BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78866_g1_i1 len=921 path=[899:0-920]

Length=921
                                                                      Score     E

sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...  79.0    4e-14   Ipomoea batatas [batate]
gb|ABB97542.1|  sporamin A precursor                                  79.0    5e-14   Ipomoea batatas [batate]
gb|AAB52547.1|  sporamin precursor                                    77.8    1e-13   Ipomoea batatas [batate]
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...  77.8    1e-13   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                              77.4    2e-13   
gb|ABG26232.1|  sporamin A                                            77.0    2e-13   Ipomoea trifida
gb|ABG26224.1|  sporamin A                                            77.0    2e-13   Ipomoea leucantha
gb|AFR60865.1|  sporamin B                                            76.6    3e-13   
gb|AFR60863.1|  sporamin B                                            76.3    4e-13   
gb|ABB97547.1|  sporamin A precursor                                  76.3    5e-13   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                            75.9    7e-13   Ipomoea trifida
gb|ABY19576.1|  sporamin A precursor                                  75.5    8e-13   Ipomoea batatas [batate]
gb|AAA33391.1|  sporamin A precursor                                  75.5    8e-13   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                  75.5    8e-13   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                  75.5    8e-13   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                            75.5    9e-13   Ipomoea trifida
gb|ABB97549.1|  sporamin A precursor                                  75.1    1e-12   Ipomoea batatas [batate]
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor   75.1    1e-12   Ipomoea batatas [batate]
gb|ABG26238.1|  sporamin A                                            75.1    1e-12   Ipomoea trifida
gb|ABG26236.1|  sporamin A                                            74.7    1e-12   Ipomoea trifida
gb|AFR60855.1|  sporamin A                                            74.7    2e-12   
gb|AFR60858.1|  sporamin A                                            74.3    2e-12   
gb|ABG26227.1|  sporamin A                                            74.3    2e-12   Ipomoea leucantha
gb|AFR60859.1|  sporamin B                                            73.9    3e-12   
gb|AAD40288.1|  sporamin A precursor                                  73.9    3e-12   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                    73.9    3e-12   Ipomoea batatas [batate]
gb|AFR60864.1|  sporamin B                                            73.9    3e-12   
gb|AFR60867.1|  sporamin B                                            73.6    3e-12   
gb|ABB97543.1|  sporamin A precursor                                  73.2    4e-12   Ipomoea batatas [batate]
gb|AAA33390.1|  sporamin B                                            73.2    5e-12   Ipomoea batatas [batate]
gb|AAL55800.1|AF289060_1  sporamin                                    73.2    5e-12   Ipomoea batatas [batate]
gb|ABG26222.1|  sporamin A                                            73.2    6e-12   Ipomoea leucantha
gb|AAD05567.1|  sporamin A                                            72.8    6e-12   Ipomoea batatas [batate]
gb|AAA86670.1|  preprosporamin                                        72.8    7e-12   Ipomoea batatas [batate]
gb|ABG26235.1|  sporamin A                                            72.4    1e-11   Ipomoea trifida
gb|ABB90968.1|  sporamin B precursor                                  72.0    1e-11   Ipomoea batatas [batate]
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor   72.0    1e-11   Ipomoea batatas [batate]
gb|AFR60862.1|  sporamin B                                            71.2    3e-11   
gb|AFR60860.1|  sporamin B                                            70.9    3e-11   
gb|AFR60856.1|  sporamin A                                            69.7    1e-10   
gb|ABG26229.1|  sporamin A                                            69.3    1e-10   Ipomoea trifida
gb|AFR60853.1|  truncated sporamin                                    60.5    7e-08   
gb|ABC96761.1|  trypsin inhibitor 2                                   54.3    1e-05   Psophocarpus tetragonolobus [asparagus bean]
sp|P25700.2|IT2_PSOTE  RecName: Full=Trypsin inhibitor 2; AltName...  53.9    2e-05   Psophocarpus tetragonolobus [asparagus bean]
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              53.9    3e-05   
emb|CDP16462.1|  unnamed protein product                              52.4    1e-04   
ref|XP_003532234.1|  PREDICTED: uncharacterized LOC100500599          50.8    3e-04   
gb|ACU15724.1|  unknown                                               49.7    8e-04   Glycine max [soybeans]



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C T+V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   L  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NSYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDHMLRTTRLALSN--SPFV  211



