BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78815_g1_i1 len=1617 path=[1595:0-1616]

Length=1617
                                                                      Score     E

sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    580   0.0      Hyoscyamus muticus
emb|CAC24711.1|  cytochrome P450                                        578   0.0      Solanum tuberosum [potatoes]
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     573   0.0      
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         573   0.0      
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              566   0.0      
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         562   0.0      
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              554   0.0      
gb|ABC69405.1|  CYP71D51v3                                              554   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         552   0.0      
gb|ABC69403.1|  CYP71D51v1                                              550   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               541   0.0      
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             541   0.0      Solanum chacoense
gb|ABC69397.1|  CYP71D48v1                                              540   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69396.1|  CYP71D48v2                                              539   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         538   0.0      
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         539   0.0      
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    536   0.0      
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         535   0.0      
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         534   0.0      
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               534   0.0      
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    533   0.0      
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    533   0.0      
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    531   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         531   0.0      
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               530   0.0      
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         530   0.0      
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         530   0.0      
gb|ABC69421.1|  CYP71D20v2                                              528   7e-180   Nicotiana tabacum [American tobacco]
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         528   8e-180   
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             527   2e-179   Solanum chacoense
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    526   4e-179   
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         526   4e-179   
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         524   2e-178   
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         525   5e-178   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         522   2e-177   
gb|AAD47832.1|  cytochrome P450                                         521   2e-177   Nicotiana tabacum [American tobacco]
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         521   3e-177   
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         521   4e-177   
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         520   2e-176   
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         517   1e-175   
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         517   2e-175   
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         517   2e-175   
gb|AHH25653.1|  cytochrome P450 CYP71D                                  516   5e-175   
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         516   5e-175   
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         517   6e-175   
emb|CDP07872.1|  unnamed protein product                                515   8e-175   
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         516   8e-175   
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              514   2e-174   
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         514   2e-174   
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         513   5e-174   
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         513   8e-174   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    510   1e-173   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         512   1e-173   
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         511   2e-173   
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         511   5e-173   
gb|ABC69395.1|  CYP71D47v2                                              510   7e-173   Nicotiana tabacum [American tobacco]
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         509   2e-172   
gb|ABC69394.1|  CYP71D47v1                                              509   3e-172   Nicotiana tabacum [American tobacco]
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         509   7e-172   
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         507   1e-171   
gb|AAF27282.1|AF122821_1  cytochrome P450                               506   2e-171   Capsicum annuum
emb|CDP08465.1|  unnamed protein product                                505   8e-171   
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         504   1e-170   
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         504   2e-170   
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               503   4e-170   
gb|ABC69399.1|  CYP71D49v1                                              503   4e-170   Nicotiana tabacum [American tobacco]
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         502   1e-169   
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         502   2e-169   
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         501   2e-169   
emb|CDP07879.1|  unnamed protein product                                502   2e-169   
gb|AIZ01224.1|  epi-aristolochene dihydroxylase                         499   3e-169   
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         501   3e-169   
gb|ABC69400.1|  CYP71D49v3                                              501   5e-169   Nicotiana tabacum [American tobacco]
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         499   4e-168   
emb|CDP20259.1|  unnamed protein product                                498   7e-168   
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    496   3e-167   
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         495   1e-166   
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         495   2e-166   
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              494   2e-166   
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         494   2e-166   
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               493   3e-166   
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               493   5e-166   
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like         493   9e-166   
ref|XP_009623936.1|  PREDICTED: premnaspirodiene oxygenase-like i...    492   1e-165   
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               491   3e-165   
ref|XP_004249812.1|  PREDICTED: premnaspirodiene oxygenase-like         491   6e-165   
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         490   6e-165   
gb|ABC69398.1|  CYP71D5v3                                               489   2e-164   Nicotiana tabacum [American tobacco]
dbj|BAC53923.1|  cytochrome P450                                        489   2e-164   Petunia x hybrida [garden petunia]
ref|XP_003611886.1|  Cytochrome P450                                    489   2e-164   
emb|CDP07887.1|  unnamed protein product                                488   3e-164   
gb|ABC69402.1|  CYP71D5v2                                               488   4e-164   Nicotiana tabacum [American tobacco]
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    488   4e-164   
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               488   5e-164   
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         488   6e-164   
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    486   2e-163   Glycine max [soybeans]
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         486   2e-163   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             485   4e-163   
emb|CDP07882.1|  unnamed protein product                                486   9e-163   
emb|CDP18841.1|  unnamed protein product                                484   1e-162   
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         484   2e-162   
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             483   3e-162   
ref|XP_006341699.1|  PREDICTED: premnaspirodiene oxygenase-like         483   4e-162   
gb|KHN42275.1|  Cytochrome P450 71D8                                    483   6e-162   
ref|XP_006341698.1|  PREDICTED: premnaspirodiene oxygenase-like         482   9e-162   
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               482   9e-162   
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         482   9e-162   
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               483   1e-161   
ref|XP_006352953.1|  PREDICTED: premnaspirodiene oxygenase-like         481   3e-161   
gb|AFK45297.1|  unknown                                                 480   3e-161   
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      479   6e-161   Nicotiana tabacum [American tobacco]
gb|AGN04217.1|  cytochrome P450                                         479   8e-161   
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    479   1e-160   
gb|AJD25162.1|  cytochrome P450 CYP71D374                               479   1e-160   
ref|XP_003611883.1|  Cytochrome P450                                    478   3e-160   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         477   4e-160   
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               477   5e-160   
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               477   7e-160   
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               475   7e-159   
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    474   1e-158   
gb|KHN36164.1|  Cytochrome P450 71D8                                    474   1e-158   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               474   1e-158   
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              474   2e-158   
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         474   2e-158   
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    474   2e-158   
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               474   2e-158   
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               473   2e-158   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              474   3e-158   
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    473   3e-158   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    474   3e-158   
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         473   4e-158   
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         473   4e-158   
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               473   4e-158   
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               473   4e-158   
ref|XP_003610580.1|  Cytochrome P450                                    473   5e-158   
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    472   6e-158   
gb|KHN36162.1|  Cytochrome P450 71D8                                    470   9e-158   
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               471   1e-157   
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               471   3e-157   
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               470   3e-157   
gb|KHN08718.1|  Cytochrome P450 71D8                                    470   4e-157   
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               469   6e-157   
gb|EYU21953.1|  hypothetical protein MIMGU_mgv1a025918mg                469   6e-157   
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               469   7e-157   
gb|ACD42776.1|  cytochrome P450 71D1                                    469   8e-157   Catharanthus roseus [chatas]
gb|KEH34014.1|  cytochrome P450 family 71 protein                       469   1e-156   
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         469   1e-156   
gb|KHN39921.1|  Cytochrome P450 71D8                                    469   2e-156   
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               468   3e-156   
dbj|BAM68816.1|  putative cytochrome P450 monooxygenase CYP71AV1        468   3e-156   
emb|CDP07881.1|  unnamed protein product                                479   3e-156   
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         468   4e-156   
ref|XP_011081932.1|  PREDICTED: cytochrome P450 71D95-like              467   5e-156   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         466   7e-156   
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               467   8e-156   
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               467   9e-156   
ref|XP_002522721.1|  cytochrome P450, putative                          466   1e-155   Ricinus communis
gb|AAO32822.1|  cytochrome P450 71D1                                    466   1e-155   Catharanthus roseus [chatas]
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         466   3e-155   
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             466   3e-155   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         466   3e-155   
dbj|BAM68809.1|  putative CYP71AV1 ortholog                             465   4e-155   
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               464   5e-155   
gb|AJD25166.1|  cytochrome P450 CYP71D413                               465   6e-155   
emb|CDP20312.1|  unnamed protein product                                463   8e-155   
ref|XP_003611884.1|  Cytochrome P450                                    464   9e-155   
gb|AHN62855.1|  germacrene A oxidase                                    463   9e-155   
dbj|BAM68815.1|  cytochrome P450 monooxygenase CYP71AV2                 464   1e-154   
ref|XP_010655870.1|  PREDICTED: cytochrome P450 71D10-like              464   1e-154   
dbj|BAM68810.1|  putative CYP71AV1 ortholog                             463   2e-154   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              463   3e-154   
gb|AGO03789.1|  germacrene A oxidase                                    462   3e-154   
sp|D5J9U8.1|GAO_LACSA  RecName: Full=Germacrene A oxidase; Short=...    462   4e-154   
gb|KHN42024.1|  Cytochrome P450 71D8                                    461   4e-154   
sp|D5JBW9.1|GAO_SAUCO  RecName: Full=Germacrene A oxidase; Short=...    462   5e-154   
gb|ABG49366.1|  P450 monooxygenase                                      462   5e-154   Artemisia annua [sweet Annie]
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                462   7e-154   
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like               462   7e-154   
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    462   8e-154   
gb|KHN48844.1|  Cytochrome P450 71D8                                    461   1e-153   
gb|KEH25835.1|  cytochrome P450 family 71 protein                       461   2e-153   
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like               462   2e-153   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         460   3e-153   
gb|AGC29947.1|  CYP71BE30                                               460   4e-153   
sp|D5JBW8.1|GAO_CICIN  RecName: Full=Germacrene A oxidase; Short=...    459   4e-153   
emb|CDP17903.1|  unnamed protein product                                459   5e-153   
gb|KDP39287.1|  hypothetical protein JCGZ_01044                         459   1e-152   
gb|KEH25843.1|  cytochrome P450 family 71 protein                       458   2e-152   
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             458   2e-152   
dbj|BAM68811.1|  putative CYP71AV1 ortholog                             457   2e-152   
gb|AHK60843.1|  CYP71D2                                                 458   3e-152   
gb|ADA70806.1|  cytochrome P450 CYP71D177                               457   6e-152   Scoparia dulcis [escobilla]
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         457   8e-152   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               456   1e-151   
gb|AIA09035.1|  germacrene A oxidase                                    456   1e-151   
gb|AIA09036.1|  germacrene A oxidase                                    456   1e-151   
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    456   2e-151   
ref|XP_003615865.1|  Cytochrome P450                                    455   4e-151   
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         455   5e-151   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         454   6e-151   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             454   1e-150   
gb|KDP29297.1|  hypothetical protein JCGZ_19400                         455   1e-150   
sp|D5JBX0.1|GAO_HELAN  RecName: Full=Germacrene A oxidase; Short=...    453   1e-150   
ref|XP_002522762.1|  cytochrome P450, putative                          453   2e-150   Ricinus communis
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              453   2e-150   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    453   2e-150   Ammi majus [ameo mayor]
sp|Q9XHE6.1|C71DF_MENPI  RecName: Full=Cytochrome P450 71D15; Alt...    453   2e-150   Mentha x piperita
gb|AED99871.1|  cytochrome P450                                         453   2e-150   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    453   2e-150   
gb|KDP39285.1|  hypothetical protein JCGZ_01042                         452   3e-150   
emb|CDP07886.1|  unnamed protein product                                451   7e-150   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                452   8e-150   
gb|AED99878.1|  cytochrome P450                                         451   1e-149   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              451   1e-149   
ref|XP_003617704.1|  Cytochrome P450                                    451   2e-149   
gb|ABR15423.1|  (-)P450 limonene-3-hydroxylase                          450   2e-149   
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              451   2e-149   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             450   3e-149   
emb|CDP18847.1|  unnamed protein product                                450   3e-149   
ref|XP_007022417.1|  Cytochrome P450 71D10, putative                    450   3e-149   
gb|KHN36161.1|  Cytochrome P450 71D8                                    447   6e-149   
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         450   6e-149   
ref|XP_007156882.1|  hypothetical protein PHAVU_002G025100g             449   9e-149   
ref|XP_007020557.1|  Cytochrome P450, putative                          449   1e-148   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              448   2e-148   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              448   2e-148   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       448   2e-148   
gb|AET00662.2|  cytochrome P450 family 71 protein                       448   2e-148   
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              448   2e-148   
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         447   3e-148   
dbj|BAM68812.1|  cytochrome P450 monooxygenase CYP71AV10                447   3e-148   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             447   4e-148   
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                447   5e-148   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         447   6e-148   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     447   6e-148   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    446   7e-148   
ref|XP_007213458.1|  hypothetical protein PRUPE_ppa024556mg             446   8e-148   
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              446   9e-148   
ref|XP_003617705.1|  Cytochrome P450                                    446   1e-147   
ref|XP_003519623.2|  PREDICTED: cytochrome P450 71D10-like              446   1e-147   
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         446   1e-147   
gb|KHG11859.1|  Cytochrome P450                                         446   2e-147   
gb|AGO03787.1|  cytochrome P450                                         445   2e-147   
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         445   2e-147   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              445   3e-147   
ref|XP_003545101.1|  PREDICTED: cytochrome P450 71D10-like              445   3e-147   
ref|XP_004516745.1|  PREDICTED: cytochrome P450 71D10-like              444   4e-147   
ref|XP_004516743.1|  PREDICTED: cytochrome P450 71D10-like              444   5e-147   
ref|XP_011087047.1|  PREDICTED: premnaspirodiene oxygenase-like         443   1e-146   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             442   1e-146   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    443   2e-146   
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     442   2e-146   
emb|CDP11812.1|  unnamed protein product                                442   2e-146   
ref|XP_003615871.1|  Cytochrome P450                                    442   2e-146   
gb|KHN43883.1|  Cytochrome P450 71D10                                   442   3e-146   
gb|KEH34024.1|  cytochrome P450 family 71 protein                       442   4e-146   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   442   5e-146   
ref|XP_003589691.1|  Cytochrome P450                                    442   6e-146   
ref|XP_006367128.1|  PREDICTED: premnaspirodiene oxygenase-like i...    439   6e-146   
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         441   9e-146   
gb|AES70567.2|  cytochrome P450 family 71 protein                       441   1e-145   
sp|Q6IV13.1|C7D95_MENSP  RecName: Full=Cytochrome P450 71D95; Alt...    440   1e-145   Mentha spicata
ref|XP_002522903.1|  cytochrome P450, putative                          441   2e-145   Ricinus communis
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         442   2e-145   
ref|XP_002513337.1|  cytochrome P450, putative                          441   2e-145   Ricinus communis
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             440   2e-145   
gb|KDP25063.1|  hypothetical protein JCGZ_22598                         440   2e-145   
gb|ABG91755.1|  amorpha-4,11-diene C-12 oxidase                         440   2e-145   Artemisia annua [sweet Annie]
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    440   2e-145   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     439   3e-145   
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               440   3e-145   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              440   3e-145   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             439   4e-145   
sp|Q6WKY9.1|C7D95_MENGR  RecName: Full=Cytochrome P450 71D95; Alt...    439   4e-145   Mentha x gracilis [ginger mint]
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1        439   4e-145   
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         439   4e-145   
dbj|BAM68808.1|  cytochrome P450 monooxygenase CYP71AV1                 439   6e-145   
ref|XP_003600323.1|  Cytochrome P450                                    439   6e-145   
gb|ABC41927.1|  amorpha-4,11-diene monooxygenase                        438   7e-145   Artemisia annua [sweet Annie]
ref|XP_003636936.1|  Cytochrome P450                                    438   7e-145   
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like              439   8e-145   
ref|XP_003617703.1|  Cytochrome P450                                    447   8e-145   
sp|Q1PS23.1|AMO_ARTAN  RecName: Full=Amorpha-4,11-diene 12-monoox...    438   1e-144   
gb|AFO64615.1|  cytochrome P450 mono-oxygenase                          438   1e-144   
gb|ABE57266.1|  amorpha-4,11-diene monooxygenase                        438   1e-144   
gb|AFP19100.1|  amorphadiene oxidase                                    437   1e-144   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              438   2e-144   
ref|XP_007020549.1|  Cytochrome P450                                    438   2e-144   
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              438   2e-144   
ref|XP_003600339.1|  Cytochrome P450                                    437   3e-144   
gb|AEX07771.1|  cytochrome P450                                         437   5e-144   
ref|XP_003617706.1|  Cytochrome P450 71D10                              436   5e-144   
ref|XP_007212707.1|  hypothetical protein PRUPE_ppa018666mg             436   5e-144   
ref|XP_006346274.1|  PREDICTED: premnaspirodiene oxygenase-like         437   6e-144   
dbj|BAM68819.1|  putative cytochrome P450 monooxygenase CYP71AV1        436   6e-144   
dbj|BAM68818.1|  putative cytochrome P450 monooxygenase CYP71AV1        436   6e-144   
gb|ABG49365.1|  P450 monooxygenase                                      436   6e-144   
gb|KEH34016.1|  cytochrome P450 family 71 protein                       435   7e-144   
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                     436   1e-143   
gb|EYU27425.1|  hypothetical protein MIMGU_mgv1a024069mg                436   1e-143   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              436   1e-143   
gb|ABI31728.1|  amorpha-4,11-diene C-12 oxidase                         435   1e-143   
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313        436   1e-143   
gb|ADU25498.1|  cytochrome P450 monooxygenase                           435   2e-143   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             435   2e-143   
gb|ACF74516.1|  amorpha-4,11-diene monooxygenase                        435   2e-143   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               435   3e-143   
gb|KHG02344.1|  Cytochrome P450                                         435   3e-143   
ref|XP_003636315.1|  Cytochrome P450                                    435   3e-143   
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    433   6e-143   
ref|XP_002513339.1|  cytochrome P450, putative                          433   8e-143   
gb|AES70585.2|  cytochrome P450 family 71 protein                       437   9e-143   
dbj|BAM68820.1|  putative cytochrome P450 monooxygenase CYP71AV11v1     432   2e-142   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       433   2e-142   
ref|XP_004247351.1|  PREDICTED: premnaspirodiene oxygenase-like         432   2e-142   
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         432   2e-142   
gb|AGO03790.1|  costunolide                                             432   2e-142   
gb|AED99876.1|  cytochrome P450                                         432   3e-142   
gb|KHG00772.1|  Cytochrome P450                                         432   3e-142   
gb|AIS36971.1|  (-)-limonene 3-hydroxylase-like cytochrome p450-d...    432   3e-142   
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                433   3e-142   
gb|AED99873.1|  cytochrome P450                                         432   3e-142   
gb|KDP39255.1|  hypothetical protein JCGZ_01012                         432   4e-142   
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         432   4e-142   
sp|Q9XHE7.1|C71DD_MENPI  RecName: Full=Cytochrome P450 71D13; Alt...    431   5e-142   
ref|XP_009606841.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    427   5e-142   
emb|CDP10756.1|  unnamed protein product                                431   6e-142   
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like               431   6e-142   
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    431   7e-142   
ref|XP_003600319.1|  Cytochrome P450                                    431   7e-142   
gb|KEH19671.1|  cytochrome P450 family 71 protein                       431   7e-142   
gb|KEH16965.1|  cytochrome P450 family 71 protein                       431   9e-142   
dbj|BAM68813.1|  cytochrome P450 monooxygenase CYP71AV11                431   1e-141   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         429   1e-141   
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         431   1e-141   
ref|XP_007156884.1|  hypothetical protein PHAVU_002G025300g             431   1e-141   
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2     430   2e-141   
ref|XP_010027347.1|  PREDICTED: premnaspirodiene oxygenase-like         431   2e-141   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         430   2e-141   
ref|XP_003617701.1|  Cytochrome P450                                    431   2e-141   
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg             430   2e-141   
gb|KEH26493.1|  cytochrome P450 family 71 protein                       430   2e-141   
ref|XP_004491658.1|  PREDICTED: uncharacterized protein LOC101503808    446   2e-141   
gb|AHN62856.1|  costunolide synthase                                    429   3e-141   
gb|KHN12340.1|  Cytochrome P450 71D10                                   429   3e-141   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             429   3e-141   
dbj|BAM68814.1|  putative cytochrome P450 monooxygenase CYP71AV11       429   3e-141   
gb|KCW62217.1|  hypothetical protein EUGRSUZ_H04878                     430   3e-141   
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             429   3e-141   
ref|XP_003617715.1|  Cytochrome P450                                    429   3e-141   
ref|XP_008779150.1|  PREDICTED: premnaspirodiene oxygenase-like         429   4e-141   
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like              429   4e-141   
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like               429   5e-141   
ref|XP_003532742.2|  PREDICTED: cytochrome P450 71D10                   429   5e-141   
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like              429   5e-141   
ref|XP_003600328.1|  Cytochrome P450                                    429   6e-141   
gb|AIM47558.1|  CYP726A4                                                428   8e-141   
ref|XP_007020556.1|  Cytochrome P450 71D10, putative                    428   1e-140   
gb|KEH29697.1|  cytochrome P450 family 71 protein                       428   1e-140   
gb|KHM99028.1|  Cytochrome P450 71D11                                   428   1e-140   
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         428   1e-140   
gb|KHN08403.1|  Cytochrome P450 71D8                                    425   2e-140   
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              428   2e-140   
gb|KHG19246.1|  Cytochrome P450                                         427   2e-140   
gb|KCW62216.1|  hypothetical protein EUGRSUZ_H04877                     427   2e-140   
emb|CDP21437.1|  unnamed protein product                                427   2e-140   
ref|XP_007148448.1|  hypothetical protein PHAVU_006G209700g             427   2e-140   
emb|CDP10758.1|  unnamed protein product                                427   2e-140   
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             426   3e-140   
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g             427   3e-140   
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g             427   4e-140   
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      426   6e-140   
ref|XP_009595834.1|  PREDICTED: premnaspirodiene oxygenase-like i...    426   6e-140   
ref|XP_008219722.1|  PREDICTED: premnaspirodiene oxygenase-like         426   6e-140   
ref|XP_007156883.1|  hypothetical protein PHAVU_002G025200g             426   7e-140   
gb|KDO38617.1|  hypothetical protein CISIN_1g045050mg                   426   8e-140   
ref|XP_010027348.1|  PREDICTED: cytochrome P450 CYP71D312-like          426   9e-140   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               425   1e-139   
ref|XP_002523467.1|  cytochrome P450, putative                          426   1e-139   
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...    425   1e-139   
ref|NP_001236165.1|  cytochrome P450 71D10                              426   1e-139   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             426   1e-139   
ref|XP_004304108.1|  PREDICTED: cytochrome P450 71D11-like              426   1e-139   
ref|XP_008778500.1|  PREDICTED: premnaspirodiene oxygenase-like         425   1e-139   
gb|ADD84654.1|  CYP71D175                                               426   2e-139   
gb|AIA09038.1|  costunolide synthase                                    424   2e-139   
ref|XP_002514827.1|  cytochrome P450, putative                          426   2e-139   
ref|XP_006377819.1|  hypothetical protein POPTR_0011s13430g             425   2e-139   
gb|AIA09039.1|  costunolide synthase                                    424   2e-139   
ref|XP_009609720.1|  PREDICTED: premnaspirodiene oxygenase              420   2e-139   
gb|ABO32530.1|  cytochrome P450-dependent monooxygenase-like protein    425   2e-139   
ref|XP_007142403.1|  hypothetical protein PHAVU_008G277500g             424   2e-139   
ref|XP_004288803.1|  PREDICTED: cytochrome P450 71D11-like              424   3e-139   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               424   4e-139   
ref|XP_010910607.1|  PREDICTED: premnaspirodiene oxygenase-like         424   4e-139   
ref|XP_006452552.1|  hypothetical protein CICLE_v10010406mg             423   5e-139   
ref|XP_004506685.1|  PREDICTED: cytochrome P450 71D10-like              424   5e-139   
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              424   5e-139   
ref|XP_003600322.1|  Cytochrome P450                                    423   6e-139   
gb|KHN01537.1|  Cytochrome P450 71D11                                   424   6e-139   
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   422   7e-139   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               423   8e-139   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like         423   1e-138   
ref|XP_003600334.1|  Cytochrome P450                                    426   1e-138   
gb|KEH15784.1|  cytochrome P450 family 71 protein                       422   2e-138   
ref|XP_003600330.1|  Cytochrome P450                                    422   2e-138   
sp|Q6WKZ1.1|C71DI_MENGR  RecName: Full=Cytochrome P450 71D18; Alt...    422   2e-138   
gb|ADC94830.1|  (-)-limonene-7-hydroxylase                              421   2e-138   
gb|ABQ24001.1|  limonene hydroxylase                                    422   3e-138   
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         422   3e-138   
ref|XP_006596106.1|  PREDICTED: cytochrome P450 71D11-like              422   4e-138   
emb|CDP07893.1|  unnamed protein product                                421   6e-138   
ref|XP_002513333.1|  cytochrome P450, putative                          421   7e-138   
emb|CDP17724.1|  unnamed protein product                                421   7e-138   
ref|XP_011095806.1|  PREDICTED: cytochrome P450 71D10-like              421   9e-138   
gb|KDP42346.1|  hypothetical protein JCGZ_02819                         425   9e-138   
ref|XP_008777955.1|  PREDICTED: premnaspirodiene oxygenase-like         420   1e-137   
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         421   1e-137   
gb|EYU21982.1|  hypothetical protein MIMGU_mgv1a026917mg                420   1e-137   
ref|XP_002532304.1|  cytochrome P450, putative                          420   1e-137   
dbj|BAO45903.1|  cytochrome P450 71D10                                  420   2e-137   
ref|XP_006590052.1|  PREDICTED: cytochrome P450 71D8-like               419   2e-137   
gb|KEH34025.1|  cytochrome P450 family 71 protein                       419   3e-137   
sp|O22307.1|C71DB_LOTJA  RecName: Full=Cytochrome P450 71D11            419   3e-137   
ref|XP_008779112.1|  PREDICTED: premnaspirodiene oxygenase-like         419   3e-137   
gb|KDP45511.1|  hypothetical protein JCGZ_17064                         419   3e-137   
ref|XP_007099625.1|  Cytochrome P450 71D10, putative                    424   4e-137   
gb|KHN37234.1|  Cytochrome P450 71D11                                   419   4e-137   
ref|XP_009780363.1|  PREDICTED: premnaspirodiene oxygenase-like         419   4e-137   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         417   7e-137   
ref|XP_009595835.1|  PREDICTED: premnaspirodiene oxygenase-like i...    418   7e-137   
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g             418   7e-137   
gb|AES59944.2|  cytochrome P450 family 71 protein                       417   9e-137   
gb|KHM99475.1|  Cytochrome P450 71D9                                    417   1e-136   
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         418   1e-136   
ref|XP_003589693.1|  Cytochrome P450                                    417   1e-136   
gb|KDP36253.1|  hypothetical protein JCGZ_09818                         417   1e-136   
ref|XP_010910161.1|  PREDICTED: premnaspirodiene oxygenase-like         417   2e-136   
gb|AGB55874.1|  flavonoid 6-hydroxylase 3                               416   2e-136   
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like         417   3e-136   
gb|AHB62239.1|  cytochrome P450                                         416   3e-136   
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                   417   3e-136   
ref|XP_002513335.1|  cytochrome P450, putative                          417   4e-136   
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         417   5e-136   
ref|XP_004506712.1|  PREDICTED: cytochrome P450 71D10-like              416   5e-136   
ref|XP_002513342.1|  cytochrome P450, putative                          417   6e-136   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             415   6e-136   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             416   6e-136   
gb|KCW76712.1|  hypothetical protein EUGRSUZ_D01067                     415   8e-136   
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         416   8e-136   
ref|XP_010104090.1|  Cytochrome P450 71D10                              416   9e-136   
ref|XP_008370832.1|  PREDICTED: premnaspirodiene oxygenase-like         414   1e-135   
gb|KDP23156.1|  hypothetical protein JCGZ_00355                         412   1e-135   
ref|XP_003615863.1|  Cytochrome P450                                    415   1e-135   
gb|KEH25844.1|  cytochrome P450 family 71 protein                       414   2e-135   
ref|XP_003555570.2|  PREDICTED: cytochrome P450 71D11-like              416   2e-135   
gb|AHK60840.1|  CYP71BT1                                                415   2e-135   
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg             415   2e-135   
gb|KHN43612.1|  Cytochrome P450 71D9                                    414   2e-135   
ref|XP_007153133.1|  hypothetical protein PHAVU_003G009500g             414   3e-135   
ref|XP_008231957.1|  PREDICTED: cytochrome P450 CYP71D312-like          419   4e-135   
ref|XP_003600327.1|  Cytochrome P450                                    413   5e-135   
ref|XP_011047545.1|  PREDICTED: cytochrome P450 71D11-like isofor...    414   5e-135   
gb|AGB55871.1|  flavonoid 6-hydroxylase 2                               413   5e-135   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             414   6e-135   
gb|KHN03535.1|  Cytochrome P450 71D8                                    411   6e-135   
ref|XP_003551489.1|  PREDICTED: cytochrome P450 71D9-like               413   6e-135   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like              414   8e-135   
ref|XP_002310634.2|  hypothetical protein POPTR_0007s07300g             413   8e-135   
gb|KCW62218.1|  hypothetical protein EUGRSUZ_H04879                     412   8e-135   
gb|KHN27239.1|  Cytochrome P450 71D11                                   411   1e-134   
gb|EYU32748.1|  hypothetical protein MIMGU_mgv1a004746mg                413   1e-134   
emb|CDP20311.1|  unnamed protein product                                417   1e-134   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg                412   2e-134   
ref|XP_011014080.1|  PREDICTED: cytochrome P450 71D11-like              412   3e-134   
gb|AAO32823.1|  cytochrome P450 71D2                                    409   4e-134   
gb|AJD25165.1|  cytochrome P450 CYP71D412                               411   4e-134   
gb|KHM99472.1|  Cytochrome P450 71D11                                   411   5e-134   
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         409   5e-134   
gb|ADA70805.1|  cytochrome P450 CYP71D176                               411   5e-134   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               411   6e-134   
ref|XP_010932987.1|  PREDICTED: premnaspirodiene oxygenase-like         410   9e-134   
ref|XP_011038767.1|  PREDICTED: cytochrome P450 71D11-like              410   9e-134   
gb|KHG00691.1|  Cytochrome P450                                         408   1e-133   
ref|XP_009385309.1|  PREDICTED: premnaspirodiene oxygenase-like         410   1e-133   
ref|XP_004491491.1|  PREDICTED: premnaspirodiene oxygenase-like         410   1e-133   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             410   1e-133   
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             410   1e-133   
ref|XP_010067806.1|  PREDICTED: premnaspirodiene oxygenase-like         409   1e-133   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               410   2e-133   
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         410   2e-133   
ref|XP_009385126.1|  PREDICTED: premnaspirodiene oxygenase-like         409   2e-133   
gb|KCW66019.1|  hypothetical protein EUGRSUZ_G03311                     409   2e-133   
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like              409   3e-133   
gb|AGN04218.1|  cytochrome P450                                         409   3e-133   
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...    409   4e-133   
gb|KHM99473.1|  Cytochrome P450 71D11                                   407   5e-133   
ref|XP_007146604.1|  hypothetical protein PHAVU_006G054100g             409   5e-133   
emb|CDP10755.1|  unnamed protein product                                405   6e-133   
gb|AIS36970.1|  (-)-limonene 6-hydroxylase-like cytochrome p450-d...    408   6e-133   



