA M +P     D GG           
Sbjct  111  KGPDAVLNFPGLALTYVAPVSNSAADIRAAASRAAEMKQP-----DQGGDEKVLEPVQPG  165

Query  697  RQERKDDPSVNT---EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA--DDSPENSD  861
            ++E  ++ S N+   E++DEE + +M  LL +MA GM++SPPR+   HP   DDSPEN +
Sbjct  166  KEEELEEVSCNSCSLEFMDEEAMLNMPTLLTEMAEGMLMSPPRM-MIHPTMEDDSPENHE  224

Query  862  AETLWNY  882
             + LW+Y
Sbjct  225  GDNLWSY  231



>emb|CDY21059.1| BnaA08g24660D [Brassica napus]
Length=188

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 119/185 (64%), Gaps = 16/185 (9%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            A++    R K P YRG+R RSGKWV EIREP+KTTRIWLGTYPT EMAAAAYDVAA+AL+
Sbjct  2    ATNGLASRKKDPVYRGIRCRSGKWVCEIREPKKTTRIWLGTYPTAEMAAAAYDVAAIALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQER-------  708
              EA+LNFP     YPVP+S+ AADIR AAA+AA+M   E    +               
Sbjct  62   GREALLNFPGSVGSYPVPLSTSAADIRSAAAAAASMKGCEEEEENAKKKSSSFSKSRSSD  121

Query  709  ---KDDPSVNT------EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
                DD   ++      +++DEEEL +M N L DMA GMMV+PP    SHP+DDSPEN +
Sbjct  122  FHVHDDMMASSSSRCVIDFMDEEELLNMPNFLADMAEGMMVAPPSWIGSHPSDDSPENFN  181

Query  862  AETLW  876
             E LW
Sbjct  182  DEDLW  186



>gb|ADE41147.1| AP2 domain class transcription factor [Malus domestica]
Length=235

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 115/171 (67%), Gaps = 14/171 (8%)
 Frame = +1

Query  400  HPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPA  579
            HP YRG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVAA+AL+  +  LNFP 
Sbjct  69   HPVYRGIRCRNGKWVSEIREPRKTTRIWLGTYPKPEMAAAAYDVAAIALKGPDTPLNFPN  128

Query  580  YAARYPVPVsseaadirraaasaaammkpesssGD---GGGSRQERKDDPSVN-------  729
                Y +P SS A+DIR AAA AA     +    +   GG S     D+  V        
Sbjct  129  SILTYLIPASSAASDIRSAAARAAQSRANKLVPRERESGGRSEPGSVDNEGVGGVVGQQE  188

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             E++DEE L +M NLLVDMA GM+VSPPRI+S    D+SPENSD E LWNY
Sbjct  189  EEFMDEEALLNMPNLLVDMAEGMLVSPPRISS----DNSPENSDGENLWNY  235



>ref|XP_010025136.1| PREDICTED: ethylene-responsive transcription factor ERF026, partial 
[Eucalyptus grandis]
Length=197

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 125/195 (64%), Gaps = 26/195 (13%)
 Frame = +1

Query  337  PRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaa  516
            P L+  G +  A S     G+HP YRGVRSRSGKWVSEIREPRKTTRIWLGTYP PEMAA
Sbjct  15   PMLSPSGSSPLAQS----TGRHPLYRGVRSRSGKWVSEIREPRKTTRIWLGTYPNPEMAA  70

Query  517  aaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS  696
            AA+DVAALAL+ ++A LNFP     YPVP S  AADIR AAASAAA             +
Sbjct  71   AAFDVAALALKGSDAALNFPHDVPNYPVPNSVSAADIRSAAASAAASRGAR--------T  122

Query  697  RQERKDDP------------SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD  840
              E K+DP                E++DE+EL +M  LL DMA GM+VSPPR   +   +
Sbjct  123  EAEGKEDPVGRPESASEISQEPGQEFMDEDELLNMPKLLDDMAEGMLVSPPRTQMAS-EN  181

Query  841  DSPENSD-AETLWNY  882
            DSPE+SD  E+LW+Y
Sbjct  182  DSPEDSDGGESLWSY  196



>ref|XP_003525731.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Glycine max]
Length=182

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 13/173 (8%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+R R GKWV+EIREPRKT RIWLGT+ TPEMAAAAYDVAALAL+  EAVLNFP
Sbjct  12   RHPLYHGIRCRGGKWVTEIREPRKTNRIWLGTFLTPEMAAAAYDVAALALKGGEAVLNFP  71

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD-----------PS  723
                 YPVP S   ADIR AA +AA +MKPE+S  +   +     +             S
Sbjct  72   DSVGGYPVPASKSPADIRTAAIAAAELMKPEASHNNNNVNASTTNEAEVVQYDNNNVFTS  131

Query  724  VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             +TE++DEE +F M +LLVDMAGGM++SPPR+  S P+DDS ++   ETLWN+
Sbjct  132  FDTEFMDEEAIFSMPSLLVDMAGGMLLSPPRM--SPPSDDSTQSYVGETLWNF  182



>ref|XP_009398079.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Musa 
acuminata subsp. malaccensis]
Length=232

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+R RS KWVSEIREPRK +RIWLGTYPT EMAA AYDVAA ALR A+AVLNFP
Sbjct  65   RHPTYRGIRFRSRKWVSEIREPRKASRIWLGTYPTAEMAAVAYDVAAHALRGADAVLNFP  124

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDG--------GGSRQERKDDPSVNT  732
               A  PVP S+    IR  AA AAA+M P+S + D         GG  +          
Sbjct  125  DEIATRPVPASASPTHIRATAAEAAALMVPKSGAADDKVAAPQQPGGLGESATG--GAEG  182

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +YIDEEE+FDM  LLV+MA GM++SPPR+ S H ++DSPE S++E+LW+Y
Sbjct  183  KYIDEEEIFDMPQLLVNMAEGMLMSPPRL-SPHGSEDSPEASESESLWSY  231



>ref|XP_009792399.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Nicotiana sylvestris]
Length=201

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 121/180 (67%), Gaps = 11/180 (6%)
 Frame = +1

Query  376  SPTGGRG-------KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            SPTG          +HP +RG+R R+ KWVSEIREPRKTTRIWLGT+ TPEMAAAAYDVA
Sbjct  21   SPTGSASGNVLSPRRHPNFRGIRQRNCKWVSEIREPRKTTRIWLGTFSTPEMAAAAYDVA  80

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            ALAL+  +A LNFP  A  YPVP S  A DIR AAA+AAA   P  S  +      E ++
Sbjct  81   ALALKGPDAPLNFPDSAYSYPVPASLSATDIRAAAANAAAARAPPISESNSHEVLAETEN  140

Query  715  ----DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                  +V   ++DEEE+F M  LL +MA  M+VSPPR++ S   D+SPENSDA++LW+Y
Sbjct  141  YEGASTTVAATFVDEEEIFGMPKLLDEMAEAMLVSPPRMHQSTSYDESPENSDADSLWSY  200



>ref|XP_010054789.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Eucalyptus grandis]
 gb|KCW77610.1| hypothetical protein EUGRSUZ_D01924 [Eucalyptus grandis]
Length=264

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 106/171 (62%), Gaps = 21/171 (12%)
 Frame = +1

Query  334  SPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMa  513
            SPR    G A++        GKHP YRG+RSRSGKWVSEIREPRKTTR+WLGTYPTPEMA
Sbjct  75   SPRSNPSGSASSG-------GKHPFYRGIRSRSGKWVSEIREPRKTTRVWLGTYPTPEMA  127

Query  514  aaaydvaalalrsaEAVLNFPAYAARYPVPVsse-----------aadirraaasaaamm  660
            AAAYDVAALAL+  +AVLNFP     YPVP S+            AA  +   +      
Sbjct  128  AAAYDVAALALKGGDAVLNFPHLVKSYPVPASTAPTDVRRAAAAAAASRKAETSGGTDDT  187

Query  661  kpesssGDGGGSRQERKDDPSVN---TEYIDEEELFDMHNLLVDMAGGMMV  804
                  GD G +R++ + D S      E+IDEE LFDM NLLVDMA GMMV
Sbjct  188  ALLGQEGDEGKTRKDHRPDLSSKPPEAEFIDEEALFDMPNLLVDMAEGMMV  238



>ref|XP_007155566.1| hypothetical protein PHAVU_003G212700g [Phaseolus vulgaris]
 gb|ESW27560.1| hypothetical protein PHAVU_003G212700g [Phaseolus vulgaris]
Length=178

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+R R GKWV+EIREPRKT RIWLGT+ TPEMAAAAYDVAALAL+  EAVLNFP
Sbjct  10   RHPLYHGIRCRGGKWVTEIREPRKTNRIWLGTFLTPEMAAAAYDVAALALKGGEAVLNFP  69

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD---------PSVN  729
                RYPVP S   ADIR AA +AA +MKPE+S  +     Q    +         P   
Sbjct  70   DSIGRYPVPASKSPADIRSAAIAAAELMKPEASHNNANAVAQSDNTEGDGYYNVAAPLNE  129

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            TE++DEE +F M +LL+DMA GM+++PPR++S  P+D   ENS  E LWN+
Sbjct  130  TEFVDEEAIFSMPSLLIDMAEGMLLTPPRMSS--PSDYWIENSGGENLWNF  178



>ref|XP_010669007.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Beta vulgaris subsp. vulgaris]
Length=185

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 112/180 (62%), Gaps = 18/180 (10%)
 Frame = +1

Query  376  SPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsa  555
            SPTG   KHP YRG+R R GKWVSEIREP+KTTRIWLGT+ T EMAAAAYD AALAL+  
Sbjct  12   SPTG---KHPLYRGIRPRGGKWVSEIREPKKTTRIWLGTWATAEMAAAAYDAAALALKGT  68

Query  556  EAVLNFPAYAARYPVP-------VsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            EA+LNFP  A RYPVP       +   AA                +++ D G    ER  
Sbjct  69   EAILNFPQDALRYPVPPSSSAADIRKAAATAAAMKQDKEKNSSTTTNADDLG---LERVG  125

Query  715  DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD----AETLWNY  882
                  E+ID E  F+M NLLVDMAGGMMVSPPR++S+    DSPEN D    A +LW+Y
Sbjct  126  KQGAEEEFIDIEAFFNMPNLLVDMAGGMMVSPPRMSSTDDR-DSPENDDCIGEAGSLWSY  184



>ref|XP_006401877.1| hypothetical protein EUTSA_v10014566mg [Eutrema salsugineum]
 gb|ESQ43330.1| hypothetical protein EUTSA_v10014566mg [Eutrema salsugineum]
Length=234

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 128/189 (68%), Gaps = 18/189 (10%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G + A  + TG  G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  50   GVSPARRTTTGLSGRHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVA  109

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            ALAL+ ++AVLNFP  A+ Y  P S+ AADIR AAA AA M +P+     GG  R E   
Sbjct  110  ALALKGSDAVLNFPGLASTYVAPASNSAADIRAAAARAAEMKQPDP----GGAERVENSG  165

Query  715  DP-------------SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPEN  855
             P             S + E++DEE + +M +LL +MA GM++SPPR+ ++   DDSPEN
Sbjct  166  RPGKKEEEEEEEALLSCSLEFMDEEAMLNMPSLLTEMAEGMLMSPPRM-TNPTMDDSPEN  224

Query  856  SDAETLWNY  882
             + ++LW+Y
Sbjct  225  HEGDSLWSY  233



>ref|XP_004515795.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Cicer arietinum]
Length=171

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 17/171 (10%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+RSR GKWV+EIREPRKT RIWLGT+ TPEMAAAAYDVA LAL+  EA+LNFP
Sbjct  9    RHPTYHGIRSRGGKWVTEIREPRKTNRIWLGTFSTPEMAAAAYDVATLALKGGEAILNFP  68

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDP--------SVNT  732
              A RYPVP S+ A DIR AA SAA +M        GG +  E  ++         +  +
Sbjct  69   DLARRYPVPASNSAEDIRSAATSAAELMT-------GGSTFNEPYNNAFYDAPHSYNYES  121

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE-NSDAETLWNY  882
            E+IDEE +F M  LLVDMA GM++SPPR+N   P+D S E  +  E+LWN+
Sbjct  122  EFIDEEAIFSMPRLLVDMAEGMLLSPPRMNLP-PSDYSTEYQTFGESLWNF  171



>gb|KEH31700.1| ethylene response factor [Medicago truncatula]
Length=168

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 117/163 (72%), Gaps = 7/163 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+RSR GKWV+EIREPRKT RIWLGT+PTPEMAAAAYDVA LAL+  +AVLNFP
Sbjct  11   RHPTYHGIRSRGGKWVTEIREPRKTNRIWLGTFPTPEMAAAAYDVATLALKGGDAVLNFP  70

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
              A++YPVP S+   DIR AA +AA +   E+ + D G + +     P   TE++DEE +
Sbjct  71   NSASKYPVPASNSPDDIRSAATAAAELTAAEAVNNDAGLNGR-----PWYETEFLDEEAI  125

Query  757  FDMHNLLVDMAGGMMVSPPRINSSHPADDSPE-NSDAETLWNY  882
            F M  L+V+MA GM++SPPR+N   P++  PE  +  E+LW+Y
Sbjct  126  FSMPRLMVEMAEGMLLSPPRMNPP-PSEYLPEYYTSGESLWSY  167



>ref|XP_009110631.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Brassica 
rapa]
Length=188

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 118/185 (64%), Gaps = 16/185 (9%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            A++    R K P YRG+R RSGKWV EIREP+KTTRIWLGTYPT EMAAAAYDVAA+AL+
Sbjct  2    ATNGLASRKKDPVYRGIRCRSGKWVCEIREPKKTTRIWLGTYPTAEMAAAAYDVAAIALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQER-------  708
              EA+LNFP     YPVP+S+ AADIR AAA+AA+M   E    +               
Sbjct  62   GREALLNFPGSVGSYPVPLSTSAADIRSAAAAAASMKGCEEEEENAKKKSSSFSKSRSSD  121

Query  709  ---KDDPSVN------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
                DD   +      T+++DEEEL +M N L DMA GMMV+PP    S P+DDSPEN +
Sbjct  122  FHVHDDMMASSSSRCVTDFMDEEELLNMPNFLADMAEGMMVAPPSWIGSRPSDDSPENFN  181

Query  862  AETLW  876
             E LW
Sbjct  182  DEDLW  186



>ref|XP_008437210.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Cucumis 
melo]
Length=251

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = +1

Query  409  YRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAA  588
            YRG+R RSGKWVSEIREPRKTTRIWLGT+PT EMAAAAYDVAALALR  +AVLNFPA   
Sbjct  87   YRGIRCRSGKWVSEIREPRKTTRIWLGTFPTAEMAAAAYDVAALALRGGDAVLNFPASIP  146

Query  589  RYPVPVsseaadirraaasaaammkpesssGDGGGSRQE--RKDDPSVNT---EYIDEEE  753
             YPVP S+   DIR AA++AA     ++       S  +    +D S  T   +++DEEE
Sbjct  147  TYPVPASNSPVDIRTAASTAAIAAAAKAVKKVASTSSVDVGTMEDGSKKTGIEKFVDEEE  206

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA-ETLWNY  882
            +F M  LL DMA GMMVSPPR+N+   +DDS ENSD  E+LW+Y
Sbjct  207  IFGMPGLLADMAEGMMVSPPRMNAPPLSDDSMENSDGTESLWSY  250



>ref|XP_009106951.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Brassica rapa]
Length=237

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G ++   + TG  G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  56   GGSSTKRTTTGLSGRHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVA  115

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG-------  693
            ALAL+  +AVLNFP  A  Y  P S+ AADIR AAA AA   +P     D GG       
Sbjct  116  ALALKGPDAVLNFPGLALTYVAPASNSAADIRAAAARAAETKQP-----DPGGVEKVMEP  170

Query  694  ---SRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA  864
                R+E +     + E++DEE + DM NLL +MA GM++SPPR+ +    DDS EN + 
Sbjct  171  GQPGREEEEKAMLSSLEFMDEEAMLDMPNLLTEMAEGMLMSPPRMINPTMEDDSLENHEG  230

Query  865  ETLWNY  882
            ++LW+Y
Sbjct  231  DSLWSY  236



>gb|KCW90742.1| hypothetical protein EUGRSUZ_A02817 [Eucalyptus grandis]
Length=253

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 125/195 (64%), Gaps = 26/195 (13%)
 Frame = +1

Query  337  PRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaa  516
            P L+  G +  A S     G+HP YRGVRSRSGKWVSEIREPRKTTRIWLGTYP PEMAA
Sbjct  71   PMLSPSGSSPLAQS----TGRHPLYRGVRSRSGKWVSEIREPRKTTRIWLGTYPNPEMAA  126

Query  517  aaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS  696
            AA+DVAALAL+ ++A LNFP     YPVP S  AADIR AAASAAA             +
Sbjct  127  AAFDVAALALKGSDAALNFPHDVPNYPVPNSVSAADIRSAAASAAASRGAR--------T  178

Query  697  RQERKDDP------------SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD  840
              E K+DP                E++DE+EL +M  LL DMA GM+VSPPR   +   +
Sbjct  179  EAEGKEDPVGRPESASEISQEPGQEFMDEDELLNMPKLLDDMAEGMLVSPPRTQMAS-EN  237

Query  841  DSPENSD-AETLWNY  882
            DSPE+SD  E+LW+Y
Sbjct  238  DSPEDSDGGESLWSY  252



>gb|ABQ62980.1| TINY-like protein [Populus trichocarpa]
Length=197

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 126/191 (66%), Gaps = 11/191 (6%)
 Frame = +1

Query  334  SPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMa  513
            SPR   +    +++ P  GR  HP ++GVR RSGKWVSEIREPRKTTR+WLGTYPTPEMA
Sbjct  9    SPRRPIRPPGGSSAQPASGR--HPTFKGVRLRSGKWVSEIREPRKTTRVWLGTYPTPEMA  66

Query  514  aaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssG----  681
            A AYDVAALAL+     LNFP     YP P S+   DIR AAASAA+   P+  SG    
Sbjct  67   ATAYDVAALALKGTNTPLNFPESILSYPTPASASPGDIRAAAASAASARSPKRESGPNPE  126

Query  682  ----DGGGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSP  849
                +  GS      D     E  DEEEL +M NLLVDMAGGM+VSPPRIN+   +DDSP
Sbjct  127  MGQPETEGSSSIITADVQSGQEIFDEEELLNMPNLLVDMAGGMLVSPPRINTLS-SDDSP  185

Query  850  ENSDAETLWNY  882
             +SDAE+LW+Y
Sbjct  186  GSSDAESLWSY  196



>ref|XP_008795369.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Phoenix dactylifera]
Length=231

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 121/194 (62%), Gaps = 32/194 (16%)
 Frame = +1

Query  376  SPTGGR--------GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydv  531
            +PTGGR         KHP YRGVRSRSGKWVSEIREPRK  RIWLGTYPT EMAA AYDV
Sbjct  44   TPTGGRMGTDSPAAWKHPSYRGVRSRSGKWVSEIREPRKANRIWLGTYPTAEMAAVAYDV  103

Query  532  aalalrsaEAVLNFPAYAARYPVPVsseaa-----------------dirraaasaaamm  660
            AA ALR A+AVLNFP   + +P P S+  +                 +  + AA+AAA  
Sbjct  104  AAHALRGADAVLNFPDRVSSHPAPASTSPSDIRAAAAAAAAALLEKPETEKDAAAAAAAA  163

Query  661  kpesssGDGGGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD  840
            +  S   +  GS Q ++       E++DEE +F M NLL  MA GM++SPPR++ +  +D
Sbjct  164  QVPSRQSEASGSGQGKE------GEFMDEEAIFGMPNLLASMAEGMLMSPPRLSPTG-SD  216

Query  841  DSPENSDAETLWNY  882
            DSPE S+ E+LW+Y
Sbjct  217  DSPEVSEGESLWSY  230



>ref|XP_009767038.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Nicotiana sylvestris]
 ref|XP_009767039.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Nicotiana sylvestris]
Length=185

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 121/176 (69%), Gaps = 4/176 (2%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            +AA S    +G+H  YRG+R R+GKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALA
Sbjct  10   SAAISNRSEQGRHSVYRGIRKRNGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALA  69

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG--GGSRQERKDD  717
            L+  +  LNFP     Y +P S  AADIR AAA+AAA+  P+    +       Q    D
Sbjct  70   LKGHDTPLNFPGSMCSYTMPASLTAADIRAAAANAAAVRAPQLEREEARHQAECQPEVGD  129

Query  718  PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAE-TLWNY  882
             ++  E+ DEEE+F M  LLVDMA  M+VSPPR+ ++ P D+ PE SDA  TLW+Y
Sbjct  130  GAMGQEFFDEEEVFGMPRLLVDMAEAMLVSPPRMKTT-PYDELPEYSDASYTLWSY  184



>ref|XP_008803287.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Phoenix dactylifera]
Length=234

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 110/176 (63%), Gaps = 19/176 (11%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            K P YRGVRSRSGKWVSEIREPRK  RIWLGTYPT EMAA AYDVAA ALR A+AVLNFP
Sbjct  63   KRPSYRGVRSRSGKWVSEIREPRKANRIWLGTYPTAEMAAVAYDVAAQALRGADAVLNFP  122

Query  577  AYAARYPVPVsseaad--------------irraaasaaammkpesssGDGGGSRQERKD  714
               +  P P S+  +D                      AA  +   SS  GG SR     
Sbjct  123  DDISSRPTPASAAPSDIRAAAAAAAAELLLRPERQEDVAAASRAPGSSETGGSSRSGEGK  182

Query  715  DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +     E+IDEEE+FDM NLL +MA GM++SPPR+ S   +DDSPE S+ ++LW+Y
Sbjct  183  E----GEFIDEEEIFDMPNLLANMAEGMLMSPPRL-SPIDSDDSPEVSEGQSLWSY  233



>ref|XP_011041634.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Populus euphratica]
Length=250

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 126/191 (66%), Gaps = 11/191 (6%)
 Frame = +1

Query  334  SPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMa  513
            SPR   +    +++ P  GR  HP ++GVR RSGKWVSEIREPRKTTR+WLGTYPTPEMA
Sbjct  62   SPRRPIRSLGGSSAQPASGR--HPSFKGVRLRSGKWVSEIREPRKTTRVWLGTYPTPEMA  119

Query  514  aaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG  693
            A AYDVAALAL+     LNFP     YP+P S+  +DIR AAASAA+   P+  SG    
Sbjct  120  ATAYDVAALALKGTNTPLNFPESILSYPIPASASPSDIRAAAASAASARSPKLESGPNPE  179