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLG  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFLM--CKPVSTY  684
            + W  ++DS S    +K G    DN + +   L  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NSYKLTYCQFGADKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDHMLRTTRLALSN--SPFV  211



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   L  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NSYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDHMLRTTRLALSN--SPFV  211



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 98/205 (48%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK F L F LSLYLLPN THS     NPIRL     +   E PV D NGDEVR G  YY+
Sbjct  1    MKAFALFFVLSLYLLPNPTHS---KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYM  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PEAT V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F       C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 88/190 (46%), Gaps = 17/190 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+    P  E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PEAT V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  +YDS S   L+K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCLFGSDKCYNVGRF  193

Query  685  YDKSIGETRL  714
             D  +  TRL
Sbjct  194  NDPMLRTTRL  203



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + D  SP +
Sbjct  194  HDPMLRTTRLALSD--SPFV  211



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 94/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+    P  + PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPPSSQTPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 98/205 (48%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK F L F LSLYLLPN THS     NPIRL     +   E PV D NGDEVR G  YY+
Sbjct  1    MKAFALFFVLSLYLLPNPTHS---KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYM  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PE+T V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTYQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F       C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 97/205 (47%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK   L F LSLYLLPN  HS     NPIRL     +   E PV D NGDEVR G  YYI
Sbjct  1    MKALALFFVLSLYLLPNPAHS---KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYI  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PE+T V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITIRPA-DPESTVVMPSTFQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F  P    C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFSIPTNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 96/204 (47%), Gaps = 27/204 (13%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDE+R GG YY+VSA       VG G 
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEIRAGGNYYMVSAI----WGVGGGG  70

Query  352  ----YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPP  510
                + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       
Sbjct  71   PRLAHLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKL  130

Query  511  CDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKP  672
            C   + W  ++DS S    +K G    DN + +   L  A   N+Y++ YC F    C  
Sbjct  131  CVNNVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NSYKLTYCQFGSDKCYN  189

Query  673  VSTYYDKSIGETRLFVGDDRSPLI  744
            V  ++D  +  TRL + +  SP +
Sbjct  190  VGRFHDHMLRTTRLALSN--SPFV  211



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANL-NFYKLTYCQFGSDKCHNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  + DS S    +K G    DN + +   L  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NSYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TR+ + +  SP +
Sbjct  194  HDHMLRTTRIALSN--SPFV  211



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   L  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  + DS S    +K G    DN + +   L  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NSYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TR+ + +  SP +
Sbjct  194  HDHMLRTTRIALSN--SPFV  211



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   L  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 97/205 (47%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK   LLF LSLYLLPN  HS     NPIRL     +   E PV D NGDEVR G  YYI
Sbjct  1    MKALALLFVLSLYLLPNPAHSK---FNPIRLRPAHETASSETPVLDINGDEVRAGENYYI  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PEAT V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F       C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCRFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 89/190 (47%), Gaps = 16/190 (8%)
 Frame = +1

Query  214  INPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPT  381
             NPIRLP+       E PV D NGDEVR GG YY+VSA            + DT ++C +
Sbjct  25   FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDTMSKCAS  84

Query  382  NVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSE  552
            +V++  ++   G  ++I PA   PE+T V        +F       C   + W  ++DS 
Sbjct  85   DVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNWRIQHDSA  144

Query  553  SDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTYYDKSIGETRL  714
            S    +K G    DN + +   +  A   N Y++ YC F    C  V  ++D  +  TRL
Sbjct  145  SGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRFHDPMLRTTRL  203

Query  715  FVGDDRSPLI  744
             + D  SP +
Sbjct  204  ALSD--SPFV  211



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NSYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D     TRL + +  SP +
Sbjct  194  HDHMSRTTRLALSN--SPFV  211



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 86/190 (45%), Gaps = 18/190 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYIVSAT-SETPEKVGFG  348
            PN  HS     NPIRL     +   E PV D NGDEVR G  YYIVSA        +   
Sbjct  16   PNPAHSK---FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLV  72

Query  349  WYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQI  522
              + ++  C ++V++ +S+F  G  ++I PA  PEAT V        +F       C   
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNN  131

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGF--LMCKPVSTY  684
            + W  ++DSES    VK G    DN + +  I       N Y+I YC F    C  V  Y
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKISYCQFGTEKCFNVGRY  190