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/472 (61%), Positives = 362/472 (77%), Gaps = 11/472 (2%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP KLP++G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SPDMAKE L+THD+AFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ E+L+ 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFSSIR DE+ RL+  VRSS   P N +ER+FLFTSS+ CR+AFG+VF  +E FIQ
Sbjct  140   KNVRSFSSIRRDEVLRLVNFVRSSTSEPVNFTERLFLFTSSMTCRSAFGKVFKEQETFIQ  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K++  L G FD AD+FPS K LH L G + +I+K H K D+I+E +IN+H+  L  G 
Sbjct  200   LIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMGK  259

Query  806   ------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                   GED +IDVLL+LM+ G LQ PIT+DNIKAII DMF AG+ETS++T +WAM +MM
Sbjct  260   TNGALGGED-LIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             +NP +LAKAQAEVRE FKGKE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET
Sbjct  319   RNPTILAKAQAEVREAFKGKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              IN GYTIPVKTKVMVN +AL  DP+YW++ + F PERFE   VDF G++F+Y+PFG GR
Sbjct  379   EIN-GYTIPVKTKVMVNVWALGRDPKYWDDADNFKPERFEQCSVDFIGNNFEYLPFGGGR  437

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RICPG++FG AN   PLA LLY+FDWKLP G+  + LD+TE++G+  ARK+D
Sbjct  438   RICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSD  489



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/472 (60%), Positives = 363/472 (77%), Gaps = 11/472 (2%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP KLP++G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SPDMAKE L+THD+AFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ ELL+ 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRS+ SIR DE+ RL+  +RSS+G P N +ER+FLFTSS+ CR+AFG+VF  +++FIQ
Sbjct  140   KNVRSYGSIRRDEVDRLVNFIRSSSGEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQ  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K++  L G FD AD+FPS K LH L G K +I+  H K D+I+E +IN+H+ K   G 
Sbjct  200   LIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVEDVINEHKKKFAIGK  259

Query  806   ------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                   GED +IDVL++LM+ G LQ PIT+DNIKAII DMF AG+ETS++T +WAM +MM
Sbjct  260   TNGALGGED-LIDVLIRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             KNP V+AKAQAEVRE FK KE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET
Sbjct  319   KNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              IN GYTIPVKTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+Y+PFG GR
Sbjct  379   DIN-GYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGGGR  437

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RICPG++FG AN   PLAHLLY+FDWKLP G+  + L++TE++G+  ARK+D
Sbjct  438   RICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDD  489



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/472 (60%), Positives = 361/472 (76%), Gaps = 11/472 (2%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP KLP++G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SPDMAKE L+THD+AFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ E+L+ 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFSSIR DE+ RL+  VRS   +P N +ER+FLFTSS+ CR+AFG+VF  +E FIQ
Sbjct  140   KNVRSFSSIRRDEVLRLVNFVRSCTSKPVNFTERLFLFTSSMTCRSAFGKVFKEQETFIQ  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K++  L G FD AD+FPS K LH L G + +I+K H K D+I+E +IN+H+  L  G 
Sbjct  200   LIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMGK  259

Query  806   ------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                   GED +IDVLL+LM+ G LQ PIT++NIKAII DMF AG+ETS++T +WAM +MM
Sbjct  260   TNGALGGED-LIDVLLRLMNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             +NP +LAKAQ EVRE FKGKE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET
Sbjct  319   RNPTILAKAQEEVREAFKGKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              I+ GYTIPVKTKVMVN +AL  DP+YWE+ + F PERFE   VDF G++F+Y+PFG GR
Sbjct  379   EID-GYTIPVKTKVMVNVWALGRDPKYWEDADDFKPERFEQCSVDFIGNNFEYLPFGGGR  437

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RICPG++FG AN   PLA LLY+FDWKLP G+  + LD+TE++G+  ARK+D
Sbjct  438   RICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSD  489



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/472 (60%), Positives = 362/472 (77%), Gaps = 11/472 (2%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP KLP++G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SPDMAKE L+THD+AFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ ELL+ 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRS+ SIR DE+ RL+  +RSS+G P N +ER+FLFTSS+ CR+AFG+VF  +++FIQ
Sbjct  140   KNVRSYGSIRRDEVDRLVNFIRSSSGEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQ  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K++  L G FD AD+FPS K LH L G K +I+  H K D+I+E +IN+H+  +  G 
Sbjct  200   LIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHDKVDAIVEDVINEHKKNIAMGK  259

Query  806   ------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                   GED +IDVL++LM+ G LQ PIT++NIKAII DMF AG+ETS++T +WAM +MM
Sbjct  260   TNGALGGED-LIDVLIRLMNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             KNP V AKAQAEVRE FK KE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET
Sbjct  319   KNPSVFAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              IN  YTIPVKTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+Y+PFG+GR
Sbjct  379   DIN-SYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGSGR  437

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RICPG++FG AN   PLAHLLY+FDWKLP G+  + L++TE++G+  ARK+D
Sbjct  438   RICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDD  489



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/474 (59%), Positives = 362/474 (76%), Gaps = 13/474 (3%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP KLP++G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SPDMAKE L+THD+AFA+R + LA  I+ Y+ SDI   PYGDYWRQMRKIC+ ELL+ 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAG--RPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + VRS+SSIR DE+ RL+  +RSS+    P N +ER+FLFTSS+ CR+AFG+VF  +++F
Sbjct  140   KNVRSYSSIRRDEVDRLVNFIRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKEQDKF  199

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
             IQ  K++  L G FD AD+FPS K LH L G K +I+  H K D+I+E +IN+H+  +  
Sbjct  200   IQLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIVNAHHKVDAIVEDVINEHKKNIAM  259

Query  812   GT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       GED +IDVLL+LM+ G LQ PIT+DNIKAII DMF AG+ETS++T +WAM +
Sbjct  260   GKTNGALGGED-LIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQ  318

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             +MKNP V AKAQAEVRE FK +E  +E+DVE+L YLK V+KETLR HPP PL+  RECRE
Sbjct  319   LMKNPSVFAKAQAEVREAFKDRETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  378

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             ET IN GYT+PVKTKVMVN +AL  DP+YW++ E F PERFE + VDF G++F+Y+PFG 
Sbjct  379   ETDIN-GYTVPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQSSVDFIGNNFEYLPFGG  437

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG++FG AN   PLA LLY+FDWKLP G+  + L++TE++G+  ARK+D
Sbjct  438   GRRICPGISFGLANVYLPLAQLLYHFDWKLPNGMEPKDLNLTELVGVTAARKDD  491



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/472 (59%), Positives = 357/472 (76%), Gaps = 11/472 (2%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP KLP++G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SPDMAKE L+THD+AFA+R + LA  I+ YN SDI   PYGDYWRQM KIC+ ELL+ 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRS+ SIR DE+ RL+  +RSS+G P N  ER+FLFTSS+ CR+AFG+VF  +++FIQ
Sbjct  140   KNVRSYGSIRRDEVDRLVNLIRSSSGEPVNFIERLFLFTSSMTCRSAFGKVFKEQDKFIQ  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K++  L G FD AD+FPS K LH L G K +I+  H K D+I+E +IN+H+  +  G 
Sbjct  200   LIKEVIGLAGGFDVADLFPSLKLLHVLSGMKGKIMNAHHKIDAIVEDVINEHKKNIAMGK  259

Query  806   ------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                   GED +IDVL++LM+ G LQ PIT+ NIKAII DMF A +ETS++T  WAM +MM
Sbjct  260   TNGALGGED-LIDVLIRLMNDGGLQFPITNVNIKAIIFDMFAAETETSSSTLDWAMVQMM  318

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             KNP V+AKAQAEVRE FK KE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET
Sbjct  319   KNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              IN GYTIPVKTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+Y+PFG GR
Sbjct  379   DIN-GYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFIGNNFEYLPFGGGR  437

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RICPG++FG AN   PLA LLY+FDWKLP G+  + L++TE++G+  ARK+D
Sbjct  438   RICPGISFGLANVYLPLAQLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDD  489



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/471 (61%), Positives = 361/471 (77%), Gaps = 11/471 (2%)
 Frame = -2

Query  1517  WKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVV  1344
             WK    +  K+PPGP KLPI+G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVVV
Sbjct  34    WKNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVV  92

Query  1343  SSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPR  1164
             +SPD AKE L+THD+AFA+R   LA  I+ YN SD+   PYGDYWRQMRKIC+ E+L+ +
Sbjct  93    TSPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAK  152

Query  1163  LVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
              VR+FSSIR +E+ RL+  +RSS+G P NV+ERIFLFTSS+ CR+AFG+VF  +++FIQ 
Sbjct  153   NVRTFSSIRRNEVLRLINFIRSSSGEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQL  212

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-  807
              K++ +L G FD AD+FPS K LH L G K +I+  H K D+I+E++IN+H+  L  G  
Sbjct  213   IKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKT  272

Query  806   -----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                  GED +IDVLL+LM+ G LQ PIT+DNIKAII DMF AG+ETS++T +WAM EM+K
Sbjct  273   NGALGGED-LIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMVK  331

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NP V AKAQAEVRE F+GKE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET 
Sbjct  332   NPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREETN  391

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             IN GYTIPVKTKVMVN +AL  DP+YW + E F+PERFE    DF G++F+Y+PFG GRR
Sbjct  392   IN-GYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGGRR  450

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE++G+  ARK+D
Sbjct  451   ICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSD  501



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/471 (61%), Positives = 361/471 (77%), Gaps = 11/471 (2%)
 Frame = -2

Query  1517  WKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVV  1344
             WK    +  K+PPGP KLPI+G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVVV
Sbjct  34    WKNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVV  92

Query  1343  SSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPR  1164
             +SPD AKE L+THD+AFA+R   LA  I+ YN SD+   PYGDYWRQMRKIC+ E+L+ +
Sbjct  93    TSPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAK  152

Query  1163  LVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
              VR+FSSIR +E+ RL+  +RSS+G P NV+ERIFLFTSS+ CR+AFG+VF  +++FIQ 
Sbjct  153   NVRTFSSIRRNEVLRLINFIRSSSGEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQL  212

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-  807
              K++ +L G FD AD+FPS K LH L G K +I+  H K D+I+E++IN+H+  L  G  
Sbjct  213   IKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKT  272

Query  806   -----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                  GED +IDVLL+LM+ G LQ PIT+DNIKAII DMF AG+ETS++T +WAM EM+K
Sbjct  273   NGALGGED-LIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMVK  331

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NP V AKAQAEVRE F+GKE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET 
Sbjct  332   NPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREETN  391

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             IN GYTIPVKTKVMVN +AL  DP+YW + E F+PERFE    DF G++F+Y+PFG GRR
Sbjct  392   IN-GYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGGRR  450

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE++G+  ARK+D
Sbjct  451   ICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSD  501



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 359/484 (74%), Gaps = 7/484 (1%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKK---QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLA  1401
             N+ S  +FVSFL L+   WK    Q R K+PPGP KLP++GN+ H+ G   PHR LRDLA
Sbjct  5     NIFSLFIFVSFLFLLIKYWKNSNDQIRKKLPPGPWKLPLLGNIFHLLGGP-PHRVLRDLA  63

Query  1400  RKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPY  1221
             +KYG +M LQ+GE+S VVV+SPDMAK+ L+THD+AFA+R   +A  I+ YN SDIV  PY
Sbjct  64    KKYGSIMHLQLGEVSLVVVTSPDMAKQVLKTHDIAFASRPMLIAAEIVCYNGSDIVFSPY  123

Query  1220  GDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSI  1041
             GDYWRQMRKICI ELL+ + V+SFSSIR DE+ R++   RSS+G   N + RIF F SS+
Sbjct  124   GDYWRQMRKICIMELLSAKNVKSFSSIRQDEVLRMIEFFRSSSGETVNATRRIFQFASSM  183

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
              CR+AFG+VF  +++ IQ  K +S LT  FD AD+FPS K LH L G KS+I+  H + D
Sbjct  184   TCRSAFGKVFKEQDELIQLVKKVSRLTEGFDVADIFPSLKFLHVLCGMKSKIMDVHHELD  243

Query  860   SIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETS  681
             +I+E+IIN+H+N  E G GE  ++  LL+LM  G LQ PIT+DNIKAII D+F AG+ETS
Sbjct  244   AILENIINEHKNNGELG-GEG-LVSTLLRLMKEGGLQFPITNDNIKAIIFDIFAAGTETS  301

Query  680   TTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPT  501
             + T  W M EMM+NP VL+KAQ EVR  FKGKE  +E+DVE+L YLK VVKE+ R HPP 
Sbjct  302   SATIDWIMVEMMRNPNVLSKAQEEVRNAFKGKETFDENDVEELKYLKLVVKESFRLHPPF  361

Query  500   PLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNG  321
             PL+  RECREE  IN GYTIP+KTKVMVNA+A+  DP+YW++ E F PERFEDN +DF G
Sbjct  362   PLLLPRECREEVEIN-GYTIPLKTKVMVNAWAIGRDPKYWDDAESFKPERFEDNSMDFIG  420

Query  320   SHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVA  141
             ++F+Y+PFG+GRR CPG++FG AN   PLA LLY+FDWKLP G+ +  LD+TE  G   A
Sbjct  421   NNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPNGINSSELDLTESAGSTCA  480

Query  140   RKND  129
             RKN+
Sbjct  481   RKNN  484



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 360/471 (76%), Gaps = 11/471 (2%)
 Frame = -2

Query  1517  WKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVV  1344
             WK    +  K+PPGP KLPI+G++LH+ G  LPH  LRDLA+KYG LM LQ+GE+SAVVV
Sbjct  34    WKNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVV  92

Query  1343  SSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPR  1164
             +SPD AKE L+THD+AFA+R   LA  I+ YN SD+   PYGDYWRQMRKIC+ E+L+ +
Sbjct  93    TSPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAK  152

Query  1163  LVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
              VR+FSSIR +E+ RL+  +RSS+G P NV+ERIFLFTSS+ CR+AFG+VF  +++FIQ 
Sbjct  153   NVRTFSSIRRNEVLRLINFIRSSSGEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQL  212

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-  807
              K++ +L G FD AD+FPS K LH L G K +I+  H K D+I+E++IN+H+  L  G  
Sbjct  213   IKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKT  272

Query  806   -----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                  GED +IDV L+LM+ G LQ PIT+DNIKAII DMF AG+ETS++T +WAM EM+K
Sbjct  273   NGALGGED-LIDVPLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMVK  331

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NP V AKAQAEVRE F+GKE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET 
Sbjct  332   NPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREETN  391

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             IN GYTIPVKTKVMVN +AL  DP+YW + E F+PERFE    DF G++F+Y+PFG GRR
Sbjct  392   IN-GYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGGRR  450

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE++G+  ARK+D
Sbjct  451   ICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSD  501



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 350/475 (74%), Gaps = 13/475 (3%)
 Frame = -2

Query  1520  QWKK----QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             +WKK     +  K+PPGP KLP IG++ H+ G  LPHR LRDLA KYG LM LQ+GE+SA
Sbjct  18    KWKKYLNNSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSA  76

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVV+SP+MAK+ L+THD+AFA+R + LA  I+ YN  DI   PYG+YWRQMRKICI E+L
Sbjct  77    VVVTSPEMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGEYWRQMRKICIMEVL  136

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRS--SAGRPFNVSERIFLFTSSIICRAAFGEVFDGRE  999
             + + VRSFSSIRHDE+ RL+  ++   ++G   N +ERI  FTSS+ CR+AFG+V   +E
Sbjct  137   SAKNVRSFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQE  196

Query  998   QFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL  819
              FI+  +++  L   FD AD+FPS+K LH   G K ++L  HRK DSI+E +I +H+  +
Sbjct  197   VFIKLIREVISLAEGFDVADIFPSYKFLHGFGGAKKKLLNAHRKVDSIVEDVIKEHKKNI  256

Query  818   ESGTGEDCI-----IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
              +   +D I     +DVLL+LM+  +LQ PI +DNIKA+IID+F AG+ETS+TT++WAM+
Sbjct  257   ATRKSDDAIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMA  316