Query  694  SRQERKD--------DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSP  849
              Q   +        D     E  DEEE  +M NLLVDMAGGM+VSPPRIN+   +DDSP
Sbjct  180  MGQPETESSSSIITTDVQSGQEIFDEEEFLNMPNLLVDMAGGMLVSPPRINTLS-SDDSP  238

Query  850  ENSDAETLWNY  882
             +SDAE+LW+Y
Sbjct  239  GSSDAESLWSY  249



>ref|XP_002321876.1| hypothetical protein POPTR_0015s13840g [Populus trichocarpa]
 gb|EEF06003.1| hypothetical protein POPTR_0015s13840g [Populus trichocarpa]
Length=250

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 126/191 (66%), Gaps = 11/191 (6%)
 Frame = +1

Query  334  SPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMa  513
            SPR   +    +++ P  GR  HP ++GVR RSGKWVSEIREPRKTTR+WLGTYPTPEMA
Sbjct  62   SPRRPIRPPGGSSAQPASGR--HPTFKGVRLRSGKWVSEIREPRKTTRVWLGTYPTPEMA  119

Query  514  aaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssG----  681
            A AYDVAALAL+     LNFP     YP P S+   DIR AAASAA+   P+  SG    
Sbjct  120  ATAYDVAALALKGTNTPLNFPESILSYPTPASASPGDIRAAAASAASARSPKRESGPNPE  179

Query  682  ----DGGGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSP  849
                +  GS      D     E  DEEEL +M NLLVDMAGGM+VSPPRIN+   +DDSP
Sbjct  180  MGQPETEGSSSIITADVQSGQEIFDEEELLNMPNLLVDMAGGMLVSPPRINTLS-SDDSP  238

Query  850  ENSDAETLWNY  882
             +SDAE+LW+Y
Sbjct  239  GSSDAESLWSY  249



>ref|XP_004140856.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Cucumis sativus]
 gb|KGN57338.1| hypothetical protein Csa_3G180265 [Cucumis sativus]
Length=192

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 117/180 (65%), Gaps = 19/180 (11%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+H  +RG+RSRSGKWVSEIREPRK TRIWLGTYPTPEMAAAAYDVAAL L+   A LNF
Sbjct  13   GRHRIFRGIRSRSGKWVSEIREPRKATRIWLGTYPTPEMAAAAYDVAALTLKGPNASLNF  72

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG----------------DGGGSRQE  705
            P     YP+P S+  +DIR AAA AAA   P++S                  DGGG    
Sbjct  73   PHSLLSYPIPPSTSPSDIRAAAAIAAAARNPQASPATTSTATTTDSSGTEAIDGGGPSSH  132

Query  706  RKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
               D   + +++DEEEL +M NLLVDMA GM+VSPPR+ S    D+SP +S  +  LW+Y
Sbjct  133  ATGD--CSGKFVDEEELLNMPNLLVDMAKGMLVSPPRMKSPSSDDNSPNHSQGDDGLWSY  190



>gb|AFV60733.1| ethylene-responsive transcription factor 1 [Carica papaya]
Length=213

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 119/163 (73%), Gaps = 8/163 (5%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            KHP YRG+R RS KWVSEIREPRKTTRIWLGTYP+PEMAAAAYDVAALAL+  +AVLNFP
Sbjct  56   KHPMYRGIRRRSDKWVSEIREPRKTTRIWLGTYPSPEMAAAAYDVAALALKGGDAVLNFP  115

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
            A    YPVP S+  ADIR AA +AAA+ KP ++  D      + K       E+IDEEEL
Sbjct  116  ALVGTYPVPKSTSPADIRDAATAAAALKKPPTAGDDPAPDHHQYK------GEFIDEEEL  169

Query  757  FDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD-AETLWNY  882
             +M NLLVDMA GMMVS P   SS P+DDS EN D  E+LW+Y
Sbjct  170  LNMPNLLVDMAEGMMVS-PPRISSPPSDDSQENFDHGESLWSY  211



>gb|ADJ67430.1| ethylene response factor 1 [Actinidia deliciosa]
Length=249

 Score =   124 bits (311),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 125/187 (67%), Gaps = 9/187 (5%)
 Frame = +1

Query  334  SPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMa  513
            SP+  +    AA+ SP     +H  +RGVRSRSGKWVSEIREP K TRIWLGT+PTPE A
Sbjct  67   SPKHPQSPTTAASPSP-----RHRIFRGVRSRSGKWVSEIREPGKATRIWLGTHPTPEAA  121

Query  514  aaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG  693
            AAAYDVAALAL+  +A LNFP     YPVP SS A D+R AAA+AA   KP S+      
Sbjct  122  AAAYDVAALALKGPDAALNFPDSILSYPVPASSAACDVRAAAAAAARHSKPVSAGESSEH  181

Query  694  SRQERKD----DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
             R E ++    + +   E+IDEE +FDM N+LVDMA G+++SPPR+ S    DDS E+S 
Sbjct  182  VRVENEEKGEGETTSGEEFIDEEAIFDMPNMLVDMAEGILLSPPRMKSPPCDDDSAESSG  241

Query  862  AETLWNY  882
             + LW+Y
Sbjct  242  GDNLWSY  248



>ref|XP_009389544.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Musa acuminata subsp. malaccensis]
Length=222

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 128/202 (63%), Gaps = 20/202 (10%)
 Frame = +1

Query  334  SPRLAEQ-----GQAAAASSP-------TGGRGKHPKYRGVRSRSGKWVSEIREPRKTTR  477
            S +LAEQ      Q A A  P        G   +HP YRG+R RSGKWVSEIREPRK+TR
Sbjct  21   SSQLAEQMTRSYDQGANAPQPEMEPRVRAGASRRHPSYRGIRYRSGKWVSEIREPRKSTR  80

Query  478  IWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaam  657
            IWLGTY T EMAA AYDVAA ALR  +A LNFP   A  P P+SS    IR AAA AAA 
Sbjct  81   IWLGTYTTAEMAAVAYDVAAHALRGTDAQLNFPDQIASRPSPLSSSPTHIRVAAAEAAAS  140

Query  658  mkpesssG---DGGGSRQERKDDPSVNTE----YIDEEELFDMHNLLVDMAGGMMVSPPR  816
            + P S +G   DG  +      D   + +    YIDEEE+FDM  LLV+MA GM++SPPR
Sbjct  141  LMPSSGAGDESDGAAAAAAAAVDTVASQQQPGSYIDEEEIFDMPQLLVNMAEGMLMSPPR  200

Query  817  INSSHPADDSPENSDAETLWNY  882
            + S H +DDSPE S+ E+LW+Y
Sbjct  201  L-SPHGSDDSPEVSEGESLWSY  221



>ref|XP_007220719.1| hypothetical protein PRUPE_ppa022719mg, partial [Prunus persica]
 gb|EMJ21918.1| hypothetical protein PRUPE_ppa022719mg, partial [Prunus persica]
Length=220

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 127/192 (66%), Gaps = 18/192 (9%)
 Frame = +1

Query  334  SPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMa  513
            SPR    G A+ +SSP G    HP YRG+RSRSGKWVSEIREPRKTTRIWLGTY  PEMA
Sbjct  38   SPRPGPTG-ASTSSSPRG----HPVYRGIRSRSGKWVSEIREPRKTTRIWLGTYAKPEMA  92

Query  514  aaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG  693
            AAAYDVAA+AL+  +  LNFP     YP+P SS A+DIR AAA AA       S+G+ GG
Sbjct  93   AAAYDVAAIALKGPDTALNFPNLILTYPIPASSAASDIRAAAARAAQSRAEMISAGESGG  152

Query  694  --------SRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSP  849
                    + + R        E++DEE L +M NLLVDMA GM+VSPPRI+S    +DSP
Sbjct  153  RSEPGGVKTEEGRVGQDEEEEEFMDEEALLNMPNLLVDMAEGMLVSPPRISS----EDSP  208

Query  850  ENSD-AETLWNY  882
             NSD  E LW+Y
Sbjct  209  GNSDGGENLWSY  220



>gb|EYU29843.1| hypothetical protein MIMGU_mgv1a021100mg [Erythranthe guttata]
Length=233

 Score =   123 bits (308),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 123/176 (70%), Gaps = 14/176 (8%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+RSR+GKWVSEIREPRKTTRIWLGTYP+PEMAAAAYDVAALAL+  + +LNF
Sbjct  58   GKHPMYRGIRSRTGKWVSEIREPRKTTRIWLGTYPSPEMAAAAYDVAALALKGGDVLLNF  117

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD----------DPS  723
            P +   +PVP S    DIRRAAA AA MM+P          +  R+D          D  
Sbjct  118  PDHVTSFPVPSSPSPQDIRRAAADAAEMMRPAGGDTAADDRKLPREDTEAAAAAEPPDNI  177

Query  724  VNT---EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            V T   E+IDEE LF M NLL+DMA GM+VS PR+ +  P +DSPENS+ E+LW+Y
Sbjct  178  VETIIDEFIDEEALFYMPNLLLDMAEGMLVSLPRM-AFRPPEDSPENSEGESLWSY  232



>ref|XP_009591044.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Nicotiana tomentosiformis]
Length=186

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 124/177 (70%), Gaps = 5/177 (3%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            + A S    +G+H  YRG+R R+GKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALA
Sbjct  10   STAISNRSEQGRHSVYRGIRRRNGKWVSEIREPRKTTRIWLGTYPTPEMAAAAYDVAALA  69

Query  544  lrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQ---ERKD  714
            L+  +  LNFP     Y +P S  AADIRRAAA+AAA+  P+  S +     +   E  D
Sbjct  70   LKGPDTPLNFPDSMCSYTMPNSLTAADIRRAAANAAAVRAPQLESEEARHQTECQPEVGD  129

Query  715  DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAE-TLWNY  882
            + +V  E+ DEEE+F M  LLVDMA  M+VSPPR+ ++   ++SPE SDA  TLW+Y
Sbjct  130  EGAVGQEFFDEEEVFGMPRLLVDMAEAMLVSPPRMKTTS-CEESPEYSDASYTLWSY  185



>dbj|BAK09567.1| AP2/ERF domain-containing protein [Populus nigra]
Length=282

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 121/172 (70%), Gaps = 10/172 (6%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+HP Y+G+R RSGKWVSEIREPRKTTR+WLGTYPTPEMAAAAYD AALAL+  +  LNF
Sbjct  111  GRHPSYKGIRLRSGKWVSEIREPRKTTRVWLGTYPTPEMAAAAYDAAALALKGPDTPLNF  170

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDG---------GGSRQERKDDPSV  726
            P     YP+P S+ ++DIR AAASAA+   P   +G           G S      D   
Sbjct  171  PESILSYPIPASASSSDIRAAAASAASSRSPRPEAGPNPEWDRLETKGTSSSTTTADIQS  230

Query  727  NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
              E+IDEEEL ++ NLLVDMAGGM+VSPPRIN+   +DDSP NSDAE LW+Y
Sbjct  231  GQEFIDEEELLNLPNLLVDMAGGMLVSPPRINTPS-SDDSPGNSDAENLWSY  281



>ref|XP_010038425.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Eucalyptus grandis]
Length=174

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 113/180 (63%), Gaps = 13/180 (7%)
 Frame = +1

Query  343  LAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaa  522
            LA+  ++ A   P   R  HP+YRG+RSR  KWVSEIREPRK TRIWLGTYPTPEMAAAA
Sbjct  7    LADASRSPACHPPVSRR--HPEYRGIRSRGRKWVSEIREPRKATRIWLGTYPTPEMAAAA  64

Query  523  ydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQ  702
            YDVAALAL+   A+LNFP+    YP+P S+  +DIR  A+ AA         G       
Sbjct  65   YDVAALALKGPGALLNFPSSVLTYPIPPSTSPSDIRATASRAATARLLRWDLGIDSNEHT  124

Query  703  ERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                  +   E+IDE+ + +M NLL DMA GM++SPPR       ++S E SDAE LWNY
Sbjct  125  A-----ASGQEFIDEDAILNMPNLLADMAEGMLLSPPR------PEESQEYSDAEGLWNY  173



>ref|XP_003535627.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Glycine max]
Length=205

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 112/167 (67%), Gaps = 15/167 (9%)
 Frame = +1

Query  406  KYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYA  585
            +YRG R RSGKWVSEIREPRKT RIWLGTYPT EMAAAAYDVAALAL+  +  +NFP   
Sbjct  44   RYRGTRCRSGKWVSEIREPRKTNRIWLGTYPTAEMAAAAYDVAALALKGPDTPVNFPNSI  103

Query  586  ARYPVPVsseaadirraaasaa--------ammkpesssGDGGGSRQERKDDPSVNTEYI  741
              YP+P S  + DIR AAA+AA           +   +  DGG    ER++      EYI
Sbjct  104  LSYPIPASLSSTDIRAAAAAAAQARIVRAPQESEETVNPDDGGQGLSERRE------EYI  157

Query  742  DEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            DE+EL +M NLL +MA GM VSP RI +S+ +DDSP NSD + LW+Y
Sbjct  158  DEDELLNMPNLLDEMARGMQVSPLRI-TSYSSDDSPGNSDGDNLWSY  203



>gb|AAF75817.1|AC011000_20 Contains similarity to transcriptional activator CBF1 from Arabidopsis 
thaliana gb|U77378 and contains an AP2 PF|00847 domain. 
This gene may be cut off, partial [Arabidopsis thaliana]
Length=238

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = +1

Query  391  RGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            R K+P YRG+R RSGKWVSEIREP+KTTR+WLGTYPTPEMAAAAYDVAALAL+  + +LN
Sbjct  84   RKKNPVYRGIRCRSGKWVSEIREPKKTTRVWLGTYPTPEMAAAAYDVAALALKGGDTLLN  143

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTE--YID  744
            FP     YP+P+SS AA IR AAA+AAA      ++   G  ++++  D + ++   ++D
Sbjct  144  FPDSLGSYPIPLSSSAAHIRCAAAAAAATRGAAGAAVKVGQKKEDKVYDTAESSTMGFVD  203

Query  745  EEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE  852
            EEEL +M  LL DMA GMMV+PP +  S P+DDSPE
Sbjct  204  EEELLNMPGLLADMAKGMMVAPPWMG-SPPSDDSPE  238



>ref|XP_009127261.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Brassica rapa]
Length=224

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 123/177 (69%), Gaps = 6/177 (3%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G + A  + TG  G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  52   GGSPARRTATGLSGRHSLFRGIRLRNGKWVSEIREPRKTTRIWLGTYPLPEMAAAAYDVA  111

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            ALAL+  +AVLNFP  A  Y  P S+ AADIR AA  AA M +PE     G   ++E ++
Sbjct  112  ALALKGPDAVLNFPGLALTYVAPASNSAADIRAAAGRAAEMKQPERVLEPGQSEKEEEEE  171

Query  715  D-PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
               S + E++DEE + +M NLL +MA GM++SPPR+      D +PEN + ++LW+Y
Sbjct  172  AILSSSLEFMDEEAMLNMPNLLTEMAHGMLMSPPRMT-----DPAPENHEEDSLWSY  223



>ref|XP_008234297.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Prunus 
mume]
Length=261

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 126/291 (43%), Positives = 156/291 (54%), Gaps = 41/291 (14%)
 Frame = +1

Query  37   APFLYTNRYIYTHHILSFPLSFSLPPIYTYIFIYIDICLCVFMADPNSKIPEIISQTASY  216
             P+   ++YIY  +I           I+  +   +DI   +FMADP   +P+    T + 
Sbjct  3    GPWSRIHKYIYDIYI-----------IHAQLVCLVDI---LFMADPYRNVPKSDQPTPTS  48

Query  217  PSRQLQVIaatattvtaaavGEDKVtetttttLDIENLLSPRLAEQGQAAAASSPTGGRG  396
             S     I                         D +   SPR    G A+ +SSP G   
Sbjct  49   NSSNPAFILLPPPAPPDPTPPAAH---------DRDCSSSPRPGPSG-ASTSSSPRG---  95

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
             HP YRG+RSRSGKWVSEIREPRKTTRIWLGTY  PEMAAAAYDVAA+AL+  +  LNFP
Sbjct  96   -HPVYRGIRSRSGKWVSEIREPRKTTRIWLGTYAKPEMAAAAYDVAAIALKGPDTALNFP  154

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQ--------ERKDDPSVNT  732
                 YP+P SS A+DIR AAA AA       S+G+ GG  +         R        
Sbjct  155  NSILTYPIPASSAASDIRAAAARAAQSRAEMISAGESGGRSEPGGVKNEEGRVGQEEEEE  214

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD-AETLWNY  882
            E++DEE L +M NLLVDMA GM+VSPPRI+S    +DSP NSD  E LW+Y
Sbjct  215  EFMDEEALLNMPNLLVDMAEGMLVSPPRISS----EDSPGNSDGGENLWSY  261



>gb|KFK26808.1| hypothetical protein AALP_AA8G296100 [Arabis alpina]
Length=232

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 126/185 (68%), Gaps = 15/185 (8%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G + A  + TG  G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP  EMAAAAYDVA
Sbjct  53   GGSPARRTATGLSGRHSVFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVAEMAAAAYDVA  112

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-----  699
            ALAL+ ++AVLNFP  A  Y  P S+ AADIR AAA AA M +P+     GG  R     
Sbjct  113  ALALKGSDAVLNFPGLALTYVPPASTSAADIRAAAARAAEMKQPDP----GGAERVLEPG  168

Query  700  ---QERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPR-INSSHPADDSPENSDAE  867
               +E ++  +   E++DEE + ++  LL +MA GM++SPPR IN +H  DDSPEN   +
Sbjct  169  QPGKEEEEALTSTLEFMDEEAMLNIPTLLSEMAEGMLMSPPRMINPTH--DDSPENHQGD  226

Query  868  TLWNY  882
            +LW+Y
Sbjct  227  SLWSY  231



>ref|XP_008439163.1| PREDICTED: ethylene-responsive transcription factor ERF027 [Cucumis 
melo]
Length=202

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 117/188 (62%), Gaps = 27/188 (14%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+H  +RG+RSRSGKWVSEIREPRK TRIWLGTYPTPEMAAAAYDVAAL L+   A LNF
Sbjct  15   GRHRIFRGIRSRSGKWVSEIREPRKATRIWLGTYPTPEMAAAAYDVAALTLKGPNASLNF  74

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG------------------------  681
            P     YP+P S+  +DIR AAA AAA   P ++S                         
Sbjct  75   PHSLLSYPIPPSTSPSDIRAAAAIAAAARNPNNTSPQASPAAATTITATTTEYSSVTEAI  134

Query  682  DGGGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
            DGGG       D   + +++DEEEL +M NLLVDMA GM+VSPPR+ S    D+SP +S 
Sbjct  135  DGGGPSSHATGD--CSGKFVDEEELLNMPNLLVDMAEGMLVSPPRMKSPSSDDNSPNHSQ  192

Query  862  AET-LWNY  882
             +  LW+Y
Sbjct  193  GDDGLWSY  200



>ref|XP_008448976.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Cucumis melo]
Length=169

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 109/164 (66%), Gaps = 5/164 (3%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +H  Y+G+R R GKWVSEIREPRKT RIWLGTYPTPEMAAAAYDVAALAL+   AVLNFP
Sbjct  8    RHDHYKGIRCRGGKWVSEIREPRKTNRIWLGTYPTPEMAAAAYDVAALALKGCNAVLNFP  67

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
               A YPVP  S + +  R AA+AAA  K     G+        +  P+   E++DEE L
Sbjct  68   DSVASYPVPA-STSPNDIRIAAAAAAASKRVDDQGENNYHNSHYQSPPA--NEFVDEEAL  124

Query  757  FDMHNLLVDMAGGMMVSPPRINSSHPADD--SPENSDAETLWNY  882
            F M NLL+DMA GM++SPPR+NSS    D  S  +S    LW+Y
Sbjct  125  FGMPNLLLDMAEGMLLSPPRMNSSPSRHDYYSWNSSGDGNLWSY  168



>ref|XP_006606090.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Glycine max]
Length=206

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 112/168 (67%), Gaps = 16/168 (10%)
 Frame = +1

Query  406  KYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYA  585
            +YRG R RSGKWVSEIREPRKT RIWLGTYPT EMAAAAYDVAALAL+  +  LNFP   
Sbjct  44   RYRGTRYRSGKWVSEIREPRKTKRIWLGTYPTAEMAAAAYDVAALALKGPDTPLNFPNSI  103

Query  586  ARYPVPVsseaadirraaasaa--------ammkpesssGDGGG-SRQERKDDPSVNTEY  738
              YP+P S  A DIR AAA+AA               +  DGGG    ER++      EY
Sbjct  104  LSYPIPASLSATDIRAAAAAAAQARIVRAPQECGETVNPDDGGGQGMSERRE------EY  157

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            IDE+EL +M NLL DMA GM VSP RI +S+ +DDSP NSD + LW+Y
Sbjct  158  IDEDELLNMPNLLDDMARGMQVSPLRI-TSYSSDDSPGNSDGDNLWSY  204



>gb|KHN14123.1| Ethylene-responsive transcription factor ERF025 [Glycine soja]
Length=161

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 92/171 (54%), Gaps = 27/171 (16%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP Y G+R R GKWV+EIREPRKT RIWLGT+ TP                 EAVLNFP
Sbjct  9    RHPLYHGIRCRGGKWVTEIREPRKTNRIWLGTFLTP---------------GNEAVLNFP  53

Query  577  AYAARYPVP-------VsseaadirraaasaaammkpesssGDGGGSRQERKDD--PSVN  729
                RYPVP       +   A          A      ++S     + Q   +D  PS  
Sbjct  54   DSVGRYPVPASNSPSDIRFAAIAAAELMKPEANNNNNVNASTTNNAAVQSDSNDVLPSFE  113

Query  730  TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            TE++DEE +F M +LLVDMAGGM++SPPR++   P  D+  N   ETLWN+
Sbjct  114  TEFMDEEAIFSMPSLLVDMAGGMLLSPPRMS---PPSDNESNYVGETLWNF  161



>gb|AID51419.1| ethylene response factor 14 [Diospyros kaki]
Length=215

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 124/186 (67%), Gaps = 17/186 (9%)
 Frame = +1

Query  361  AAAASSPTGGR------GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaa  522
            AA +S+ +GG       GKHP YRG+RSRSGKWVSEIREPRKTTRIWLGTYPTPEMAA A
Sbjct  34   AAMSSTSSGGSPRRPAAGKHPVYRGIRSRSGKWVSEIREPRKTTRIWLGTYPTPEMAATA  93