Query  685  YDKSIGETRL  714
            YD     TRL
Sbjct  191  YDPLTRATRL  200



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+    PP E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPPPSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V +  ++   G  ++I P+   PE++ +        +F       C   
Sbjct  75   HLDMMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 75/205 (37%), Positives = 96/205 (47%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK   L F LSLYLLPN  HS     NPIRL     +   E PV D NGDEVR G  YYI
Sbjct  1    MKALALFFVLSLYLLPNPAHS---KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYI  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PE+T V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F       C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 86/192 (45%), Gaps = 17/192 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAILGACGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPA-YPPEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D    C ++V++  ++   G  ++I PA   PEAT V        +F       C   
Sbjct  75   HLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  +YDS S   L+K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCLFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFV  720
             D  +  TRL +
Sbjct  194  NDPMLRTTRLAI  205



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 97/204 (48%), Gaps = 16/204 (8%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK   LLF LSLYLLPN  HS     NPIRL     +   E PV D NGDEVR G  YYI
Sbjct  1    MKALALLFVLSLYLLPNPAHSK---FNPIRLRPAHETASSETPVLDINGDEVRAGENYYI  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G   +I PA  PEAT V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPTTITPA-DPEATVVMPSTYQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTGD--NDSPYPFILYPA-PAPNTYEIIY  648
              +F       C   + W  ++DSES    VK G+  +D+   F +       N Y+I Y
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISY  176

Query  649  CGF--LMCKPVSTYYDKSIGETRL  714
            C F    C  V  YYD     TRL
Sbjct  177  CQFGTEKCFNVGRYYDPLTRATRL  200



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 86/190 (45%), Gaps = 18/190 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYIVSAT-SETPEKVGFG  348
            PN  HS     NPIRL     +   E PV D NGDEVR G  YYIVSA        +   
Sbjct  16   PNPAHSK---FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLV  72

Query  349  WYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQI  522
              + ++  C ++VV+ +S+F  G  ++I PA  PE+T V        +F       C   
Sbjct  73   RLDSSSNECASDVVVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNN  131

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGF--LMCKPVSTY  684
            + W  ++DSES    VK G    DN + +  I       N Y+I YC F    C  V  Y
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKISYCQFGTEKCFNVGRY  190

Query  685  YDKSIGETRL  714
            YD     TRL
Sbjct  191  YDPLTRATRL  200



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 88/190 (46%), Gaps = 16/190 (8%)
 Frame = +1

Query  214  INPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPT  381
             NPIRLP+       E PV D NGDEVR GG YY+VSA            + D  ++C +
Sbjct  5    FNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSKCAS  64

Query  382  NVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSE  552
            +V++  ++   G  ++I PA   PE+T V        +F       C   + W  ++DS 
Sbjct  65   DVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQHDSA  124

Query  553  SDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTYYDKSIGETRL  714
            S    +K G    DN + +   L  A   N Y++ YC F    C  V  ++D  +  TRL
Sbjct  125  SGQYFLKAGEFVSDNSNQFKIELVDANL-NFYKLTYCQFGSDKCYNVGRFHDPMLRTTRL  183

Query  715  FVGDDRSPLI  744
             + +  SP +
Sbjct  184  ALSN--SPFV  191



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 86/190 (45%), Gaps = 18/190 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYIVSAT-SETPEKVGFG  348
            PN  HS     NPIRL     +   E PV D NGDEVR G  YYIVSA        +   
Sbjct  16   PNPAHSK---FNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLV  72

Query  349  WYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQI  522
              + ++  C ++V++ +S+F  G  ++I PA  PE+T V        +F       C   
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNN  131

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGF--LMCKPVSTY  684
            + W  ++DSES    VK G    DN + +  I       N Y+I YC F    C  V  Y
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKISYCQFGTEKCFNVGRY  190

Query  685  YDKSIGETRL  714
            YD     TRL
Sbjct  191  YDPLTRATRL  200



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPLMRTTRLALSN--SPFV  211



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+    P  E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I P+   PE++ +        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 85/189 (45%), Gaps = 15/189 (8%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---GFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYLVSAILGACGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPA-YPPEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D    C ++V++  ++   G  ++I PA   PEAT V        +F       C   
Sbjct  75   HLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTGD--NDSPYPFILYPAPAP-NTYEIIYCGFL--MCKPVSTYY  687
            + W  +YDS S   L+K G+  +D    F +    A  N Y++ YC F    C  V  + 
Sbjct  135  VNWGIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFN  194