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EM+KNP V AKAQAEVRE F+ K   + +DVE+L YLK V+KET+R H P PL+  RECR
Sbjct  317   EMLKNPSVFAKAQAEVREAFRDKVTFDGNDVEELKYLKLVIKETMRLHAPVPLLVPRECR  376

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             EET IN GYTIPVKTKVMVN +AL  DP+YW++ E F PERFE   +DF G++F+Y+PFG
Sbjct  377   EETEIN-GYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFG  435

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              GRRICPG++FG AN   PLA LLY+FDWKLP G+  + LD+TE  G+ VARK D
Sbjct  436   GGRRICPGISFGLANVYFPLAQLLYHFDWKLPTGMEPKDLDLTESAGITVARKGD  490



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/475 (56%), Positives = 348/475 (73%), Gaps = 13/475 (3%)
 Frame = -2

Query  1520  QWKK----QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             +WKK     +  K+PPGP KLP IG + H+ G  LPHR LRDLA KYG LM LQ+GE+SA
Sbjct  18    KWKKYLNNSQTKKLPPGPWKLPFIGGMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSA  76

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVV+SP+MAK+ L+THD+AFA+R + LA  I+ YN  DI   PYGDYWRQMRKICI E+L
Sbjct  77    VVVTSPEMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVL  136

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRS--SAGRPFNVSERIFLFTSSIICRAAFGEVFDGRE  999
             + + VRSFSSIRHDE+ RL+  ++   ++G   N +ERI  FTSS+ CR+AFG+V   +E
Sbjct  137   SAKSVRSFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQE  196

Query  998   QFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL  819
              FI+  +++  L   FD AD+FPS+K LH   G K ++L  HRK DSI+E +I +H+  L
Sbjct  197   VFIKLIREVISLAEGFDVADIFPSYKFLHGFGGAKQKLLNAHRKVDSIVEDVIKEHKKNL  256

Query  818   ESGTGEDCI-----IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
              +   +D I     +D L++LM+  +LQ PI +DNIKA+IID+F AG+ETS+TT++WAM+
Sbjct  257   ATRKSDDAIGGEDLVDALVRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMA  316

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EM+KNP V AKAQA+VRE F+ K   +E+DVE+L YLK V+KET+R H P PL+  RECR
Sbjct  317   EMLKNPSVFAKAQAKVREAFRDKVTFDENDVEELKYLKLVIKETMRLHAPVPLLVPRECR  376

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             EET IN GYTIPVKTKVMVN +AL  DP+YW++ E F PERFE   +DF G++F+Y+PFG
Sbjct  377   EETEIN-GYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFG  435

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              GRRICPG++FG AN   PLA LLY+FDWKLP G+  + LD+TE  G+  ARK D
Sbjct  436   GGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTESAGITAARKGD  490



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 367/491 (75%), Gaps = 14/491 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S + LV+ +WK  R+  +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIFLVFKKWK-TRKLNLPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+G+I  +V+SSP MAKE L+THDLAFATR + +   I+ Y+++DI   PYG
Sbjct  65    RYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++++ +R++   P N++++IF FTSS+I
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIRTTPNLPVNLTDKIFWFTSSVI  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  L G F  AD FP+WK +H + G+KS+++K HRK D 
Sbjct  185   CRSALGKICGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+E+++N+H+     G        GED +IDVLL++ +SG +Q+PIT DNIK+I+IDMF 
Sbjct  245   ILENVVNEHKQNRADGKKGNGEFGGED-LIDVLLRVRESGEVQIPITDDNIKSILIDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEM-LEESDVEQLPYLKTVVKET  522
             AGSETS+TT +WA++EMMK P VLAKAQAEVR+  KGK++  +E D+++L YLK V+KET
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKGKKISFQEIDIDKLKYLKLVIKET  363

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DPQ W++PE F PERFE+
Sbjct  364   LRMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPERFEN  422

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             N +DF G+H Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G + E  DMTE
Sbjct  423   NSIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTE  482

Query  161   MLGLAVARKND  129
               G++  RK+D
Sbjct  483   SPGISATRKDD  493



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 367/491 (75%), Gaps = 14/491 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S + LV+ +WK  R+  +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIFLVFKKWK-TRKLNLPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+G+I  +V+SSP MAKE L+THDLAFATR + +   I+ Y+++DI L PYG
Sbjct  65    RYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDSTDIALSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++++ +R++   P N++++IF FTSS+I
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIRTTPNLPVNLTDKIFWFTSSVI  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  L G F  AD FP+WK +H + G+KS+++K HRK D 
Sbjct  185   CRSALGKICGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+E+++N+H+     G        GED +IDVLL++ +SG +Q+PIT DNIK+I+IDMF 
Sbjct  245   ILENVVNEHKQNRADGKKGNGEFGGED-LIDVLLRVRESGEVQIPITDDNIKSILIDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEM-LEESDVEQLPYLKTVVKET  522
             AGSETS+TT +WA++EMMK P VLAKAQAEV +  KGK++  +E D+++L YLK V+KET
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVSQALKGKKISFQEIDIDKLKYLKLVIKET  363

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DPQ W++PE F PERFE+
Sbjct  364   LRMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPERFEN  422

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             N +DF G+H Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G T +  DMTE
Sbjct  423   NSIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQTHQNFDMTE  482

Query  161   MLGLAVARKND  129
               G++  RK+D
Sbjct  483   SPGISATRKDD  493



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/491 (53%), Positives = 367/491 (75%), Gaps = 14/491 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S + LV+ +WK  R+  +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIFLVFKKWK-TRKLNLPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+G+I  +V+SSP MAKE L+THDLAFATR + +   I+ Y+++DI   PYG
Sbjct  65    RYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++++ +R++   P N++++IF FTSS+I
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSYIRTTPNLPVNLTDKIFWFTSSVI  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  L G F  AD FP+WK +H + G+KS+++K HRK D 
Sbjct  185   CRSALGKICGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+E+++N+H+     G        GED +IDVLL++ +SG +Q+PIT DNIK+I+IDMF 
Sbjct  245   ILENVVNEHKQNRADGKKGNGEFGGED-LIDVLLRVRESGEIQIPITDDNIKSILIDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEM-LEESDVEQLPYLKTVVKET  522
             AGSETS+TT +WA++EMMK P VLAKAQAEVR+  KGK++  +E D+++L YLK V+KET
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKGKKISFQEIDIDKLKYLKLVIKET  363

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DPQ W++PE F PERFE+
Sbjct  364   LRMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPERFEN  422

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             N +DF G+H Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G T +  DMTE
Sbjct  423   NSIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQTHQNFDMTE  482

Query  161   MLGLAVARKND  129
               G++  RK+D
Sbjct  483   SPGISATRKDD  493



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/474 (57%), Positives = 349/474 (74%), Gaps = 11/474 (2%)
 Frame = -2

Query  1520  QWKKQRR--GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WKK R    K+PPGP KLP +G+L H+    LPH AL  L +KYG LM LQ+GEIS VV
Sbjct  52    EWKKSRNLNKKLPPGPWKLPFLGSLHHLAIGGLPHHALTKLGKKYGPLMHLQLGEISTVV  111

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             VSS DMA+E L+THDLAFA+R +  +  I+ Y ++DIV  PYG+YWRQMRK+C+ ELL  
Sbjct  112   VSSMDMAREVLKTHDLAFASRPKLASIDIICYKSTDIVFSPYGEYWRQMRKVCVMELLTA  171

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSA-GRPFNVSERIFLFTSSIICRAAFG-EVFDGREQF  993
             + VRSFSSI HDE  RL+  ++SS  G P N++ERI  +TSSI C+ AFG ++   +E+F
Sbjct  172   KNVRSFSSILHDEASRLVQFIQSSTHGEPINITERILWYTSSITCKTAFGDQLLKDQEKF  231

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
             IQ  K +  L   F  AD+FPS K L  L G +S ILK H+  D+I+E +IN+H+  L S
Sbjct  232   IQMVKKLVELASGFSLADIFPSIKILGVLTGARSRILKVHKNVDAIVEDVINEHKKNLAS  291

Query  812   GT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       G + ++DVL++LM SG L++PIT+DNIKAI++D+F AG+ETS+TT+ WAM+E
Sbjct  292   GKKGNGAFGGENLVDVLIRLMGSGELKIPITNDNIKAIMVDLFSAGTETSSTTATWAMTE  351

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             MM+NPRVL KAQAEVRE FKGKE  +E  +E+L YL+ VVKETLR HPP PL+A RECRE
Sbjct  352   MMRNPRVLKKAQAEVREAFKGKETFDEDVIEELKYLRQVVKETLRLHPPVPLLAPRECRE  411

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             ET IN GYTIP+KT+VMVN +++  DP+YWE+ E FIPERF  + VDF G++F+Y+PFGA
Sbjct  412   ETNIN-GYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFARSSVDFLGNNFEYLPFGA  470

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG+ FG  N   PLA LLY+FDWKLP+G   E +DMTE+  +  ARK++
Sbjct  471   GRRMCPGITFGLFNVYLPLAKLLYHFDWKLPDGQKPEDVDMTELSAITAARKSE  524



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/474 (57%), Positives = 351/474 (74%), Gaps = 13/474 (3%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP K+PI+G++LH+ G   PH  LRDLA+KYG LM LQ GEISAVV
Sbjct  21    KWKNSNSQTKKLPPGPWKIPILGSMLHMVGGE-PHHVLRDLAKKYGPLMHLQFGEISAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+S +MAKE L+THD+ FA+R + LA  I+ YN SDI   PYGD+WRQMRKIC+ ELLN 
Sbjct  80    VTSREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + VRSFSSIR DE+ RL+  +RS +  G   N ++RI  F SS+ CR+AFG+V  G++ F
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVF  199

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
              ++ +++  L   FD AD+FPS+K LH L G K ++L  H K D+I+E +IN+H+  L +
Sbjct  200   AKKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAT  259

Query  812   GT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       GED +IDVLL+LM+  +LQ PIT+DNIKAII+DMF AG+ETS+TT++WAM+E
Sbjct  260   GKTNGALGGED-LIDVLLRLMNDTSLQFPITNDNIKAIIVDMFAAGTETSSTTTVWAMAE  318

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             MMKNP V  KAQAEVRE FK K   +E+D E+L YLK V+KETLR HPP+PL+  RECRE
Sbjct  319   MMKNPSVFTKAQAEVREAFKNKVTFDENDAEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             +T IN GYTIP KTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+++PFG 
Sbjct  379   DTDIN-GYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGG  437

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE+ G+ +ARK D
Sbjct  438   GRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGMKPRDLDLTELAGITIARKGD  491



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/488 (56%), Positives = 360/488 (74%), Gaps = 10/488 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKK--QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             NL+S  LFVS L L + +WKK   +  ++PPGP K+P +G++ H+ G  LPH  L +LA+
Sbjct  5     NLVSIFLFVSSLFL-FMKWKKSNNQTKRLPPGPWKVPFLGSMFHMLGG-LPHHVLTNLAK  62

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG LM LQ+GE+S VVV+SP+MAKE L+THDLAFA+R + +A  I+ YN +DI   PYG
Sbjct  63    KYGPLMHLQLGEMSVVVVTSPEMAKEVLKTHDLAFASRPKLVAVDIVGYNGTDIAFSPYG  122

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQMRKIC+ ELL+ + VRSF+SIR DE+  L+   RSSAG P NV++RI++F SS+I
Sbjct  123   DYWRQMRKICVMELLSAKNVRSFNSIRRDEVCSLIEFFRSSAGEPVNVTKRIYVFASSMI  182

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              R+AFG+V   +++ I+  KD+S L G FD AD+FPS K LH L G K + +  H K D+
Sbjct  183   FRSAFGKVIKEQDECIRLIKDVSGLVGGFDVADIFPSQKVLHVLSGKKGKTMYLHHKIDT  242

Query  857   IIESIINDHRNKLESGT-----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             IIE++IN+H+  L +G      G + +IDVLL+LM  G+LQ PIT DNIKAI ID+F  G
Sbjct  243   IIENVINEHKQNLATGKFNGQLGSEDLIDVLLRLMKDGSLQFPITTDNIKAIFIDLFAGG  302

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             +ETS++T  WAM EMMKNP +L KAQ+EVR+ FKGKE  +E+DVE+L YLK V+KET R 
Sbjct  303   TETSSSTVTWAMVEMMKNPSILIKAQSEVRDAFKGKEAFDENDVEELKYLKLVIKETFRL  362

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP PL+  RECREET IN GYTIP+KT +MVN +A+  DP+YW + E F PERF+ + +
Sbjct  363   HPPLPLLIPRECREETNIN-GYTIPLKTTIMVNVWAMGRDPKYWVDAENFKPERFQHSTM  421

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G++F+++PFG+GRRICPG++FG AN   PLA LLY+FDW LP G+    LD+ E  G
Sbjct  422   DFTGNNFEFLPFGSGRRICPGISFGLANIYLPLAQLLYHFDWNLPTGINPSDLDLAESAG  481

Query  152   LAVARKND  129
             LAV RK+D
Sbjct  482   LAVLRKSD  489



>ref|XP_009796910.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/489 (57%), Positives = 364/489 (74%), Gaps = 12/489 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQW--KKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             +L+S  +F SFL L+  +W   K +  ++PPGP KLPI+G++LH+ G  LPHR LRDLA+
Sbjct  5     DLVSIFIFASFLFLL-KKWMNSKNQAKRLPPGPWKLPILGSMLHMVGG-LPHRVLRDLAK  62

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG LM LQ+GE+S VVV+SP++AKE L+THDLAFA+R + LA  I+LY++SD+   PYG
Sbjct  63    KYGPLMHLQLGEVSVVVVTSPEIAKEVLKTHDLAFASRPKLLAAEIVLYDSSDVAFAPYG  122

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQMRKIC+ E+L+ + VRSFSSIR DE+ RL+   RSS+G+P N ++RI LF S II
Sbjct  123   DYWRQMRKICVLEVLSTKNVRSFSSIRRDEVVRLIEFFRSSSGKPVNFTKRISLFMSFII  182

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+AFG VF  +++FIQ  KD++ L   FD AD+FPS K LH L G +++ +  H K D 
Sbjct  183   CRSAFGTVFKEQDEFIQVMKDVTALLEGFDVADIFPSLKFLHVLTGMRAKAMNLHHKVDD  242

Query  857   IIESIINDHRNKLESGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             I+++IIN+H+  L +G       GED +IDVLL+L   G  Q PIT+DNIKAII DMF A
Sbjct  243   IVDNIINEHKKNLATGKFNGQLGGED-LIDVLLRLKKDGGFQFPITNDNIKAIIYDMFAA  301

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ET++TT  WAM EM++N  V AKAQAEVREVF  KE  +E+DVE+L YLK V+KETLR
Sbjct  302   GTETTSTTIDWAMVEMIRNASVFAKAQAEVREVFNRKETFDENDVEELKYLKLVIKETLR  361

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECREET IN GYTIP+K+KVMVN +A+  DP+ W++ E F PERFE + 
Sbjct  362   LHPPLPLMLPRECREETNIN-GYTIPLKSKVMVNVWAIGRDPKNWDDAESFKPERFEQSS  420

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             VDF G++F+Y+PFG+GRRICPG+ FG AN   PLA LLY FDWKLP G+    LDMTE  
Sbjct  421   VDFVGNNFEYLPFGSGRRICPGILFGLANIYLPLAQLLYYFDWKLPTGINPSDLDMTESD  480

Query  155   GLAVARKND  129
             G + ARK++
Sbjct  481   GASCARKSN  489



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/476 (56%), Positives = 354/476 (74%), Gaps = 14/476 (3%)
 Frame = -2

Query  1520  QWKKQRR----GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             +WKK  +     K+PPGP KLP IG++ H+ G  LPHR LRDLA+KYG LM LQ+GE+SA
Sbjct  18    KWKKYSKYSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAKKYGPLMHLQLGEVSA  76

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVV+SPD+AK+ L+THD+AFA+R + LA  I+ Y+  DI   PYG+YW+QMRKIC+ E+L
Sbjct  77    VVVTSPDIAKQILKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVMEVL  136

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGRE  999
             + + VRSFSSIR DE+ RL+  ++SS+  G   N++ER+  FTSS+ CR+AFG+V   ++
Sbjct  137   SAKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNLTERVIWFTSSMTCRSAFGQVPKEQD  196

Query  998   QFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL  819
              FI+  +++  L   FD AD+FPS+K LH     K ++L  HRK D+I+E +IN+H+   
Sbjct  197   MFIKLIREVISLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNF  256

Query  818   ESGTGEDC------IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAM  657
              +   +D       ++DVLL+LM+  +LQ PI +DNIKAIIIDMF AG+ETS+TT++WAM
Sbjct  257   STRKNDDHALGGEDLVDVLLRLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAM  316

Query  656   SEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATREC  477
             +EM+KNP VLAKAQAEVRE F+ K  L+E+DVE+L YLK V+KET+R H P PL+  REC
Sbjct  317   AEMLKNPSVLAKAQAEVREAFRNKVTLDENDVEELKYLKLVIKETMRLHAPIPLLVPREC  376

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
             REET IN GYTIPVKTKVMVN +AL  DP+YW++ E F PERFE   +DF G++F+Y+PF
Sbjct  377   REETEIN-GYTIPVKTKVMVNVWALGRDPKYWDDVESFKPERFEQCSIDFIGNNFEYLPF  435

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G GRRICPG++FG AN   PLA LL  FDWKLP G+  + LD+TE+ G++VARK D
Sbjct  436   GGGRRICPGISFGLANVYLPLAQLLCRFDWKLPAGMEPKDLDLTELAGMSVARKGD  491



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/474 (56%), Positives = 352/474 (74%), Gaps = 13/474 (3%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP K+PI+G++LH+ G   PH  LRDLA+KYG LM LQ+GEISAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+S DMAKE L+THD+ FA+R + +A  I+ YN SDI   PYGD+WRQMRKIC+ ELLN 
Sbjct  80    VTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + VRSFSSIR DE+ RL+  +RS +  G   N ++RI  F SS+ CR+AFG+V  G++ F
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIF  199

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
              ++ +++  L   FD  D+FP++K LH L G K ++L  H K D+I+E +IN+H+  L +
Sbjct  200   AKKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAA  259

Query  812   GT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       GED +IDVLL+LM+  +LQ PIT+DNIKA+++DMF AG+ETS+TT++WAM+E
Sbjct  260   GKSNGALGGED-LIDVLLRLMNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAE  318

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             MMKNP V  KAQAEVRE F+ K   +E+DVE+L YLK V+KETLR HPP+PL+  RECRE
Sbjct  319   MMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             +T IN GYTIP KTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+++PFG 
Sbjct  379   DTDIN-GYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGG  437

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE+ G+ +ARK D
Sbjct  438   GRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGD  491



>ref|XP_009624010.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=502

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/467 (58%), Positives = 357/467 (76%), Gaps = 9/467 (2%)
 Frame = -2

Query  1511  KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPD  1332
             K +  ++PPGP KLPI+G++LH+ G  LPHR LRDLA+KYG LM L++GE+S VVV+SP+
Sbjct  26    KNQAKRLPPGPWKLPILGSMLHMVGG-LPHRILRDLAKKYGPLMHLKLGEVSVVVVTSPE  84

Query  1331  MAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRS  1152
             +AKE L+THDLAFA+R + LA  I+LYN+SDI   PYGDYWRQMRKIC+ E+LN + VRS
Sbjct  85    IAKEVLKTHDLAFASRPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRS  144

Query  1151  FSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDI  972
             FSSIR DE+ RL+   RSS+G+P N ++RI LFTS IICR+AFG VF  +++FIQ  K++
Sbjct  145   FSSIRRDEVFRLIEFFRSSSGKPVNFTKRISLFTSFIICRSAFGTVFKEQDEFIQVMKNV  204

Query  971   SVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-----  807
             + L    D AD+FPS K LH L G +++++  H K DSI++++IN+H+  L +G      
Sbjct  205   TALLEGLDVADIFPSLKFLHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFNGQL  264

Query  806   -GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
              GED +IDVLL+LM  G+LQ PIT+DNIKAII DMF AG+ET++TT  WAM E+++N  V
Sbjct  265   GGED-LIDVLLRLMKDGDLQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRNASV  323

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
              AKAQAEVREVF+  E  +E+DVE+L YLK V+KETLR HPP PL+  RECREET IN G
Sbjct  324   FAKAQAEVREVFRRIETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNIN-G  382

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             +TIP+K+KVMVN +A+  DP+YW++ E F PERFE + VDF G++F+Y+PFG+GRRICPG
Sbjct  383   FTIPLKSKVMVNVWAIGRDPKYWDDAENFKPERFEQSSVDFTGNNFEYLPFGSGRRICPG  442

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             + FG AN   PLA LLY FDWKLP G+    LD+TE  G + ARK++
Sbjct  443   ILFGLANIYLPLAQLLYYFDWKLPTGINPSDLDLTESDGASCARKSN  489



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/472 (57%), Positives = 351/472 (74%), Gaps = 13/472 (3%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP K+PI+G++LH+ G   PH  LRDLA+KYG LM LQ+GEISAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+S DMAKE L+THD+ FA+R + +A  I+ YN SDI   PYGD+WRQMRKIC+ ELLN 
Sbjct  80    VTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + VRSFSSIR DE+ RL+  +RS +  G   N ++RI  F SS+ CR+AFG+V  G++ F
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIF  199

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
              ++ +++  L   FD  D+FP++K LH L G K ++L  H K D+I+E +IN+H+  L +
Sbjct  200   AKKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAA  259

Query  812   GT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       GED +IDVLL+LM+  +LQ PIT+DNIKA+I+DMF AG+ETS+TT++WAM+E
Sbjct  260   GKSNGALGGED-LIDVLLRLMNDTSLQFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAE  318

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             MMKNP V  KAQAEVRE F+ K   +E+DVE+L YLK V+KETLR HPP+PL+  RECRE
Sbjct  319   MMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             +T IN GYTIP KTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+++PFG 
Sbjct  379   DTDIN-GYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGG  437

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             GRRICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE+ G+ +ARK
Sbjct  438   GRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIMPRDLDLTELSGITIARK  489



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/458 (57%), Positives = 343/458 (75%), Gaps = 4/458 (1%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PPGP KLPIIG++LH+ G  LPH  LRDLA+KYG +M LQ+GE+S VV++SP+MAKE 
Sbjct  31    RLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVITSPEMAKEV  89

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFA+R   +A  I+ YN +DI   PYG+YWRQMRKIC+ ELL+ + V+SF+SIR
Sbjct  90    LKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIR  149

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+HR++   RSS G+P NV++R  LFTSS+ CR+AFG+ +  +++F +  K +S L  
Sbjct  150   QDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLME  209

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN--KLESGTGEDCIIDV  783
              FD AD+FPS K LH L G K++++  H + D I+++II +H+   K    +G + IIDV
Sbjct  210   GFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKKVAKTNCESGSEGIIDV  269

Query  782   LLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVR  603
             LL+LM  G LQ PIT+DNIKAII DMF AG+ETS TT  WAM EMMKNP V AK QAEVR
Sbjct  270   LLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMMKNPSVFAKTQAEVR  329

Query  602   EVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKV  423
             ++ +GKE   E DVE+  YLK V+KET R HPP PL+  RECREET +N GYTIP+KTKV
Sbjct  330   KILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREETDLN-GYTIPLKTKV  388

Query  422   MVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTI  243
             +VN +A+  DP+YW++ E F PERFE+N +D+ G++F+Y+PFG+GRRICPG++FG AN  
Sbjct  389   VVNVWAMGRDPKYWDDVESFKPERFENNSMDYTGNNFEYLPFGSGRRICPGISFGLANVY  448