Query  523  ydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQ  702
            YDVAA AL+ +EAVLNFP +   YPVP SS  ADIR AAA+AA  +K E    +G     
Sbjct  94   YDVAAFALKGSEAVLNFPDHVYSYPVPSSSSQADIRAAAAAAATAIKTE----EGEKPAA  149

Query  703  ERKDDPSVNTEYIDEEELFDMHNL------LVDMAGGMMVSPPRINSSHPADDSPENSDA  864
            +        +     +E  D   L      LVDMAGGM++SPPR+ S  P+ DSPENS+ 
Sbjct  150  DPGGGDGGGSASAAGDEFIDEEALFDMPNLLVDMAGGMLMSPPRMKSP-PSGDSPENSEG  208

Query  865  ETLWNY  882
            E+LW+Y
Sbjct  209  ESLWSY  214



>ref|XP_009400452.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Musa acuminata subsp. malaccensis]
Length=211

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 116/179 (65%), Gaps = 11/179 (6%)
 Frame = +1

Query  346  AEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaay  525
            A Q ++     P   R +H  YRG+R RSGKWVSEIREPRK +RIWLGTYPT EMAA AY
Sbjct  43   AVQAESETRMRPDASR-RHLSYRGIRYRSGKWVSEIREPRKASRIWLGTYPTAEMAAVAY  101

Query  526  dvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQE  705
            DVAA ALR  +AVLNFP   A  P P S+    IR AAA AAA + P+ ++     S Q 
Sbjct  102  DVAAHALRGTDAVLNFPDEIASRPAPASASPNHIRAAAAEAAASLVPKPAA--AAASHQH  159

Query  706  RKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                      YIDEEE+FDM  LLV+MA GM++SPPR++    +DD PE S+ E+LW+Y
Sbjct  160  -------PGSYIDEEEIFDMPQLLVNMAEGMLMSPPRLSPDR-SDDPPELSEGESLWSY  210



>ref|XP_010482549.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Camelina sativa]
Length=238

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G + A  + TG  GKH  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  53   GGSPARRTGTGLSGKHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVA  112

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaa--------ammkpesssGDGG  690
            ALAL+ ++AVLNFP  A  Y  PVS+ AADIR AA+ AA           K    +G  G
Sbjct  113  ALALKGSDAVLNFPGLALTYVPPVSNSAADIRAAASKAAEMKQPDPGEAEKVLDPTGQPG  172

Query  691  GSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA-DDSPENSDAE  867
               +    +     E++DEEE+ +M  LL +MA GM++SPPR+  +    DDSPEN    
Sbjct  173  KEEEVVVVEVEEGFEFMDEEEMLNMPTLLTEMAEGMLMSPPRMMITPTVDDDSPENHHGA  232

Query  868  TLWNY  882
             LW+Y
Sbjct  233  NLWSY  237



>ref|XP_010919217.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Elaeis guineensis]
Length=224

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 120/181 (66%), Gaps = 24/181 (13%)
 Frame = +1

Query  394  GKH-PKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G H P YRGVRSRSGKWVSEIREPRK  RIWLGT+PT EMAA AYDVAA ALR A+AVLN
Sbjct  49   GTHRPSYRGVRSRSGKWVSEIREPRKANRIWLGTFPTAEMAAVAYDVAAHALRGADAVLN  108

Query  571  FPAYAARYPVPVsseaadirraaasaaamm----kpesssGDGGGSR-------------  699
            FP   +  P P S   +DIR AAA+AAA +    + +      GGSR             
Sbjct  109  FPDDISSRPTPASVSPSDIRAAAAAAAAELLPRPERQEDVAAAGGSRAPGSSEAGGSSGS  168

Query  700  QERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWN  879
             +RK+      E+IDEEE+F M NLL +MA GM++SPPR++ +  +DDSP+ S+ E+LW+
Sbjct  169  GQRKE-----GEFIDEEEIFGMPNLLANMAEGMLMSPPRLSPTG-SDDSPDASEGESLWS  222

Query  880  Y  882
            Y
Sbjct  223  Y  223



>gb|KCW46383.1| hypothetical protein EUGRSUZ_K00220, partial [Eucalyptus grandis]
Length=162

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 106/162 (65%), Gaps = 11/162 (7%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP+YRG+RSR  KWVSEIREPRK TRIWLGTYPTPEMAAAAYDVAALAL+   A+LNFP
Sbjct  11   RHPEYRGIRSRGRKWVSEIREPRKATRIWLGTYPTPEMAAAAYDVAALALKGPGALLNFP  70

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
            +    YP+P S+  +DIR  A+ AA         G             +   E+IDE+ +
Sbjct  71   SSVLTYPIPPSTSPSDIRATASRAATARLLRWDLGIDSNEHTA-----ASGQEFIDEDAI  125

Query  757  FDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             +M NLL DMA GM++SPPR       ++S E SDAE LWNY
Sbjct  126  LNMPNLLADMAEGMLLSPPR------PEESQEYSDAEGLWNY  161



>ref|XP_010086541.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|AHJ25963.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB19758.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=261

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 109/185 (59%), Gaps = 18/185 (10%)
 Frame = +1

Query  382  TGGRGKHP-KYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaE  558
            T     HP ++RG+R RSGKWVSEIREPRKTTRIWLGT+P PEMAAAAYDVAALAL+ ++
Sbjct  76   TSSGSNHPARFRGIRCRSGKWVSEIREPRKTTRIWLGTFPAPEMAAAAYDVAALALKGSD  135

Query  559  AVLNFPAYAARYPVPVsse-------------aadirraaasaaammkpesssGDGGGSR  699
            AVLNFP     YPVP S+              +         AA      S  GD   + 
Sbjct  136  AVLNFPTSVGDYPVPASTSPGDIRSAATAAAASKRAELERRKAAREAMTASFHGDSSSTT  195

Query  700  QERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADD---SPENSD-AE  867
                     + EY+DEE LF M NLLV+MA GM++SPPR+  S P  D   SP +SD  +
Sbjct  196  TAELTTSYDHGEYVDEEALFGMPNLLVEMAEGMLLSPPRMMESPPPSDEYYSPGSSDGGD  255

Query  868  TLWNY  882
            +LW Y
Sbjct  256  SLWGY  260



>ref|XP_006281020.1| hypothetical protein CARUB_v10027037mg [Capsella rubella]
 gb|EOA13918.1| hypothetical protein CARUB_v10027037mg [Capsella rubella]
Length=237

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 122/193 (63%), Gaps = 24/193 (12%)
 Frame = +1

Query  355  GQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
            G + A  + TG  GKH  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA
Sbjct  51   GGSPARRTTTGLSGKHSVFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVA  110

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            ALAL+ ++AVLNFP  A  Y  PVS+ AADIR AA  AA M +P     D G    E+  
Sbjct  111  ALALKGSDAVLNFPGLALTYVAPVSNSAADIRAAAGKAAEMKQP-----DPG--EAEKVP  163

Query  715  DPS----------------VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA-DD  843
            +P                  + E++DEE + +M  LL +MA GM++SPPR+  +    DD
Sbjct  164  EPGQPEKEEEVEVVEEEGLCSLEFMDEEAMLNMPTLLTEMAEGMLMSPPRMMITPTVDDD  223

Query  844  SPENSDAETLWNY  882
            SPEN   + LW+Y
Sbjct  224  SPENHQGDNLWSY  236



>ref|XP_010036724.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Eucalyptus grandis]
Length=229

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 120/196 (61%), Gaps = 20/196 (10%)
 Frame = +1

Query  340  RLAEQGQAAAASSPTGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaa  516
            R   +G  +   SP    G+HP YRGVR RS GKWVSEIREPRK TRIWLGT+PTPEMAA
Sbjct  38   REGSRGSGSGTQSPAAS-GRHPVYRGVRRRSSGKWVSEIREPRKPTRIWLGTFPTPEMAA  96

Query  517  aaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammk--------pes  672
             AYDVAAL L+  EA LNFPA  A  P P SS   DI+ AAASAAA              
Sbjct  97   IAYDVAALTLKGPEAELNFPASVASLPTPASSSPRDIQAAAASAAAAAGAARDALRPTRL  156

Query  673  ssGDGGGS-----RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHP  834
              G+G G      R E     +VN E++DEE +F+M N+L +MA GM++SPPR+   S P
Sbjct  157  VQGEGQGQASSERRLEGNASGNVN-EFVDEEMIFNMPNVLANMAEGMLLSPPRLEVDSTP  215

Query  835  ADDSPENSDAETLWNY  882
                PEN++ + LW +
Sbjct  216  G---PENTEDQDLWKF  228



>ref|XP_010442714.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Camelina sativa]
Length=237

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = +1

Query  343  LAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaa  522
            LA  G + A  + TG  GKH  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAA
Sbjct  49   LASAGGSPARRTGTGLSGKHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAA  108

Query  523  ydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG-----  687
            YDVAALAL+ ++AVLNFP  A  Y  PVS+ AADIR AA+ AA M +P+    +      
Sbjct  109  YDVAALALKGSDAVLNFPGLALTYVPPVSNSAADIRAAASKAAEMKQPDPGEAEKVLDPT  168

Query  688  --GGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA-DDSPENS  858
               G  +E   +     E++DEEE+ +M  LL +MA GM++SPPR+  +    DDSPEN 
Sbjct  169  GQPGKEEEVVVEGEEGFEFMDEEEMLNMPTLLTEMAEGMLMSPPRMMITPTVDDDSPENH  228

Query  859  DAETLWNY  882
              + LW+Y
Sbjct  229  HGDNLWSY  236



>ref|XP_004171678.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Cucumis sativus]
Length=169

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 107/164 (65%), Gaps = 5/164 (3%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +H  Y+G+R R GKWVSEIREPRKT RIWLGTYPTPEMAAAAYDVAALAL+   AVLNFP
Sbjct  8    RHDHYKGIRCRGGKWVSEIREPRKTNRIWLGTYPTPEMAAAAYDVAALALKGCNAVLNFP  67

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
               A YPVP  S +    R AA+AAA  K     G+        +  P+   E++DEE L
Sbjct  68   NSVAFYPVPA-STSPTDIRIAAAAAAASKKVDDQGENSYHNSHYQSPPT--NEFVDEEAL  124

Query  757  FDMHNLLVDMAGGMMVSPPRINSSHPADD--SPENSDAETLWNY  882
            F M NLL DMA GM++SPPR+NSS    D  S  +S    LW+Y
Sbjct  125  FGMPNLLHDMAEGMLLSPPRMNSSPSRHDYYSWNSSGDGNLWSY  168



>ref|XP_004151047.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Cucumis sativus]
Length=169

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 108/164 (66%), Gaps = 5/164 (3%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +H  Y+G+R R GKWVSEIREPRKT RIWLGTYPTPEMAAAAYDVAALAL+   AVLNFP
Sbjct  8    RHDHYKGIRCRGGKWVSEIREPRKTNRIWLGTYPTPEMAAAAYDVAALALKGCNAVLNFP  67

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
               A YPVP  S + +  R AA+AAA  K     G+        +  P+   E++DEE L
Sbjct  68   NSVAFYPVPA-STSPNDIRIAAAAAAASKKVDDQGENSYHNSHYQSPPT--NEFVDEEAL  124

Query  757  FDMHNLLVDMAGGMMVSPPRINSSHPADD--SPENSDAETLWNY  882
            F M NLL DMA GM++SPPR+NSS    D  S  +S    LW+Y
Sbjct  125  FGMPNLLHDMAEGMLLSPPRMNSSPSRHDYYSWNSSGDGNLWSY  168



>ref|XP_010242644.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Nelumbo nucifera]
Length=211

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 117/206 (57%), Gaps = 24/206 (12%)
 Frame = +1

Query  337  PRLAEQGQAAAASSPTGGRGK--------HPKYRGVRSRSG-KWVSEIREPRKTTRIWLG  489
            PR    G+  A  S               HP YRGVR RSG KWVSEIREP+K  RIWLG
Sbjct  5    PRTNSDGRTNAGGSSVANDADANHLLPCHHPVYRGVRRRSGGKWVSEIREPKKPNRIWLG  64

Query  490  TYPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsse-----aadirraaasaaa  654
            TYPTPEMAA AYDVAALAL+  +A LNFP  AA  PVP S        A    AAA+ AA
Sbjct  65   TYPTPEMAAVAYDVAALALKGPDAKLNFPLSAASLPVPTSKSPRDIQDAAATAAAAAGAA  124

Query  655  mmkpesssGDGGGSRQERKDDPSVNT---------EYIDEEELFDMHNLLVDMAGGMMVS  807
            M     S G GG ++ +     +V +         +YIDEE LFDM NLLV+MA GM++S
Sbjct  125  MDSFSESPGPGGQAKNDFSSSVTVTSDANYSLVSNDYIDEEFLFDMPNLLVNMAEGMLLS  184

Query  808  PPRINSSHPADDSP-ENSDAETLWNY  882
            PPR+      DD+  EN+    LW+Y
Sbjct  185  PPRLGVVAADDDATIENTATHNLWSY  210



>ref|XP_010444260.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Camelina sativa]
Length=237

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 125/188 (66%), Gaps = 8/188 (4%)
 Frame = +1

Query  343  LAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaa  522
            LA  G + A  + TG  GKH  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAA
Sbjct  49   LAVAGGSPARRTGTGLSGKHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPAPEMAAAA  108

Query  523  ydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG-----  687
            YDVAALAL+ ++AVLNFP  A  Y  PVS+ AADIR AA+ AA M +P+    +      
Sbjct  109  YDVAALALKGSDAVLNFPGLALTYVPPVSNSAADIRAAASKAAEMKQPDPGEAEKVLDPT  168

Query  688  --GGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPA-DDSPENS  858
               G  +E   +     E++DEEE+ +M  LL +MA GM++SPPR+  +    DDSP+N 
Sbjct  169  GQPGKEEELVVEVEEGLEFMDEEEMLNMPTLLTEMAEGMLMSPPRMMITPTVDDDSPDNH  228

Query  859  DAETLWNY  882
              + LW+Y
Sbjct  229  HGDNLWSY  236



>gb|KCW48357.1| hypothetical protein EUGRSUZ_K02071 [Eucalyptus grandis]
Length=194

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 119/192 (62%), Gaps = 20/192 (10%)
 Frame = +1

Query  352  QGQAAAASSPTGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaayd  528
            +G  +   SP    G+HP YRGVR RS GKWVSEIREPRK TRIWLGT+PTPEMAA AYD
Sbjct  7    RGSGSGTQSPAAS-GRHPVYRGVRRRSSGKWVSEIREPRKPTRIWLGTFPTPEMAAIAYD  65

Query  529  vaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammk--------pesssGD  684
            VAAL L+  EA LNFPA  A  P P SS   DI+ AAASAAA                G+
Sbjct  66   VAALTLKGPEAELNFPASVASLPTPASSSPRDIQAAAASAAAAAGAARDALRPTRLVQGE  125

Query  685  GGGS-----RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDS  846
            G G      R E     +VN E++DEE +F+M N+L +MA GM++SPPR+   S P    
Sbjct  126  GQGQASSERRLEGNASGNVN-EFVDEEMIFNMPNVLANMAEGMLLSPPRLEVDSTPG---  181

Query  847  PENSDAETLWNY  882
            PEN++ + LW +
Sbjct  182  PENTEDQDLWKF  193



>ref|XP_007210670.1| hypothetical protein PRUPE_ppa022712mg [Prunus persica]
 gb|EMJ11869.1| hypothetical protein PRUPE_ppa022712mg [Prunus persica]
Length=178

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 117/177 (66%), Gaps = 19/177 (11%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKH +Y G+R R GKWVSEIREPRKT RIWLGTYPTPEMAAAAYDVAALAL+  +AVLNF
Sbjct  7    GKHSRYHGIRCRGGKWVSEIREPRKTRRIWLGTYPTPEMAAAAYDVAALALKRGDAVLNF  66

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEY-----  738
            P+  A YPVP S+   DIR AA++AAA+   E ++       +++K +  + T       
Sbjct  67   PSSIASYPVPASTSPEDIRSAASAAAALQWNEEANNSLKHRERQKKQEDDMRTMMNSSSL  126

Query  739  -----IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSDA--ETLWNY  882
                 IDEEELF M NLLV+MA GM++SPPR     P D  DS  NSD     LW++
Sbjct  127  ASSVGIDEEELFGMPNLLVEMAEGMLLSPPR-----PPDYPDSSGNSDGGESGLWSF  178



>ref|XP_009621025.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Nicotiana tomentosiformis]
Length=217

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 123/212 (58%), Gaps = 35/212 (17%)
 Frame = +1

Query  331  LSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEM  510
            LS  + E  Q+A  ++      KHP YRG+R RSGKWVSEIREPRKTTRIWLGT+PTPEM
Sbjct  13   LSNTVVENKQSARTNT------KHPLYRGIRCRSGKWVSEIREPRKTTRIWLGTFPTPEM  66

Query  511  aaaaydvaalalrsaE-AVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG  687
            AAAAYDVAALAL+ ++  VLNFP +   YP  +    +     +A+A A    +  +G+G
Sbjct  67   AAAAYDVAALALKGSDNVVLNFPCHVNSYP-QLPPSPSPADIQSAAATAAALMKQEAGEG  125

Query  688  GGSRQERKDD--------------------PS-------VNTEYIDEEELFDMHNLLVDM  786
                Q+  DD                    PS       +  +Y+DE+++F M NLLVDM
Sbjct  126  TVVAQQGNDDQLSGSNGVGATFNEGDSVEFPSLENYNVQIGEKYVDEDDVFYMPNLLVDM  185

Query  787  AGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            A  MM+SPPRINSS   D   +    E+LW+Y
Sbjct  186  AEAMMMSPPRINSSTLEDSKGDPLYIESLWSY  217



>ref|XP_002528595.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
 gb|EEF33803.1| Dehydration-responsive element-binding protein 1B, putative [Ricinus 
communis]
Length=186

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 112/170 (66%), Gaps = 8/170 (5%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+  +A LN
Sbjct  17   GRHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGRDAELN  76

Query  571  FPAYAARYPVPVsse-aadirraaasaaammkpesssGDGGGSR-----QERKDDPSVNT  732
            FP  AA  PVP S+        AA++AAA+     + G G  S      QE    P V+ 
Sbjct  77   FPNSAASLPVPASASPRDIQAAAASAAAAIGAARDALGIGSSSHQTVIMQESNYRPMVH-  135

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            E++DE+ +FDM NLLV+MA GM++SPPR++ +  A    EN   + LW +
Sbjct  136  EFVDEDLIFDMPNLLVNMAEGMLLSPPRLDIAPDAAFDDENPGDQNLWKF  185



>ref|XP_004496613.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Cicer arietinum]
Length=213

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 107/175 (61%), Gaps = 16/175 (9%)
 Frame = +1

Query  406  KYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYA  585
            +YRG R RSGKWVSEIREPRKT RIWLGTYPT EMAAAAYDVAALAL+  +  LNFP   
Sbjct  37   RYRGTRCRSGKWVSEIREPRKTKRIWLGTYPTSEMAAAAYDVAALALKGPDTFLNFPNSI  96

Query  586  ARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV----------NTE  735
              YP+P S    DIR AA +AA                ++ K++PS             +
Sbjct  97   LSYPIPASMSPTDIRAAAEAAAQARIVNVIRSSQSQQEEKEKENPSCFEGSNSDSGHQQQ  156

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINS---SHPADDSPENSDA---ETLWNY  882
            YIDE+EL +M NLL DMA GM VSPPRI S       D+SP NSD+   + LW+Y
Sbjct  157  YIDEDELLNMPNLLDDMARGMQVSPPRITSFSNYSDHDNSPSNSDSGGGDNLWSY  211



>ref|XP_010940895.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Elaeis guineensis]
Length=179

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 113/170 (66%), Gaps = 7/170 (4%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKH  YRGVRSR GKWVSEIREP K +RIWLGTYPTPEMAA AYDVAALALR + AVLNF
Sbjct  9    GKHQSYRGVRSRYGKWVSEIREPGKDSRIWLGTYPTPEMAAMAYDVAALALRGSGAVLNF  68

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS----RQERKDDPSV---NT  732
            P    R+P   S+   DIR AA++AAA M   ++   G  S    RQ   D  S      
Sbjct  69   PDAVGRHPALASTSRTDIRAAASAAAAAMTVPATQRPGTSSDATDRQCWFDGTSSGGDGA  128

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +++DE+E+FDM  LL  MA GM+++PP   S   ++D+PE S  E+LW+Y
Sbjct  129  KFLDEDEIFDMPQLLRSMAEGMLMTPPSWLSPSQSEDTPETSGEESLWSY  178



>emb|CBI30255.3| unnamed protein product [Vitis vinifera]
Length=199

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +1

Query  397  KHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR RS GKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+  +A LNF
Sbjct  36   RHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGQDAELNF  95

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-QERKDDPSVNTEYIDEE  750
            P  A+  PVP S+   DI+ AAASAAA       +  GGGS         S+  E++DE+
Sbjct  96   PNSASSLPVPASTSPRDIQVAAASAAAAAGAAVDALSGGGSTISPIALGRSMANEFVDED  155

Query  751  ELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             +FDM NLLV+MA GM++SPPR++ +   D + + +   +LWNY
Sbjct  156  LIFDMPNLLVNMAEGMLLSPPRLDLAG-EDATADFTGDHSLWNY  198



>gb|EPS66754.1| hypothetical protein M569_08021 [Genlisea aurea]
Length=211

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 120/185 (65%), Gaps = 19/185 (10%)
 Frame = +1

Query  367  AASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalal  546
            A +SP  GR  HP YRG+R+RSGKWVSEIREPRKTTRIWLGTY T EMAAAAYDVA LAL
Sbjct  28   AVASPPSGR--HPLYRGIRTRSGKWVSEIREPRKTTRIWLGTYTTAEMAAAAYDVATLAL  85

Query  547  rsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-------QE  705
            +  +A LNFP  A+ YPVP  + +A   RAAA+A A  +   +  DG  S          
Sbjct  86   KGPDAPLNFPHLASSYPVPA-TLSAGDIRAAAAAIATSQQPKNPSDGETSDPAAAVPLTN  144

Query  706  RKDDPSVNTE--YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA----E  867
                P++  E  ++DEE++F+M  L+ +MA GM++SPPRIN   PAD+  E++DA     
Sbjct  145  PARSPAIAEEEIFMDEEDIFEMPKLMAEMAEGMLLSPPRIN--LPADED-ESTDAFAGNT  201