Query  688  DKSIGETRL  714
            D  +  TRL
Sbjct  195  DPMLRTTRL  203



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 93/200 (47%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C + 
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVKN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   +  A   N Y++ YC F    C     +
Sbjct  135  VNWGIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANL-NFYKLTYCQFGSDKCYNCGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMLRTTRLALSN--SPFV  211



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 92/200 (46%), Gaps = 19/200 (10%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPSSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE++ +        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W   +DS S    +K G    DN + +   +  A   N+Y++ YC F    C  V  +
Sbjct  135  VNWGIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NSYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLI  744
            +D  +  TRL + +  SP +
Sbjct  194  HDPMMRTTRLALSN--SPFV  211



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 95/205 (46%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK   L F LSLYLL N  HS     NPIRL     +   E PV D NGDEVR G  YYI
Sbjct  1    MKALALFFVLSLYLLANPAHS---KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYI  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PE+T V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F       C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 84/190 (44%), Gaps = 17/190 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+V A            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVYAILGACGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPA-YPPEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D    C ++V++  ++   G  ++I PA   PEAT V        +F       C   
Sbjct  75   HLDLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  +YDS S   L+K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCLFGSDKCYNVGRF  193

Query  685  YDKSIGETRL  714
             D  +  TRL
Sbjct  194  KDPMLRTTRL  203



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 95/205 (46%), Gaps = 18/205 (9%)
 Frame = +1

Query  139  MKTFlllfalslyllPNSTHSTRNNINPIRL----PSPPYEPPVRDTNGDEVRTGGVYYI  306
            MK   L F LSLYLL N  HS     NPIRL     +   E PV D NGDEVR G  YYI
Sbjct  1    MKALALFFVLSLYLLANPAHS---KFNPIRLRPAHETASSETPVLDINGDEVRAGENYYI  57

Query  307  VSAT-SETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPV  477
            VSA        +     + ++  C ++V++ +S+F  G  ++I PA  PE+T V      
Sbjct  58   VSAIWGAGGGGLRLVRLDSSSNECASDVMVSRSDFDNGDPITITPA-DPESTVVMPSTFQ  116

Query  478  NLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEII  645
              +F       C   + W  ++DSES    VK G    DN + +  I       N Y+I 
Sbjct  117  TFRFNIATNKLCVNNVNWGIKHDSESGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKIS  175

Query  646  YCGF--LMCKPVSTYYDKSIGETRL  714
            YC F    C  V  YYD     TRL
Sbjct  176  YCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 82/180 (46%), Gaps = 15/180 (8%)
 Frame = +1

Query  214  INPIRL----PSPPYEPPVRDTNGDEVRTGGVYYIVSAT-SETPEKVGFGWYNDTNTRCP  378
             NPIRL     +   E PV D NGDEVR G  YYIVSA        +     + ++  C 
Sbjct  23   FNPIRLRPARETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDSSSNECA  82

Query  379  TNVVLWKSEF--GIAVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSE  552
            ++V++ +S+F  G  ++I PA  PE+T V        +F       C   + W  ++DSE
Sbjct  83   SDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNWGIKHDSE  141

Query  553  SDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGF--LMCKPVSTYYDKSIGETRL  714
            S    VK G    DN + +  I       N Y+I YC F    C  V  YYD     TRL
Sbjct  142  SGQYFVKAGEFVSDNSNQFK-IEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLTRATRL  200



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 85/190 (45%), Gaps = 17/190 (9%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  + DS S    +K G    DN + +   +  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANL-NFYKLTYCLFGSDKCYNVGRF  193

Query  685  YDKSIGETRL  714
             D  +  TRL
Sbjct  194  KDPMLRTTRL  203



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 90/202 (45%), Gaps = 17/202 (8%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + D  ++C ++V++  +    G  ++I PA   PE+T V        +F           
Sbjct  75   HLDMMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRVNN  134

Query  523  LTWDAEYDSESDLGLVKTG----DNDSPYPFILYPAPAPNTYEIIYCGFL--MCKPVSTY  684
            + W  ++DS S    +K G    DN + +   L  A   N Y++ YC F    C  V  +
Sbjct  135  VNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANL-NFYKLTYCQFGSDKCYNVGRF  193