Query  242   SPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              PLA LLY+FDWKLP  +    LD+TE  G A ARKND
Sbjct  449   FPLAQLLYHFDWKLPTEINPSELDLTEAAGAACARKND  486



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/475 (55%), Positives = 344/475 (72%), Gaps = 13/475 (3%)
 Frame = -2

Query  1520  QWKK----QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             +WKK     +  K+PPGP KLP IG++ H+ G  L HR LRDLA+KYG LM LQ+GE+SA
Sbjct  18    KWKKYSNNTQTKKLPPGPWKLPFIGSMHHLAGG-LSHRVLRDLAKKYGPLMHLQLGEVSA  76

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VV +SPDMAK+ L+ HD+AFA+R   LA  I+ YN  DI   PYG+YWRQMRKIC+ E+L
Sbjct  77    VVATSPDMAKQVLKIHDIAFASRPSLLATDIICYNRRDIAFIPYGEYWRQMRKICVMEVL  136

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGRE  999
               + VRSFSSIR DE+ RL+  ++SS+  G P N +E+I  FTSS+ CR+AFG+V   +E
Sbjct  137   GAKNVRSFSSIRRDEVVRLIDSIQSSSFSGEPVNFTEKIIWFTSSMTCRSAFGQVLKEQE  196

Query  998   QFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL  819
              FI+  +++  LT  FD AD+FPS+K LH   G K ++L  HRK DSI+E +I +H+  L
Sbjct  197   VFIKLIREVISLTEGFDVADIFPSYKFLHGFGGAKKQLLNAHRKVDSIVEDVIKEHKKNL  256

Query  818   ESGTGEDCI-----IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
              +   +D I     +DVLL+LM+  +LQ PI +DNIKA+IID+F AG+ETS+TT++WAM+
Sbjct  257   ATRKSDDSIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMA  316

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EM KNP +L+KAQAEVRE F+ K    E+DVE L YLK V+KETLR H P PL+  RECR
Sbjct  317   EMFKNPTLLSKAQAEVREAFRNKVKFGENDVEDLKYLKLVIKETLRIHAPIPLLVPRECR  376

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             EET IN GYTIP+KTKVMVN +AL  DP+YW+  E F PERFE+  +DF G++F+++PFG
Sbjct  377   EETKIN-GYTIPMKTKVMVNVWALGRDPKYWDNAESFKPERFEECSMDFVGNNFEFLPFG  435

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              GRRICPG++FG AN   PLA LLY+FDWKLP G+    LD+ E+  +  +RK D
Sbjct  436   GGRRICPGISFGLANIYLPLAQLLYHFDWKLPTGIEPRDLDLIELSRITASRKGD  490



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/458 (57%), Positives = 343/458 (75%), Gaps = 4/458 (1%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PPGP KLPIIG++LH+ G  LPH  LRDLA+KYG +M LQ+GE+S VV+SSP+MAKE 
Sbjct  31    RLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVISSPEMAKEV  89

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFA+R   +A  I+ YN +DI   PYG+YWRQMRKIC+ ELL+ + V+SF+SIR
Sbjct  90    LKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIR  149

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+HR++   RSS G+P NV++R  LFTSS+ CR+AFG+ +  +++F +  K +S L  
Sbjct  150   QDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLME  209

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN--KLESGTGEDCIIDV  783
              FD AD+FPS K LH L G K++++  H + D I+++II +H+   K    +G + IIDV
Sbjct  210   GFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKKVAKTNCESGSEGIIDV  269

Query  782   LLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVR  603
             LL+LM  G LQ PIT+DNIKAII DMF AG+ETS TT  WAM EMMKNP V AK QAEVR
Sbjct  270   LLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMMKNPSVFAKTQAEVR  329

Query  602   EVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKV  423
             ++ +GKE   E DV++  YLK V+KET R HPP PL+  RECREET +N GYTIP+KTKV
Sbjct  330   KILRGKETFGEIDVDEFKYLKMVIKETFRLHPPLPLLLPRECREETDLN-GYTIPLKTKV  388

Query  422   MVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTI  243
             +VN +A+  DP+YW++ E F PERFE+N +D+ G++F+Y+PFG+GRRICPG++FG AN  
Sbjct  389   VVNVWAMGRDPKYWDDVESFKPERFENNSMDYTGNNFEYLPFGSGRRICPGISFGLANVY  448

Query  242   SPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              PLA LLY+FDWKLP  +    LD+TE  G A ARKND
Sbjct  449   FPLAQLLYHFDWKLPTEINPSELDLTEAAGAACARKND  486



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/474 (54%), Positives = 353/474 (74%), Gaps = 10/474 (2%)
 Frame = -2

Query  1529  VYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAV  1350
             ++ +  K+   K+PPGP KLPIIG++ H+ G VLPH  LR+L++KYG +M L++GEI  V
Sbjct  20    IFVRKSKKSNQKLPPGPWKLPIIGSMHHLIG-VLPHHVLRNLSKKYGPIMHLKLGEIDTV  78

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             VVSS  MAK+ L+ HDL FA R E ++  I+ YN +DIV   YGDYW+QMRKICI+ELL+
Sbjct  79    VVSSAHMAKQVLKVHDLCFAARPELMSSDIVFYNQNDIVFAKYGDYWKQMRKICISELLS  138

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              ++V+SFS IR DE+H L+A +RS+     N+SE+I   TSS+ICR+AFG+V+D R+  +
Sbjct  139   AKMVKSFSLIRQDEVHDLVASIRSTPNVVVNISEKILRLTSSVICRSAFGKVWDDRDNLL  198

Query  989   QQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG  810
                +++  L+G FD AD+FPSW  LH + G ++ +   H+K D I+E II++H+    +G
Sbjct  199   MLMREVLSLSGGFDVADLFPSWTLLHGIGGMRNRLKSLHQKIDVILEKIIHEHKENRANG  258

Query  809   T-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                     GED +IDVLL++M++G LQ PIT+D++KA+++D+F  G+ETS+    WA+SE
Sbjct  259   KKGNSEFGGED-LIDVLLRVMENGELQFPITNDSVKAVVLDLFFGGTETSSVIIQWALSE  317

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             +MKNP+V+AKAQAEVR V KGK+ L ++ VE+L YLK V+ ETLR HP +PL+  R+CRE
Sbjct  318   LMKNPKVMAKAQAEVRRVCKGKKDLNDNVVEELKYLKLVINETLRLHPASPLLGLRQCRE  377

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             ET I+ GYTIP+K++V+VN +A+A DP+ W++PE F+PERFE N VDFNG+HFQY+PFGA
Sbjct  378   ETKID-GYTIPLKSQVVVNGWAIARDPESWDDPEAFVPERFEKNSVDFNGNHFQYIPFGA  436

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G R+CPG+ FG AN + PLA LLY+FDWKLP G   E LDMTE LG++  RKND
Sbjct  437   GSRMCPGMHFGLANVVYPLAQLLYHFDWKLPYGQQPEDLDMTETLGISATRKND  490



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   528 bits (1361),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 266/474 (56%), Positives = 351/474 (74%), Gaps = 13/474 (3%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  K+PPGP K+PI+G++LH+ G   PH  LRDLA+K G LM LQ+GEISAVV
Sbjct  21    KWKNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKDGPLMHLQLGEISAVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+S DMAKE L+THD+ FA+R + +A  I+ YN SDI   PYGD+WRQMRKIC+ ELLN 
Sbjct  80    VTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + VRSFSSIR DE+ RL+  +RS +  G   N ++RI  F SS+ CR+AFG+V  G++ F
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIF  199

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
              ++ +++  L   FD  D+FP++K LH L G K ++L  H K D+I+E +IN+H+  L +
Sbjct  200   AKKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAA  259

Query  812   GT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       GED +IDVLL+LM+  +LQ PIT+DNIKA+++DMF AG+ETS+TT++WAM+E
Sbjct  260   GKSNGALGGED-LIDVLLRLMNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAE  318

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             MMKNP V AKAQAEVRE F+ K   +E+DVE+L YLK V+KETLR HPP+PL+  RECRE
Sbjct  319   MMKNPSVFAKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             +T IN GYTIP KTKVMVN +AL  DP+YW++ E F PERFE   VD  G++F+++PFG 
Sbjct  379   DTDIN-GYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDIFGNNFEFLPFGG  437

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG++FG AN   PLA LLY+FDWKLP G+    LD+TE+ G+ +ARK D
Sbjct  438   GRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGD  491



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   528 bits (1361),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 269/475 (57%), Positives = 348/475 (73%), Gaps = 15/475 (3%)
 Frame = -2

Query  1517  WKKQRR--GKMPPGPRKLPIIGNLLHITGPV---LPHRALRDLARKYGGLMSLQIGEISA  1353
             WKK R    K+PPGP KLP IG++ H+  P+   LPH AL +L +K+G  M LQ+GEIS 
Sbjct  26    WKKSRNLNKKLPPGPWKLPFIGSVHHL--PLEGGLPHHALTNLGKKHGPFMHLQLGEIST  83

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             +VVSS DMA+E L+THDLAFA+R++ LA  I+ Y ++DI   PYGDYWRQM K+C+ ELL
Sbjct  84    IVVSSMDMAREVLKTHDLAFASRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELL  143

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA-GRPFNVSERIFLFTSSIICRAAFGEVFDGREQ  996
               + VRSFSSIR DE   L+  +RSS    P NV+ERI  + SSI C+ AFGE+   +E+
Sbjct  144   TTKNVRSFSSIRRDEASHLVQFIRSSTRDEPINVTERILWYQSSITCKTAFGELLKDQEK  203

Query  995   FIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLE  816
             F+   +++  + G F  AD+FPS K L  L G KS+ILK H+  D I+E +IN+H+  + 
Sbjct  204   FLGILRELMEVAGGFSLADIFPSIKILQVLSGLKSKILKVHKNADVIVEDVINEHKKNIA  263

Query  815   SGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
             SG       G + ++DVLL+L +SG L++PIT+DNIKAIIID+F AGSETS TT++WAMS
Sbjct  264   SGKKGNGAFGGENLVDVLLRLKESGELKIPITNDNIKAIIIDLFSAGSETSGTTTIWAMS  323

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EMM+ P VLAKAQAEVRE FKGKE  +E  +E+L YLK VVKETLR HPP PL+  R+CR
Sbjct  324   EMMRKPSVLAKAQAEVRETFKGKETFDEDVIEELKYLKQVVKETLRLHPPVPLLIPRKCR  383

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             EET IN GYTIP+KT+VMVN YA+  DP+YWE+ E FIPERFE + VDF G++F+Y+PFG
Sbjct  384   EETNIN-GYTIPLKTRVMVNVYAMGRDPKYWEDAEIFIPERFEQSSVDFMGNNFEYLPFG  442

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             AGRR+CPG+ FG  N   PLA LLY+FDWKLP+G+  + +DMTE  G+  ARK++
Sbjct  443   AGRRMCPGITFGLINVYLPLAKLLYHFDWKLPDGLKPKYVDMTEFSGITAARKSE  497



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   527 bits (1358),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 266/476 (56%), Positives = 349/476 (73%), Gaps = 14/476 (3%)
 Frame = -2

Query  1520  QWKKQRRG----KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             +WKK  +     K+PPGP KLP IG++ H+ G   PHR LRDLA+KYG LM LQ+GE+SA
Sbjct  18    KWKKYSKNSQTKKLPPGPWKLPFIGSMHHLAGG-RPHRVLRDLAKKYGPLMHLQLGEVSA  76

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVV+SPDMAKE L+THD+AFA+R + LA  I+ Y+  DI   PYG+YW+QMRKIC+TE+L
Sbjct  77    VVVTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVL  136

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGRE  999
             + + VRSFSSIR DE+ RL+  ++SS+  G   N  ER+  FTSS+ CR+AFG++   ++
Sbjct  137   SAKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKEQD  196

Query  998   QFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL  819
              FI+  +++  L   FD AD+FPS+K LH     K ++L  HRK D+I+E +IN+H+   
Sbjct  197   MFIKLIREVIRLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNF  256

Query  818   ESGTGED------CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAM  657
              +   +D       +IDVLLKLM+  +LQ PI +DNIKAIIIDMF AG+ETS+TT++WAM
Sbjct  257   ATRKNDDHALGGENLIDVLLKLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAM  316

Query  656   SEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATREC  477
              EM+KNPRVLAKAQAEVRE F+ K   +E+DVE L YLK V+KET+R H P PL+  REC
Sbjct  317   VEMLKNPRVLAKAQAEVREAFRNKVTFDENDVEDLKYLKLVIKETMRLHAPIPLLVPREC  376

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
             R+ET IN GYTIPVKTKVMVN +AL  DP+YW++ E F PERFE   +DF G++F+Y+PF
Sbjct  377   RKETEIN-GYTIPVKTKVMVNVWALGRDPKYWDDVECFKPERFEQCSIDFIGNNFEYLPF  435

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G GRRICPG +FG AN   PLA LL +FDWKLP G+  + LD+TE+ G++ A K+D
Sbjct  436   GGGRRICPGTSFGLANDYLPLAQLLCHFDWKLPTGMEPKDLDLTELAGMSAASKDD  491



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   526 bits (1356),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 265/464 (57%), Positives = 345/464 (74%), Gaps = 11/464 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PPGP K+PI+G++LH+ G   PH  LRDLA+KYG +M LQ GEISAVVV+S +MAKE 
Sbjct  31    QLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVVTSREMAKEV  89

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THD+ FA+R + LA  I+ YN SDI   PYGD+WRQMRKIC+ ELLN + VRSFSSIR
Sbjct  90    LKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIR  149

Query  1136  HDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVL  963
              DE+ RL+  +RS +  G   N ++RI  F SS+ CR+AFG+V  G++ F ++ +++  L
Sbjct  150   RDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGL  209

Query  962   TGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT------GE  801
                FD AD+FPS+K LH L G K ++L  H K D+I+E +IN+H+  L +G       GE
Sbjct  210   AEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATGKTNGALGGE  269

Query  800   DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAK  621
             D +IDVLL+LM+  +LQ PIT+D IKA+I+DMF AG+ETS+TT++WAM+EMMKNP V  K
Sbjct  270   D-LIDVLLRLMNDTSLQFPITNDKIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPNVFNK  328

Query  620   AQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTI  441
             AQAEVRE FK K   +E D E+L YLK V+KETLR HPP+PL+  RECRE+T IN GYTI
Sbjct  329   AQAEVRETFKDKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECREDTDIN-GYTI  387

Query  440   PVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAF  261
             P KTKVMVN +AL  DP+YW++ E F PERFE   VDF G++F+++PFG GRRICPG++F
Sbjct  388   PAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRRICPGMSF  447

Query  260   GFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G AN   PLA LLY+FDWKLP G+    LD+TE+ G+ +ARK D
Sbjct  448   GLANLYLPLAQLLYHFDWKLPSGMMPGDLDLTELAGITIARKGD  491



>ref|XP_009772938.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   526 bits (1356),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 269/467 (58%), Positives = 352/467 (75%), Gaps = 9/467 (2%)
 Frame = -2

Query  1511  KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPD  1332
             K +  ++PPGP KLPI G+ LH+ G  LPHR LRDLA+KYG LM LQ+GE+S VVV+SP+
Sbjct  26    KNQVKRLPPGPWKLPIRGSTLHMVGG-LPHRVLRDLAKKYGPLMHLQLGEVSVVVVTSPE  84

Query  1331  MAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRS  1152
             +AKE L+THDLAFA+R + LA  I+LY++SD+   PYGDYWRQMRKIC+ E+L+ + VRS
Sbjct  85    IAKEVLKTHDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRS  144

Query  1151  FSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDI  972
             FSSIR DE+ RL+   RSS+G+P N ++RI LF S IICR+AFG VF  +++FIQ  K++
Sbjct  145   FSSIRRDEVFRLVEFFRSSSGKPVNYTKRISLFMSFIICRSAFGTVFKEQDEFIQVMKNV  204

Query  971   SVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-----  807
             + L   FD AD+FPS K LH + G +++ +  H K D+I++++IN+H+  L +G      
Sbjct  205   TALLEGFDVADIFPSLKFLHVVTGMRAKAMNLHHKVDAIVDNVINEHKENLATGKFSGQL  264

Query  806   -GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
              GED +IDVLL+LM  G  Q PIT+DNIKAII DMF AG+ET++TT  WAM EM++N  V
Sbjct  265   GGED-LIDVLLRLMKDGGFQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVEMIRNASV  323

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
              AKAQAEVREVF  KE  +E+DVE+L YLK V+KETLR HPP PL+  +ECREET IN G
Sbjct  324   FAKAQAEVREVFSRKETFDENDVEKLKYLKLVIKETLRLHPPLPLMLPKECREETNIN-G  382

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             YTIP+K+KVMVN +A+  DP+YW++ E F PER+E + VDF G++F+Y+PFG+GRRICPG
Sbjct  383   YTIPLKSKVMVNVWAIGRDPKYWDDAESFKPERYEQSSVDFVGNNFEYLPFGSGRRICPG  442

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++FG  N   PLA LLY FDWKLP G+    LDMTE  G + ARK++
Sbjct  443   ISFGIVNIYLPLAQLLYYFDWKLPTGINPSDLDMTESDGASCARKSN  489



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   524 bits (1350),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 336/467 (72%), Gaps = 6/467 (1%)
 Frame = -2

Query  1523  TQWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAV  1350
              +WK    +  ++PPGP KLP+IG++ H+ G  LPH   RDLA+KYG +M LQ+GE+S V
Sbjct  20    NKWKNSNSKSKRLPPGPWKLPLIGSMFHLLGG-LPHHVFRDLAKKYGPIMHLQLGEVSLV  78

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             VV+S DMAK+ L+THDLAFA R + L G IL Y  +DIV  PYGDYWRQMRKIC+ E L+
Sbjct  79    VVTSADMAKQVLKTHDLAFAFRPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLS  138

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              + V+SF+SIR DE+H ++   RSS+G   NV++RI+ F+SS+ CR+ FG+VF  + + +
Sbjct  139   AKNVKSFNSIRQDEVHHMIEFFRSSSGETINVTKRIYQFSSSMTCRSVFGKVFKEQNKLM  198

Query  989   QQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG  810
             +  K+ S     FD AD+FPS K LH L G K +I+  H + D+I+E+IIN+H+N  E G
Sbjct  199   ELAKEASRFLKGFDVADIFPSLKFLHVLCGMKGKIMDAHHELDAILENIINEHKNNGELG  258

Query  809   TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
              GE  ++  LL LM  G LQ PIT+DNIKAII DMF  G++TS+T   WAM EMMKNP V
Sbjct  259   -GEGLLV-ALLSLMKEGGLQFPITNDNIKAIIFDMFAGGTDTSSTLIDWAMVEMMKNPSV  316

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
             L KAQ E+R  F GKE   E+DVE+L YLK VVKET R HPP PL+  RECREE  I+ G
Sbjct  317   LLKAQDEIRNAFTGKETFNENDVEELKYLKLVVKETFRLHPPAPLLVARECREEVDID-G  375

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             Y IP+KTKV+VNAYA+  DP+YW + E F PERFE   VDF G++F+++PFG+GRRICPG
Sbjct  376   YNIPLKTKVLVNAYAIGRDPKYWIDAECFKPERFEQISVDFIGNNFEFLPFGSGRRICPG  435

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++FG AN   PLA LLY+FDWKLP G+    LD+TE  G+A ARK++
Sbjct  436   ISFGLANIFFPLAKLLYHFDWKLPIGINPSDLDLTESAGIACARKSN  482



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   525 bits (1351),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 268/471 (57%), Positives = 352/471 (75%), Gaps = 10/471 (2%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLP++G++ H+ G   PH  L DLA+KYG LM LQ+GE+S V 
Sbjct  47    KWKNSHSQTKRLPPGPWKLPVLGSMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVS  105

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R   LA  I+ YN +DIV  PYGDYWRQMRKIC+ ELL+ 
Sbjct  106   VTSPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSA  165

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFSS+R DE+  ++   RSS+G+P NVS+RI LFT+S+ CR+AFG+ +  +++F +
Sbjct  166   KNVRSFSSVRRDEVFHMIEYFRSSSGKPVNVSKRISLFTTSMTCRSAFGQEYKEQDEFAR  225

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K +S L   FD AD+FPS K LH L G K++++  H + D+I+E+IIN+H+ K+ +G 
Sbjct  226   LVKKVSSLMEGFDVADIFPSLKFLHVLSGMKAKVMDAHHELDAILENIINEHK-KIATGK  284

Query  806   -----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                  G + +IDVLL+LM  G LQ PIT+DNIKAII DMFGAG+ETS+TT  WAM EM+K
Sbjct  285   NNNELGGEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVEMIK  344

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NP V AKAQAEVRE F+ KE  +E+DVE+L YLK V+KET R HPP PL+  RE REET 
Sbjct  345   NPSVFAKAQAEVREAFREKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESREETD  404

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             IN GYTIP KTK+MVN +A+  DP+YW++ E F PERFE N +DF G++F+Y+PFG+GRR
Sbjct  405   IN-GYTIPFKTKLMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFIGNNFEYLPFGSGRR  463

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +CPG++FG AN   PLA LLY+FDWKLP G+ +  LDMTE  G+  ARK+D
Sbjct  464   MCPGISFGLANVYLPLAQLLYHFDWKLPTGINSSDLDMTESSGVTCARKSD  514



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   522 bits (1344),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 262/468 (56%), Positives = 354/468 (76%), Gaps = 6/468 (1%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLPI+G++LH+ G  LPH  LRDLA+KYG +M LQ+GE+S VV
Sbjct  21    KWKNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             +SSP+MAKE L+THDLAFA R   +A  I+ YN +DI   PYG+YWRQMRKIC+ ELL+ 
Sbjct  80    ISSPEMAKEVLKTHDLAFANRPLLVAAKIVCYNGTDIAFSPYGNYWRQMRKICLLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + V+SF+SIR DE+HR++   RSS+G+P NV++RI LFT+S+ CR+AFG+ +  +++F++
Sbjct  140   KTVKSFNSIRQDEVHRMIEFFRSSSGKPVNVTKRIALFTNSMTCRSAFGQEYKKQDEFVE  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHR--NKLES  813
               K +S L   FD AD+FPS K LH L G K++++  H + D+I+E+IIN+H+  +K + 
Sbjct  200   LVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKKTSKSDG  259

Query  812   GTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPR  633
              +G + II VLL+LM  G LQ PIT+DNIKAII D+FG G+ETS+TT  WAM+EMMKNP 
Sbjct  260   ESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAEMMKNPC  319

Query  632   VLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVING  453
             V +KAQAEVR++ +GKE   E DVE+  YLK V+KET R HPP PL+  RECREE  +N 
Sbjct  320   VFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLN-  378

Query  452   GYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICP  273
             GYTIP+KTKV+VNA+A+  DP+YW++ E F PERFE N +D+ G++++Y+PFG+GRRICP
Sbjct  379   GYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRRICP  438

Query  272   GLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G++FG AN   PLA LL +FDWKLP G+    LD+TE  G+A A KND
Sbjct  439   GISFGLANVYFPLAQLLNHFDWKLPTGINPSELDLTEAAGVACATKND  486