Query  868  TLWNY  882
             LW Y
Sbjct  202  ILWTY  206



>ref|XP_008809497.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Phoenix dactylifera]
Length=183

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 114/181 (63%), Gaps = 10/181 (6%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            A++P    GKH  YRGVR RSGKWVSEIRE  K +RIWLGTYPTPEMAA A+DVAALALR
Sbjct  2    ATNPPAAGGKHRSYRGVRYRSGKWVSEIRELGKDSRIWLGTYPTPEMAAMAHDVAALALR  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERK---DDP  720
                VLNFP    R+P   S+  ADIR AA++AAA M    +      S  +R+   D  
Sbjct  62   GPGTVLNFPDAVGRHPALASTSRADIRAAASAAAAAMTVSGTQRPETSSAADRRCWFDGK  121

Query  721  SVNTE-------YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWN  879
            S   E       ++DE+E+FDM  LL  MA GM+++PP      P++D+PE S  E+LW+
Sbjct  122  STGCEEELDEVKFLDEDEIFDMPQLLTSMAEGMLMTPPSWFCPSPSEDTPEASGVESLWS  181

Query  880  Y  882
            Y
Sbjct  182  Y  182



>ref|XP_009132569.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Brassica rapa]
Length=212

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 113/163 (69%), Gaps = 7/163 (4%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA+LAL+ +E+VLNF
Sbjct  56   GRHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVASLALKGSESVLNF  115

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
            P     Y  P S+ A DIR AAA AA M +P      G    +E ++    + E++DEE 
Sbjct  116  PGLVLSYVAPASNSAKDIRAAAARAAEMKQP------GKEEEEEEEEALYSSLEFMDEEA  169

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            + +M +L  +MA GM++SPPR+      DDSPEN + + LW+Y
Sbjct  170  MLNMPSLFTEMAEGMLMSPPRMTDLW-MDDSPENHEGDCLWSY  211



>ref|XP_008238801.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Prunus mume]
Length=180

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 112/179 (63%), Gaps = 21/179 (12%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKH +Y G+R R GKWVSEIREPRKT RIWLGTYPTPEMAAAAYDVAALAL+  +AVLNF
Sbjct  7    GKHSRYHGIRCRGGKWVSEIREPRKTRRIWLGTYPTPEMAAAAYDVAALALKRGDAVLNF  66

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEY-----  738
            P+  A YPVP S+   DIR AAA+AAA     +   +    ++E +     +        
Sbjct  67   PSSIASYPVPASTSPEDIRSAAAAAAAAALQWNEEANNSLKQRESQKKQENDMRMMMNSS  126

Query  739  -------IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSDA--ETLWNY  882
                   IDEEELF M NLL +MA GM++SPPR     P D  DS  NSD     LW++
Sbjct  127  SLASSVGIDEEELFGMPNLLTEMAEGMLLSPPR-----PPDYPDSSGNSDGGESGLWSF  180



>ref|XP_007158457.1| hypothetical protein PHAVU_002G154000g [Phaseolus vulgaris]
 gb|ESW30451.1| hypothetical protein PHAVU_002G154000g [Phaseolus vulgaris]
Length=168

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 116/167 (69%), Gaps = 6/167 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+RSR  KWVSEIREPRK +RIWLGT+PTPEMAA AYDVAALAL+   AVLN P
Sbjct  2    RHPLYRGIRSRGRKWVSEIREPRKASRIWLGTFPTPEMAATAYDVAALALKGDAAVLNLP  61

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNT-----EYI  741
                +Y +P ++  ADIR AA++AAAMMK E+ +     S+ E       +T      ++
Sbjct  62   HSVTKYQIPATNSPADIRTAASAAAAMMKSETEASHNIASQTEATHTNYASTWWFENNFL  121

Query  742  DEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            DEE +F M +LLVDMAGGM++S P   S  P+D+SPE   AETLW+Y
Sbjct  122  DEEAIFGMPSLLVDMAGGMLLS-PPRMSPPPSDNSPEKQAAETLWSY  167



>ref|XP_004976542.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
isoform X1 [Setaria italica]
Length=199

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 108/185 (58%), Gaps = 23/185 (12%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKHP YRG+RSRSGKWVSEIREPRKT RIWLGT+PT EMAA AYDVAA ALR  +  LNF
Sbjct  13   GKHPYYRGIRSRSGKWVSEIREPRKTRRIWLGTFPTAEMAAVAYDVAARALRGPDTALNF  72

Query  574  PAYAARYPVPVsseaad---------------------irraaasaaammkpesssGDGG  690
            P  AA  P P S+ A D                         A +AA     +   G   
Sbjct  73   PDLAASRPAPASTSADDIRAAAAEAAAALQEPDRHSAQGGGIAPAAAGGTAQQQPGGSSA  132

Query  691  GSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA-E  867
             + Q+     + +  Y+DEE LF+    L +MA GMM+SPPR+  +  +DDSP+ S+A +
Sbjct  133  AAHQQEGSSSAGSQYYLDEEALFETPQYLRNMAAGMMMSPPRLGRNS-SDDSPDPSEAGD  191

Query  868  TLWNY  882
            +LW+Y
Sbjct  192  SLWSY  196



>ref|XP_002283401.3| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF024 [Vitis vinifera]
Length=276

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +1

Query  397  KHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR RS GKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+  +A LNF
Sbjct  113  RHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGQDAELNF  172

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-QERKDDPSVNTEYIDEE  750
            P  A+  PVP S+   DI+ AAASAAA       +  GGGS         S+  E++DE+
Sbjct  173  PNSASSLPVPASTSPRDIQVAAASAAAAAGAAVDALSGGGSTISPIALGRSMANEFVDED  232

Query  751  ELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             +FDM NLLV+MA GM++SPPR++ +   D + + +   +LWNY
Sbjct  233  LIFDMPNLLVNMAEGMLLSPPRLDLAG-EDATADFTGDHSLWNY  275



>emb|CAN71903.1| hypothetical protein VITISV_035581 [Vitis vinifera]
Length=327

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = +1

Query  397  KHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR RS GKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+  +A LNF
Sbjct  164  RHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGQDAELNF  223

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-QERKDDPSVNTEYIDEE  750
            P  A+  PVP S+   DI+ AAASAAA       +  GGGS         S+  E++DE+
Sbjct  224  PNSASSLPVPASTSPHDIQVAAASAAAAAGAAVDALSGGGSTISPIALGRSMANEFVDED  283

Query  751  ELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             +FDM NLLV+MA GM++SPPR++ +   D + + +   +LWNY
Sbjct  284  LIFDMPNLLVNMAEGMLLSPPRLDLAG-EDATADFTGDHSLWNY  326



>ref|XP_006358390.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Solanum tuberosum]
Length=201

 Score =   114 bits (284),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 105/189 (56%), Gaps = 29/189 (15%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaE-AVLNF  573
            KHP YRG+R RSGKWV EIREPRKTTRIWLGTYPTP+MAAAAYDVAALAL+  +  VLNF
Sbjct  15   KHPIYRGIRCRSGKWVCEIREPRKTTRIWLGTYPTPQMAAAAYDVAALALKGTQNVVLNF  74

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVN--------  729
            P     Y  P    +        +AA      +S GD      E +D    N        
Sbjct  75   PHLVDSY--PKLPPSPSPADIQRAAATAAGAMASLGDDDDRSLESRDGAICNERGSTEFP  132

Query  730  ------------------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPEN  855
                               EY+DEE LF+  +LLV+MA  MM+SPPRINS    D S  +
Sbjct  133  SSSGNYDMQIGTQTTAGEEEYVDEEALFEFPSLLVNMAEAMMLSPPRINSFQSEDYSSGD  192

Query  856  SDAETLWNY  882
             DAE+LW+Y
Sbjct  193  FDAESLWSY  201



>ref|XP_007155698.1| hypothetical protein PHAVU_003G223600g [Phaseolus vulgaris]
 gb|ESW27692.1| hypothetical protein PHAVU_003G223600g [Phaseolus vulgaris]
Length=205

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = +1

Query  406  KYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYA  585
            +YRG R RSGKWVSEIREPRKT RIWLGTYP  EMAAAAYDVAALAL+  +  LNFP   
Sbjct  46   RYRGTRCRSGKWVSEIREPRKTKRIWLGTYPAAEMAAAAYDVAALALKGPDTPLNFPNSI  105

Query  586  ARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEELFDM  765
              YP+P S  A DIR AAA+AA      +    G         +     EY DE+EL +M
Sbjct  106  LSYPIPASLSATDIRAAAAAAAQARIVRAPQESGQAVNPHIGQELERREEYYDEDELLNM  165

Query  766  HNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             NLL +MA GM VSPPRI SS  +DDSP NSD + LW+Y
Sbjct  166  PNLLDEMARGMQVSPPRI-SSFSSDDSPGNSDGDNLWSY  203



>emb|CDY32604.1| BnaC03g15720D [Brassica napus]
Length=220

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 9/163 (6%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+H  +RG+R R+GKWVSEIREPRKTTRIWLGTYP PEMAAAAYDVA+LAL+ +E+VLNF
Sbjct  66   GRHSFFRGIRLRNGKWVSEIREPRKTTRIWLGTYPVPEMAAAAYDVASLALKGSESVLNF  125

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
            P     Y  P S+ A DIR AAA AA M +P        G  +E ++    + E++DEE 
Sbjct  126  PGLVLSYVAPASNSAKDIRAAAARAAEMKQP--------GKEEEEEEALYSSLEFMDEEA  177

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            + +M +L  +MA GM++SPPR+      DDS EN + ++LW+Y
Sbjct  178  MLNMPSLFTEMAEGMLMSPPRMTDLW-MDDSQENHEGDSLWSY  219



>ref|NP_172723.2| dehydration-responsive element-binding protein A-4 [Arabidopsis 
thaliana]
 sp|Q38Q39.1|ERF27_ARATH RecName: Full=Ethylene-responsive transcription factor ERF027 
[Arabidopsis thaliana]
 gb|ABB02373.1| Ap2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AEE28903.1| ethylene-responsive transcription factor ERF027 [Arabidopsis 
thaliana]
Length=192

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 115/191 (60%), Gaps = 16/191 (8%)
 Frame = +1

Query  358  QAAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaa  537
             ++ AS+  G R K P YRG+R RSGKWVSEIREPRKTTRIWLGTYP  EMAAAAYDVAA
Sbjct  2    NSSMASAGLGSRRKDPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPMAEMAAAAYDVAA  61

Query  538  lalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD-  714
            +AL+  EAVLNFP     YPVP S+ AADIR AAA+AAAM   E    +     ++    
Sbjct  62   MALKGREAVLNFPGSVGSYPVPESTSAADIRAAAAAAAAMKGCEEGEEEKKAKEKKSSSS  121

Query  715  ---------DPSVNTEYIDEEELFDMHNLL------VDMAGGMMVSPPRINSSHPADDSP  849
                     D  V +      E  D   +L       +MA GMMV+PP    S P+DDSP
Sbjct  122  KSRARECHVDNDVGSSSWCGTEFMDEEEVLNMPNLLANMAEGMMVAPPSWMGSRPSDDSP  181

Query  850  ENSDAETLWNY  882
            ENS+ E LW Y
Sbjct  182  ENSNDEDLWGY  192



>ref|XP_006482362.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Citrus sinensis]
Length=210

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 101/158 (64%), Gaps = 16/158 (10%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREPRK TRIWLGT+ TPEMAA AYDVAALAL+  EA LN
Sbjct  29   GRHPTYRGVRRRSSGKWVSEIREPRKPTRIWLGTFATPEMAAIAYDVAALALKGQEAELN  88

Query  571  FPAYAARYPVPVsse------aadirraaasaaammkpesssGDGGGSRQERKDD-----  717
            FP  AA  PVP S+       AA    AA  AA       +  + G   Q  ++D     
Sbjct  89   FPNSAASLPVPASTSPRDIQAAAASAAAALGAAKDALSGETIAESGDHHQAPRNDSVMIE  148

Query  718  ----PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRI  819
                P V  E++DEE +FDM NLLV+MA GM++SPPR+
Sbjct  149  PAERPMVLQEFMDEELIFDMPNLLVNMAEGMLLSPPRL  186



>ref|XP_006430287.1| hypothetical protein CICLE_v10012757mg [Citrus clementina]
 gb|ESR43527.1| hypothetical protein CICLE_v10012757mg [Citrus clementina]
Length=210

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 101/158 (64%), Gaps = 16/158 (10%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREPRK TRIWLGT+ TPEMAA AYDVAALAL+  EA LN
Sbjct  29   GRHPTYRGVRRRSSGKWVSEIREPRKPTRIWLGTFATPEMAAIAYDVAALALKGQEAELN  88

Query  571  FPAYAARYPVPVsse------aadirraaasaaammkpesssGDGGGSRQERKDD-----  717
            FP  AA  PVP S+       AA    AA  AA       +  + G   Q  ++D     
Sbjct  89   FPNSAASLPVPASTSPRDIQAAAASAAAALGAAKDALSGETIAESGDHHQAPRNDSVMIE  148

Query  718  ----PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRI  819
                P V  E++DEE +FDM NLLV+MA GM++SPPR+
Sbjct  149  PAERPMVLQEFMDEELIFDMPNLLVNMAEGMLLSPPRL  186



>ref|XP_011094407.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Sesamum indicum]
Length=202

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 116/184 (63%), Gaps = 9/184 (5%)
 Frame = +1

Query  352  QGQAAAASSPTGGRGKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaay  525
            +G+     S + G G+ P YRGVR R  SGKWVSEIREPR   RIWLGT+PTPEMAA AY
Sbjct  20   RGRYGGGKSVSDGGGR-PMYRGVRRRKSSGKWVSEIREPRTPNRIWLGTFPTPEMAAVAY  78

Query  526  dvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQE  705
            DVAA AL+  EA LNFP+ A+  PVP S+   DI+ AAASAAA +     +   G     
Sbjct  79   DVAAFALKGKEAELNFPSSASSLPVPASTSQRDIQAAAASAAAALGAAGDALGFGSLETS  138

Query  706  R-----KDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET  870
            +      + P VN E+IDE+ +FD+ N+L +MA GM++SPPRI+ +   +D       E 
Sbjct  139  KIGAAQPEMPVVN-EFIDEDLIFDLPNVLANMAQGMLISPPRIDFAEDENDFGGGMQDEY  197

Query  871  LWNY  882
            LWNY
Sbjct  198  LWNY  201



>gb|KDO61042.1| hypothetical protein CISIN_1g039696mg [Citrus sinensis]
Length=210

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 101/158 (64%), Gaps = 16/158 (10%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREPRK TRIWLGT+ TPEMAA AYDVAALAL+  EA LN
Sbjct  29   GRHPTYRGVRRRSSGKWVSEIREPRKPTRIWLGTFATPEMAAIAYDVAALALKGQEAELN  88

Query  571  FPAYAARYPVPVsse------aadirraaasaaammkpesssGDGGGSRQERKDD-----  717
            FP  AA  PVP S+       AA    AA  AA       +  + G   Q  ++D     
Sbjct  89   FPNSAASLPVPASTSPRDIQAAAASAAAALGAAKDALSGETIAESGDHHQAPRNDSVMIE  148

Query  718  ----PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRI  819
                P V  E++DEE +FDM NLLV+MA GM++SPPR+
Sbjct  149  PAERPMVLQEFMDEELIFDMPNLLVNMAEGMLLSPPRL  186



>ref|XP_007027629.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY08131.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=260

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 112/168 (67%), Gaps = 6/168 (4%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWVSEIREPRK  RIWLGT+PT EMAA AYDVAALAL+  +A LNF
Sbjct  92   RHPVYRGVRRRTSGKWVSEIREPRKPNRIWLGTFPTAEMAAIAYDVAALALKGQDAELNF  151

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERK-----DDPSVNTEY  738
            P  AA  PVP S+   DI+ AA SAAA +   + +  G    + R      D P+   E+
Sbjct  152  PNSAASLPVPASTSPRDIQAAATSAAAALGAANDALFGNEDNEARNSPVGPDKPTTVDEF  211

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +DE+ +FDM N+LV+MA GM++SPPR++ +     + +  DAE LW +
Sbjct  212  VDEDLIFDMPNVLVNMAEGMLLSPPRLDIAPAPAPADDAGDAENLWKF  259



>gb|AAF88080.1|AC025417_8 T12C24.16 [Arabidopsis thaliana]
 gb|AAT44960.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABE65615.1| AP2 domain-containing protein [Arabidopsis thaliana]
Length=188

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 113/187 (60%), Gaps = 16/187 (9%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            AS+  G R K P YRG+R RSGKWVSEIREPRKTTRIWLGTYP  EMAAAAYDVAA+AL+
Sbjct  2    ASAGLGSRRKDPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPMAEMAAAAYDVAAMALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD-----  714
              EAVLNFP     YPVP S+ AADIR AAA+AAAM   E    +     ++        
Sbjct  62   GREAVLNFPGSVGSYPVPESTSAADIRAAAAAAAAMKGCEEGEEEKKAKEKKSSSSKSRA  121

Query  715  -----DPSVNTEYIDEEELFDMHNLL------VDMAGGMMVSPPRINSSHPADDSPENSD  861
                 D  V +      E  D   +L       +MA GMMV+PP    S P+DDSPENS+
Sbjct  122  RECHVDNDVGSSSWCGTEFMDEEEVLNMPNLLANMAEGMMVAPPSWMGSRPSDDSPENSN  181

Query  862  AETLWNY  882
             E LW Y
Sbjct  182  DEDLWGY  188



>gb|ABK28393.1| unknown [Arabidopsis thaliana]
Length=189

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 113/187 (60%), Gaps = 16/187 (9%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            AS+  G R K P YRG+R RSGKWVSEIREPRKTTRIWLGTYP  EMAAAAYDVAA+AL+
Sbjct  2    ASAGLGSRRKDPVYRGIRCRSGKWVSEIREPRKTTRIWLGTYPMAEMAAAAYDVAAMALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD-----  714
              EAVLNFP     YPVP S+ AADIR AAA+AAAM   E    +     ++        
Sbjct  62   GREAVLNFPGSVGSYPVPESTSAADIRAAAAAAAAMKGCEEGEEEKKAKEKKSSSSKSRA  121

Query  715  -----DPSVNTEYIDEEELFDMHNLL------VDMAGGMMVSPPRINSSHPADDSPENSD  861
                 D  V +      E  D   +L       +MA GMMV+PP    S P+DDSPENS+
Sbjct  122  RECHVDNDVGSSSWCGTEFMDEEEVLNMPNLLANMAEGMMVAPPSWMGSRPSDDSPENSN  181

Query  862  AETLWNY  882
             E LW Y
Sbjct  182  DEDLWGY  188



>ref|XP_009382289.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Musa acuminata subsp. malaccensis]
Length=223

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +1

Query  406  KYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYA  585
             YRG+R RSGKWVSEIREP K +RIWLGTY T EMAA AYDVAA ALR A+AVLNFP   
Sbjct  64   SYRGIRQRSGKWVSEIREPGKASRIWLGTYATAEMAAVAYDVAAHALRGADAVLNFPDEI  123

Query  586  ARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEELFDM  765
            A  PVP S     IR AAA AA  +    +              PS   +YIDE+E+FDM
Sbjct  124  ATRPVPASGSPTAIRSAAAEAATALLLRGTGIAAADDDDAVPQRPS-EGQYIDEDEIFDM  182

Query  766  HNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
              LLV+MA GM++SPPR++ S P DD PE  + E+LW +
Sbjct  183  PQLLVNMAEGMLMSPPRLSPSGP-DDLPEVYEGESLWRW  220



>ref|XP_008238800.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Prunus mume]
Length=182

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 101/156 (65%), Gaps = 15/156 (10%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GK  +Y G+R R GKWVSEIREPRKT RIWLGTYPTPEMAA+AYDVAALAL+   AVLNF
Sbjct  7    GKQTRYHGIRCRGGKWVSEIREPRKTRRIWLGTYPTPEMAASAYDVAALALKGGHAVLNF  66

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPS----------  723
            P+  A YPVP S    DIR AAA+AAA +     S +   +  E K+ P           
Sbjct  67   PSSIALYPVPASKSPEDIRSAAAAAAAAVSAALQSNEEANNSLELKESPKKQEDDMTTMM  126

Query  724  -----VNTEYIDEEELFDMHNLLVDMAGGMMVSPPR  816
                  ++  +DEEELF M NLL +MA GM++SPPR
Sbjct  127  NSTSLASSVGMDEEELFGMPNLLAEMAEGMLLSPPR  162



>gb|KFK43528.1| hypothetical protein AALP_AA1G137900 [Arabis alpina]
Length=192

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 117/191 (61%), Gaps = 20/191 (10%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            AS+ +  + K P YRG+R RSGKWVSEIREP+KTTRIWLGTYPT EMAAAAYDVAALAL+
Sbjct  2    ASAGSSNQKKDPVYRGIRCRSGKWVSEIREPKKTTRIWLGTYPTAEMAAAAYDVAALALK  61

Query  550  saEAVLNFPAYAARYPVPVsseaadirraaasaaammk--------------pesssGDG  687
              EAVLNFP  A  YPVP S+ AADIR AAA+AAA +K                 SS   
Sbjct  62   GREAVLNFPGSAQSYPVPGSTSAADIRTAAAAAAAAVKGCEEEEDEKEKTKKSSRSSSSK  121

Query  688  GGSRQERKDDPSVNTEYIDEEELFDMHNLL------VDMAGGMMVSPPRINSSHPADDSP  849
              +R    D    ++ +    +  D   +L       +MA GMMV+PP    S P++DSP
Sbjct  122  SRARDYHVDYDMASSSWCGTGQFMDEEEVLNMPNLLANMAEGMMVAPPSWMDSPPSNDSP  181

Query  850  ENSDAETLWNY  882
            ENS+ E LW Y
Sbjct  182  ENSNDENLWGY  192



>ref|XP_011001062.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Populus euphratica]
Length=214

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 114/169 (67%), Gaps = 6/169 (4%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G    +RGVR RS GKWVSEIREP+K  RIWLGT+P PEMAA AYDVAALAL+  +A LN
Sbjct  45   GPQRAFRGVRRRSSGKWVSEIREPKKPNRIWLGTFPNPEMAAVAYDVAALALKGQDAELN  104

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesss----GDGGGSRQERKDDPSVNTEY  738
            FP  AA  PVP S+   DI+ AAASAAA +     +      G  ++ E++  P+V+ ++
Sbjct  105  FPNSAASLPVPASTSPRDIQAAAASAAAAIGAAKDALGIPNTGDTNQMEKEIRPTVDDQF  164