Query  685  YDKSIGETRLFVGDDRSPLIVQ  750
            +D  +  TRL + +     +++
Sbjct  194  HDPMLRTTRLALSNSPFAFVIR  215



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 63/131 (48%), Gaps = 10/131 (8%)
 Frame = +1

Query  184  PNSTHSTRNNINPIRLPS----PPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGW  351
            PN  HS     NPIRLP+       E PV D NGDEVR GG YY+VSA            
Sbjct  18   PNPAHS---RFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLA  74

Query  352  YNDTNTRCPTNVVLWKSEF--GIAVSIAPAYP-PEATDVWVRIPVNLKFYTPVVPPCDQI  522
            + DT ++C ++V++  ++   G  ++I PA   PE+T V        +F       C   
Sbjct  75   HLDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNN  134

Query  523  LTWDAEYDSES  555
            + W  ++DS S
Sbjct  135  VNWGIQHDSAS  145



>gb|ABC96761.1| trypsin inhibitor 2 [Psophocarpus tetragonolobus]
Length=182

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 71/177 (40%), Gaps = 18/177 (10%)
 Frame = +1

Query  262  DTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPTNVVLWKSEFGIAVSIAPAYP  441
            D  G  VR GG YY+V      P   G       N  CP  VV    E      I  A  
Sbjct  5    DVEGKTVRNGGTYYLVPQLR--PGGGGMEAAKVGNEDCPLTVVKSLDENSNGELIRIASR  62

Query  442  PEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG---DNDSPYPFI--  606
              +T +     VNL F  P  P C     W    D    L  +K G   D++  YPF   
Sbjct  63   LRSTFIPEYSLVNLGFADP--PKCAPSPFWTVVKDQSERLPSIKLGEYKDSELDYPFKFE  120

Query  607  -LYPAPAPNTYEIIYCGF------LMCKPVSTYYDKSIGETRLFVGDDRSPLIVQFQ  756
             +Y A     Y+++YCG       +MCK +  Y D+  G  RL V    +PL+V F+
Sbjct  121  RVYAASKMYAYKLLYCGSEDEEEEMMCKDIGVYRDQE-GYQRLVV-SKHNPLVVGFK  175



>sp|P25700.2|IT2_PSOTE RecName: Full=Trypsin inhibitor 2; AltName: Full=WTI-2 [Psophocarpus 
tetragonolobus]
Length=182

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 71/177 (40%), Gaps = 18/177 (10%)
 Frame = +1

Query  262  DTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPTNVVLWKSEFGIAVSIAPAYP  441
            D  G  VR GG YY+V      P   G       N  CP  VV    E      I  A  
Sbjct  5    DVEGKTVRNGGTYYLVPQLR--PGGGGMEAAKVGNEDCPLTVVKSLDENSNGEPIRIASR  62

Query  442  PEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSESDLGLVKTG---DNDSPYPFI--  606
              +T +     VNL F  P  P C     W    D    L  +K G   D++  YPF   
Sbjct  63   LRSTFIPEYSLVNLGFADP--PKCAPSPFWTVVKDQSERLPSIKLGEYKDSELDYPFKFE  120

Query  607  -LYPAPAPNTYEIIYCGF------LMCKPVSTYYDKSIGETRLFVGDDRSPLIVQFQ  756
             +Y A     Y+++YCG       +MCK +  Y D+  G  RL V    +PL+V F+
Sbjct  121  RVYAASKMYAYKLLYCGSEDEEEEMMCKDIGVYRDQE-GYQRLVV-SKHNPLVVGFK  175



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 82/193 (42%), Gaps = 23/193 (12%)
 Frame = +1

Query  241  PYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GI  414
             Y  PV D  G+E++ G  Y I SA        G G  + TN  CP +V+ +  +   G+
Sbjct  25   AYTEPVLDIQGEELKAGAEYIISSAI----WGAGGGDVSATNKTCPDDVIQYSLDLLRGL  80

Query  415  AVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSESDLG-LVKTGDN--  585
             V+ +PA      D  +RI  +L     +   CD    W  +  S S++   V TG    
Sbjct  81   PVTFSPA---NYGDDVIRISTDLNIKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEG  137

Query  586  ----DSPYPFILYPAPAPNTYEIIYC------GFLMCKPVSTYYDKSIGETRLFVGDDRS  735
                D+   +          Y++++C        ++C+ +  Y++ + G   L + D  S
Sbjct  138  NPGVDTLTNWFKIEKAGILGYKLVFCPKDICHCGVLCRDIGIYFENNRGRI-LSLSDQLS  196