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   521 bits (1343),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 266/468 (57%), Positives = 350/468 (75%), Gaps = 6/468 (1%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLPI+G++LH+ G  LPH  LRDLA+KYG +M LQ+GE+S VV
Sbjct  21    KWKNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             +SSP MAKE L+THDLAFA R   +A  I  YN  DI L PYG+YWRQMRKIC+ ELL+ 
Sbjct  80    ISSPGMAKEVLKTHDLAFANRPLLVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + V+SF+SIR DE+HR++   RSS G+P NV++RI LFT+S+ CR+AFG+ +  +++F+Q
Sbjct  140   KNVKSFNSIRQDEVHRMIKFFRSSPGKPVNVTKRISLFTNSMTCRSAFGQEYKEQDEFVQ  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHR--NKLES  813
               K +S L   FD AD+FPS K LH L G K++++ TH + D+I+E+IIN+H+  +K + 
Sbjct  200   LVKKVSNLIEGFDVADIFPSLKFLHVLTGMKAKVMNTHNELDAILENIINEHKKTSKSDG  259

Query  812   GTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPR  633
              +G + II VLL+LM  G LQ PIT+DNIKAII D+FG G+ETS+TT  WAM EMMKNP 
Sbjct  260   ESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIISDIFGGGTETSSTTINWAMVEMMKNPS  319

Query  632   VLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVING  453
             V +KAQAEVRE+ +GKE   E DVE+  YLK V+KET R HPP PL+  RECREE  +N 
Sbjct  320   VFSKAQAEVREILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLN-  378

Query  452   GYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICP  273
             GYTIP+KTKV+VNA+A+  DP+YW++ E F PERFE N +D+ G++++Y+PFG+GRRICP
Sbjct  379   GYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRRICP  438

Query  272   GLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G++FG AN   PLA LL +FDWKLP G+     D+TE  G A ARKND
Sbjct  439   GISFGLANVYFPLAQLLNHFDWKLPTGINPRNCDLTEAAGAACARKND  486



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   521 bits (1343),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 261/468 (56%), Positives = 346/468 (74%), Gaps = 6/468 (1%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLPI+G++LH+ G   PH  LRDLA+KYG LM LQ+GE+S VV
Sbjct  21    KWKNSSSQTKRLPPGPWKLPILGSMLHLLGG-HPHHVLRDLAKKYGPLMHLQLGEVSLVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R   LA  I+ YN +DIV  PYG+YWRQMRKIC+ ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + V+SF+SIR DE+HR++   RSS G+P NV++R  LFTSS+ CR+AFG+    +++F++
Sbjct  140   KNVKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEHKEKDEFVR  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN--KLES  813
               K +S     FD AD+FPS K LH + G K++++  H + D I E+II++ +   K   
Sbjct  200   LVKKVSNYMEGFDVADIFPSLKFLHVVTGLKAKVMDAHHELDEIFENIISERKKVAKTNC  259

Query  812   GTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPR  633
              +  + I+DVLL+LM  G LQ PIT+DNIKAI+ DMF AG+ETS+TT  WAM EMMK P 
Sbjct  260   ESRGEGIVDVLLRLMKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMMKKPS  319

Query  632   VLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVING  453
             V AKAQAEVR++ +GKE  +E DVE+  YLK V+KET R HPP PL+  RECREET +N 
Sbjct  320   VFAKAQAEVRKILRGKETFDEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREETDLN-  378

Query  452   GYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICP  273
             GYTIP+KTKV+VN +A+  DP+YW++ E F PERFE+N +D+ G++F+Y+PFG GRRICP
Sbjct  379   GYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNPMDYIGNNFEYLPFGGGRRICP  438

Query  272   GLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G++FG AN   PLA +LY+FDWKLP G+    LD+TE  G A ARKND
Sbjct  439   GISFGLANVYFPLAQMLYHFDWKLPTGINPSELDLTEAAGAACARKND  486



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   521 bits (1342),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 267/471 (57%), Positives = 348/471 (74%), Gaps = 10/471 (2%)
 Frame = -2

Query  1520  QWKKQRR--GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK       ++PPGP KLP++GN+ H+ G   PH  L DLA+KYG LM LQ+GE+S V 
Sbjct  21    KWKNSNSHTKRLPPGPWKLPLLGNMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVA  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R   LA  I+ YN +DIV  PYGDYWRQMRKIC+ ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFSS+R DE+ R++   RSS+G+P NV++RI +FTSS+ CR+AFG+ +  +++F +
Sbjct  140   KNVRSFSSVRRDEVFRMIEFFRSSSGKPVNVTKRISVFTSSMTCRSAFGQEYKEQDEFAR  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K +S L   FD AD+FPS K LH L G K++++  H + D+I+E IIN+H+ K+ +G 
Sbjct  200   LVKKVSSLMEGFDIADIFPSLKFLHVLSGMKAKVMDAHHELDAILEKIINEHK-KIATGK  258

Query  806   GED-----CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
               D      +IDVLL+LM  G LQ PIT+DNIKAII DMFGAG+ETS+TT  WAM EMMK
Sbjct  259   NNDELGGEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVEMMK  318

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NP V AKAQAEVR+ F+GKE  +E+DVE+L YLK V+KET R HPP PL+  RE REET 
Sbjct  319   NPTVFAKAQAEVRKAFRGKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESREETD  378

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             IN GYTI +KTK+MVN +A+  DP+YW++ E F PERFE N +DF G++F+Y+PFG+GRR
Sbjct  379   IN-GYTISLKTKLMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFIGNNFEYLPFGSGRR  437

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +CPG++FG AN   PLA LLY+FDWKLP G+    LDM E  G   +RK+D
Sbjct  438   MCPGISFGLANVYLPLAQLLYHFDWKLPTGINPCDLDMIESSGATCSRKSD  488



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 341/476 (72%), Gaps = 13/476 (3%)
 Frame = -2

Query  1523  TQWKKQRR--GKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISA  1353
              +WKK R    K+PPGP  LP +G+L H+     LPH AL +L +KYG  M LQ+GE S 
Sbjct  24    VEWKKSRNFNKKLPPGPWNLPFLGSLHHLALEGGLPHHALTNLGKKYGPFMHLQLGETSM  83

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVVSS DMA+E ++THDLAFA+R + ++  I+ Y ++DI    YG+YWRQMRKIC+ EL 
Sbjct  84    VVVSSLDMAREVMKTHDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELF  143

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA-GRPFNVSERIFLFTSSIICRAAFGEVFDGREQ  996
               + VRSFSSIR DE   L+  +RSS  G P NV+E+I  + SS   RAAFG++   +E+
Sbjct  144   TAKNVRSFSSIRRDEASSLVQFIRSSTRGEPINVTEQISWYESSNTSRAAFGKLLKDQEK  203

Query  995   FIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLE  816
             FI   K++  L   F  AD FPS K LH L G +S ILK H+  D+I+E +IN+H+  + 
Sbjct  204   FIGLVKELVELASGFSVADFFPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKNIA  263

Query  815   SGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAM  657
             SG        GED ++DVLL+L +S  L++PIT+DNIKAI+ID+FGAG+ETS TT +WAM
Sbjct  264   SGKKGNGAFGGED-LVDVLLRLKESRELKIPITNDNIKAIMIDLFGAGTETSGTTIIWAM  322

Query  656   SEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATREC  477
             SEMM+NP VLAKAQAEVRE FKGKE   E  +E+L YLK VVKET R HPP PL+  REC
Sbjct  323   SEMMRNPSVLAKAQAEVREAFKGKETFNEDVIEELKYLKQVVKETFRLHPPAPLLIPREC  382

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
             REET IN GYTIP+KT+V+VN YA+  DP+YWE+ E FIPERFE   VDF G++F+Y+PF
Sbjct  383   REETSIN-GYTIPLKTRVIVNVYAMGRDPKYWEDAESFIPERFEQISVDFMGNNFKYLPF  441

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GAGRR+CPG+ FG  N   PLA+LLY+FDWKLP+GV  E +DMTE  G+  ARK++
Sbjct  442   GAGRRMCPGILFGLINVYLPLANLLYHFDWKLPDGVKLEDVDMTEFFGITAARKSE  497



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 262/468 (56%), Positives = 352/468 (75%), Gaps = 6/468 (1%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLPI+G++LH+ G  LPH  LRDLA+KYG +M LQ+GE+S VV
Sbjct  21    KWKNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             +SSP+MAKE L+THDLAFA R   +A  I+ YN  DI   PYG+YWRQMRKIC+ ELL+ 
Sbjct  80    ISSPEMAKEVLKTHDLAFANRPLLVAAKIVSYNCMDIAFSPYGNYWRQMRKICLLELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + V+SF+SIR DE+HR++   RSS G+P NV++RI LFT+S+ CR+AFG+ +  +++F++
Sbjct  140   KNVKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRISLFTNSMTCRSAFGQEYKKQDEFVE  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHR--NKLES  813
               K +S L   FD AD+FPS K LH L G K++++  H + D+I+E+IIN+H+  +K + 
Sbjct  200   LVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKKTSKSDG  259

Query  812   GTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPR  633
              +G + II VLL+LM  G LQ PIT+DNIKAII D+FG G+ETS+TT  WAM+EMMKNP 
Sbjct  260   ESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAEMMKNPC  319

Query  632   VLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVING  453
             V +KAQAEVR++ +GKE   E DVE+  YLK V+KET R HPP PL+  RECREE  +N 
Sbjct  320   VFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLN-  378

Query  452   GYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICP  273
             GYTIP+KTKV+VNA+A+  DP+YW++ E F PERFE N +D+ G++++Y+PFG+GRRICP
Sbjct  379   GYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRRICP  438

Query  272   GLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G++FG AN   PLA LL +FDWKLP G+    LD+TE  G+A A KND
Sbjct  439   GISFGLANVYFPLAQLLNHFDWKLPTGINPSELDLTEAAGVACATKND  486



>ref|XP_006339043.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=509

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 352/475 (74%), Gaps = 13/475 (3%)
 Frame = -2

Query  1520  QWKKQRR--GKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISAV  1350
             Q KK R    K+PPGP KLP +G++ H+     LPH AL +L++KYG LM LQ+GEIS V
Sbjct  25    QRKKSRNLNKKLPPGPWKLPFLGSIHHLVLEGGLPHHALTNLSKKYGPLMHLQLGEISTV  84

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             +VSS DMA+E L+THDLAFA+R +  +   + Y ++DI   PYG+YWRQMRK+C+ ELL 
Sbjct  85    IVSSTDMAREVLKTHDLAFASRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELLT  144

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
              + VRSFSSIR DE   L+  ++SS  G P NV+ERI  + SSI C+AAFGE+   +E+F
Sbjct  145   AKNVRSFSSIRKDEASGLVQFIQSSTCGEPINVTERILWYQSSITCKAAFGELLKDQEKF  204

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
             IQ  K++  L G F+ AD+FPS K L  L G +S ILK H+  D+I+E +IN+H+  + S
Sbjct  205   IQMVKEVMELAGGFNLADIFPSIKILQVLSGVRSRILKVHKNVDAIVEDVINEHKKNIAS  264

Query  812   GT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
             G        GED ++DVLL+LM+SG L++PIT+DNIKAI+ID+F AG+ETS+TT+ WAM+
Sbjct  265   GKKGNGAFGGED-LVDVLLRLMESGELKIPITNDNIKAIMIDLFSAGTETSSTTATWAMT  323

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EMM+NP VL KAQAEVRE FKGKE  +E  +E+L YLK VVKET R HPP PL+  RECR
Sbjct  324   EMMRNPSVLKKAQAEVREAFKGKETFDEDVIEELKYLKQVVKETFRLHPPLPLLVPRECR  383

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             EET IN GYTIP+KT+VMVN +++  DP+YWE+ E FIPERFE + VDF G++F+++PFG
Sbjct  384   EETNIN-GYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFEQSSVDFMGNNFEFLPFG  442

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             AGRR+CPG+ FG  N   PLA LLY+FDWKLP+G  +E +DMTE+ G+  ARK++
Sbjct  443   AGRRMCPGITFGLINVHLPLAKLLYHFDWKLPDGQKSEDMDMTEVSGITAARKSE  497



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 253/491 (52%), Positives = 355/491 (72%), Gaps = 11/491 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH-ITGPVLPHRALRDLARK  1395
             NL+S  +F+S LV++  +W K ++ ++PPGP +LP IG+L H I G  LPHR  R+LAR+
Sbjct  11    NLVSLLIFLSSLVILVRKWSKNKKQRLPPGPWRLPFIGSLHHLIIGGQLPHRVFRNLARR  70

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG +M LQ+GEI  V++SSP +A+E LRTHDLAFA R + ++ +I+ YNN DIV   YGD
Sbjct  71    YGPIMYLQLGEIPVVIISSPTIAQEILRTHDLAFADRPQFVSTNIIFYNNKDIVFSQYGD  130

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLAD---VRSSAGRPFNVSERIFLFTSS  1044
             YWRQMRKIC+ ELL+ ++V+SFS IR DE+  L++     R  A    N+SE++F F +S
Sbjct  131   YWRQMRKICMVELLSVKMVKSFSGIRQDELSSLISSICSTRGGATVLINMSEKVFRFINS  190

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             + CR+AFG++  G+++FI   K++    G FD AD+FPSWK LH + G KS ++  H+K 
Sbjct  191   VTCRSAFGKICKGKDEFITLMKEVLFFAGGFDVADLFPSWKLLHNISGVKSRLMNAHQKV  250

Query  863   DSIIESIINDHRNKLESGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMF  702
             D+I+E+IIN+H      G       G++ ++DVLL++ ++  LQ PIT+D+IKA+I D+F
Sbjct  251   DAIMENIINEHIENKAIGKKRNGEFGDEDLVDVLLRIKENSQLQFPITNDHIKAVITDIF  310

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
              AG+E S+ T +WA+SEMM+NP V+AKAQ EVR+VFKGK+  +E D+E+L YLK V+KET
Sbjct  311   IAGTEASSLTIIWALSEMMRNPNVMAKAQHEVRQVFKGKKNYDEKDIEKLTYLKLVIKET  370

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR H P PL+  RECRE T I+ GY IP KT+V+VN +ALA DP+YW+ P  FIPERFE+
Sbjct  371   LRLHTPGPLMGPRECRENTNID-GYIIPQKTRVLVNVWALARDPKYWQNPTSFIPERFEN  429

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             + +DF G+ F+++PFG+GRR+CPG+ F  AN    LA LLY+F+W+LP GV  + LDMTE
Sbjct  430   SSIDFMGNDFEFIPFGSGRRMCPGIQFALANVGFSLAQLLYHFEWELPNGVNPKDLDMTE  489

Query  161   MLGLAVARKND  129
               GL  ++K D
Sbjct  490   THGLTASKKKD  500



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   516 bits (1328),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 267/467 (57%), Positives = 344/467 (74%), Gaps = 6/467 (1%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLP++G++ H+ G   PH  L +LA+KYG L+ LQ+GE+S VV
Sbjct  21    KWKNSNSKIKRLPPGPWKLPLLGSMFHMLGG-HPHHVLTNLAKKYGPLVHLQLGEMSVVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ ELL  
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFSSIR DE+HR++   RSS  +  NV++RI+ FTSS+ CR+AFG+VF  +++FI 
Sbjct  140   KNVRSFSSIRRDEVHRMIEFFRSSIDQQVNVTKRIYQFTSSMTCRSAFGKVFKEQDEFIL  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG-  810
               K  + L   FD AD+FPS K LH L G K+ ++  H K D+I+E+IIN+ R K+ +G 
Sbjct  200   LVKRNTALMEGFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINE-RKKIATGE  258

Query  809   TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
              G   +IDVLL+LM  G LQ PIT+DNIKAII D F AG+ETS+ T  WAM EMMKNP V
Sbjct  259   VGGKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDTFAAGTETSSVTIDWAMVEMMKNPSV  318

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
             LAKAQAEVR+ F+GKE  +E+DVE+L YLK V+KE  R HPP PL+  RECREET IN G
Sbjct  319   LAKAQAEVRKAFRGKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECREETDIN-G  377

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             YTIP+K KVMVN +A+  DP+YW++ E F PERFE N +DF G++F+Y+PFG+GRR CPG
Sbjct  378   YTIPLKAKVMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFVGNNFEYLPFGSGRRNCPG  437

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++FG AN   PLA LLY+FDWKLP G+    LD+TE  G   ARK++
Sbjct  438   ISFGLANVYYPLAQLLYHFDWKLPNGINPNELDLTESAGATCARKSN  484



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   516 bits (1328),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 265/456 (58%), Positives = 340/456 (75%), Gaps = 4/456 (1%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFL  1314
             +PPGP KLP++G++ H+ G   PH  L +LA+KYG L+ LQ+GE+S VVV+SP+MAKE L
Sbjct  32    LPPGPWKLPLLGSMFHMLGG-HPHHVLTNLAKKYGPLVHLQLGEMSVVVVTSPEMAKEVL  90

Query  1313  RTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRH  1134
             +THDLAFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ ELL  + VRSFSSIR 
Sbjct  91    KTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRR  150

Query  1133  DEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGS  954
             DE+HR++   RSS  +  NV++RI+ FTSS+ CR+AFG+VF  +++FI   K  + L   
Sbjct  151   DEVHRMIEFFRSSIDQQVNVTKRIYQFTSSMTCRSAFGKVFKEQDEFILLVKRNTALMEG  210

Query  953   FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG-TGEDCIIDVLL  777
             FD AD+FPS K LH L G K+ ++  H K D+I+E+IIN+ R K+ +G  G   +IDVLL
Sbjct  211   FDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINE-RKKIATGEVGGKGLIDVLL  269

Query  776   KLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREV  597
             +LM  G LQ PIT+DNIKAII DMF AG+ETS+ T  WAM EMMKNP VLAKAQAEVR+ 
Sbjct  270   RLMKEGGLQFPITNDNIKAIIFDMFAAGTETSSVTIDWAMVEMMKNPSVLAKAQAEVRKA  329

Query  596   FKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMV  417
             F+GKE  +E+DVE+L YLK V+KE  R HPP PL+  RECREET IN GYTIP+K KVMV
Sbjct  330   FRGKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECREETDIN-GYTIPLKAKVMV  388

Query  416   NAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISP  237
             N +A+  DP+YW++ E F PERFE N +DF G++F+Y+PFG+GRR CPG++FG AN   P
Sbjct  389   NVWAIGRDPKYWDDAESFKPERFEHNSMDFVGNNFEYLPFGSGRRNCPGISFGLANVYYP  448

Query  236   LAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             LA LLY+FDWKLP G+    LD+TE  G   AR+++
Sbjct  449   LAQLLYHFDWKLPNGINPNELDLTESAGATCARESN  484



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   517 bits (1331),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 258/461 (56%), Positives = 337/461 (73%), Gaps = 9/461 (2%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFL  1314
             +PPGP KLP+IG+LLH+ G  LPH +LRDL+ KYG LM L+ GE+S +VVSSP +AKE L
Sbjct  61    LPPGPWKLPLIGHLLHVVGS-LPHHSLRDLSNKYGPLMHLKFGEVSTIVVSSPKVAKEVL  119

Query  1313  RTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRH  1134
             +T D A A R ++LA  I+ YN  DI   PYG+YWRQMRKICI ELL+ + VRSF  IR 
Sbjct  120   KTVDPACADRPQSLASQIMWYNYIDIAFSPYGEYWRQMRKICILELLSVKNVRSFDYIRK  179

Query  1133  DEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGS  954
             DE  RL+  +R+S+GRP N++++ FLFTS+I CRAAFG+V   RE  I   K+  VL G 
Sbjct  180   DEASRLVESIRASSGRPINLTDKTFLFTSAITCRAAFGKVLKDRETLISLLKEAVVLAGG  239

Query  953   FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL---ESGTGE---DCI  792
             FD AD+FPS K L+ +  NK ++LK   K D+I++ +I++H++ L   + G GE   + +
Sbjct  240   FDMADLFPSLKILNIINWNKYKLLKMRSKMDAILDRLIDEHKDNLATSKKGNGEMGSEDL  299

Query  791   IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQA  612
             +DVLL+L  SG  + PI ++NIKA++ DMF AG+ETS+TT  WAM+E+M+NP VLAKAQA
Sbjct  300   VDVLLRLKQSGEFEFPIANNNIKAVLFDMFSAGTETSSTTVDWAMAELMRNPHVLAKAQA  359

Query  611   EVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVK  432
             EVRE FKGKE +EE DV  L YLK V+KETLR HPP PL+  R CREE  +  GYTIP+K
Sbjct  360   EVRETFKGKETIEECDVHALKYLKLVIKETLRMHPPIPLLP-RACREECEVE-GYTIPLK  417

Query  431   TKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFA  252
              KVMVN +A+  DP YW +PE F PERFE+N +D+ G+H+QY+PFG+GRRICPG+ FG A
Sbjct  418   AKVMVNTWAMGRDPNYWPQPENFKPERFEENSIDYLGAHYQYLPFGSGRRICPGMTFGLA  477

Query  251   NTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             N   PLA LLY+FDWKLP G+    +DM +  G+AV RK++
Sbjct  478   NVELPLAQLLYHFDWKLPNGMKPSDMDMADAEGIAVGRKHN  518



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   515 bits (1327),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 254/491 (52%), Positives = 360/491 (73%), Gaps = 12/491 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRG-KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             N  +F LF++F++ +    K+ +   K+PP P KLPIIG++ H++G   PH ALR LA+K
Sbjct  6     NFTAFFLFIAFVLTLIKVLKRSKTAQKLPPSPWKLPIIGHMHHLSGSP-PHHALRKLAQK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM +Q+GEIS++VV+SP +AKE ++THDLAFA R ETLAG I+LYN SDI   PYGD
Sbjct  65    YGPLMHIQLGEISSIVVTSPRLAKEIMKTHDLAFANRGETLAGKIMLYNCSDIACCPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRS--SAGRPFNVSERIFLFTSSI  1041
             YWRQMRKIC  ELL+ + VRS  SIR +E   L++ +++  +AG+  +V+E++  + S++
Sbjct  125   YWRQMRKICTLELLSSKSVRSCGSIRQEEALHLVSSIKALANAGKSIDVTEKMSSYASAV  184

Query  1040  ICRAAFGEVF-DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             + RAAFG+V  D    F Q  K+ S +  +FD +D+ PS+K LHP    K+++L    K 
Sbjct  185   LYRAAFGKVSNDDHFAFFQLIKESSSIASAFDVSDLLPSFKILHPFLSVKNKMLNIRYKL  244

Query  863   DSIIESIINDH-----RNKLESGTGE-DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMF  702
             D +++ II+ H     R K+ +G  + + IIDVLL++ +SG LQ+P+T DNIKA++ D+F
Sbjct  245   DKVLDKIIDQHMDNLARTKIATGASDNEDIIDVLLRVKESGELQIPLTKDNIKAVLSDVF  304

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
               G+ETS+TT  WAMSEM++NP V+AKAQ+E+R  F+GK  +EE+D+++L YL++V+KET
Sbjct  305   AGGTETSSTTVEWAMSEMIRNPGVMAKAQSEIRNAFRGKNTIEETDIQRLQYLRSVIKET  364

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HPP PL+  RECREE  I+ GY IPVKT+V+VNA+A+  DP+YW++ E F PERFE+
Sbjct  365   LRLHPPIPLLIPRECREECEID-GYIIPVKTRVLVNAWAIGRDPEYWDDAESFKPERFEN  423

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             + +DFNGSHF+Y+PFGAGRRICPG+AFG AN   PLA LLY+FDW+LP G+ +  LDMTE
Sbjct  424   SSIDFNGSHFEYLPFGAGRRICPGIAFGLANVELPLALLLYHFDWRLPNGLDSNDLDMTE  483