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDSPENSDAETLWNY  882
            +DE+ +FDM N+LV+MA GM++SPPR++ +      S +N+  + LW +
Sbjct  165  VDEDLIFDMPNVLVNMAEGMLLSPPRLDIAGDETTTSDDNAGDQNLWKF  213



>ref|XP_007203383.1| hypothetical protein PRUPE_ppa020711mg [Prunus persica]
 gb|EMJ04582.1| hypothetical protein PRUPE_ppa020711mg [Prunus persica]
Length=202

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 114/179 (64%), Gaps = 16/179 (9%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREPRK  RIWLGT+PTPEMAA AYDVAA+AL+  +A LN
Sbjct  23   GRHPTYRGVRRRSSGKWVSEIREPRKPNRIWLGTFPTPEMAAVAYDVAAIALKGQDAELN  82

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesss----GDGGGSRQERKDDPSVNTE-  735
            FP  A+  PVP SS + DI+ AAASAAA +   +++     D   SR E +       E 
Sbjct  83   FPNSASSLPVPASSSSRDIQAAAASAAAAIGAAAAAMGVGNDDSHSRTEVQAQGHRTIEA  142

Query  736  ----------YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                      ++DE+ +FDM N+LV+MA GM++SPPR++ +       +  D + LW +
Sbjct  143  ADRVALSDHQFVDEDLIFDMPNVLVNMAEGMLLSPPRLDIADDDVVGADQEDDQNLWKF  201



>ref|XP_008442806.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Cucumis melo]
Length=183

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 107/178 (60%), Gaps = 16/178 (9%)
 Frame = +1

Query  394  GKHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR R +GKWVSEIREPRK  RIWLGT+PT EMAA AYDVAALAL+  +  LN
Sbjct  6    GRHPVYRGVRRRNTGKWVSEIREPRKPNRIWLGTFPTAEMAAVAYDVAALALKGQDTELN  65

Query  571  FPAYAARYPVPVsse----aadirraaasaaammkpesssGDGGGSRQERKDDP------  720
            FP  A+  P+P S       A    AAA+  A      +  + G  R    DD       
Sbjct  66   FPNSASSLPIPASRSPSDIQAAAASAAAALGAAAAAMEARNNSGSRRGSHSDDVVYEARY  125

Query  721  ----SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                 + ++++DE+ +FDM N+L++MA GM++SPPR N +H  D+  +    + LWN+
Sbjct  126  GQEYELESQFMDEDLIFDMPNVLMNMAEGMLLSPPRFN-NHGGDEDRDFGTDQNLWNF  182



>ref|XP_004138009.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Cucumis sativus]
 ref|XP_004167928.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Cucumis sativus]
 gb|KGN59068.1| hypothetical protein Csa_3G751430 [Cucumis sativus]
Length=183

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 16/178 (9%)
 Frame = +1

Query  394  GKHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR R +GKWVSEIREPRK  RIWLGT+PT EMAA AYDVAALAL+  +A LN
Sbjct  6    GRHPVYRGVRRRNTGKWVSEIREPRKPNRIWLGTFPTAEMAAVAYDVAALALKGQDAELN  65

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPS---------  723
            FP  A+  P+P S   +DI+ AAASAAA +   +++ +   +   R+   S         
Sbjct  66   FPNSASSLPIPASRSPSDIQAAAASAAAALGAAAAAMEARNNISSRRGSHSEDVMYGARY  125

Query  724  -----VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                 +  +++DE+ +FDM N+L++MA GM++SPPR N +H  DD+ +    + LWN+
Sbjct  126  GQEYELGNQFMDEDLIFDMPNVLMNMAEGMLLSPPRFN-NHGGDDNRDFGTDQNLWNF  182



>ref|XP_002307914.1| hypothetical protein POPTR_0006s02180g [Populus trichocarpa]
 gb|EEE91437.1| hypothetical protein POPTR_0006s02180g [Populus trichocarpa]
Length=208

 Score =   108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 112/170 (66%), Gaps = 9/170 (5%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G H  +RGVR RS GKWVSEIREP+K  RIWLGT+P PEMAA AYDVAALAL+  +A LN
Sbjct  40   GHHHVFRGVRRRSSGKWVSEIREPKKPNRIWLGTFPNPEMAAVAYDVAALALKGQDAELN  99

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpes------ssGDGGGSRQERKDDPSVNT  732
            FP  AA  PVP S+   DI+ AAASAAA +          S GD     QE +  P VN 
Sbjct  100  FPNSAASLPVPASTSPRDIQAAAASAAAAIGAAKDALGIRSMGDTNQMEQEIR--PMVND  157

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +++DE+ +FDM N+LV+MA  M++SPPR++ +     + +++  + LW +
Sbjct  158  QFVDEDLMFDMPNVLVNMAEAMLLSPPRLDIAGDDATAYDSTGDQNLWKF  207



>ref|XP_003537044.2| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Glycine max]
Length=204

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 109/170 (64%), Gaps = 17/170 (10%)
 Frame = +1

Query  406  KYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAY  582
            KYRGVR R SGKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+  +A LNFP  
Sbjct  40   KYRGVRRRTSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGKDAGLNFPDS  99

Query  583  AARYPVPVssea----adirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEE  750
            A+  PVP S  A         AAA+A A      +        + +++   ++ +++DE+
Sbjct  100  ASSLPVPASLSARDIQVAAAAAAAAAGAANDAMRTQTANNNFSEAQENQTGMSNQFVDED  159

Query  751  ELFDMHNLLVDMAGGMMVSPPRINSSHPAD-----DSPENSDAET-LWNY  882
             +FDM N+LV+MA GM++SPP      P D     +SPEN++ ET LWN+
Sbjct  160  LIFDMPNVLVNMAQGMLLSPP------PFDIGLEPNSPENTEQETNLWNF  203



>ref|XP_009353175.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Pyrus x bretschneideri]
Length=199

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 116/179 (65%), Gaps = 16/179 (9%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAA+AL+  +A LN
Sbjct  20   GRHPTYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAAIALKGQDAELN  79

Query  571  FPAYAARYPVPVsseaadirraaasaaamm---------kpesssGDGGGSRQERK----  711
            FP  A+  P+P S+ + DI+ AA+SAAA M           +   G      Q  K    
Sbjct  80   FPNSASSLPMPASTSSRDIQAAASSAAAAMGVAIDRCSYSRDEVQGGHHNVHQAHKTVDE  139

Query  712  DDPSV-NTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDSPENSDAETLWNY  882
            DD  V N E++DE+ +F+M N+LV+MA GM++SPPR++ +   A D+ +    + LW +
Sbjct  140  DDRFVLNHEFVDEDLIFNMPNVLVNMAEGMLLSPPRLDIAGDDAIDADQEQGDQNLWKF  198



>ref|XP_008391810.1| PREDICTED: ethylene-responsive transcription factor ERF024 [Malus 
domestica]
Length=199

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 16/177 (9%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAA+AL+  +A LN
Sbjct  20   GRHPTYRGVRRRSSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAAIALKGQDAELN  79

Query  571  FPAYAARYPVPVsseaadirraaasaaamm---------kpesssGDGGGSRQERK----  711
            FP  A+  PVP S+ + DI+ AA+SAAA M           +   G      Q  K    
Sbjct  80   FPNSASSLPVPASTSSRDIQAAASSAAAAMGVAIDRCSYSRDEVQGGHHNVHQAHKTVDE  139

Query  712  DDPSV-NTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDSPENSDAETLW  876
            DD  V N E++DE+ +F+M N+LV+MA GM++SPPR++ +   A D+ +    + LW
Sbjct  140  DDRFVLNHEFVDEDLIFNMPNVLVNMAEGMLLSPPRLDIAGDDAIDADQEQGDQNLW  196



>gb|AFK49383.1| unknown [Lotus japonicus]
Length=179

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 112/178 (63%), Gaps = 24/178 (13%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaE-AVLNF  573
            +HP Y G+R R GKWVSEIREPRK +RIWLGT+PT EMAAAAYDVAALAL+  + AVL+ 
Sbjct  9    RHPVYHGIRCRGGKWVSEIREPRKASRIWLGTFPTAEMAAAAYDVAALALKGHDNAVLSL  68

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVN--------  729
            P     Y +PV++  ADIR AA +AA +MK            +    D S+N        
Sbjct  69   PGLMGMYQMPVTNSPADIRSAATAAAELMKNGGVE----EEEEGSGHDVSMNVMSEAAAG  124

Query  730  -------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
                   ++++DEE +F M +LLVDMAGGM++SPPR++  H    SPE    ETLW+Y
Sbjct  125  SSSLWFESDFMDEEAIFRMPSLLVDMAGGMLLSPPRMSPQH----SPERQAGETLWSY  178



>ref|XP_009793202.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Nicotiana sylvestris]
Length=196

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 118/189 (62%), Gaps = 20/189 (11%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
              +A++P    G+HP YRG+R R  SGKWVSEIREPR   RIWLGT+PT EMAA AYDVA
Sbjct  12   GGSATAPDNYSGRHPVYRGIRRRKSSGKWVSEIREPRSPNRIWLGTFPTAEMAAVAYDVA  71

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            A+AL+  +  LNFP  AA  PVP +S   DI+ AAASAAA +     +     +R+E  D
Sbjct  72   AIALKGRDTDLNFPNSAASLPVPATSSPRDIQAAAASAAAAVGAAGDA---LLARREVHD  128

Query  715  DPSV----------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADD---SPEN  855
              S           N E++DE+ +FDM N+LV+MA GM++SPPR N   P +D   + E 
Sbjct  129  QKSKLVSENLGFENNYEFMDEDLIFDMPNVLVNMAEGMLLSPPRFN--LPDEDFAAAAEY  186

Query  856  SDAETLWNY  882
            +  + LWNY
Sbjct  187  TAYQNLWNY  195



>ref|XP_007210653.1| hypothetical protein PRUPE_ppa021384mg [Prunus persica]
 gb|EMJ11852.1| hypothetical protein PRUPE_ppa021384mg [Prunus persica]
Length=185

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 98/159 (62%), Gaps = 18/159 (11%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G H +Y G+R R GKWVSEIREPRKT RIWLGTYPTPEMAA+AYDVAALAL+  +AVLNF
Sbjct  7    GNHTRYHGIRCRGGKWVSEIREPRKTRRIWLGTYPTPEMAASAYDVAALALKGGDAVLNF  66

Query  574  PAYAARYPVPVsse---aadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEY--  738
            P+  A YPVP S           AAA+AAA +     S +   +  E K+ P    +   
Sbjct  67   PSSIALYPVPASRSPEDIRSAAAAAAAAAAAVSAALQSNEEANNSLELKESPKKQEDNMT  126

Query  739  -------------IDEEELFDMHNLLVDMAGGMMVSPPR  816
                         +DEEELF M NLL +MA GM++SPPR
Sbjct  127  TMMNSTSLASSVGMDEEELFGMPNLLAEMAEGMLLSPPR  165



>ref|XP_007162859.1| hypothetical protein PHAVU_001G187100g [Phaseolus vulgaris]
 gb|ESW34853.1| hypothetical protein PHAVU_001G187100g [Phaseolus vulgaris]
Length=188

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 107/167 (64%), Gaps = 9/167 (5%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            +++ +  G  G+HP YRGVR RS GKWVSEIREPRK  RIWLGT+ TPEMAA AYDVAAL
Sbjct  8    SSSGASNGNTGRHPVYRGVRRRSSGKWVSEIREPRKPNRIWLGTFTTPEMAAIAYDVAAL  67

Query  541  alrsaEAVLNFPAYAARYPVPVssea---adirraaasaaammkpesssGDGGG----SR  699
            AL+  +A LNFP  A+  PVP SS A        +AA+A        S G  GG    S 
Sbjct  68   ALKGKDAELNFPNSASSLPVPASSAARDIQMAAASAAAAVGAANDALSEGSRGGNVSVSM  127

Query  700  QERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD  840
             +   + ++N  ++DE+ +FDM N+LV+MA GM++SPPR ++    D
Sbjct  128  AQEFSEGNLN-HFVDEDLIFDMPNILVNMAEGMLLSPPRFDNFAATD  173



>ref|XP_009764158.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Nicotiana sylvestris]
Length=218

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 115/200 (58%), Gaps = 39/200 (20%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr-saEAVLNF  573
            KHP YRG+R RSGKWVSEIREPRKTTRIWLGT+PTPEMAAAAYDVAALAL+ S+  VLNF
Sbjct  20   KHPVYRGIRCRSGKWVSEIREPRKTTRIWLGTFPTPEMAAAAYDVAALALKGSSNVVLNF  79

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD------------  717
            P +   YP  +    +     +A+A A    +  +GDG    Q+  DD            
Sbjct  80   PCHVNFYPQ-LPPSPSPADIQSAAAIAAALMKKEAGDGIVVAQQGNDDKLSGNSGGATCN  138

Query  718  -----------------PS-------VNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINS  825
                             PS       +  +Y+DE+++F M NLLVDMA  MM+SPPRINS
Sbjct  139  EGDSVGATCNEGDSIEYPSPESYNVQIGEKYVDEDDVFYMPNLLVDMAEAMMMSPPRINS  198

Query  826  SHPADDSPEN-SDAETLWNY  882
            S   + S  + S  E LW+Y
Sbjct  199  STWEEYSRGDPSYIENLWSY  218



>ref|XP_006339312.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Solanum tuberosum]
Length=188

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 115/187 (61%), Gaps = 16/187 (9%)
 Frame = +1

Query  367  AASSPTGGRGKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            ++S    G G+HP Y+G+R R  SGKWVSEIREPR   RIWLGT+PTPEMAA AYDVAAL
Sbjct  2    SSSGENNGSGRHPVYKGIRRRKSSGKWVSEIREPRSPNRIWLGTFPTPEMAAVAYDVAAL  61

Query  541  alrsaEAVLNFPAYAARYPVPVsse---------aadirraaasaaammkpesssGDGGG  693
            AL+  +A LNFP  A   PVP ++           A     AA  A +    SS+ +   
Sbjct  62   ALKGRDAELNFPNSAPSLPVPATNSPRDIQTAAACAAAALGAAGDALVGGRSSSNSNSRA  121

Query  694  SRQERKDD---PSVNT-EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD  861
              +E +D+   P+ N   ++DE+ +FDM N++++MA GM++SPPR+N   P DD    +D
Sbjct  122  VSREVEDNYLMPNNNEYNFMDEDLIFDMPNVIMNMAEGMLLSPPRLNHLPPDDDYIGGAD  181

Query  862  AETLWNY  882
             + LWNY
Sbjct  182  -QNLWNY  187



>ref|XP_003541448.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Glycine max]
Length=182

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 7/164 (4%)
 Frame = +1

Query  409  YRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYA  585
            YRGVR R SGKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+  +A LNFP  A
Sbjct  19   YRGVRRRNSGKWVSEIREPKKPNRIWLGTFPTPEMAAVAYDVAALALKGKDAGLNFPDSA  78

Query  586  ARYPVPVssea---adirraaasaaammkpesssGDGGGSRQERKDDPS-VNTEYIDEEE  753
            +  PVP S  A        AAA+AA   K    +  G  +  E +++P+ +  +++DE+ 
Sbjct  79   SSLPVPASLSARDIQVAAAAAAAAAGAAKDSMRTQTGNYNISEGQENPTGMGNQFVDEDL  138

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
            +FDM N+LV+MA GM++SPP  +      +SPEN++ ET LWN+
Sbjct  139  IFDMPNVLVNMAQGMLLSPPPFDIGL-EPNSPENTEQETSLWNF  181



>ref|XP_004246896.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Solanum lycopersicum]
Length=202

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 109/174 (63%), Gaps = 13/174 (7%)
 Frame = +1

Query  394  GKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVL  567
            G+HP YRG+R R  SGKWVSEIREP+   RIWLGT+PTPEMAA AYDVAA+AL+  EA L
Sbjct  30   GRHPVYRGIRRRKSSGKWVSEIREPKSPNRIWLGTFPTPEMAAIAYDVAAIALKGPEADL  89

Query  568  NFPAYAARYPVPVsseaadirraaasaaammkpesssGDGG---------GSRQERKDDP  720
            NFP  AA +PVP +S A DI+ AAA AAA +     +               + + ++  
Sbjct  90   NFPNSAASFPVPATSSARDIQTAAARAAAAIGAAGDALLAAAAVHREVVINEKGKLENVE  149

Query  721  SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
              N E++DE+ +FDM N+LV+MA GM++SPPR       DD       + LWNY
Sbjct  150  IQNFEFMDEDLIFDMPNVLVNMAEGMLLSPPRFYMHD--DDDQTTITYQNLWNY  201



>ref|XP_011004457.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Populus euphratica]
Length=207

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 111/170 (65%), Gaps = 9/170 (5%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G H  +RGVR RS GKWVSEIREP+K  RIWLGT+P PEMAA AYDVAALAL+  +A LN
Sbjct  39   GHHHVFRGVRRRSSGKWVSEIREPKKPNRIWLGTFPNPEMAAVAYDVAALALKGQDAELN  98

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpes------ssGDGGGSRQERKDDPSVNT  732
            FP  AA  PVP S+   DI+ AAASAAA +          S GD     QE +  P VN 
Sbjct  99   FPNSAASLPVPASTSPRDIQAAAASAAAAIGAAKDALGIPSMGDTNQMEQEIR--PMVND  156

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +++DE+ +FDM N+LV+MA  M++ PPR++ +     + +++  + LW +
Sbjct  157  QFVDEDLMFDMPNVLVNMAEAMLLIPPRLDIAGGDATADDSTGDQNLWKF  206



>ref|XP_009627498.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Nicotiana tomentosiformis]
Length=196

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 117/189 (62%), Gaps = 20/189 (11%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydva  534
             A+ S+     G+HP YRG+R R  SGKWVSEIREPR   RIWLGT+PT EMAA AYDVA
Sbjct  12   GASNSASNNYSGRHPIYRGIRRRKSSGKWVSEIREPRSPNRIWLGTFPTAEMAAIAYDVA  71

Query  535  alalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD  714
            A+AL+  +  LNFP  AA  PVP +S   DI+ AAASAAA +     +     +R+E  D
Sbjct  72   AIALKGPDTDLNFPDSAASLPVPATSSPRDIQAAAASAAAAVGAAGDA---LLARREVHD  128

Query  715  DPSV----------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADD---SPEN  855
              S           N E++DE+ +FDM N+LV+MA GM++SPPR N   P DD   + E 
Sbjct  129  QKSKSISENLGIGNNYEFMDEDLIFDMPNVLVNMAEGMLLSPPRFN--LPDDDIAAAAEY  186

Query  856  SDAETLWNY  882
            +  + LWNY
Sbjct  187  TAYQNLWNY  195



>ref|XP_002322550.1| hypothetical protein POPTR_0016s02010g [Populus trichocarpa]
 gb|ABQ62981.1| TINY-like protein [Populus trichocarpa]
 gb|EEF04311.1| hypothetical protein POPTR_0016s02010g [Populus trichocarpa]
Length=214

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 113/169 (67%), Gaps = 6/169 (4%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G    +RGVR RS GKWVSEIREP+K  RIWLGT+P PEMAA AYDVAALAL+   A LN
Sbjct  45   GSQRAFRGVRRRSSGKWVSEIREPKKPNRIWLGTFPNPEMAAVAYDVAALALKGQNADLN  104

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesss----GDGGGSRQERKDDPSVNTEY  738
            FP  AA  PVP S+   DI+ AAASAAA +     +      G  ++ E++  P+V+ ++
Sbjct  105  FPNSAASLPVPASTSPRDIQAAAASAAAAIGAAKDALGIPNMGDTNQMEQEITPTVDDQF  164

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPRIN-SSHPADDSPENSDAETLWNY  882
            +DE+ +FDM N+LV+MA GM++SPPR++ +      + +N+  + LW +
Sbjct  165  VDEDLIFDMPNVLVNMAEGMLLSPPRLDIAGDETTTAYDNTGDQNLWKF  213



>ref|XP_008241430.1| PREDICTED: ethylene-responsive transcription factor ERF024 [Prunus 
mume]
Length=202

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 117/179 (65%), Gaps = 16/179 (9%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREPRK  RIWLGT+PTPEMAA AYDVAA+AL+  +A LN
Sbjct  23   GRHPTYRGVRRRSSGKWVSEIREPRKPNRIWLGTFPTPEMAAVAYDVAAIALKGRDAELN  82

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGG-------------GSRQ-ER  708
            FP  A+  PVP SS + DI+ AAASAAA +   +++   G             G R  E 
Sbjct  83   FPNSASSLPVPASSSSRDIQAAAASAAAAIGAAAAAMGVGNDDSHSTSEVQAQGHRTIEA  142

Query  709  KDDPSV-NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
             D  ++ + +++DE+ +FDM N+LV+MA GM++SPPR++ +       +  D + LW +
Sbjct  143  ADRVALSDHQFVDEDLIFDMPNVLVNMAEGMLLSPPRLDIADDDVVGADQEDDQNLWKF  201



>ref|XP_003553587.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Glycine max]
Length=188

 Score =   105 bits (262),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 107/166 (64%), Gaps = 8/166 (5%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            +++ +  G  G+HP YRGVR RS GKWVSEIREP+K  RIWLGT+ TPEMAA AYDVAAL
Sbjct  8    SSSRASNGNTGRHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFATPEMAAIAYDVAAL  67

Query  541  alrsaEAVLNFPAYAARYPVPVsseaa--dirraaasaaammkpesssGDGGG----SRQ  702
            AL+  +A LNFP  A+  P+P SS A    +  A A+ A     ++  G  GG    S  
Sbjct  68   ALKGKDAELNFPNSASSLPIPASSAAHDIQMAAALAATAVGAANDALEGSQGGNVSVSLA  127

Query  703  ERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD  840
            E     ++N  ++DE+ +FDM N+LV+MA GM++SPPR ++    D
Sbjct  128  EEFSGGNLN-HFVDEDLIFDMPNILVNMAEGMLLSPPRFDNFAATD  172



>ref|XP_009793989.1| PREDICTED: ethylene-responsive transcription factor ERF024 [Nicotiana 
sylvestris]
Length=189

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 105/174 (60%), Gaps = 12/174 (7%)
 Frame = +1

Query  397  KHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            +HP Y+G+R R  SGKWVSEIREPR   RIWLGT+PTPEMAA AYDVAALAL+  +A LN
Sbjct  15   RHPVYKGIRRRKSSGKWVSEIREPRSPNRIWLGTFPTPEMAAVAYDVAALALKGRDAELN  74