Query  736  PLIVQFQFVQ*LS  774
            P +V F+ V  LS
Sbjct  197  PFVVVFKKVGPLS  209



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 74/171 (43%), Gaps = 18/171 (11%)
 Frame = +1

Query  253  PVRDTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPTNVVLWKSEF--GIAVSI  426
            PV D +GDE+R G  YYIVS+             +  N  CP  VV  K +   G  V+ 
Sbjct  26   PVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIGNESCPLPVVQEKLDLLRGHPVTF  85

Query  427  APAYPPEATDVWVRIPVNLKFYTPVVPPCDQILTWDAEYDSESDLGLVKT-GDNDSP---  594
             P    E   V V   +N+KF +   P C++   W  ++D E     + T G   +P   
Sbjct  86   TPVNSKEGV-VRVSTDLNIKF-SKAAPVCNESNVWKLDFDEELGQHFILTNGVEGNPGCG  143

Query  595  --YPFILYPAPAPNTYEIIYC------GFLMCKPVSTYYDK--SIGETRLF  717
              + +     P   +Y +++C        ++CK V  + D+  ++G TR F
Sbjct  144  TIHNWFKIEGPYHKSYRLVFCPTVCNICNVICKDVGVFSDRRLALGGTRSF  194



>ref|XP_003532234.1| PREDICTED: uncharacterized LOC100500599 [Glycine max]
 gb|KHN01857.1| Kunitz-type trypsin inhibitor KTI1 [Glycine soja]
Length=203

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 77/184 (42%), Gaps = 11/184 (6%)
 Frame = +1

Query  229  LPSPPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPTNVVLWKSEF  408
            LPS   +  + D NGD VR GG YYI+       +  G  +    N  CP  VV    E 
Sbjct  19   LPSATADT-IFDINGDFVRNGGTYYILPVIR--GDGGGIEFAATGNETCPLTVVQSPLEV  75

Query  409  GIAVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQI-LTWDAEYDSESDLGLVKTG-D  582
               + +  + P E   +   + +N+ F    VPPC  I   W         L +  TG +
Sbjct  76   SKGLPLIISSPFEILSIQEGLILNIGF--TFVPPCALIPSEWTTVKGLPEGLAVKLTGYE  133

Query  583  NDSPYPFILYPAPAP-NTYEIIYCGF--LMCKPVSTYYDKSIGETRLFVGDDRSPLIVQF  753
            N  P  F +       N Y++++C      C  +  Y D   G  RL V ++  PL+V F
Sbjct  134  NKVPGWFKIERVSLEFNDYKLVFCATEDSTCVDIGVYIDGE-GNRRLVVTENNDPLLVHF  192

Query  754  QFVQ  765
            + V+
Sbjct  193  KKVE  196



>gb|ACU15724.1| unknown [Glycine max]
Length=203

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 75/181 (41%), Gaps = 11/181 (6%)
 Frame = +1

Query  229  LPSPPYEPPVRDTNGDEVRTGGVYYIVSATSETPEKVGFGWYNDTNTRCPTNVVLWKSEF  408
            LPS   +  + D NGD VR GG YYI+       +  G  +    N  CP  VV    E 
Sbjct  19   LPSATADT-IFDINGDFVRNGGTYYILPVIR--GDGGGIEFAATGNETCPLTVVQSPLEV  75

Query  409  GIAVSIAPAYPPEATDVWVRIPVNLKFYTPVVPPCDQI-LTWDAEYDSESDLGLVKTG-D  582
               + +  + P E   +   + +N+ F    VPPC  I   W         L +  TG +
Sbjct  76   SKGLPLIISSPFEILSIQEGLILNIGF--TFVPPCALIPSEWTTVKGLPEGLAVKLTGYE  133

Query  583  NDSPYPFILYPAPAP-NTYEIIYCGF--LMCKPVSTYYDKSIGETRLFVGDDRSPLIVQF  753
            N  P  F +       N Y++++C      C  +  Y D   G  RL V ++  PL+V F
Sbjct  134  NKVPGWFKIERVSLEFNDYKLVFCATEDSTCVDIGVYIDGE-GNRRLVVTENNDPLLVHF  192

Query  754  Q  756
            +
Sbjct  193  R  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1936310281356