Query  161   MLGLAVARKND  129
              + +  +R N+
Sbjct  484   TVVITASRANN  494



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   516 bits (1328),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 250/471 (53%), Positives = 346/471 (73%), Gaps = 9/471 (2%)
 Frame = -2

Query  1520  QWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVS  1341
             QW + R+ ++PPGP + PIIG+L H+ G  +PHR LR LA+KYG LM LQ+G+   V++S
Sbjct  29    QWSRNRKQRLPPGPWRFPIIGSLHHLMGREVPHRTLRSLAQKYGPLMYLQLGQAPTVIIS  88

Query  1340  SPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRL  1161
             SP MAK+ L+THDLAFA RA+  + +I+ YNN DIV   Y DYWRQMRKICI ELL+ ++
Sbjct  89    SPSMAKQVLKTHDLAFANRAQLTSSNIIFYNNKDIVFSQYSDYWRQMRKICILELLSTKM  148

Query  1160  VRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQT  981
             V+SFS+IR DE+  L++ +RS  G P N++E+IF  T+SI  RAAFG VF  R +F++  
Sbjct  149   VKSFSAIRQDELSSLISSIRSMRGSPVNLTEKIFQLTNSITGRAAFGNVFKDRHEFMKLM  208

Query  980   KDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT--  807
             K++  L G FD AD+FPSWK LH + G KS ++  HRK D I+E I+N+H     +G   
Sbjct  209   KEVLELAGGFDVADLFPSWKLLHKMSGVKSRLVNAHRKVDEIMEDILNEHIENKAAGNKG  268

Query  806   -----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                  GED ++DV L++ ++  LQ PIT+DNIKA+I D+F AGSETS+T  +WA+SEM+K
Sbjct  269   IGEFGGED-LVDVFLRIKENAELQFPITNDNIKAVIFDIFLAGSETSSTAIIWALSEMIK  327

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NP ++AKAQ+EVR+VFKGK+  +E D+E+L YL  V+KETLR HP   L+  RECRE+T 
Sbjct  328   NPNIMAKAQSEVRQVFKGKKKYDEEDLEKLTYLNLVIKETLRLHPSVSLLPPRECREQTD  387

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             I+ GYTIP+KT+++VNA+AL  DP+ W +PE FIPERF+++ ++F G+HF+++PFGAGRR
Sbjct  388   ID-GYTIPLKTRIIVNAWALGRDPESWHDPESFIPERFKNSSIEFTGNHFEFIPFGAGRR  446

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +CPG+ FG  N   PLA LL +F+W+LP    ++ LDMTE  GL+ A++ D
Sbjct  447   MCPGIQFGLVNVGLPLAQLLQHFEWELPHETNSQDLDMTETRGLSAAKQKD  497



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 250/484 (52%), Positives = 351/484 (73%), Gaps = 7/484 (1%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKK----QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             +  +  LF SF+ L+   W K    ++  K+PP P +LP+IG+L H+ G  LPH ALR +
Sbjct  8     SFTTLLLFSSFIFLLIRAWMKPKSPRKYEKLPPSPPQLPVIGHLHHLVGG-LPHHALRRV  66

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A+KYG ++ L++GE+SAVV+SS +  KE ++  D A A R E++   I+ Y+ +DI    
Sbjct  67    AQKYGPVLYLKLGEVSAVVISSREATKEVVKVQDPACADRPESIGSKIMWYDYTDIAFSA  126

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             Y +YWRQMRKICI ELL+ + V+SF SIR DE+ RL+  ++SS+G+  N++E++F FTSS
Sbjct  127   YNEYWRQMRKICILELLSAKNVKSFGSIRQDEVSRLMKSLQSSSGQAINLTEKVFAFTSS  186

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             I CRAAFG+V   R+  I   K    + G F+ AD+FPS K LH L  NK ++L+  RK 
Sbjct  187   ITCRAAFGKVMRDRDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNKYKLLRMRRKL  246

Query  863   DSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             D+I+++I+ +H+ K     G + I+DVLL++  +G LQ PIT+DN+KA+I DMF AG+ET
Sbjct  247   DTILDAILEEHKLKQSGEFGGEDIVDVLLRMQKTGELQFPITNDNVKAVIFDMFSAGTET  306

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPP  504
             S+TT  WAM+E+M+NPRV+AK QAEVRE FKGK  +EESDV+ L YLK V+KET R HPP
Sbjct  307   SSTTIDWAMAELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALKYLKLVIKETFRLHPP  366

Query  503   TPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFN  324
              PL+  R CR+E  +N GYTIP+K+KVM+N +A+  DP YW++P+ F PERF++N +DF 
Sbjct  367   IPLLP-RACRDECKVN-GYTIPLKSKVMINIWAMGRDPAYWDQPDTFQPERFDNNSIDFL  424

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
             G++F+Y+PFGAGRRICPG+ FG AN   PLA LLY+FDWK+P+G+T + +DMTE  G+AV
Sbjct  425   GNNFEYIPFGAGRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMTPDDIDMTEAEGIAV  484

Query  143   ARKN  132
             +R+N
Sbjct  485   SRRN  488



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   514 bits (1324),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 276/490 (56%), Positives = 361/490 (74%), Gaps = 12/490 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLV--YTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             NLIS +LFVSFL L+        Q    +PPGP KLP +G++ H+ G  LPHR LRDLA+
Sbjct  5     NLISISLFVSFLFLLKKLKNSNSQINKSLPPGPWKLPFVGSMFHMIGG-LPHRVLRDLAK  63

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG ++ LQ+GE+S VVV+SP MAK+ L+THDLAFA+R   LA  I+LYN +DI   PYG
Sbjct  64    KYGSILHLQLGEVSLVVVTSPIMAKQVLKTHDLAFASRPRLLAAEIVLYNCTDIAFCPYG  123

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAG-RPFNVSERIFLFTSSI  1041
             DYWRQMRKIC+ E+L+ + VRSF SIR DE  RL+   RSS+   P NV++RI LFTS I
Sbjct  124   DYWRQMRKICVLEVLSGKNVRSFGSIRQDETIRLVEFFRSSSSSEPVNVTKRISLFTSFI  183

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
             ICR+AFG +F  +++FIQ  K ++ L   F+ AD+FPS K LH L G KS+ +  H K D
Sbjct  184   ICRSAFGTIFKEQDEFIQVMKGVTSLLEGFNVADIFPSLKFLHVLSGMKSKTMYLHHKVD  243

Query  860   SIIESIINDHRNKLESGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             +I+E++IN+H+  L +G       GED +IDVLL+LM+ G+LQ PIT+DNIKAI+ DMF 
Sbjct  244   TIVENVINEHKKNLVNGKTNGELGGED-LIDVLLRLMEDGDLQFPITNDNIKAIVYDMFA  302

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AG+ET++TT  WAM EM+KN  +L KAQ EVREVF+GK+  +E+DVE+L YLK VVKETL
Sbjct  303   AGTETTSTTIDWAMVEMIKNSSILVKAQKEVREVFRGKDTFDENDVEELKYLKLVVKETL  362

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  RECREE  I+ GYTIP KTK++VN +A+  DP+YW++ E F PERFE +
Sbjct  363   RLHPPLPLMLPRECREEVDID-GYTIPSKTKLIVNVWAIGRDPKYWDDAESFKPERFEQS  421

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G++F+++PFG+GRRICPG++FG AN   PLA+LLY+FDWKLP G+    LDMTE 
Sbjct  422   SLDFVGNNFEFLPFGSGRRICPGISFGLANVYLPLANLLYHFDWKLPPGIKPSDLDMTES  481

Query  158   LGLAVARKND  129
              G +  RK++
Sbjct  482   DGASCTRKSN  491



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   513 bits (1322),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 258/491 (53%), Positives = 361/491 (74%), Gaps = 14/491 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S ++L+  +WK Q    +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSTILLLLKKWKTQNLN-LPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
              YG LM LQ+GEI  V++SSP MAKE L+THDL FATR + +   I+ Y+++DI   PYG
Sbjct  65    CYGALMHLQLGEIPTVIISSPRMAKEVLKTHDLVFATRPKLVVADIVHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGR-PFNVSERIFLFTSSI  1041
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++++ +R+     P N++++IF FTSS+
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIRTMPNNLPVNLTDKIFWFTSSV  184

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
              CR+A G++   +++ I   ++I  L G F  AD FP+WK LH + G+K+ ++K HRK D
Sbjct  185   TCRSALGKICCDQDKLIIFMREIISLAGGFSVADFFPTWKMLHDVGGSKTRLVKAHRKID  244

Query  860   SIIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMF  702
              I+E+++N+H+     G        GED +IDVLL++ +SG +Q+PIT DNIKAI++DMF
Sbjct  245   EILENVVNEHKQNRADGKKGNGEFGGED-LIDVLLRVRESGEVQIPITDDNIKAILVDMF  303

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
              AGSETS+TT +WA++EMMK P VLAKAQAEVR+V K K+  ++ D+++L YLK V+KET
Sbjct  304   SAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKET  363

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DP+ W++PE F PERFE+
Sbjct  364   LRMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERFEN  422

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             + +DF GSH Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G + E LD+TE
Sbjct  423   SSIDFLGSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENLDLTE  482

Query  161   MLGLAVARKND  129
               G++  RK+D
Sbjct  483   SPGISATRKDD  493



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   513 bits (1320),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 346/466 (74%), Gaps = 4/466 (1%)
 Frame = -2

Query  1520  QWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLP+IG++ HI G  LPH  LR+LA+K+G LM LQ+GE+S VV
Sbjct  21    KWKNSNSQTKRLPPGPWKLPLIGSMFHILGG-LPHHVLRNLAKKFGPLMHLQLGEMSVVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R + LA  I++YN SDI   PYGDYWRQMRKIC+ ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFSPYGDYWRQMRKICMIELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFSSIR DE+HR++   RSS G+  NV++RI+ F SS+ CR+AFG+VF  +++ I 
Sbjct  140   KNVRSFSSIRRDEVHRMIEFFRSSTGKQVNVTKRIYQFASSMTCRSAFGKVFKEQDELIL  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K  + L   FD AD+FPS K LH L G K++++  H K D+I+E+IIN+ +       
Sbjct  200   LVKRNTALVEGFDVADIFPSLKFLHVLSGMKTKVMDVHHKLDAILENIINERKKIATDEL  259

Query  806   GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVL  627
              ++ +IDVLL+LM  G LQ PIT+DNIKAII D+F AG++TS+ T  WAM EMMKN  +L
Sbjct  260   ADEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDIFSAGTDTSSATVDWAMVEMMKNQSIL  319

Query  626   AKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGY  447
             AKAQAEVR+ F+GKE  +E++VE+L YLK V+KETLR HPP PL+  RECREET IN GY
Sbjct  320   AKAQAEVRKTFRGKETFDENNVEELKYLKLVIKETLRLHPPLPLLLPRECREETNIN-GY  378

Query  446   TIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGL  267
             TIP+KTKVM+N +A+  DP+YW++ E F PERFE N +DF G++F+Y+PFG+GRR CPG+
Sbjct  379   TIPLKTKVMINVWAIGRDPKYWDDAEIFKPERFEHNSMDFTGNNFEYLPFGSGRRNCPGI  438

Query  266   AFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +FG AN   PLA LLY+FDWKLP       LD+TE  G   +RK++
Sbjct  439   SFGLANVYFPLAQLLYHFDWKLPTETNPSDLDLTESAGATCSRKSN  484



>ref|XP_009624011.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=458

 Score =   510 bits (1314),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 263/448 (59%), Positives = 342/448 (76%), Gaps = 9/448 (2%)
 Frame = -2

Query  1454  LLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAET  1275
             +LH+ G  LPHR LRDLA+KYG LM L++GE+S VVV+SP++AKE L+THDLAFA+R + 
Sbjct  1     MLHMVGG-LPHRVLRDLAKKYGPLMHLKLGEVSVVVVTSPEIAKEVLKTHDLAFASRPKL  59

Query  1274  LAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS  1095
             LA  I+LYN+SDI   PYGDYWRQMRKIC+ E+LN + VRSFSSIR DE+ RL+   RSS
Sbjct  60    LAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDEVFRLIEFFRSS  119

Query  1094  AGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKAL  915
             +G+P N ++RI LFTS IICR+AFG VF  +++FIQ  K+++ L    D AD+FPS K L
Sbjct  120   SGKPVNFTKRISLFTSFIICRSAFGTVFKEQDEFIQVMKNVTALLEGLDVADIFPSLKFL  179

Query  914   HPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT------GEDCIIDVLLKLMDSGNL  753
             H L G +++++  H K DSI++++IN+H+  L +G       GED +IDVLL+LM  G+L
Sbjct  180   HVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFNGQLGGED-LIDVLLRLMKDGDL  238

Query  752   QVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLE  573
             Q PIT+DNIKAII DMF AG+ET++TT  WAM E+++N  V AKAQAEVREVF+  E  +
Sbjct  239   QFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRNASVFAKAQAEVREVFRRIETFD  298

Query  572   ESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATD  393
             E+DVE+L YLK V+KETLR HPP PL+  RECREET IN G+TIP+K+KVMVN +A+  D
Sbjct  299   ENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNIN-GFTIPLKSKVMVNVWAIGRD  357

Query  392   PQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNF  213
             P+YW++ E F PERFE + VDF G++F+Y+PFG+GRRICPG+ FG AN   PLA LLY F
Sbjct  358   PKYWDDAENFKPERFEQSSVDFTGNNFEYLPFGSGRRICPGILFGLANIYLPLAQLLYYF  417

Query  212   DWKLPEGVTAETLDMTEMLGLAVARKND  129
             DWKLP G+    LD+TE  G + ARK++
Sbjct  418   DWKLPTGINPSDLDLTESDGASCARKSN  445



>ref|XP_009612418.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 344/466 (74%), Gaps = 4/466 (1%)
 Frame = -2

Query  1520  QWKK--QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK    +  ++PPGP KLP++G++ HI G  LPH  L +LA+KYG LM LQ+GE+S VV
Sbjct  21    KWKNSNNQTKRLPPGPWKLPLLGSMFHILGG-LPHHVLTNLAKKYGPLMHLQLGEMSVVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R + LA  I++YN SDI   PYGDYWRQMRKIC+ ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFCPYGDYWRQMRKICMIELLSA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + V+SFSSIR DE+H ++   RSS G+  N+++RI+ F SS+ CR+AFG+VF  +++ I 
Sbjct  140   KNVKSFSSIRRDEVHGMIEFFRSSTGKQVNITKRIYQFASSMTCRSAFGKVFKEQDELIL  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K  + L   FD AD+FPS K LH L G K++++  H K D I+E+IIN+ +       
Sbjct  200   LVKRNTALVEGFDVADIFPSLKFLHVLSGMKAKVMDVHHKLDVILENIINERKKIATDEL  259

Query  806   GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVL  627
             G++ +IDVLL+LM  G LQ PIT+DNIKAII D+F AG+ETS+ T  WAM EMMKN  +L
Sbjct  260   GDEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDIFSAGTETSSATVDWAMVEMMKNQSIL  319

Query  626   AKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGY  447
             AKAQAEVR+ F+GKE  +E+DVE+L YLK V+KETLR HPP PL+  RECREET IN GY
Sbjct  320   AKAQAEVRKTFRGKETFDENDVEELKYLKLVIKETLRLHPPFPLLLPRECREETDIN-GY  378

Query  446   TIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGL  267
             TIP KTKVM+N +A+  DP+YW + E F PERFE N +DF G++F+Y+PFG+GRR CPG+
Sbjct  379   TIPFKTKVMINVWAIGRDPKYWNDAEIFKPERFEHNSMDFVGNNFEYLPFGSGRRNCPGI  438

Query  266   AFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +FG AN   PLA LLY+FDWKLP G+ +  LD TE  G   +RK++
Sbjct  439   SFGLANVYFPLAQLLYHFDWKLPTGINSSELDFTESAGATCSRKSN  484



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 252/474 (53%), Positives = 350/474 (74%), Gaps = 14/474 (3%)
 Frame = -2

Query  1520  QWKKQRRGKMPPGPRKLPIIGNLLHIT--GPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK Q    +PPGP KLP IG+L H+   GP LPH  L++LA++YG L+ LQ+GEI  V+
Sbjct  24    KWKTQNLN-LPPGPWKLPFIGSLHHLALAGP-LPHHGLKNLAKRYGALIYLQLGEIPTVI  81

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             +SSP MAKE L+THDL FATR + +   I+ Y++SDI   PYG+YWRQ+RKICI ELL+ 
Sbjct  82    ISSPRMAKEVLKTHDLVFATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSA  141

Query  1166  RLVRSFSSIRHDEIHRLLADVRS-SAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
             ++V+ FSSIR DE+ ++++ +R+     P N++++IF FTSS+ CR+A G++   +++ I
Sbjct  142   KMVKFFSSIRQDELSKMVSSIRTMPNNHPVNLTDKIFWFTSSVTCRSALGKICCDQDKLI  201

Query  989   QQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG  810
                ++I  L G F  AD FP+WK LH + G+K+ +LK HRK D I+E+++N+H+     G
Sbjct  202   IFMREIISLAGGFSVADFFPTWKMLHDVGGSKTRLLKAHRKIDEILENVVNEHKQNRADG  261

Query  809   T-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                     GED +IDVLL++ +SG +Q+PIT DNIK+I++DMF AGSETS+TT +WA++E
Sbjct  262   KKGNGEFGGED-LIDVLLRVRESGEVQIPITDDNIKSILVDMFSAGSETSSTTIIWALAE  320

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             MMK P VLAKAQAEVR+V K K+  ++ D+++L YLK V+KETLR HPP PL+  REC E
Sbjct  321   MMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECME  380

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             +T I+ GY IP KT+V+VNA+A+  DP+ W++PE F PERFE++ VDF GSH Q++PFGA
Sbjct  381   DTKID-GYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSVDFLGSHHQFIPFGA  439

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG+ FG AN   PLA LLY+FDWKLP G + E+LD+TE  G++  RK+D
Sbjct  440   GRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHESLDLTESPGISATRKDD  493



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   511 bits (1315),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 262/466 (56%), Positives = 337/466 (72%), Gaps = 4/466 (1%)
 Frame = -2

Query  1520  QWKKQRR--GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK       ++PPGP KLP+IG++ H+ G   PH  L +LA+KYG LM LQ+GE+  VV
Sbjct  21    KWKNSNSQIKRLPPGPWKLPLIGSMFHMLGG-HPHHVLTNLAKKYGPLMHLQLGEMPVVV  79

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             V+SP+MAKE L+THDLAFA+R + LA  I+ YN SDI   PYGDYWRQMRKIC+ ELL  
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKFLATEIVFYNCSDIAFCPYGDYWRQMRKICVIELLTA  139

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             + VRSFS+IR DE+HR++   RSS  +  NV++RI  FTSS+ CR+AFG+V   +++FI 
Sbjct  140   KNVRSFSAIRQDEVHRMIEFFRSSTDQQINVTKRICQFTSSMTCRSAFGKVIKEQDEFIL  199

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               K  + L   FD AD+FPS K LH L G K+ ++  H K D+I+E+IIN+ +       
Sbjct  200   LVKRNTALVEGFDVADIFPSLKFLHVLSGKKARVMDVHHKIDAILENIINERKEIATGEL  259

Query  806   GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVL  627
             G   +IDVLL+LM  G LQ PIT+DNIKAII DMF AG+ETS+    WAM EMMKNP VL
Sbjct  260   GGKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSSVAIDWAMVEMMKNPNVL  319

Query  626   AKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGY  447
             AKAQ EVR+ F+GKE  +E+DVE+L YLK V+KET R HPP PL+  RECREET IN GY
Sbjct  320   AKAQTEVRKAFRGKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRECREETDIN-GY  378

Query  446   TIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGL  267
             TIP+K KVMVN +A+  DP+YW++ E F PERFE N +DF G++F+Y+PFG+GRR CPG+
Sbjct  379   TIPLKAKVMVNVWAIGRDPKYWDDAEIFKPERFEHNSMDFVGNNFEYLPFGSGRRNCPGI  438

Query  266   AFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +FG AN   PLA LLY+F+WKLP G+    LD+TE  G + ARK++
Sbjct  439   SFGLANVYFPLAQLLYHFNWKLPTGINPSELDLTESAGASCARKSN  484



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   510 bits (1314),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 254/490 (52%), Positives = 365/490 (74%), Gaps = 13/490 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S + L++ +WK  R+  +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIFLLFKKWK-TRKLNLPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+G+I  +++SSP MAKE L+THDLAFATR + +A  I+ Y+++DI   PYG
Sbjct  65    RYGPLMHLQLGQIPTLIISSPQMAKEVLKTHDLAFATRPKLVAADIIHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++L+ +R++     N++++IF FTSS+ 
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMLSSIRTTPNLTVNLTDKIFWFTSSVT  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  L G F  AD FP+WK +H + G+KS+++K HRK D 
Sbjct  185   CRSALGKICGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+ +++++H+     G        GED +IDVLL++ +SG +Q+PIT+DNIK+I+IDMF 
Sbjct  245   ILGNVVDEHKKNRADGKKGNGEFGGED-LIDVLLRVRESGEVQIPITNDNIKSILIDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AGSETS+TT +WA++EMMK P VLAKAQAEVR+  K K+  ++ D+++L YLK V+KETL
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETL  363

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DP+ W++PE F+PERFE++
Sbjct  364   RMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENS  422

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G+H Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G + E  DMTE 
Sbjct  423   SIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTES  482

Query  158   LGLAVARKND  129
              G++  RK+D
Sbjct  483   PGISATRKDD  492



>ref|XP_009619866.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 257/458 (56%), Positives = 341/458 (74%), Gaps = 4/458 (1%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PPGP KLPI+G++LH+ G   PH  LRDLA+KYG LM LQ+GE+S VVV+SP+MAKE 
Sbjct  31    RLPPGPWKLPILGSMLHLLGG-HPHHVLRDLAKKYGPLMHLQLGEVSLVVVTSPEMAKEV  89

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFA+R   +A  I+ YN +DIV  PYG+YWRQMRKIC+ ELL+ + V+SF+SIR
Sbjct  90    LKTHDLAFASRPLLVAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKNVKSFNSIR  149

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+HR++   RSS G+P NV++R  LFTSS+ CR+AFG+    +++F++  K +S L  
Sbjct  150   QDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEHKEQDEFVRLVKKVSNLME  209

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN--KLESGTGEDCIIDV  783
              FD A++FPS   LH L G K++++  H + D I+E+II +H+   K    +G + I+DV
Sbjct  210   GFDVANIFPSLNFLHVLTGMKAKVMNVHHELDEILENIITEHKKVAKTICESGGEGIVDV  269

Query  782   LLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVR  603
             LL+LM  G LQ PIT+DNIKAI+ DMF AG+ETS+TT  WAM EMMK P V AKAQAEVR
Sbjct  270   LLRLMKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMMKKPSVFAKAQAEVR  329

Query  602   EVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKV  423
             ++ +GKE   E DVE+  YLK V+KET R HPP PL+  R+CREET +N GYTIP+KT V
Sbjct  330   KILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLIPRKCREETDLN-GYTIPLKTTV  388

Query  422   MVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTI  243
             +VN +A+  DP+YW++ E F PERFE+N +D+ G++F+Y+PFG+GRRI PG++FG AN  
Sbjct  389   VVNVWAMGRDPKYWDDVESFKPERFENNSMDYIGNNFEYLPFGSGRRIYPGISFGLANVY  448