Query  571  FPAYAARYPVPVsse----------aadirraaasaaammkpesssGDGGGSRQERKDDP  720
            FP  A+  PVP ++           AA    AA  A    +   +S +   SR+     P
Sbjct  75   FPNSASSLPVPTTNSPRDIQAAAACAAAALGAAGDALGARRGVDNSNNRPVSREVENSTP  134

Query  721  SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
              N E++DE+ +FDM N++++MA GM++SPPR N       + E    + LWNY
Sbjct  135  WNNNEFMDEDLIFDMPNVIMNMAEGMLLSPPRFNVPDDDTSAAEYIADQDLWNY  188



>ref|XP_007145242.1| hypothetical protein PHAVU_007G222600g [Phaseolus vulgaris]
 gb|ESW17236.1| hypothetical protein PHAVU_007G222600g [Phaseolus vulgaris]
Length=210

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 116/199 (58%), Gaps = 20/199 (10%)
 Frame = +1

Query  319  IENLLSPRLAEQGQAAAASSPTGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTY  495
            I+N  +        A  +S  + G G+   YRGVR RS GKWVSEIREP+K  RIWLGT+
Sbjct  20   IDNTTTTTAMYSNNATGSSRASSGTGR---YRGVRRRSNGKWVSEIREPKKPNRIWLGTF  76

Query  496  PTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVssea----adirraaasaaammk  663
            PTPEMAA AYDVAA AL+  +A LNFP  A+  PVP S  A         AA +A A   
Sbjct  77   PTPEMAAVAYDVAAYALKGKDAELNFPDSASSLPVPASLSARDIQMAAAAAAGAAGAAKD  136

Query  664  pesssGDGGGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD-  840
               +      S   +++   ++ +++DE+ +FDM N+LV+MA GM++SPP      P D 
Sbjct  137  AMQTPTGNYNSSGLQENQAGMSNQFVDEDLIFDMPNVLVNMAQGMLLSPP------PFDI  190

Query  841  ----DSPENSDAET-LWNY  882
                +SPEN + ET LWN+
Sbjct  191  GLEPNSPENIEHETSLWNF  209



>ref|XP_009590884.1| PREDICTED: ethylene-responsive transcription factor ERF024 [Nicotiana 
tomentosiformis]
Length=190

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 111/177 (63%), Gaps = 17/177 (10%)
 Frame = +1

Query  397  KHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            +HP Y+G+R R  SGKWVSEIREPR   RIWLGT+PTPEMAA AYDVAALAL+  +A LN
Sbjct  15   RHPVYKGIRKRKSSGKWVSEIREPRSPNRIWLGTFPTPEMAAVAYDVAALALKGRDAELN  74

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssG------DGGG-----SRQERKDD  717
            FP  A+  PVP ++   DI+ AAA AAA +     +       D        SR+     
Sbjct  75   FPNSASSLPVPATNSPHDIQAAAACAAAALGAAGDALSARRGVDNNNNIIPVSREVENST  134

Query  718  PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDS--PENSDAETLWNY  882
            P  N E++DE+ +FDM N++++MA GM++SPPR N   P DD+   E    + LWNY
Sbjct  135  PWNNNEFMDEDLIFDMPNVIMNMAEGMLLSPPRFN--LPDDDTTAAEYIADQDLWNY  189



>gb|EAY88292.1| hypothetical protein OsI_09748 [Oryza sativa Indica Group]
Length=199

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 114/187 (61%), Gaps = 35/187 (19%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+R RSGKWVSEIREP K++RIWLGTYPTPEMAAAAYD AALALR A+A LNFP
Sbjct  22   RHPVYRGIRLRSGKWVSEIREPGKSSRIWLGTYPTPEMAAAAYDAAALALRGADAALNFP  81

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR-QERKDDPSVN--------  729
              A   P P S    DIR AAA+AAAM+        G G R  +R  D S +        
Sbjct  82   GTATSRPAPASGSPDDIRAAAAAAAAMI--------GSGHRGNQRAADASTSRAAPAPEV  133

Query  730  ---------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSS-------HPADDSPENSD  861
                        +DE+++F+M  LLV MA G+M++PPR++ S        P DD  E+ D
Sbjct  134  AVAAGAGDQKRVVDEDDVFEMPRLLVSMAEGLMMNPPRLSPSTDGVGGVSPEDD--EDED  191

Query  862  AETLWNY  882
              +LWN+
Sbjct  192  GMSLWNH  198



>gb|KDP42687.1| hypothetical protein JCGZ_23627 [Jatropha curcas]
Length=213

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 114/185 (62%), Gaps = 22/185 (12%)
 Frame = +1

Query  394  GKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR RS GKWVSEIREPRK  RIWLGT+PTPEMAA AYDVAALAL+  +  LN
Sbjct  28   GRHPVYRGVRRRSSGKWVSEIREPRKPNRIWLGTFPTPEMAAIAYDVAALALKGRDTELN  87

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQE---------------  705
            FP  A   PVP S+   DI+ AAASAA+ +     +   G ++ E               
Sbjct  88   FPNSAPSLPVPASTSPRDIQAAAASAASALGAARDALGIGNNQLEITNNNYNYNINQTVL  147

Query  706  -RKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSD-----AE  867
             ++     + +++DE+ +FDM NLLV+MA GM++SPPR++ S  AD + ++        +
Sbjct  148  GQESSIMTDHQFVDEDLIFDMPNLLVNMAEGMLLSPPRLDFSASADATDDDHQNPSVGEQ  207

Query  868  TLWNY  882
             LW +
Sbjct  208  NLWKF  212



>ref|XP_003546972.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Glycine max]
Length=188

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 114/167 (68%), Gaps = 8/167 (5%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaa  537
            A+++ +     G+HP YRGVR RS GKWVSEIREP+K  RIWLGT+ TPEMAA AYDVAA
Sbjct  7    ASSSRASNANTGRHPVYRGVRRRSSGKWVSEIREPKKPNRIWLGTFATPEMAAIAYDVAA  66

Query  538  lalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDG--GG----SR  699
            LAL+  +A LNFP  A+  PVP SS A DI+ AAASAAA +   + + +G  GG    S 
Sbjct  67   LALKGKDAELNFPNSASSLPVPASSAARDIQMAAASAAAAVGAANDALEGSRGGNASVSL  126

Query  700  QERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD  840
             E     ++N  ++DE+ +FDM N+LV+MA GM++SPPR ++    D
Sbjct  127  TEEFSGGNLN-HFVDEDLIFDMPNILVNMAEGMLLSPPRFDNFAATD  172



>ref|XP_004953436.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Setaria italica]
Length=277

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 118/194 (61%), Gaps = 36/194 (19%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            GKH  YRG+R RSGKWVSEIREPRK  RIWLGTYPT EMAAAAYDVAA ALR A+AVLNF
Sbjct  86   GKHAFYRGIRCRSGKWVSEIREPRKARRIWLGTYPTAEMAAAAYDVAARALRGADAVLNF  145

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGD-----------------------  684
            P   A    P S+  ADIR AAA+AAA  + E   G                        
Sbjct  146  PGAIASRQAPASASPADIRAAAAAAAAAAQLEHPQGGEAAATANPPAAAQDRHHQHHGMS  205

Query  685  -------GGGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADD  843
                   GG + Q+  D    + E++DEE +F+M  LL +MA GMM+SPPR+ S   +D+
Sbjct  206  SATADAAGGYTPQQGID----SGEFMDEEAIFEMPQLLRNMAAGMMMSPPRL-SPDTSDE  260

Query  844  SPENSDA-ETLWNY  882
            SP+ S+A E+LW+Y
Sbjct  261  SPDPSEAGESLWSY  274



>ref|XP_007210022.1| hypothetical protein PRUPE_ppa016829mg [Prunus persica]
 gb|EMJ11221.1| hypothetical protein PRUPE_ppa016829mg [Prunus persica]
Length=180

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 115/187 (61%), Gaps = 24/187 (13%)
 Frame = +1

Query  370  ASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalr  549
            ASSP+G   K  +Y G+RSR GKWVSEIREPRKT RIWLGT+PT EMAAAAYD AALAL+
Sbjct  2    ASSPSG---KQSRYHGIRSRGGKWVSEIREPRKTRRIWLGTFPTAEMAAAAYDAAALALK  58

Query  550  saEAVLNFPAYAARYPVPVsse-aadirraaasaaammkpesssGDGGGSRQERKDD---  717
             A+AVLNFP+    YPVP S         AAA+AAA     +   D      ER+     
Sbjct  59   RADAVLNFPSSMDSYPVPASMSPQDIRSAAAAAAAATALQRNEDADNSLKVTERQKKYEY  118

Query  718  --------PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSD-A  864
                       ++  +DEEELF M NLL +MA GM++SPPR     P+D  DS  NSD A
Sbjct  119  DMTMMSSTSLASSVGMDEEELFGMPNLLANMAEGMLLSPPR-----PSDYPDSSGNSDGA  173

Query  865  ET-LWNY  882
            E+ LW+Y
Sbjct  174  ESRLWSY  180



>gb|EYU38617.1| hypothetical protein MIMGU_mgv1a021879mg [Erythranthe guttata]
Length=203

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 114/185 (62%), Gaps = 23/185 (12%)
 Frame = +1

Query  397  KHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            +HP YRGVR R  SGKWVSEIREPR   R+WLGT+PTPEMAA AYDVAALAL+  EA LN
Sbjct  18   RHPIYRGVRRRKSSGKWVSEIREPRTPNRVWLGTFPTPEMAAVAYDVAALALKGTEAKLN  77

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV--------  726
            FP  A+ +PVP S+   DI+ AAA AAA       +  G  +     D+ +         
Sbjct  78   FPNSASSHPVPASTSPQDIQAAAAGAAAAAGAAGDAIFGRNNNIPETDEVAAAARSHEEI  137

Query  727  --------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRI---NSSHPADDSPE--NSDAE  867
                    + E++DE+ +FDM N+LV+MA GMM+SPPR+   + ++  D+  +  ++D  
Sbjct  138  FPGWNIDHDEEFVDEDLIFDMPNVLVNMAQGMMISPPRLGPSDHNYYGDNHVDYYDNDDH  197

Query  868  TLWNY  882
             LWNY
Sbjct  198  NLWNY  202



>ref|XP_008359485.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Malus domestica]
Length=210

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 105/181 (58%), Gaps = 22/181 (12%)
 Frame = +1

Query  397  KHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRG+R RS GKWVSEIREP+K  RIWLGT+ TPEMAA AYDVAA+AL+  +A LNF
Sbjct  32   RHPTYRGIRRRSSGKWVSEIREPKKPNRIWLGTFTTPEMAAVAYDVAAIALKGQDAELNF  91

Query  574  PAYAARYPVPVsse---------aadirraaasaaammkpesssGDGGGSRQERK-----  711
            P  A+  PVP S+          +A      A   A        GD   + Q  K     
Sbjct  92   PNSASSLPVPASTSPRDIQAAASSAAAAMGVAIDHASYSRSEVQGDQQDAHQAHKTVDEA  151

Query  712  DDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAE----TLWN  879
            D   +N E++DE+ +F+M N+LV+MA GM++SPPR++    A D    +D E     LW 
Sbjct  152  DRLMLNQEFVDEDLIFNMPNVLVNMAEGMLLSPPRLDI---AGDDAIGADQEQGDHNLWK  208

Query  880  Y  882
            +
Sbjct  209  F  209



>ref|XP_007210605.1| hypothetical protein PRUPE_ppa017269mg [Prunus persica]
 gb|EMJ11804.1| hypothetical protein PRUPE_ppa017269mg [Prunus persica]
Length=180

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 105/181 (58%), Gaps = 27/181 (15%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            K  +Y G+RSR GKWVSEIREPRKT RIWLGT+PT EMAAAAYDVAALAL+  +AVLNFP
Sbjct  8    KQSRYHGIRSRGGKWVSEIREPRKTRRIWLGTFPTAEMAAAAYDVAALALKRGDAVLNFP  67

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEY------  738
            +    YPVP    +   +   ++AAA     +  G+       +  +     EY      
Sbjct  68   SSMDSYPVPA---STSPQDIRSAAAAAAAAAALQGNEEPDNSLKLIEKKTKYEYDMMMMS  124

Query  739  ---------IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSDA--ETLWN  879
                     +DEEELF M NLL +MA GM+VSPPR     P+D  DS  NSD     LW+
Sbjct  125  STSLASSVGMDEEELFGMPNLLANMAEGMLVSPPR-----PSDYPDSSGNSDGLDSRLWS  179

Query  880  Y  882
            Y
Sbjct  180  Y  180



>ref|XP_008238802.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Prunus mume]
Length=180

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 108/182 (59%), Gaps = 29/182 (16%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            K  +Y G+RSR GKWVSEIREPRKT RIWLGT+PT EMAAAAYDVAALAL+  +AVLNFP
Sbjct  8    KQSRYHGIRSRGGKWVSEIREPRKTRRIWLGTFPTAEMAAAAYDVAALALKRGDAVLNFP  67

Query  577  AYAARYPVPVsse-aadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEY-----  738
            +    YPVP S+        AAA+AAA     +   D   +  E+K       EY     
Sbjct  68   SSLDSYPVPASTSPQDIRSAAAAAAAAAALQGNEEPDNSLNLIEKK----TKYEYDMMMM  123

Query  739  ----------IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSDA--ETLW  876
                      +DEEELF M NLL +MA GM+VSPPR     P+D  DS  NSD     LW
Sbjct  124  SSTSLASSVGMDEEELFGMPNLLANMAEGMLVSPPR-----PSDYPDSSGNSDGADSRLW  178

Query  877  NY  882
            +Y
Sbjct  179  SY  180



>ref|XP_004305361.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Fragaria vesca subsp. vesca]
Length=185

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 13/177 (7%)
 Frame = +1

Query  382  TGGRGKHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaE  558
            T G G+HP YRGVR RS GKWVSEIREP+K  RIWLGT+ TPEMAA AYDVAALAL+  +
Sbjct  11   TTGPGRHPTYRGVRRRSNGKWVSEIREPKKPNRIWLGTFLTPEMAAVAYDVAALALKGQD  70

Query  559  AVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGG-------SRQERKDD  717
            A LNFP  A+  PVP S+ + DI+ AAASAAA +   +++   G        S +     
Sbjct  71   AELNFPNSASSLPVPASNSSRDIQAAAASAAAAISAAAAAMGVGNLATSSWPSTESSHGH  130

Query  718  PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN--SSHPADDSPENSDAETLWNY  882
               + E++DE+ +FDM N+L++MA GM++SPPR++    H A  + E+    TLW +
Sbjct  131  MLNDHEFVDEDLIFDMPNVLMNMAEGMLLSPPRLDIAGDHDALATEEHG---TLWKF  184



>ref|XP_010061462.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Eucalyptus grandis]
Length=220

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 105/164 (64%), Gaps = 5/164 (3%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REPRK +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  58   RHPVYRGVRLRDSGKWVCEVREPRKKSRIWLGTFPTVEMAARAHDVAALALRGRSACLNF  117

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
               A R PVP S++  +I++AAA AA   +   S     G  ++ + +  V   + DEE+
Sbjct  118  ADSAWRLPVPASADTKEIQKAAARAAEAFQSVESEDVMSGDEKKLRSEEGV---FYDEED  174

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
            +F M  LL DMA GM++SPP+        +  EN DA T LW+Y
Sbjct  175  IFGMPGLLADMAEGMLLSPPKWGGDIYGGEDEENLDAYTSLWSY  218



>ref|NP_001048769.1| Os03g0117900 [Oryza sativa Japonica Group]
 gb|ABF93665.1| AP2 domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10683.1| Os03g0117900 [Oryza sativa Japonica Group]
 gb|EAZ25367.1| hypothetical protein OsJ_09184 [Oryza sativa Japonica Group]
Length=200

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 101/186 (54%), Gaps = 32/186 (17%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+R RSGKWVSEIREP K++RIWLGTYPTPEMAAAAYD AALALR A+A LNFP
Sbjct  22   RHPVYRGIRLRSGKWVSEIREPGKSSRIWLGTYPTPEMAAAAYDAAALALRGADAALNFP  81

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV----------  726
              A   P P               AA     +  G G    Q   D  +           
Sbjct  82   GTATSRPAPA------SGSPDDIRAAAAAAAAMIGSGHRGNQRAADASTSRAATAAPEAA  135

Query  727  -------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSS-------HPADDSPENSDA  864
                       +DE+++F+M  LLV MA G+M+SPPR++ S        P DD  E+ D 
Sbjct  136  VAAGAGDQKRVVDEDDVFEMPRLLVSMAEGLMMSPPRLSPSTDGVGGVSPEDD--EDEDG  193

Query  865  ETLWNY  882
             +LWN+
Sbjct  194  MSLWNH  199



>ref|XP_006851572.1| hypothetical protein AMTR_s00040p00196580 [Amborella trichopoda]
 gb|ERN13153.1| hypothetical protein AMTR_s00040p00196580 [Amborella trichopoda]
Length=200

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 110/188 (59%), Gaps = 30/188 (16%)
 Frame = +1

Query  394  GKHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaE-AVL  567
            G+HP YRGVR R  GKWVSEIREPRK+TRIWLGTY TPEMAA AYDVAALAL+    A L
Sbjct  14   GRHPIYRGVRQRKGGKWVSEIREPRKSTRIWLGTYATPEMAAVAYDVAALALKGRHGATL  73

Query  568  NFPAYAARYPVPVsseaadirraaasaaammkpesssG------DGGGSRQERKDDPSVN  729
            NFP   A  P P ++ ++DIR AAASAA  +    + G      D   + Q    DP++ 
Sbjct  74   NFPDSIADLPSPSTNSSSDIRAAAASAAEALSGSRNPGFALKGTDSTMTAQTTSGDPNIT  133

Query  730  -----------------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENS  858
                             TE++DEE +FDM NLLV MA G+M+SPPR+          +N 
Sbjct  134  GDSSDFPVFGESGDSDMTEFMDEELIFDMPNLLVSMAEGLMLSPPRLGEEEGCGGGDDN-  192

Query  859  DAETLWNY  882
                LWNY
Sbjct  193  ----LWNY  196



>ref|XP_009365379.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Pyrus x bretschneideri]
Length=210

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = +1

Query  397  KHPKYRGVRSRS-GKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRG+R RS GKWVSEIREP+K  RIWLGT+ TPEMAA AYDVAA+AL+   A LNF
Sbjct  32   RHPTYRGIRRRSSGKWVSEIREPKKPNRIWLGTFSTPEMAAVAYDVAAIALKGQGAELNF  91

Query  574  PAYAARYPVPVsse---------aadirraaasaaammkpesssGDGGGSRQERK-----  711
            P  A+  PVP S+          +A      A            GD   + Q  K     
Sbjct  92   PNSASSLPVPASTSPRDIQAAASSAAAAMGVAIDHGSYSRSEVQGDQQDAHQAHKTVDEA  151

Query  712  DDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN  822
            D   +N E++DEE +F+M N+LV+MA GM++SPPR++
Sbjct  152  DRLMLNQEFVDEELIFNMPNVLVNMAEGMLLSPPRLD  188



>gb|EYU19512.1| hypothetical protein MIMGU_mgv1a025309mg [Erythranthe guttata]
Length=229

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 112/169 (66%), Gaps = 9/169 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K TRIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  61   RHPVYRGVRLRDSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  120

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPS------VNTE  735
               + R PVP S++A DI++ AA AA   +P+SSS  GG +R+E     +       N  
Sbjct  121  ADSSWRLPVPASADAKDIQKTAAEAAEAFRPQSSSDSGGDAREETAVAANNYTASPENMY  180

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEE +F MH L+ +MA G+M+ PPR +  +  DD   ++D  +LW+Y
Sbjct  181  FMDEEMMFGMHGLVDNMAEGLMMMPPR-HHQYTDDDVEMDADV-SLWSY  227



>ref|XP_006857915.1| hypothetical protein AMTR_s00069p00140780 [Amborella trichopoda]
 gb|ERN19382.1| hypothetical protein AMTR_s00069p00140780 [Amborella trichopoda]
Length=237

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 119/203 (59%), Gaps = 42/203 (21%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+HP +RG+RSRSGKWVSEIREPRK+ RIWLGTYPTPEMAA+AYD AA  L+ + AVLNF
Sbjct  36   GRHPMFRGIRSRSGKWVSEIREPRKSNRIWLGTYPTPEMAASAYDAAAYFLKGSNAVLNF  95

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQER---------KDDPSV  726
            P   A  PVP SS  ADI+ AAA+AA++ +  +S+    G  ++R         ++DP V
Sbjct  96   PESYASLPVPASSSHADIQAAAAAAASLRRQTNSAASSTGPNRDRDRDRDRDLAQNDPIV  155

Query  727  -------------------------NTEYIDEEEL------FDMHNLLVDMAGGMMVSPP  813
                                     N   I E E       FDM +L+V MA GM+VSPP
Sbjct  156  THGSPPSAPAPASAAEGEGPFLETENVGQIQEPEFLDEEELFDMPSLIVSMAEGMLVSPP  215

Query  814  RINSSHPADDSPENSDAETLWNY  882
            R++   P ++   +SD+  LW+Y
Sbjct  216  RMDP--PPENDNGDSDSGGLWSY  236



>emb|CDP15372.1| unnamed protein product [Coffea canephora]
Length=244

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 115/191 (60%), Gaps = 19/191 (10%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaa  537
            A+++S     G+ P YRGVR R  SGKWVSEIREPR   RIWLGT+PTPEMAAAAYDVAA
Sbjct  54   ASSTSEAPLPGRRPMYRGVRRRKSSGKWVSEIREPRTPNRIWLGTFPTPEMAAAAYDVAA  113

Query  538  lalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD-  714
            LAL+  EA LNFP  A+  P P S+   DI+ AAASAAA       +  G  +     + 
Sbjct  114  LALKGPEAELNFPNSASSLPAPASASPRDIQAAAASAAAAAGAAMDALAGNAAALHAMNH  173

Query  715  ---------------DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSP  849
                           D   + E+IDE+ +FDM N+L +MA GM++SPPR++ +   + S 
Sbjct  174  ALADKTENLISPTPPDHQKDHEFIDEDLIFDMPNVLTNMAEGMLLSPPRLDIAG-DETST  232

Query  850  ENSDAETLWNY  882
            E+  A  LWN+
Sbjct  233  ESMGAHDLWNH  243



>ref|XP_008665817.1| PREDICTED: ethylene-responsive transcription factor ERF025 [Zea 
mays]
Length=181