Query  242   SPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              PLA LLY+FD KLP G+    LD+TE  G A ARKND
Sbjct  449   FPLAQLLYHFDGKLPSGINPSALDLTEATGAACARKND  486



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   509 bits (1310),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 253/490 (52%), Positives = 364/490 (74%), Gaps = 13/490 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S + L++ +WK  R+  +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIFLLFKKWK-TRKLNLPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+G+I  +++SSP MAKE L+THDLAFATR + +   I+ Y+++DI   PYG
Sbjct  65    RYGPLMHLQLGQIPTLIISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++L+ +R++     N++++IF FTSS+ 
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMLSSIRTTPNLTVNLTDKIFWFTSSVT  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  L G F  AD FP+WK +H + G+KS+++K HRK D 
Sbjct  185   CRSALGKICGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+ +++++H+     G        GED +IDVLL++ +SG +Q+PIT+DNIK+I+IDMF 
Sbjct  245   ILGNVVDEHKKNRADGKKGNGEFGGED-LIDVLLRVRESGEVQIPITNDNIKSILIDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AGSETS+TT +WA++EMMK P VLAKAQAEVR+  K K+  ++ D+++L YLK V+KETL
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETL  363

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DP+ W++PE F+PERFE++
Sbjct  364   RMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENS  422

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G+H Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G + E  DMTE 
Sbjct  423   SIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTES  482

Query  158   LGLAVARKND  129
              G++  RK+D
Sbjct  483   PGISATRKDD  492



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   509 bits (1310),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 256/490 (52%), Positives = 349/490 (71%), Gaps = 11/490 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGK--MPPGPRKLPIIGNL-LHITGPVLPHRALRDLAR  1398
              IS  +FVSF+  +   WK  +     +PPGP   P+IGNL L + G +  H  LR L+R
Sbjct  24    FISVLIFVSFIFRLVQIWKASKTFNKILPPGPWSPPLIGNLHLFMNGRLPVHHTLRSLSR  83

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG +  L++GEIS +VVSSP+MAKE ++T DL FATR E +AG I+ YN +DI+  PYG
Sbjct  84    RYGPIFHLRLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMAGDIIFYNYTDIITCPYG  143

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPF-NVSERIFLFTSSI  1041
             D+WR MRK+CI ELL+ ++V+SF+SIR  E+  L++ V S       N+S+++F FTSS+
Sbjct  144   DHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLISSVNSMPDDSLINLSDKMFWFTSSV  203

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
              CR+AFG+V   +++ I   KDIS L   FD ADMFPS K LH + G KS++LK H+K D
Sbjct  204   TCRSAFGKVIHDQDKLIMLVKDISSLAAGFDLADMFPSRKWLHKITGLKSKMLKVHKKVD  263

Query  860   SIIESIINDHRNKLESG------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             +I+E+I+N+H+    +G      TG + +IDVLL++M+SG L  PIT++NIK++I DMF 
Sbjct  264   AILENILNEHQESRANGKKSNGETGGEDLIDVLLRVMESGELGTPITNENIKSVIFDMFL  323

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AG+ETS TT +WAM+EM++NP V+AKAQ EVREV KGK   E+ D+E+L YL  V+KETL
Sbjct  324   AGAETSATTIIWAMAEMIRNPSVMAKAQLEVREVLKGKRTFEDIDLEELKYLNLVIKETL  383

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  RECREET I+  Y IP+KT+V+VN +A+  +   W  PE FIPERFE+N
Sbjct  384   RLHPPVPLLIPRECREETKID-KYIIPIKTRVLVNVWAIGRESTNWHNPESFIPERFENN  442

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G+HF+++PFGAGRR+CPGL FG  N   PLA LLY+FDWK P G+  + L+MTE 
Sbjct  443   SIDFRGNHFEFIPFGAGRRMCPGLLFGLVNVGHPLAQLLYHFDWKTPHGIAPDNLNMTET  502

Query  158   LGLAVARKND  129
             +G+A  RK+D
Sbjct  503   IGVAGGRKDD  512



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   507 bits (1306),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/490 (51%), Positives = 363/490 (74%), Gaps = 13/490 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S + L++ +WK  R+  +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIFLLFKKWK-TRKLNLPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+G+I  +++SSP MAKE L+THDLAFATR + +   I+ Y+++DI   PYG
Sbjct  65    RYGPLMHLQLGQIPTLIISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+ ++++ +R++     N++++IF FTSS+ 
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIRTTPNLTVNLTDKIFWFTSSVT  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  L G F  AD FP+WK +H + G+KS+++K HRK D 
Sbjct  185   CRSALGKICGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+ +++++H+     G        GED +IDVLL++ +SG +Q+PIT DNIK+I+IDMF 
Sbjct  245   ILGNVVDEHKKNRADGKKGNGEFGGED-LIDVLLRVRESGEVQIPITDDNIKSILIDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AGSETS+TT +WA++EMMK P VLAKAQAEVR+  K K+  ++ D+++L YLK V+KETL
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETL  363

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  REC E+T I+ GY IP KT+V+VNA+A+  DP+ W++PE F+PERFE++
Sbjct  364   RMHPPIPLLVPRECMEDTKID-GYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENS  422

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G+H Q++PFGAGRRICPG+ FG AN   PLA LLY+FDWKLP G + E  DMTE 
Sbjct  423   SIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTES  482

Query  158   LGLAVARKND  129
              G++  RK+D
Sbjct  483   PGISATRKDD  492



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 258/490 (53%), Positives = 360/490 (73%), Gaps = 13/490 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLH--ITGPVLPHRALRDLAR  1398
             NL++F LF+S ++L+  +WK Q+   +PPGP KLP IG+L H  + GP LPH  L++LA+
Sbjct  7     NLVAFLLFLSSIILLLKKWKTQKLN-LPPGPWKLPFIGSLHHLAVAGP-LPHHGLKNLAK  64

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
              YG LM L++GEI  V++SSP MAKE L+THDLAFATR + +   I+ Y+++DI   PYG
Sbjct  65    LYGPLMHLRLGEIPTVIISSPRMAKEVLKTHDLAFATRPKLVVADIVHYDSTDIAFSPYG  124

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKICI ELL+ ++V+ FSSIR DE+  +++ +R+    P N++++IF FTSS+ 
Sbjct  125   EYWRQIRKICILELLSAKMVKFFSSIRQDELSMMVSSIRTMPNFPVNLTDKIFWFTSSVT  184

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CR+A G++   +++ I   ++I  LTG F  AD FP+WK LH + G+K+ +LK HRK D 
Sbjct  185   CRSALGKICRDQDKLIIFMREIISLTGGFSIADFFPTWKMLHDVGGSKTRLLKAHRKIDE  244

Query  857   IIESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             I+E ++N+H+     G        GED +IDVLL++ +SG +Q+ IT DNIK+I++DMF 
Sbjct  245   ILEHVVNEHKQNRADGQKGNGEFGGED-LIDVLLRVRESGEVQISITDDNIKSILVDMFS  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AGSETS+TT +WA++EMMK P VLAKAQAEVR+V K K+  ++ D+++L YLK V+KETL
Sbjct  304   AGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETL  363

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  REC ++T I+ GY IP KT+V+VNA+A+  DP+ W++PE F PERFE++
Sbjct  364   RMHPPIPLLVPRECMKDTKID-GYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERFENS  422

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              VDF GSH Q++PFGAGRRICPG+ FG AN   PLA LLY+FD KLP G + E LDMTE 
Sbjct  423   SVDFLGSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDRKLPNGQSHENLDMTES  482

Query  158   LGLAVARKND  129
              G++  RK+D
Sbjct  483   PGISATRKDD  492



>emb|CDP08465.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   505 bits (1301),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 261/497 (53%), Positives = 364/497 (73%), Gaps = 13/497 (3%)
 Frame = -2

Query  1586  SNIMENLISFALFVSFLVLVYTQWKKQRR----GKMPPGPRKLPIIGNLLHITGPVLPHR  1419
              +I  N I   L  + L+ +  + K+ ++     K+PPGP KLP IG + H+ G  LPHR
Sbjct  4     QSITSNFIPCFLVAAILLTLIKELKRSQKTKTIQKLPPGPWKLPFIGCMHHLIGS-LPHR  62

Query  1418  ALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSD  1239
              L++LA+KYG LM LQ+GE+S ++V+SP++AKE ++THDL+FATR E LA  I+ Y+  D
Sbjct  63    CLKNLAQKYGSLMHLQLGEVSLIIVTSPNLAKEIMKTHDLSFATRPELLAFKIICYDTKD  122

Query  1238  IVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIF  1059
             I   PYGDYWRQMRKI + ELL+ + VRSF +IR DE+  L+  +R  AG+  N++E++F
Sbjct  123   IAFSPYGDYWRQMRKISVLELLSAKSVRSFENIRQDEVLHLVEAIRPLAGKKVNLTEQVF  182

Query  1058  LFTSSIICRAAFGEVF-DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEIL  882
              + SS++CRAAFG+V  + + +F+Q  K ++ L G FD AD+FPS+K LH L G K ++L
Sbjct  183   SYASSMVCRAAFGQVSKEDQYEFVQLMKQVAALAGGFDIADLFPSYKILHVLTGMKPKLL  242

Query  881   KTHRKTDSIIESIINDH-----RN-KLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKA  720
             K H K DSI E +I +H     RN KL + + ++ +IDVLL++ DSGNLQ PIT++NIKA
Sbjct  243   KIHHKMDSIFEKLIEEHIKNQTRNKKLVADSNQEDLIDVLLRIRDSGNLQFPITNNNIKA  302

Query  719   IIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLK  540
             II DMF AG+ETS++T  WAMSEM++NP V+AKAQ E+R+ FKGK+ ++E+DV+ L YLK
Sbjct  303   IIFDMFAAGTETSSSTVEWAMSEMIRNPDVMAKAQREIRQSFKGKQNIDEADVQGLRYLK  362

Query  539   TVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfi  360
              V+KETLR HPP PL+  RECRE+  +N GYTIP+KTKVM+N +A+  DP++W +PE F+
Sbjct  363   LVIKETLRLHPPFPLLLPRECREQCELN-GYTIPIKTKVMINFWAIGRDPEHWSDPESFV  421

Query  359   perfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAE  180
             PERF++N VDF G+HF++VPFGAGRRICPG++F  AN   PLA LL +F+W+LP+G+ + 
Sbjct  422   PERFDNNPVDFTGNHFEFVPFGAGRRICPGMSFALANVELPLALLLCHFNWRLPDGMKSR  481

Query  179   TLDMTEMLGLAVARKND  129
              LDM E  G+   RKN+
Sbjct  482   ELDMLENNGITATRKNN  498



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 342/474 (72%), Gaps = 11/474 (2%)
 Frame = -2

Query  1529  VYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAV  1350
             +  Q KKQR   +PPGP +LP IGNL H+ G  LPHR LRDL+++YG +M LQ+G++  V
Sbjct  20    IIRQNKKQR---LPPGPWRLPFIGNLHHLIGGGLPHRVLRDLSQRYGPIMYLQLGQVPTV  76

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             V++SP +A+E L+THDLAFA R + ++ +I+ YNN D+    YGDYWRQMRKICI ELL+
Sbjct  77    VITSPTIAQEILKTHDLAFADRPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLS  136

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              ++V+SFS IR DE+  L++ +RS+ G   N++E++F FT+ + CR+AFG++   R +F+
Sbjct  137   TKMVKSFSGIRQDELSSLISSIRSTRGTTINMTEKVFQFTNCVTCRSAFGKICKDRNEFV  196

Query  989   QQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH-RNKL--  819
                K I V  G FD AD+FPSWK LH + G KS ++K H+K D+I+E+IIN+H  NK+  
Sbjct  197   ALLKKILVFAGGFDLADLFPSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKVAG  256

Query  818   ESGTGE---DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEM  648
             + G GE   + ++DV L++ ++  LQ PIT ++IKA+I D+F AG+ETS+ T +WA+SE+
Sbjct  257   KKGNGEFGDEDLVDVFLRVKENAELQFPITKEHIKAVISDIFIAGTETSSATIIWALSEL  316

Query  647   MKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREE  468
             MKNP V+AKAQ+EVR+V KGK+   E D+E+L YLK V+KETLR H P PLI  RECRE+
Sbjct  317   MKNPNVMAKAQSEVRQVLKGKKNYGEEDIEKLTYLKLVIKETLRLHTPVPLIGPRECREK  376

Query  467   TVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN-GVDFNGSHFQYVPFGA  291
             T I+ GYTIP   +V+VNA+ALA DP+ W++          +N  +DF G+HF+++PFGA
Sbjct  377   TNID-GYTIPHNARVLVNAWALARDPKNWDKNPESFIPERFENSSIDFMGNHFEFIPFGA  435

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG+ FG AN   PLA LLY+F+W+LP GV  + LDM+E  GL  ++  D
Sbjct  436   GRRICPGIQFGLANVALPLAQLLYHFEWELPYGVNPKDLDMSETHGLTASKAKD  489



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 238/468 (51%), Positives = 344/468 (74%), Gaps = 7/468 (1%)
 Frame = -2

Query  1514  KKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSP  1335
             + +++ ++PPGP +LP+IGNL H+ G  LPH   R L+++YG LM LQ+GE+  VV+SS 
Sbjct  34    RNEKQFRLPPGPWRLPLIGNLHHLIGGGLPHHIFRKLSQRYGPLMYLQLGEVPTVVISST  93

Query  1334  DMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVR  1155
              +AKE LRTHD AFA R +  + +I+ YN+ DI   PYGDYWRQMRKIC  EL + ++++
Sbjct  94    TIAKEILRTHDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTLELFSIKMIK  153

Query  1154  SFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKD  975
              FS+IR DE+  L++ +RS  G P N++++IFLFT+ IICR+AFG+V   R +F+   K+
Sbjct  154   LFSAIREDELTSLISSIRSMRGSPVNMTKKIFLFTNCIICRSAFGKVCKDRGEFLTTLKE  213

Query  974   ISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT----  807
             + +L   F  AD++PSWK LH L G K+ ++  H+K D+++E I+N+H     +G     
Sbjct  214   VLLLAAGFFMADLYPSWKLLHNLRGEKTRMVNAHKKVDAVMEEILNEHIENKAAGKKGNG  273

Query  806   --GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPR  633
               G++ ++DVLL++ ++  LQ PIT+D+IKA+I D+F  G+ +S++T +WA+SEM+KNP 
Sbjct  274   EFGDEDLVDVLLRVKENAELQYPITNDHIKAVIFDIFLGGTGSSSSTIIWALSEMIKNPN  333

Query  632   VLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVING  453
             V+ KAQ+EVR+VFKGK+   E +VE L YLK+V+KETLR H P PL+ +RECRE+ VI+ 
Sbjct  334   VMIKAQSEVRQVFKGKQNFSEEEVENLTYLKSVIKETLRLHTPAPLLGSRECREQRVID-  392

Query  452   GYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICP  273
             GYTIP+K +V+VNA+ALA DP+ W++PE FIPERFE++ +DF G+HF+++PFG+GRR+CP
Sbjct  393   GYTIPLKARVLVNAWALARDPESWDDPENFIPERFENSSIDFMGNHFEFIPFGSGRRVCP  452

Query  272   GLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GL  G AN I PLA LLY+F+W+LP G   E LDMTE  GL   +K +
Sbjct  453   GLLLGVANVIHPLAQLLYHFEWELPNGTNPEDLDMTETHGLTAEKKEN  500



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   503 bits (1296),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 250/489 (51%), Positives = 350/489 (72%), Gaps = 12/489 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             NLI+  LF+SFL ++  +W   +  K+PPGP +LP+IG+L H+ G  LPH  LRDLARKY
Sbjct  9     NLIALLLFISFLFILLKKWN-TKIPKLPPGPWRLPLIGSLHHLKGK-LPHHHLRDLARKY  66

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GE+  VV+SSP +AK  L+THDLAFATR   ++  I+ Y + DI   PYGDY
Sbjct  67    GPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPYGDY  126

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR-SSAGRPFNVSERIFLFTSSIIC  1035
             WRQMRKI   ELL+ ++++SFS+IR DE+ +LL+ +R ++A    N++E++  FTS + C
Sbjct  127   WRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSSIRLATASSAVNINEKLLWFTSCMTC  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             R AFG++ + R++ I   ++I  L+G FD  D+FPSWK LH +   K+ +   H K + I
Sbjct  187   RLAFGKICNDRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYNLI  246

Query  854   IESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             +E+IIN+H+    +G        GED +ID LL++ ++  LQ PI +DN+KA+I+D+F A
Sbjct  247   MENIINEHKENHAAGIKGNNEFGGED-MIDALLRVKENNELQFPIENDNMKAVILDLFIA  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ETS T  +WA+SE+MK+P V+AKAQAEVR+VFK  E L+E+D+++LPYLK+V+KETLR
Sbjct  306   GTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECRE+T I+ GYT+P+K +VMVNA+A+  DP+ WE+PE F PERFE+  
Sbjct  366   MHPPVPLLGPRECREQTEID-GYTVPLKARVMVNAWAIGRDPESWEDPESFKPERFENIS  424

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             VD  G+H+Q++PFG+GRR+CPG++FG  NT  PLA LLY FDWK P  V A     TE  
Sbjct  425   VDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYFFDWKFPHKVNAADFHTTETS  484

Query  155   GLAVARKND  129
              +  A K+D
Sbjct  485   RVFAASKDD  493



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   503 bits (1296),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 250/489 (51%), Positives = 350/489 (72%), Gaps = 12/489 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             NLI+  LF+SFL ++  +W   +  K+PPGP +LP+IG+L H+ G  LPH  LRDLARKY
Sbjct  9     NLIALLLFISFLFILLKKWN-TKIPKLPPGPWRLPLIGSLHHLKGK-LPHHHLRDLARKY  66

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GE+  VV+SSP +AK  L+THDLAFATR   ++  I+ Y + DI   PYGDY
Sbjct  67    GPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPYGDY  126

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR-SSAGRPFNVSERIFLFTSSIIC  1035
             WRQMRKI   ELL+ ++++SFS+IR DE+ +LL+ +R ++A    N++E++  FTS + C
Sbjct  127   WRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSSIRLATASSAVNINEKLLWFTSCMTC  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             R AFG++ + R++ I   ++I  L+G FD  D+FPSWK LH +   K+ +   H K + I
Sbjct  187   RLAFGKICNDRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYNLI  246

Query  854   IESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             +E+IIN+H+    +G        GED +ID LL++ ++  LQ PI +DN+KA+I+D+F A
Sbjct  247   MENIINEHKENHAAGIKGNNEFGGED-MIDALLRVKENNELQFPIENDNMKAVILDLFIA  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ETS T  +WA+SE+MK+P V+AKAQAEVR+VFK  E L+E+D+++LPYLK+V+KETLR
Sbjct  306   GTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECRE+T I+ GYT+P+K +VMVNA+A+  DP+ WE+PE F PERFE+  
Sbjct  366   MHPPVPLLGPRECREQTEID-GYTVPLKARVMVNAWAIGRDPESWEDPESFKPERFENIS  424

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             VD  G+H+Q++PFG+GRR+CPG++FG  NT  PLA LLY FDWK P  V A     TE  
Sbjct  425   VDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYLFDWKFPHKVNAADFHTTETS  484

Query  155   GLAVARKND  129
              +  A K+D
Sbjct  485   RVFAASKDD  493



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   502 bits (1292),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 346/473 (73%), Gaps = 9/473 (2%)
 Frame = -2

Query  1526  YTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +++  K  + K+PPGP +LPIIG++ H+T    PHR L +L++KYG +M LQ+GE+  VV
Sbjct  23    WSRNSKTLKKKLPPGPWRLPIIGSVHHLTRGT-PHRVLGNLSQKYGPIMYLQLGEVPTVV  81

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             VSSP MAK+ L+THDLAFA+R+ T+ G IL YN++DI   PYGDYWR MRK+ + ELL+ 
Sbjct  82    VSSPHMAKQILKTHDLAFASRSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSA  141

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             ++V+SFSSIRHDE+  LL+ + S  G P N+SE++F F ++  CR+ FG+    + + + 
Sbjct  142   KMVKSFSSIRHDELSNLLSSIDSMVGSPINLSEKLFWFMNASTCRSTFGKTCKNQNELVT  201

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG-  810
               +    L+  F+ AD+FPS   LH + G +S+++K   K D ++++IIN HR    +G 
Sbjct  202   LIQRAMSLSSGFELADLFPSKTFLHGISGMESKLMKARNKVDILLDNIINVHRENHTNGK  261

Query  809   -----TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                  +G + +IDV L++M+SG  Q P+T+DNIKA+I+DMF AGS+TS+ T +WA+SEMM
Sbjct  262   NYNGESGTEDLIDVFLRVMESGEFQFPLTNDNIKAVILDMFVAGSDTSSATVIWALSEMM  321

Query  644   KNPRVLAKAQAEVREVFKGKEML-EESDVEQLPYLKTVVKETLRCHPPTPLIATRECREE  468
             K+P V+AKAQAEVREVFKGKE   +++D+E+L YLK V+KETLR HPPTPL+  RECREE
Sbjct  322   KSPSVMAKAQAEVREVFKGKETCNDDTDLEKLNYLKLVIKETLRLHPPTPLLVPRECREE  381

Query  467   TVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAG  288
             T I+ G+TIP+K+KV+VN +A+  DP+ WE PE FIPERFE++ ++F G+ FQ +PFGAG
Sbjct  382   TKID-GFTIPLKSKVLVNVWAIGRDPKSWENPECFIPERFENSSIEFTGNCFQLLPFGAG  440

Query  287   RRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RR+CPG+ FG A    PLAHLLY FDWKLPEG+    LDMTE  G+   R+ND
Sbjct  441   RRMCPGIHFGIALVTLPLAHLLYKFDWKLPEGIHVRDLDMTESNGITARREND  493



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   502 bits (1293),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 350/464 (75%), Gaps = 12/464 (3%)
 Frame = -2

Query  1490  PPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYG-GLMSLQIGEISAVVVSSPDMAKEF  1317
             PPGP KLPI+G++ H+      PH AL +LA+KYG  LM LQ+GEIS VVVSS DMA+E 
Sbjct  37    PPGPWKLPILGSVHHLALEGGHPHHALANLAKKYGPDLMHLQLGEISTVVVSSLDMAREV  96

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFA+R + LA  I+ Y ++DI    YGDYWRQMRK+ + ELL+ + VRSF+SIR
Sbjct  97    LKTHDLAFASRPKLLALEIIFYKSTDIAFSAYGDYWRQMRKVAVLELLSAKNVRSFTSIR  156

Query  1136  HDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLT  960
              DE  RL+  +RSS    P NV+ERI  + SS+ C+AAFGE+   +++FI   ++++ L+
Sbjct  157   RDEASRLIQIIRSSPTDEPINVTERILWYESSMTCKAAFGELLKDQKKFILIVRELTELS  216

Query  959   GSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-------GE  801
             G F  AD+FPS K LH L G K  IL TH++ D+I+E +IN+H   L +G        GE
Sbjct  217   GGFSVADIFPSIKILHLLSGMKGRILNTHKRVDAIVEDVINEHIKNLANGKAGNGALGGE  276

Query  800   DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAK  621
             D ++DVLL+L +SG LQ+PIT+DNIKA++ID+F AG+ETS+TT++WAM+EMM+NP+V AK
Sbjct  277   D-LVDVLLRLKESGELQIPITNDNIKAVMIDLFSAGTETSSTTTIWAMTEMMRNPKVYAK  335