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 6/144 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+R R GKWVSEIREPRK++RIWLGTYP PEMAAAAYD AALALR AEA LNFP
Sbjct  29   RHPVYRGIRYRGGKWVSEIREPRKSSRIWLGTYPAPEMAAAAYDTAALALRGAEAALNFP  88

Query  577  AYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEEL  756
              A   PVP     +     AA+A+A        G  G + + R  D S+    +DE+++
Sbjct  89   GAALSRPVPA--SRSPDDIRAAAASAARSQSPQVGGEGPAPERRAGDRSI----VDEDDV  142

Query  757  FDMHNLLVDMAGGMMVSPPRINSS  828
            F +  LL  MA G+M+SPPR+  +
Sbjct  143  FQVPRLLAGMAEGLMMSPPRLAGA  166



>ref|XP_004244718.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Solanum lycopersicum]
Length=202

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 105/188 (56%), Gaps = 26/188 (14%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEA-VLNF  573
            KH  YRG+R RSGKWV EIREPRKT RIWLGTYPTP+MAAAAYDVAALAL++ +  VLNF
Sbjct  15   KHHVYRGIRCRSGKWVCEIREPRKTKRIWLGTYPTPQMAAAAYDVAALALKATQNIVLNF  74

Query  574  PAYAARY--------PVPVsseaadirraaasaaammkpesssGDGG-GSRQERKDDPSV  726
            P     Y        P  +   AA    A AS            DG  G+ +   + PS 
Sbjct  75   PHLVDSYPKLPPSPSPADIQRAAATAAEAMASLGYDDDRSLDRRDGAIGNERGSTEYPSS  134

Query  727  NTEY----------------IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENS  858
            +  Y                +DEE LF+  NL+V+MA  MM+SPPRINS    D S  + 
Sbjct  135  SGNYDMQIGDAQTTMGEDEYVDEEALFEFPNLVVNMAEAMMLSPPRINSFPSEDYSSGDF  194

Query  859  DAETLWNY  882
            D E+LW+Y
Sbjct  195  DTESLWSY  202



>gb|KDP25515.1| hypothetical protein JCGZ_20671 [Jatropha curcas]
Length=230

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 112/178 (63%), Gaps = 20/178 (11%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R+G KWV E+REP K TRIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  57   RHPVYRGVRKRNGNKWVCELREPNKKTRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  116

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV---------  726
               A R PVP S +A +IRRAA+ AA M + E    +    +  R+DD  V         
Sbjct  117  ADSAWRLPVPASRDAKEIRRAASQAAEMFRRE----ESDDVQITRRDDSFVDSTDSECKN  172

Query  727  ---NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD--DSPENSDAE-TLWNY  882
               N  +++E+ +FDM  LLVDMA G+++SPPR       D  +  ++SD++ +LW+Y
Sbjct  173  YEENLWFVEEDTIFDMPRLLVDMAQGLLLSPPRFEGEFSNDHWNPLDSSDSDMSLWSY  230



>ref|XP_004494908.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Cicer arietinum]
Length=205

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 110/178 (62%), Gaps = 15/178 (8%)
 Frame = +1

Query  394  GKHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            G+HP YRGVR R SGKWVSEIREP+K  RIWLGT+PTPEMAA AYDVAALAL+   A LN
Sbjct  24   GRHPLYRGVRRRNSGKWVSEIREPKKPNRIWLGTFPTPEMAAIAYDVAALALKGKNAELN  83

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD-----------  717
            FP  ++  PVP SS A DI+ AAASAAA +     +    G+      D           
Sbjct  84   FPNSSSSLPVPASSSARDIQLAAASAAAAVGAAKDALATEGNHAVELQDFFSSGNENNNN  143

Query  718  PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN---SSHPADDSPENSDAETLWNY  882
             +   E+IDE+ +FDM N+LV+MA GM++SPPR +   + +  D      D   LW+Y
Sbjct  144  NNNINEFIDEDLIFDMPNVLVNMAEGMLISPPRFDHFETDYHYDVQENMCDDPNLWSY  201



>ref|XP_004985962.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Setaria italica]
Length=204

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 102/188 (54%), Gaps = 31/188 (16%)
 Frame = +1

Query  397  KHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFP  576
            +HP YRG+R R GKWVSEIREPRK+ RIWLGTYPTPEMAAAAYD AALALR AEA LNFP
Sbjct  21   RHPVYRGIRYRGGKWVSEIREPRKSNRIWLGTYPTPEMAAAAYDAAALALRGAEAALNFP  80

Query  577  AYAARYPVPVsse-----------------------aadirraaasaaammkpesssGDG  687
              AA    PVS                         AA       +AA       S   G
Sbjct  81   GAAASRAAPVSCSPDDIRAAASAAAATMMVGYPGECAAGHSHLPQAAAIASTSSGSENAG  140

Query  688  GGSRQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPE---NS  858
              S  E+++        +DE+++F M  LL  MA G+M+SPPR++ +     S E   N 
Sbjct  141  AASASEQRE-----KRIVDEDDVFQMPRLLEGMAEGLMMSPPRLSPTAEGAGSLEEDGND  195

Query  859  DAETLWNY  882
            D  +LW++
Sbjct  196  DGMSLWDH  203



>gb|ACB45091.1| CBF1-2 fusion protein [Solanum pimpinellifolium]
Length=216

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRG+R R SGKWV E+REP K TRIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  51   RHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  110

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
               A R P+P SS + DI++AAA AA + +P   S +  G   E  ++   +++++DEE 
Sbjct  111  SDSAWRLPIPASSNSKDIQKAAAEAAEIFRPLKESEEVSGESPETSENVQESSDFVDEEA  170

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET---LWNY  882
            LF M  LL +MA G+M+ PP+       D   E +D      LWNY
Sbjct  171  LFSMPGLLANMAEGLMLPPPQC--LEIGDHYVELADVHAYMPLWNY  214



>ref|XP_004249787.1| PREDICTED: ethylene-responsive transcription factor ERF024 [Solanum 
lycopersicum]
Length=197

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 19/180 (11%)
 Frame = +1

Query  397  KHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            +HP Y+G+R R  SGKWVSEIREPR   RIWLGT+PTPEMAA AYDVAALAL+  +  LN
Sbjct  18   RHPVYKGIRRRKSSGKWVSEIREPRSPNRIWLGTFPTPEMAAIAYDVAALALKGRDTELN  77

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSR------------QERKD  714
            FP  A   PVP ++   DI+ AAA AAA +     +  GG S             ++ +D
Sbjct  78   FPNSAPSLPVPATNSPRDIQTAAACAAAAIGAAGDALIGGRSNNSNSNSNSRTVSRDVED  137

Query  715  DPSV--NTEY--IDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            +  +  N EY  +DE+ +FDM N++++MA GM++SPPR+N   P DD    +D + LWNY
Sbjct  138  NYLIPNNNEYNFMDEDLIFDMPNVIMNMAEGMLLSPPRLNHLPPDDDYIGGAD-QNLWNY  196



>ref|XP_002299565.1| hypothetical protein POPTR_0001s08710g [Populus trichocarpa]
 gb|EEE84370.1| hypothetical protein POPTR_0001s08710g [Populus trichocarpa]
Length=213

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 105/168 (63%), Gaps = 7/168 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALALR   A LNF
Sbjct  47   RHPVFRGVRKRNGNKWVCEMREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSACLNF  106

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDD----PSVNTEYI  741
               A R PVPVS ++ DI RAA  AA + +P+   G     +    +     P  N  + 
Sbjct  107  ADSAWRLPVPVSKDSKDITRAANEAAELFRPQEFGGHPAKQQDSNAEAVFAMPGENDVFF  166

Query  742  DEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD-DSPENSDAETLWNY  882
             EE +FDM  LLVDMA G+++SPPR   +   D D  EN    +LW+Y
Sbjct  167  -EEAVFDMPGLLVDMAEGLLLSPPRYVRNDCNDLDHMENGSDLSLWSY  213



>ref|XP_010236849.1| PREDICTED: ethylene-responsive transcription factor ERF027-like 
[Brachypodium distachyon]
Length=285

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 109/198 (55%), Gaps = 38/198 (19%)
 Frame = +1

Query  394  GKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            G+HP YRG+R R+GKWVSEIREPRK  RIWLGTYPT EMAAAAYDVAA ALR  +AVLNF
Sbjct  88   GRHPFYRGIRCRNGKWVSEIREPRKARRIWLGTYPTAEMAAAAYDVAARALRGPDAVLNF  147

Query  574  PAYAARYPVPVsse-------------------------aadirraaasaaammkpesss  678
            P   A  P P S+                          A +   AAA  AA  +     
Sbjct  148  PGATATRPAPASASPEDIRAAAAAAAAALQPIIDKPGARAPEADAAAADPAAAAEQVQRH  207

Query  679  GDGGGSRQERKDDP------SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSH---  831
             D  GS     D+P      +   E++DEE +F+M  +L +MA GMM+SPPR++ +    
Sbjct  208  HDQTGSAAAGGDEPRQKEIGNEGEEFMDEEAIFEMPQMLRNMAAGMMMSPPRLSPTASDE  267

Query  832  -PADDSPENSDAETLWNY  882
             PAD S      E+LW+Y
Sbjct  268  WPADPS---GAGESLWSY  282



>ref|XP_006573759.1| PREDICTED: ethylene-responsive transcription factor ERF026-like 
[Glycine max]
Length=183

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = +1

Query  364  AAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaala  543
            A +SSP+  R  HP + G+R R  KWVSEIREPRK +RIWLGT+PTPEMAAAAYDVAALA
Sbjct  2    APSSSPSSKR--HPLFHGIRCRGRKWVSEIREPRKASRIWLGTFPTPEMAAAAYDVAALA  59

Query  544  lrsaEAVLNFPAYAARYPVPVsse--------aadirraaasaaammkpesssGDGGGSR  699
            L+   AVLN P   ++Y +P+++         +A      A          +      + 
Sbjct  60   LKGDGAVLNLPHSVSKYQMPLTNSPADIRSAASAAAAMIKAETETEATHNHNMNIASITD  119

Query  700  QERKDDPSVN---TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET  870
             E     S +   T++IDEE +F M +LLVDMAGGM++S P   S  P+D+S E  + ET
Sbjct  120  NEATYTASTSWFETDFIDEEVIFGMPSLLVDMAGGMLLS-PPRMSPPPSDNSLEKQNGET  178

Query  871  LWNY  882
            LW+Y
Sbjct  179  LWSY  182



>gb|AGB07591.1| ethylene-responsive transcription factor 8 [Artemisia annua]
Length=191

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 107/175 (61%), Gaps = 9/175 (5%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
              A SS T    +H  Y G+R R+GKWVSEIREP K +RIWLGTYPTPEMAAAAYDVAAL
Sbjct  25   VTAGSSST----RHTVYHGIRLRAGKWVSEIREPNKPSRIWLGTYPTPEMAAAAYDVAAL  80

Query  541  alrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDP  720
            AL+  +  LNFP       +P      +IR AAA AAA   P     +  G         
Sbjct  81   ALKGTDTKLNFPDSILSNTLPECPTTDEIRAAAARAAAARDPT----NQSGYGSSSGIGT  136

Query  721  SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPEN-SDAETLWNY  882
            + + +Y+D E++F M N+L DMA GM++SPPRINSS P D +  N S  E LW+Y
Sbjct  137  NPHDQYMDHEDVFGMPNMLSDMAEGMLLSPPRINSSPPDDGTDYNYSGGENLWDY  191



>ref|XP_009141595.1| PREDICTED: ethylene-responsive transcription factor ERF024-like 
[Brassica rapa]
 emb|CDY70747.1| BnaAnng34830D [Brassica napus]
Length=179

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 106/172 (62%), Gaps = 12/172 (7%)
 Frame = +1

Query  394  GKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVL  567
            G+HP Y+GVR R  S KWVSEIREPRK  RIWLGT+ TPEMAA AYDVAALAL+  +  L
Sbjct  10   GRHPLYKGVRQRRNSDKWVSEIREPRKPNRIWLGTFSTPEMAAIAYDVAALALKGTQTEL  69

Query  568  NFPAYAARYPVPVsse-----aadirraaasaaammkpesssGDGGGSRQERKDDPSVNT  732
            NFP  A+  PVP S       AA    AAA  AA      ++     S  ER +   VNT
Sbjct  70   NFPNSASSLPVPASMSPGDIQAAAASAAAAFGAARDAIVRTNNTNASSSVERSN---VNT  126

Query  733  E-YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
              Y+DE+ +FDM N+L++MA GM++SPPR +    A D+   +  +  LWN+
Sbjct  127  NGYMDEDLIFDMPNVLMNMAEGMLLSPPRQSIFDAASDADGYTGGDDYLWNF  178



>gb|ABP64695.1| putative C-repeat binding protein 4 [Populus trichocarpa]
Length=209

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 105/164 (64%), Gaps = 3/164 (2%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALALR   A LNF
Sbjct  47   RHPVFRGVRKRNGNKWVCEMREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSACLNF  106

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
               A R PVPVS ++ DI RAA  AA + +P+    +    ++     P  N  +  EE 
Sbjct  107  ADSAWRLPVPVSKDSKDITRAANEAAELFRPQEFGENDVFFKEAVFAMPGENDVFF-EEA  165

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPAD-DSPENSDAETLWNY  882
            +FDM  LLVDMA G+++SPPR   +   D D  EN    +LW+Y
Sbjct  166  VFDMPGLLVDMAEGLLLSPPRYVRNDCNDLDHMENGSDLSLWSY  209



>ref|XP_002298067.2| dehydration responsive element binding protein 1 [Populus trichocarpa]
 gb|EEE82872.2| dehydration responsive element binding protein 1 [Populus trichocarpa]
Length=231

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 97/153 (63%), Gaps = 14/153 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  59   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  118

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG---------DGGGSRQERKDD---  717
               A R PVP+S+EA DIRRAA+ AA + +     G         D G  R    DD   
Sbjct  119  ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDFRREDRGEVRSSTNDDIRD  178

Query  718  -PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
             PS N  YIDEE  F+M  LL  MA G+++SPP
Sbjct  179  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPP  211



>gb|ABO48363.1| C-repeat binding facor 1 [Populus trichocarpa]
Length=192

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 102/171 (60%), Gaps = 9/171 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  20   RHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  79

Query  574  PAYAARYPVPVsseaadirraaasaaam-------mkpesssGDGGGSRQERKDDPSVNT  732
               A R PVP SSEA DI++AAA AA               +GD G    E   +     
Sbjct  80   ADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELMRTGDEGEKAAETTAEAGEEV  139

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
             Y+D+E +F M  LL +MA GM++ PP         D+ EN DA+  LW++
Sbjct  140  FYMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENIDADMPLWSF  190



>ref|XP_010038424.1| PREDICTED: ethylene-responsive transcription factor ERF025-like 
[Eucalyptus grandis]
Length=174

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 110/181 (61%), Gaps = 28/181 (15%)
 Frame = +1

Query  361  AAAASSPTGGRGKHPKYRGVRSRSGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaal  540
            ++A   P   R +HP+YRG+RSR  KWVSEIREPR+ TRIWLGTYPT EMAAAAYDVAAL
Sbjct  12   SSAVDHPPVSR-RHPEYRGIRSRGRKWVSEIREPRQVTRIWLGTYPTAEMAAAAYDVAAL  70

Query  541  alrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKD-D  717
            AL+   A+LNFP+ A  YP+P S    DIR AA+ AAA   P             R+D D
Sbjct  71   ALKGPGALLNFPSSALTYPIPPSRLPTDIRAAASRAAASRLP-------------RRDLD  117

Query  718  PSVN-------TEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLW  876
              +N        E+IDE+ + +M  LL DMA GM++ PP         +SPE    E+LW
Sbjct  118  MDLNECVATSGQEFIDEDTILNMPKLLADMAEGMLMRPPT------PQESPEYLSEESLW  171

Query  877  N  879
            N
Sbjct  172  N  172



>ref|XP_008437209.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Cucumis melo]
Length=229

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 99/170 (58%), Gaps = 12/170 (7%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R+  KWV E+REP K TRIWLGTYPT EMAA A+D+AALALR   A LNF
Sbjct  64   RHPVYRGVRQRNNDKWVCELREPNKKTRIWLGTYPTAEMAARAHDIAALALRGKSACLNF  123

Query  574  PAYAARYPVPVss-----eaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEY  738
               A R+P+P S        A +R A               DGG ++QE   D    T+Y
Sbjct  124  ADSAWRFPIPASDDPAVIREAAVRAANEGRDEECNVGREEDDGGSNQQEAYPD---RTDY  180

Query  739  IDEEELFDMHNLLVDMAGGMMVSPPR--INSSHPADDSPENSDAETLWNY  882
            +D+E + +M  LL +MA G+++SPP   +N     DD   N D  +LW++
Sbjct  181  VDDETMSNMPMLLANMAEGLLLSPPSFCVNEDVEWDDVATNDDV-SLWSF  229



>gb|KCW90748.1| hypothetical protein EUGRSUZ_A02824, partial [Eucalyptus grandis]
Length=212

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 100/157 (64%), Gaps = 4/157 (3%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REPRK +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  58   RHPVYRGVRLRDSGKWVCEVREPRKKSRIWLGTFPTVEMAARAHDVAALALRGRSACLNF  117

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
               A R PVP S++  +I++AAA AA   +   S     G  ++ + +  V   + DEE+
Sbjct  118  ADSAWRLPVPASADTKEIQKAAARAAEAFQSVESEDVMSGDEKKLRSEEGV---FYDEED  174

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA  864
            +F M  LL DMA GM++SPP+        +  EN DA
Sbjct  175  IFGMPGLLADMAEGMLLSPPKWGGDIYGGEDEENLDA  211



>gb|AAY43213.1| CRT/DRE binding factor 1 [Hevea brasiliensis]
Length=231

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 119/200 (60%), Gaps = 11/200 (6%)
 Frame = +1

Query  316  DIENLLSPRLAEQGQAAAASSPT--GGRGK-----HPKYRGVRSR-SGKWVSEIREPRKT  471
            D  + L   L+++    A+S P    GR K     HP YRGVR R SGKWV EIREP K 
Sbjct  30   DTCSALRANLSDEEVLLASSYPKKRAGRKKFRETRHPIYRGVRRRNSGKWVCEIREPNKK  89

Query  472  TRIWLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaa  651
            +RIWLGT+PT EMAA A+DVAALALR   A LNF   + R PVP S EA DIR+AAA AA
Sbjct  90   SRIWLGTFPTEEMAARAHDVAALALRGRSACLNFADSSWRLPVPASREAKDIRKAAAEAA  149

Query  652  ammkpesssGDGGGSRQERK---DDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRIN  822
               +PE + G  G  +QE K   +    +  Y+DEE +F M  LL  MA GM++ PP+  
Sbjct  150  MAFQPEGTEGFSGELKQENKWTTESAPEDVFYMDEEAVFAMPGLLASMAEGMLLPPPQCV  209

Query  823  SSHPADDSPENSDAETLWNY  882
            +    +D   ++   +LW++
Sbjct  210  AGSGGEDGEMDAADVSLWSF  229



>gb|EYU19514.1| hypothetical protein MIMGU_mgv1a026630mg [Erythranthe guttata]
Length=229

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 112/169 (66%), Gaps = 9/169 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K TRIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  61   RHPVYRGVRLRDSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  120

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPS------VNTE  735
               + R PVP S++A DI++ AA AA   +P+SSS  GG +R+E     +       N  
Sbjct  121  ADSSWRLPVPASADAKDIQKTAAEAAEAFRPQSSSDSGGDAREETAVAANNYTASPENMY  180

Query  736  YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
            ++DEE +F MH L+ +MA G+M+ PP  +  + +DD   ++D  +LW+Y
Sbjct  181  FMDEEMMFGMHGLVDNMAEGLMMMPPPHHHQY-SDDVGMDADV-SLWSY  227



>ref|XP_004171792.1| PREDICTED: LOW QUALITY PROTEIN: dehydration-responsive element-binding 
protein 1C-like [Cucumis sativus]
Length=213

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 109/201 (54%), Gaps = 22/201 (11%)
 Frame = +1

Query  325  NLLSPRLAEQGQAAAASSPT--GGRGK-----HPKYRGVRSR-SGKWVSEIREPRKTTRI  480
            N   P  +++    AAS+P    GR K     HP YRGVR R SGKWV E+REP K +RI
Sbjct  20   NCRLPIFSDEDFMLAASNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKSRI  79

Query  481  WLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaamm  660
            WLGT+PT EMAA A+DVAA+ALR   A LNF   A R PVP    A       A+A A  
Sbjct  80   WLGTFPTAEMAARAHDVAAIALRGFTACLNFADSAWRLPVPA--SADARDIQKAAAEAAE  137

Query  661  kpesssGDGGGSRQERKDDPSV-------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRI  819
                S  DG  +   R ++  +       N  Y+DEE +F M  LL DMA GMM+ PP+ 
Sbjct  138  AFRPSESDGSSADDSRTENGMMMETTTPENLFYMDEEAVFGMPGLLEDMAAGMMLPPPQ-  196

Query  820  NSSHPADDSPENSDAETLWNY  882
               H  DD    SD  +LW+Y
Sbjct  197  ---HFRDDMDFYSDV-SLWSY  213



>ref|NP_181186.1| ethylene-responsive transcription factor ERF024 [Arabidopsis 
thaliana]
 sp|Q9SJR0.1|ERF24_ARATH RecName: Full=Ethylene-responsive transcription factor ERF024 
[Arabidopsis thaliana]
 gb|AAD24629.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAT44934.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABE65890.1| AP2 domain-containing protein [Arabidopsis thaliana]
 gb|AEC09255.1| ethylene-responsive transcription factor ERF024 [Arabidopsis 
thaliana]
Length=184

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 107/177 (60%), Gaps = 17/177 (10%)
 Frame = +1

Query  394  GKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVL  567
            G+HP YRGVR R  S KWVSEIREPRK  RIWLGT+ TPEMAA AYDVAALAL+ ++A L
Sbjct  10   GRHPLYRGVRQRKNSNKWVSEIREPRKPNRIWLGTFSTPEMAAIAYDVAALALKGSQAEL  69

Query  568  NFPAYAARYPVPVsse---------aadirraaasaaammkpesssGDGGGSRQERKDDP  720
            NFP   +  P P S           +A     AA  A +M   +S   G        D+ 
Sbjct  70   NFPNSVSSLPAPTSMSPADIQAAAASAAAAFGAARDAIVMANNNSQTSGVACMNSSYDNT  129

Query  721  SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPR---INSSHPADDSPENSDAETLWNY  882
            ++N  ++DE+ +FDM N+L++MA GM++SPPR    ++++ AD  P   D   LWN+
Sbjct  130  NMNG-FMDEDLVFDMPNVLMNMAEGMLLSPPRPTVFDAAYDADGFPGGDD--YLWNF  183



>ref|NP_001234123.1| CBF1 protein [Solanum lycopersicum]
 gb|AAK57551.1| putative transcriptional activator CBF1 [Solanum lycopersicum]
 gb|AAS77820.1| CBF1 [Solanum lycopersicum]
Length=210

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 105/165 (64%), Gaps = 10/165 (6%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRG+R R SGKWV E+REP K TRIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  51   RHPIYRGIRKRNSGKWVCEVREPNKKTRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  110

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
               A R P+P SS + DI++AAA A  + + E  SG+      E  ++   +++++DEE 
Sbjct  111  SDSAWRLPIPASSNSKDIQKAAAQAVEIFRSEEVSGES----PETSENVQESSDFVDEEA  166

Query  754  LFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAE--TLWNY  882
            +F M  LL +MA G+M+ PP+        D    +DA   TLWNY
Sbjct  167  IFFMPGLLANMAEGLMLPPPQCAE---MGDHCVETDAYMITLWNY  208



>gb|ABK28526.1| unknown [Arabidopsis thaliana]
Length=185

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 107/177 (60%), Gaps = 17/177 (10%)
 Frame = +1

Query  394  GKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVL  567
            G+HP YRGVR R  S KWVSEIREPRK  RIWLGT+ TPEMAA AYDVAALAL+ ++A L
Sbjct  10   GRHPLYRGVRQRKNSNKWVSEIREPRKPNRIWLGTFSTPEMAAIAYDVAALALKGSQAEL  69

Query  568  NFPAYAARYPVPVsse---------aadirraaasaaammkpesssGDGGGSRQERKDDP  720
            NFP   +  P P S           +A     AA  A +M   +S   G        D+ 
Sbjct  70   NFPNSVSSLPAPTSMSPADIQAAAASAAAAFGAARDAIVMANNNSQTSGVACMNSSYDNT  129

Query  721  SVNTEYIDEEELFDMHNLLVDMAGGMMVSPPR---INSSHPADDSPENSDAETLWNY  882
            ++N  ++DE+ +FDM N+L++MA GM++SPPR    ++++ AD  P   D   LWN+
Sbjct  130  NMNG-FMDEDLVFDMPNVLMNMAEGMLLSPPRPTVFDAAYDADGFPGGDD--YLWNF  183



>ref|XP_004143933.1| PREDICTED: dehydration-responsive element-binding protein 1C-like 
[Cucumis sativus]
 ref|XP_004166983.1| PREDICTED: dehydration-responsive element-binding protein 1C-like 
[Cucumis sativus]
 gb|KGN50146.1| Dehydration-responsive element-binding protein 1F [Cucumis sativus]
Length=225

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 102/165 (62%), Gaps = 7/165 (4%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R+  KWV E+REP K TRIWLGTYPT EMAA A+D+AALALR   A LNF
Sbjct  65   RHPVYRGVRQRNNDKWVCELREPNKKTRIWLGTYPTAEMAARAHDIAALALRGKSACLNF  124

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTEYIDEEE  753
               A R+P+P S +   IR AAA AA          +GG ++ +   D    T+Y+D+E 
Sbjct  125  ADSAWRFPIPTSDDPTVIREAAARAANECNVGREEDEGGLNQPDTYPD---GTDYVDDEA  181

Query  754  LFDMHNLLVDMAGGMMVSPPR--INSSHPADDSPENSDAETLWNY  882
            + +M  LL +MA G+++SPP   +N     DD   N D  +LWN+
Sbjct  182  MSNMPMLLANMAEGLLLSPPSFCVNDDVEWDDEAMNDDV-SLWNF  225



>ref|XP_008439162.1| PREDICTED: dehydration-responsive element-binding protein 1A 
[Cucumis melo]
Length=212

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 107/201 (53%), Gaps = 22/201 (11%)
 Frame = +1

Query  325  NLLSPRLAEQGQAAAASSPT--GGRGK-----HPKYRGVRSR-SGKWVSEIREPRKTTRI  480
            N   P  +++    AAS+P    GR K     HP YRGVR R SGKWV E+REP K +RI
Sbjct  19   NCRRPIFSDEDFMLAASNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKSRI  78

Query  481  WLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaamm  660
            WLGT+PT EMAA A+DVAA+ALR   A LNF   A R PVP            A+A A  
Sbjct  79   WLGTFPTAEMAARAHDVAAIALRGLTACLNFADSAWRLPVPA--STDARDIQKAAAEAAE  136

Query  661  kpesssGDGGGSRQERKDDPSV-------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRI  819
                +  DG      R ++  +       N  Y+DEE +F M  LL DMA GMM+ PP+ 
Sbjct  137  AFRPAESDGSSVDDSRTENGMMAETTTPENVFYMDEEAVFGMPGLLEDMAAGMMLPPPQ-  195

Query  820  NSSHPADDSPENSDAETLWNY  882
               H  DD    SD  +LW+Y
Sbjct  196  ---HFRDDMDFYSDV-SLWSY  212



>gb|AIQ82398.1| CBF3, partial [Populus deltoides]
Length=198

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 97/154 (63%), Gaps = 14/154 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  32   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  91

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG---------DGGGSRQERKDD---  717
               A R PVP+S+EA DIRRAA+ AA + +     G         D G       DD   
Sbjct  92   ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDFRREDCGEVCSSTNDDIRD  151

Query  718  -PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPR  816
             PS N  YIDEE  F+M  LL  MA G+++SPP+
Sbjct  152  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPPQ  185



>ref|XP_004140794.1| PREDICTED: dehydration-responsive element-binding protein 1C-like 
[Cucumis sativus]
 gb|KGN57337.1| hypothetical protein Csa_3G180260 [Cucumis sativus]
Length=213

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 108/201 (54%), Gaps = 22/201 (11%)
 Frame = +1

Query  325  NLLSPRLAEQGQAAAASSPT--GGRGK-----HPKYRGVRSR-SGKWVSEIREPRKTTRI  480
            N   P  +++    AAS+P    GR K     HP YRGVR R SGKWV E+REP K +RI
Sbjct  20   NCRLPIFSDEDFMLAASNPKKRAGRKKFKETRHPVYRGVRRRNSGKWVCEVREPNKKSRI  79

Query  481  WLGTYPTPEMaaaaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaamm  660
            WLGT+PT EMAA A+DVAA+ALR   A LNF   A R PVP    A       A+A A  
Sbjct  80   WLGTFPTAEMAARAHDVAAIALRGFTACLNFADSAWRLPVPA--SADARDIQKAAAEAAE  137

Query  661  kpesssGDGGGSRQERKDDPSV-------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRI  819
                S  DG      R ++  +       N  Y+DEE +F M  LL DMA GMM+ PP+ 
Sbjct  138  AFRPSESDGSSVDDSRTENGMMMETTTPENLFYMDEEAVFGMPGLLEDMAAGMMLPPPQ-  196

Query  820  NSSHPADDSPENSDAETLWNY  882
               H  DD    SD  +LW+Y
Sbjct  197  ---HFRDDMDFYSDV-SLWSY  213



>ref|XP_002318846.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
 gb|EEE97066.1| hypothetical protein POPTR_0012s13870g [Populus trichocarpa]
Length=255

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 103/171 (60%), Gaps = 9/171 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  83   RHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  142

Query  574  PAYAARYPVPVsseaadirraaasaa-------ammkpesssGDGGGSRQERKDDPSVNT  732
               A R PVP SSEA DI++AAA AA        +      +GD G    E   +     
Sbjct  143  ADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGCVGGELMRTGDEGEKAAETTAEAGEEV  202

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
             Y+D+E +F M  LL +MA GM++ PP         D+ EN DA+  LW++
Sbjct  203  FYMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENIDADMPLWSF  253



>ref|XP_006410822.1| hypothetical protein EUTSA_v10017537mg [Eutrema salsugineum]
 gb|ESQ52275.1| hypothetical protein EUTSA_v10017537mg [Eutrema salsugineum]
Length=190

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 110/185 (59%), Gaps = 27/185 (15%)
 Frame = +1

Query  394  GKHPKYRGVRSR--SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVL  567
            G+HP YRGVR R  S KWVSEIREPRK  RIWLGT+ TPEMAA AYDVAALAL+  +  L
Sbjct  10   GRHPLYRGVRQRRNSNKWVSEIREPRKPNRIWLGTFSTPEMAAIAYDVAALALKGTQTEL  69

Query  568  NFPAYAARYPVP-------VsseaadirraaasaaammkpesssGDGGGSRQER------  708
            NFP  A+  PVP       + + AA    A  +A   +   +++ +  G+          
Sbjct  70   NFPNSASSLPVPASMSPGDIQAAAASAAAAFGAARDAIVLANNNSETSGASHSNMMMMNG  129

Query  709  --KDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET----  870
               ++ ++N  +IDE+ +FDM N+L++MA GM++SPPR     PA D+  ++D  T    
Sbjct  130  SYNENTNMNG-FIDEDLIFDMPNVLMNMAEGMLLSPPRA----PAFDAASDADCYTGADD  184

Query  871  -LWNY  882
             LWN+
Sbjct  185  YLWNF  189



>gb|AIQ82399.1| CBF3, partial [Populus deltoides]
 gb|AIQ82401.1| CBF3, partial [Populus deltoides]
Length=198

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 96/153 (63%), Gaps = 14/153 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  32   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  91

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG---------DGGGSRQERKDD---  717
               A R PVP+S+EA DIRRAA+ AA + +     G         D G       DD   
Sbjct  92   ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDFRREDCGEVCSSTNDDIRD  151

Query  718  -PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
             PS N  YIDEE  F+M  LL  MA G+++SPP
Sbjct  152  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPP  184



>gb|AIQ82400.1| CBF3, partial [Populus deltoides]
Length=198

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 96/153 (63%), Gaps = 14/153 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  32   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  91

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG---------DGGGSRQERKDD---  717
               A R PVP+S+EA DIRRAA+ AA + +     G         D G       DD   
Sbjct  92   ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDFRREDCGEVCSSTNDDIRD  151

Query  718  -PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
             PS N  YIDEE  F+M  LL  MA G+++SPP
Sbjct  152  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPP  184



>ref|XP_010061439.1| PREDICTED: dehydration-responsive element-binding protein 1D-like 
[Eucalyptus grandis]
 gb|AFB35600.1| trancription factor CBF2 [Eucalyptus grandis]
 gb|KCW90744.1| hypothetical protein EUGRSUZ_A02820 [Eucalyptus grandis]
Length=196

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 109/183 (60%), Gaps = 3/183 (2%)
 Frame = +1

Query  340  RLAEQGQAAAASSPTGGRGKHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaa  516
            RLA       A        +HP YRGVR R SGKWV E+REPRK +RIWLGT+PT EMAA
Sbjct  13   RLASHHPKKRAGRKKFRETRHPVYRGVRLRDSGKWVCEVREPRKKSRIWLGTFPTVEMAA  72

Query  517  aaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS  696
             A+DVAALALR   A LNF   A R PVP S++  DI++AAA AA   +P  S  +   S
Sbjct  73   RAHDVAALALRGRSACLNFADSAWRLPVPASADTKDIQKAAAKAAEAFQPVESESEDVMS  132

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA-ETL  873
              E+K  PS      D+E++F M  LL++MA GM++ PPR        +   N DA  +L
Sbjct  133  GDEKK-SPSEEGMLYDDEDVFGMPGLLMNMAEGMLLPPPRCGGDGYGGEDDGNLDAYVSL  191

Query  874  WNY  882
            W+Y
Sbjct  192  WSY  194



>gb|ACF15447.1| C-repeat binding factor 1d [Eucalyptus gunnii]
Length=196

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 108/183 (59%), Gaps = 3/183 (2%)
 Frame = +1

Query  340  RLAEQGQAAAASSPTGGRGKHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaa  516
            RLA       A        +HP YRGVR R SGKWV E+REPRK +RIWLGT+PT EMAA
Sbjct  13   RLASHHPKKRAGRKKFRETRHPVYRGVRLRDSGKWVCEVREPRKKSRIWLGTFPTVEMAA  72

Query  517  aaydvaalalrsaEAVLNFPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGS  696
             A+DVAALALR   A LNF   A R PVP S++  DI++AAA AA   +P  S  +   S
Sbjct  73   RAHDVAALALRGRSACLNFVDSAWRLPVPASADTKDIQKAAAKAAVAFQPVESESEDVMS  132

Query  697  RQERKDDPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDA-ETL  873
              E+K  PS      D+E++F M  LL +MA GM++ PPR        +   N DA  +L
Sbjct  133  GDEKK-SPSEEGMLFDDEDVFGMPGLLTNMAEGMLLPPPRCGGDGYGGEDDGNLDAYVSL  191

Query  874  WNY  882
            W+Y
Sbjct  192  WSY  194



>emb|CBJ94884.1| CBF2 protein [Populus balsamifera]
Length=208

 Score = 97.8 bits (242),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 96/153 (63%), Gaps = 14/153 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  52   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  111

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG---------DGGGSRQERKDD---  717
               A R PVP+S+EA DIRRAA+ AA + +     G         D G       DD   
Sbjct  112  ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDFRREDRGEVCSSTNDDIRD  171

Query  718  -PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
             PS N  YIDEE  F+M  LL  MA G+++SPP
Sbjct  172  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPP  204



>gb|AIU92947.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92951.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92959.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92960.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92961.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92969.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
 gb|AIU92970.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 103/171 (60%), Gaps = 9/171 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  83   RHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  142

Query  574  PAYAARYPVPVsseaadirraaasaa-------ammkpesssGDGGGSRQERKDDPSVNT  732
               A R PVP SSEA DI++AAA AA        +      +GD G    E   +     
Sbjct  143  ADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGDEGEKAVETAAEAGEEV  202

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
             Y+D+E +F M  LL +MA GM++ PP         D+ EN DA+  LW++
Sbjct  203  FYMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENIDADMPLWSF  253



>gb|AIQ82369.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82370.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82371.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82372.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82373.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82374.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82375.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82377.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82378.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82379.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82380.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82381.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82382.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82383.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82384.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82385.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82386.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82387.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82388.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82389.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82390.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82391.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82392.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82393.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82394.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82395.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82396.1| CBF3, partial [Populus balsamifera]
 gb|AIQ82397.1| CBF3, partial [Populus balsamifera]
Length=198

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 96/153 (63%), Gaps = 14/153 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  34   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  93

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG---------DGGGSRQERKDD---  717
               A R PVP+S+EA DIRRAA+ AA + +     G         D G       DD   
Sbjct  94   ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDFRREDRGEVCSSTNDDIRD  153

Query  718  -PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
             PS N  YIDEE  F+M  LL  MA G+++SPP
Sbjct  154  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPP  186



>gb|AIQ82376.1| CBF3, partial [Populus balsamifera]
Length=198

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 98/153 (64%), Gaps = 14/153 (9%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  34   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  93

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGD--GGGSRQER-----------KD  714
               A R PVP+S+EA DIRRAA+ AA + +     G       R++R           +D
Sbjct  94   ADSAWRLPVPISNEAKDIRRAASEAAELFRTSDLGGQVMEDXRREDRGEVCSSTNDDIRD  153

Query  715  DPSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
             PS N  YIDEE  F+M  LL  MA G+++SPP
Sbjct  154  LPSENVGYIDEEAEFNMPGLLASMAEGLLLSPP  186



>gb|AIU92963.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 103/171 (60%), Gaps = 9/171 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  83   RHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  142

Query  574  PAYAARYPVPVsseaadirraaasaa-------ammkpesssGDGGGSRQERKDDPSVNT  732
               A R PVP SSEA DI++AAA AA        +      +GD G    E   +     
Sbjct  143  ADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELMRTGDEGEKAVETAAEAGEEV  202

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
             Y+D+E +F M  LL +MA GM++ PP         D+ EN DA+  LW++
Sbjct  203  FYMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENIDADMPLWSF  253



>gb|AIU92948.1| C-repeat/dehydration-responsive element-binding factor 4 [Populus 
simonii]
Length=255

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 103/171 (60%), Gaps = 9/171 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  83   RHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  142

Query  574  PAYAARYPVPVsseaadirraaasaa-------ammkpesssGDGGGSRQERKDDPSVNT  732
               A R PVP SSEA DI++AAA AA        +      +GD G    E   +     
Sbjct  143  ADSAWRLPVPASSEAKDIQKAAAEAAGGFRPEGRVGGELLRTGDEGEKAVETAAEAGEEV  202

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
             Y+D+E +F M  LL +MA GM++ PP         D+ EN DA+  LW++
Sbjct  203  FYMDDEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNMENIDADMPLWSF  253



>gb|AGY31292.1| C-repeat binding factor 4c [Populus euphratica]
Length=223

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 109/181 (60%), Gaps = 23/181 (13%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALALR   A LNF
Sbjct  47   RHPVFRGVRKRNGNKWVCEMREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSACLNF  106

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV---------  726
               A R PVPVS ++ DI RAA  AA + +P+    + GG   +++D  +V         
Sbjct  107  ADSAWRLPVPVSKDSKDITRAANEAAELFRPQ----EFGGHPAKQQDSNAVLEDYSSEVC  162

Query  727  --------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD-DSPENSDAETLWN  879
                      ++  EE + DM  LLVDMA G+++SPPR   +   D D  EN    +LW+
Sbjct  163  SDDCKTFQENDFFFEEAVLDMPGLLVDMAEGLLLSPPRYVRNDCNDLDHVENGSDLSLWS  222

Query  880  Y  882
            Y
Sbjct  223  Y  223



>ref|XP_011029177.1| PREDICTED: dehydration-responsive element-binding protein 1E 
[Populus euphratica]
Length=228

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 100/157 (64%), Gaps = 22/157 (14%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALA R   A LNF
Sbjct  56   RHPIFRGVRKRNGDKWVCELREPNKKSRIWLGTYPTPEMAARAHDVAALAFRGKSACLNF  115

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQE--RKDD----------  717
               A R PVP+S+EA DIRRAA+ AA + +      D GG   E  R++D          
Sbjct  116  ADSAWRLPVPISNEAKDIRRAASEAAELFRTT----DFGGQEMEYFRREDRGEVCSSPND  171

Query  718  -----PSVNTEYIDEEELFDMHNLLVDMAGGMMVSPP  813
                 PS N  YIDEE  F+M  LL +MA G+++SPP
Sbjct  172  DIRDLPSENVGYIDEEAEFNMPGLLANMAEGLLLSPP  208



>ref|XP_007209556.1| hypothetical protein PRUPE_ppa010909mg [Prunus persica]
 gb|ABR19831.1| dehydration responsive element binding protein [Prunus persica]
 gb|ADN93458.1| CBF/DREB transcription factor [Prunus persica]
 gb|EMJ10755.1| hypothetical protein PRUPE_ppa010909mg [Prunus persica]
 gb|AGL07691.1| CBF/DREB 2 [Prunus persica]
Length=230

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 107/172 (62%), Gaps = 10/172 (6%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPR-KTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLN  570
            +HP YRGVR R+  KWV E+REP  K +RIWLGTYPT EMAA A+DVAALA R   A +N
Sbjct  57   RHPVYRGVRRRNNNKWVCELREPNNKKSRIWLGTYPTAEMAARAHDVAALAFRGKLACIN  116

Query  571  FPAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSVNTE-----  735
            F   A R P+P S +  DIRRAAA AA   +P    G   GS  E++ + SV+ E     
Sbjct  117  FADSAWRLPLPASMDTMDIRRAAAEAAEGFRPAEFGGLSSGSSDEKEMNLSVDMEKNSSL  176

Query  736  ---YIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAETLWNY  882
               Y+DEEE+FDM  L+ +MA G+++SPP+ ++ +   D  E      LW++
Sbjct  177  CLFYLDEEEMFDMPRLIDNMAQGLLLSPPQCSAGYLNWDDVETEADAKLWSF  228



>ref|XP_011029176.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
 ref|XP_011014145.1| PREDICTED: dehydration-responsive element-binding protein 1E-like 
[Populus euphratica]
Length=240

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 109/181 (60%), Gaps = 23/181 (13%)
 Frame = +1

Query  397  KHPKYRGVRSRSG-KWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP +RGVR R+G KWV E+REP K +RIWLGTYPTPEMAA A+DVAALALR   A LNF
Sbjct  64   RHPVFRGVRKRNGNKWVCEMREPNKKSRIWLGTYPTPEMAARAHDVAALALRGKSACLNF  123

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssGDGGGSRQERKDDPSV---------  726
               A R PVPVS ++ DI RAA  AA + +P+    + GG   +++D  +V         
Sbjct  124  ADSAWRLPVPVSKDSKDITRAANEAAELFRPQ----EFGGHPAKQQDSNAVLEDYSSEVC  179

Query  727  --------NTEYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPAD-DSPENSDAETLWN  879
                      ++  EE + DM  LLVDMA G+++SPPR   +   D D  EN    +LW+
Sbjct  180  SDDCKTFQENDFFFEEAVLDMPGLLVDMAEGLLLSPPRYVRNDCNDLDHMENGSDLSLWS  239

Query  880  Y  882
            Y
Sbjct  240  Y  240



>gb|AGY31291.1| C-repeat binding factor 4b [Populus euphratica]
Length=252

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 104/171 (61%), Gaps = 9/171 (5%)
 Frame = +1

Query  397  KHPKYRGVRSR-SGKWVSEIREPRKTTRIWLGTYPTPEMaaaaydvaalalrsaEAVLNF  573
            +HP YRGVR R SGKWV E+REP K +RIWLGT+PT EMAA A+DVAALALR   A LNF
Sbjct  80   RHPVYRGVRRRNSGKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAALALRGRSACLNF  139

Query  574  PAYAARYPVPVsseaadirraaasaaammkpesssG-------DGGGSRQERKDDPSVNT  732
               A R PVP SSEA DI+RAAA AA   +PE   G       D G    +   +     
Sbjct  140  ADSAWRLPVPASSEAKDIQRAAAEAAGGFRPEGCVGGELMRTVDEGEKAADTAAEAGEEV  199

Query  733  EYIDEEELFDMHNLLVDMAGGMMVSPPRINSSHPADDSPENSDAET-LWNY  882
             Y+DEE +F M  LL +MA GM++ PP         D+ EN DA+  LW++
Sbjct  200  FYMDEEAVFGMPGLLANMAEGMLLPPPHCGGGGDGWDNVENIDADMPLWSF  250



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3869447245482