Query  620   AQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTI  441
             AQAEVREVFKGKE ++E ++E+L YLK VVKETLR HPP PL+  RECREET IN GYTI
Sbjct  336   AQAEVREVFKGKETIDEDNIEELKYLKQVVKETLRLHPPLPLLLPRECREETNIN-GYTI  394

Query  440   PVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAF  261
             P+KT+VMVNA+A+  DP+YWE+ E+F PERFE   VDF G++F+Y+PFG+GRR+CPG++F
Sbjct  395   PLKTRVMVNAWAIGRDPKYWEDAEQFKPERFEHGSVDFMGNNFEYLPFGSGRRMCPGISF  454

Query  260   GFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G  N   PLA LLY+ DWKLP+GV  E LDMTE   +  ARK++
Sbjct  455   GLINVHLPLAKLLYHCDWKLPDGVKPEDLDMTEFTAITAARKSE  498



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   501 bits (1291),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/489 (51%), Positives = 354/489 (72%), Gaps = 11/489 (2%)
 Frame = -2

Query  1574  ENLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             ++L+SF LF+SF+ L+  +W+K +R  +PPGP +LPIIG++ H+T  V  HR LR+L++K
Sbjct  4     QHLVSFLLFISFIFLLIQKWRKSKR--LPPGPWRLPIIGSVHHLTSGV-SHRVLRNLSQK  60

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             +G +M LQ+GE+  VVVSSP MAK+ L+THDLAFA+R E + G I+ Y+  DI   PYGD
Sbjct  61    FGPIMYLQLGEVPTVVVSSPHMAKQILKTHDLAFASRPEIMMGKIICYDCKDIAFSPYGD  120

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWR MRK+   ELL+ ++V+SFS IR DE+  LL+ + S    P N+ E++  F ++  C
Sbjct  121   YWRHMRKLSTLELLSAKMVKSFSPIRRDELSSLLSSIESMGDLPINLVEKLLWFMNAATC  180

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             R+AFG+V   +++ I        L+G F+ AD+FPS K LH + G +S++++   K D +
Sbjct  181   RSAFGKVCKDQKELITLIHRAQSLSGGFELADLFPSKKFLHGISGMRSKLMEARNKIDVV  240

Query  854   IESIINDHRNKLESG------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             +++IIN HR    +G      +G +  IDV  ++M+SG L  P+ +DNIKA+I+DMF AG
Sbjct  241   LDNIINVHRENRANGKCCNGESGAEDFIDVFQRVMESGELPFPLENDNIKAVILDMFVAG  300

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEML-EESDVEQLPYLKTVVKETLR  516
             S+TS++T +WA++EM+KNP V+AKAQAEVRE FKGK+   E++D+E+L YL  V+KETLR
Sbjct  301   SDTSSSTVIWALAEMIKNPSVMAKAQAEVREAFKGKKTCDEDTDLEKLSYLNLVIKETLR  360

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  RECREET I+ G+TIP+K+KV+VN +A+  DP+ W  PE FIPERFE++ 
Sbjct  361   LHPPTPLLVPRECREETEID-GFTIPLKSKVLVNVWAIGRDPENWGNPECFIPERFENSS  419

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             ++F G+HFQ +PFGAGRRICPG+ FG A    PLAHLL+NFDWKLPEG+ A  LDMTE  
Sbjct  420   IEFTGNHFQLLPFGAGRRICPGIQFGMALVTLPLAHLLHNFDWKLPEGINARDLDMTEAN  479

Query  155   GLAVARKND  129
             G++  R+ D
Sbjct  480   GISARREKD  488



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 346/465 (74%), Gaps = 11/465 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+PP P KLPIIG++ H+ G   PH ALR LA+KYG LM++Q+G+++A+VV+SP +AKE 
Sbjct  32    KLPPSPWKLPIIGHMHHLLGSP-PHHALRKLAQKYGPLMNIQLGQMTAIVVTSPRLAKEI  90

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             ++THDLAFA RAE L+G I+ Y+ SDI    YGDYWRQMRKIC  ELL+ + VRSF S+R
Sbjct  91    MKTHDLAFADRAEFLSGKIMCYDCSDIACCRYGDYWRQMRKICTLELLSAKSVRSFVSVR  150

Query  1136  HDEIHRLLADVRSSAG--RPFNVSERIFLFTSSIICRAAFGEVF-DGREQFIQQTKDISV  966
              DE   L++ ++  AG   P +++E++  +TSS++CRAAFG+V  D    F+Q  K+   
Sbjct  151   QDEALHLISSIKVLAGAREPIDLTEKVSSYTSSVVCRAAFGKVSKDDHAAFLQLMKEALP  210

Query  965   LTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH-----RNKLESGT-G  804
             +  +FD +D+ PS+K LHPL   +S++LK H K D I+E II+ H     R  + +G  G
Sbjct  211   IASAFDISDLLPSFKILHPLLSVESKLLKMHDKEDEILEKIIDQHIDNQARRNISTGEYG  270

Query  803   EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLA  624
             ++ +IDVLL++ +SG LQ PIT +NIKA+I D+FGAG+ETS++   WAMSEM++NP V+A
Sbjct  271   QEDLIDVLLRVKESGELQFPITKNNIKAVIHDVFGAGTETSSSIVDWAMSEMIRNPGVMA  330

Query  623   KAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYT  444
             KAQ+E+R  F+GK  +EE+D++QL YL++V+KETLR HPP PL+  RECREE  I+ GY 
Sbjct  331   KAQSEIRNAFRGKNTIEETDIQQLQYLRSVIKETLRLHPPIPLLIPRECREECEID-GYI  389

Query  443   IPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLA  264
             IPVKTK++VNA+A+  DP+YW++PE F PERFE++ +DF GS F+++PFGAGRRICPG++
Sbjct  390   IPVKTKILVNAWAIGRDPEYWDDPECFKPERFEESPIDFTGSRFEFLPFGAGRRICPGIS  449

Query  263   FGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             FG AN    LA LLY+FDWKLP G+  + LDM E +G+  +R N+
Sbjct  450   FGLANVEVALALLLYHFDWKLPNGLDTKDLDMKETVGITASRTNN  494



>gb|AIZ01224.1| epi-aristolochene dihydroxylase, partial [Nicotiana benthamiana]
Length=438

 Score =   499 bits (1284),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 251/440 (57%), Positives = 329/440 (75%), Gaps = 11/440 (3%)
 Frame = -2

Query  1454  LLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAET  1275
             +LH+ G   PH  LRDLA+KYG LM LQ+GEISAVVV+S DMAKE L+THD+ FA+R + 
Sbjct  1     MLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVTSRDMAKEVLKTHDVVFASRPKI  59

Query  1274  LAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS  1095
             +A  I+ YN SDI   P+GD+WRQMRKIC+ ELLN + VRSFSSIR DE+ RL+  +RS 
Sbjct  60    VAMDIICYNQSDIAFSPHGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSD  119

Query  1094  A--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWK  921
             +  G   N ++RI  F SS+ CR+AFG+V  G++ F ++ +++  L   FD  D+FP++K
Sbjct  120   SSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIFPTYK  179

Query  920   ALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT------GEDCIIDVLLKLMDSG  759
              LH L G K ++L  H K D+I+E +IN+H+  L +G       GED +IDVLL+LM+  
Sbjct  180   FLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGED-LIDVLLRLMNDT  238

Query  758   NLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEM  579
             +LQ PIT+DNIKA+I+DMF AG+ETS+TT++WAM+EMMKNPRV  KAQAEVRE F+ K  
Sbjct  239   SLQFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPRVFTKAQAEVREAFRDKVS  298

Query  578   LEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALA  399
              +E+DVE+L YLK V+KETLR HPP+PL+  RECRE+T IN GYTIP KTKVMVN +AL 
Sbjct  299   FDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDTDIN-GYTIPAKTKVMVNVWALG  357

Query  398   TDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLY  219
              DP+YW++ E F PERFE   +DF G++F+++PFG GRRICPG++FG AN   PLA LLY
Sbjct  358   RDPKYWDDAESFKPERFEQCSLDFYGNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLY  417

Query  218   NFDWKLPEGVTAETLDMTEM  159
             +FDWKLP G+    LD+TE+
Sbjct  418   HFDWKLPTGMKPRDLDLTEL  437



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/492 (51%), Positives = 341/492 (69%), Gaps = 13/492 (3%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKM--PPGPRKLPIIGNLLHITGPV-LPHRALRDLAR  1398
              IS  LF+ F+  ++  WKK +      PPGP KLPIIGNL  +     LPH  LR L++
Sbjct  11    FISLLLFLYFIFYLFQIWKKSKTLTKKLPPGPWKLPIIGNLHQLASHGGLPHHTLRTLSQ  70

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG L  LQ+GEISA+VVSSP+MAKE ++T D+ FATR +++ GSI+ YN SDI L PYG
Sbjct  71    KYGPLTHLQLGEISAIVVSSPEMAKEIMKTQDVRFATRPQSMTGSIIFYNYSDIALCPYG  130

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRP--FNVSERIFLFTSS  1044
             DYWR MRKIC+ ELL+ ++V+SF+SIR +E+  L++ + +S       N+S +IF FT S
Sbjct  131   DYWRNMRKICVLELLSAKMVKSFNSIRQEEMSSLVSSIINSTPDESLVNLSNKIFWFTGS  190

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             + CR+AFG+V   +++ I   K+   L+  FD  D+FPS K LH + G KS +LK H K 
Sbjct  191   VTCRSAFGKVVHDQDKLIMLVKEAVSLSSGFDLTDLFPSHKWLHGISGMKSRLLKAHEKV  250

Query  863   DSIIESIINDH------RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMF  702
             D I+E +IN+H       NK    +G + +IDVLL++M+SG   +PIT+ NIKA+I +MF
Sbjct  251   DVILEKLINEHCENRANGNKGNGESGAEDLIDVLLRVMESGEFGMPITNQNIKAVIFEMF  310

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
              AG+ETS+TT +WA SEM+KNP V+AKAQ EVRE FKGK+  E+ D+E+L YLK V+KET
Sbjct  311   MAGAETSSTTIIWAFSEMIKNPGVMAKAQLEVREAFKGKKTFEDIDLEELKYLKLVIKET  370

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HP  PL+  RECREET I+ GY IP+KTKV+VNA+A+  D +YW +          +
Sbjct  371   LRLHPAAPLLIPRECREETQID-GYNIPIKTKVIVNAWAIGRDSRYWHDDPESFIPERFE  429

Query  341   N-GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMT  165
             N  +DF G++F+++PFGAGRR+CPG+  G A     LA LLY+FDWKLP+GV+ +  DMT
Sbjct  430   NSSIDFRGNNFEFIPFGAGRRMCPGMLSGLATVGHSLAKLLYHFDWKLPDGVSVDDFDMT  489

Query  164   EMLGLAVARKND  129
             E  G+A +RKND
Sbjct  490   EAEGVAASRKND  501



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   501 bits (1289),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 249/489 (51%), Positives = 349/489 (71%), Gaps = 12/489 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             NLI+  LF+SFL ++  +W   +  K+PPGP +LP+IG+L H+ G  LPH  LRDLARKY
Sbjct  9     NLIALLLFISFLFILLKKWN-TKIPKLPPGPWRLPLIGSLHHLKGK-LPHHHLRDLARKY  66

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GE+  VV+SSP +AK  L+THDLAFATR   ++  I+ Y + DI   PYGDY
Sbjct  67    GPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPYGDY  126

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR-SSAGRPFNVSERIFLFTSSIIC  1035
             WRQMRKI   ELL+ ++++SFS+IR D + +LL+ +R ++A    N++E++  FTS + C
Sbjct  127   WRQMRKILTQELLSNKMLKSFSTIRKDGLSKLLSSIRLATASSAVNINEKLLWFTSCMTC  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             R AFG++ + R++ I   ++I  L+G FD  D+FPSWK LH +   K+ +   H K + I
Sbjct  187   RLAFGKICNDRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYNLI  246

Query  854   IESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             +E+IIN+H+    +G        GED +ID LL++ ++  LQ PI +DN+KA+I+D+F A
Sbjct  247   MENIINEHKENHAAGIKGNNEFGGED-MIDALLRVKENNELQFPIENDNMKAVILDLFIA  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ETS T  +WA+SE+MK+P V+AKAQAEVR+VFK  E L+E+D+++LPYLK+V+KETLR
Sbjct  306   GTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECRE+T I+ GYT+P+K +VMVNA+A+  DP+ WE+PE F PERFE+  
Sbjct  366   MHPPVPLLGPRECREQTEID-GYTVPLKARVMVNAWAIGRDPESWEDPESFKPERFENIS  424

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             VD  G+H+Q++PFG+GRR+CPG++FG  NT  PLA LLY FDWK P  V A     TE  
Sbjct  425   VDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYFFDWKFPHKVNAADFHTTETS  484

Query  155   GLAVARKND  129
              +  A K+D
Sbjct  485   RVFAASKDD  493



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   499 bits (1284),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 255/502 (51%), Positives = 348/502 (69%), Gaps = 25/502 (5%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQR--RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             NL + AL V  + L+  +WKK +    K+PPGP+KLPIIG+L  I+   LP R+ RDLA+
Sbjct  8     NLTAVALLVPVIFLLIKKWKKSKPVSVKLPPGPKKLPIIGDLHLISA--LPFRSFRDLAK  65

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG +M L++GE+  +VVSSP++AKE LR HD  FA R E +A  I+ YN  DI   PYG
Sbjct  66    QYGPIMHLKLGEVPTIVVSSPEIAKEVLREHDPNFADRPEAIAMKIMWYNYIDIAFSPYG  125

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQMRKICI ELLN + VRSFSSIR+DE+ RL+  +R S+G P N++E+IF  TSSI 
Sbjct  126   DYWRQMRKICIIELLNAKNVRSFSSIRNDEVSRLIKSIRLSSGEPVNLTEKIFSLTSSIT  185

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CRAAFG+V    +  I+  K+   + G F+ AD+FPS K ++ L  +K  ++   RK D 
Sbjct  186   CRAAFGKVCKDSDALIKLLKEGIQMAGGFEIADLFPSSKIINALSWSKLRLVMMRRKLDV  245

Query  857   IIESIINDHRNKL-----ESGTGE--------------DCIIDVLLKLMDSGNLQVPITH  735
             I++ II +H+  L     E+G GE              + ++DV L++ +SG L+ PI +
Sbjct  246   ILDDIIKEHKENLAKMARENGDGEGKESARRGNGEFGNEDLVDVFLRIQESGELEFPIGN  305

Query  734   DNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQ  555
             DNIKA+I DMF AG+ETS+T   W M+E+++NPRV+AKAQAEVRE F G E+++E+DV++
Sbjct  306   DNIKAVIYDMFSAGTETSSTAIDWTMAELVRNPRVMAKAQAEVREFFNGSEIIQENDVQK  365

Query  554   LPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWee  375
             L YLK V++E+LR HPP P++  R  REE  I+ GYTIP K KV+VN +A+  DP+YW  
Sbjct  366   LKYLKLVIRESLRLHPPVPILP-RASREEREIS-GYTIPAKVKVLVNNWAMQRDPKYWTN  423

Query  374   perfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPE  195
             PE F PERFE+  +DF G+ FQY+PFG GRR+CPG+ FG A+   PLA LLY+F+WKLP+
Sbjct  424   PETFEPERFENQSLDFLGADFQYLPFGTGRRMCPGMTFGLASVELPLAQLLYSFNWKLPD  483

Query  194   GVTAETLDMTEMLGLAVARKND  129
             GV AE LDM E  G+  +RK++
Sbjct  484   GVKAEDLDMIENPGITASRKDN  505



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   498 bits (1282),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 263/495 (53%), Positives = 358/495 (72%), Gaps = 18/495 (4%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRR----GKMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             N I+F +F++ ++ ++ +WKK R+     K+PPGPRKLP IGNL ++ G  LPH+AL +L
Sbjct  6     NFITFFIFLALILTLWKRWKKPRKVNATQKLPPGPRKLPFIGNLHNLLGS-LPHQALTNL  64

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A+K+G LM LQ+GE+SA+VVSSP  AKE L+THDLAFA R E L G I+ Y+ S I   P
Sbjct  65    AKKHGDLMHLQLGEVSAIVVSSPRSAKEILKTHDLAFADRPEVLVGKIICYDYSSIAFCP  124

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS--AGRPFNVSERIFLFT  1050
             YG+YWRQMRKIC  ELL+ ++VRSF SIR DE+  LL+ +R+S   G+P N++E +  FT
Sbjct  125   YGEYWRQMRKICTLELLSAKMVRSFGSIRQDEVLHLLSSIRASTGGGKPINLTEEVSSFT  184

Query  1049  SSIICRAAFGEVFDGREQ-FIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTH  873
             SS++CR+AFG++F  +    IQ  K++   T  FD +D+FPS K LH L   K  +LK H
Sbjct  185   SSMVCRSAFGKMFGEKNTILIQLVKEVLSRTSGFDISDLFPSQKILHHLSWMKPTLLKVH  244

Query  872   RKTDSIIESIINDHRNKLESG------TGEDCIIDVLLKLMDS-GNLQVPITHDNIKAII  714
              K D I+++IIN+H   L  G      +G++ +ID+LL++ +S G+L+ PIT+  +KAI+
Sbjct  245   HKIDVILDNIINEHIRNLARGKGGNGESGQEDLIDILLRIKESGGDLRFPITNKIVKAIM  304

Query  713   IDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTV  534
              DMF A +ETS T   WAMSEM++NP V++KAQ E+R+ F GK  +EE D+E L YLK+V
Sbjct  305   FDMFTAATETSATVVEWAMSEMIRNPDVMSKAQNEIRKAFMGKAKIEEMDIEGLIYLKSV  364

Query  533   VKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfipe  354
             +KETLR HPP PL+   ECRE+ V++ GY IP+KT+V+VNA+A+  DP+YW+ PE F PE
Sbjct  365   IKETLRLHPPLPLLVPMECREQRVLD-GYVIPIKTRVLVNAWAIHRDPKYWDYPESFKPE  423

Query  353   rfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETL  174
             RF++N VDF G+HF Y+PFG GRRICPG++FG AN   PLA LLYNFDWKLP G   + L
Sbjct  424   RFDNNPVDFTGTHFHYLPFGGGRRICPGISFGLANVELPLAQLLYNFDWKLPPG--KDGL  481

Query  173   DMTEMLGLAVARKND  129
             DMTE  G+ VARK++
Sbjct  482   DMTEAFGITVARKSN  496



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   496 bits (1278),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 254/475 (53%), Positives = 336/475 (71%), Gaps = 15/475 (3%)
 Frame = -2

Query  1514  KKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSP  1335
             K Q   K+PPGP K+P IG++ HI G   PH  LRDLA+KYG LM LQ+GE+  VVV+S 
Sbjct  26    KSQTTKKLPPGPWKIPFIGSIHHIVGG-YPHHVLRDLAKKYGPLMHLQLGEVCVVVVTSS  84

Query  1334  DMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVR  1155
             +MAK+  +THDLAFA+R + L   I+ YN+ DI   PYGDYW+QMRKI + ELLN + VR
Sbjct  85    EMAKQIFKTHDLAFASRPKLLVMDIITYNSRDIAFSPYGDYWKQMRKISVMELLNAKNVR  144

Query  1154  SFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQT  981
             SFSSIRHDE+  L+  +RSS+  G P N SER+  F SS++CR+AFG++   ++ FI+  
Sbjct  145   SFSSIRHDEVVHLIDSIRSSSSSGEPVNFSERVLWFASSMLCRSAFGKLPKDQDIFIKLV  204

Query  980   KDISVLTGS-FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES---  813
             + +  L+   FD AD+FPS+K LH L G K +IL  H K DSI+E +IN+H+    +   
Sbjct  205   RQVLRLSNQGFDMADIFPSYKFLHGLGGLKKKILDVHYKIDSIVEDVINEHKKSFANHKR  264

Query  812   -------GTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
                    G G++ +IDVLL+LM   +LQ PI +  IKAII+D+F  G++T++   +WAM+
Sbjct  265   TSDDDALGGGDEDLIDVLLRLMKDKSLQFPINNHTIKAIIVDIFAGGTDTTSIIIVWAMA  324

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EMM+NP +LAKAQAEVRE FKGK   ++ DVE+L YLK VVKETLR HP  PL   RECR
Sbjct  325   EMMRNPSILAKAQAEVREAFKGKVKFDKYDVEELKYLKLVVKETLRLHPSVPLSVPRECR  384

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             EET IN GYTIP+KTK+++N +AL  DP+YW++PE F PERFE   VDF G++F+++PFG
Sbjct  385   EETDIN-GYTIPLKTKILINVWALGRDPEYWDDPESFKPERFEQCSVDFIGNNFEFLPFG  443

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +GRR+CPG++FG AN  S LA  LY+FDWKLP G+    LD+TE  G +   KND
Sbjct  444   SGRRVCPGISFGLANIYSSLAQSLYHFDWKLPNGMDPTDLDLTESDGGSTGMKND  498



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   495 bits (1275),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 246/489 (50%), Positives = 336/489 (69%), Gaps = 11/489 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQR--RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
              IS  LF+S   LV  +WKK +     +PPGP +LP IGNL H     LPHR+LR+L++K
Sbjct  20    FISLVLFLSSFFLVSQKWKKSKSPNKTLPPGPWRLPFIGNL-HQLMSDLPHRSLRNLSKK  78

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG +M L++G IS +V+SS +MAKE ++T DL F  R + ++ SI+ Y+ +DI    YGD
Sbjct  79    YGPIMHLRLGNISTIVISSSEMAKEIMKTQDLHFVDRPQIMSTSIIFYDCTDIGFSSYGD  138

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPF-NVSERIFLFTSSII  1038
             YWR MRK+C+ ELL+ ++V+S +SIR +EI  L++ +RSS      N+S +IF FT+++ 
Sbjct  139   YWRNMRKVCVLELLSTKMVKSLASIRQEEISNLISSLRSSTPDSLINLSNKIFWFTNTVT  198

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             CRA  G++   R +FI   KDI  L G FD  D+FPS K LH + G K ++ K H K D 
Sbjct  199   CRAVSGKIIHDRNKFIMLVKDIYSLIGGFDLTDLFPSQKWLHNISGMKYKLSKAHSKVDE  258

Query  857   IIESIINDHRNKLESGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             I+E I+NDHR+    GT      G +  +D LL++M+S      IT+ NIKA+I+DMF A
Sbjct  259   ILEQIVNDHRDNRAKGTKYNGESGNEDFVDALLRVMESEEFGPRITNQNIKAVILDMFLA  318

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ET++TT +WA  E++KNPRV+ KAQ EVRE   GK+   ++D+E+L YL+ V+KETLR
Sbjct  319   GTETASTTLIWAFLELIKNPRVMVKAQLEVRERLNGKKTFNDTDLEELNYLQFVIKETLR  378

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECREET I+ GYTIPVKTKV+VNA+++  DP+YW   E FIPERFE++ 
Sbjct  379   LHPPAPLLIPRECREETKID-GYTIPVKTKVLVNAWSIGRDPKYWHNSESFIPERFENSS  437

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G+HF+++PFGAGRR+CPG+ FG  N   PL+ LLY+FDWK+P GV    LD  E  
Sbjct  438   IDFRGNHFEFIPFGAGRRMCPGMLFGLVNIAHPLSQLLYHFDWKVPHGVNPNDLDTIETE  497

Query  155   GLAVARKND  129
             GL   RKND
Sbjct  498   GLTARRKND  506



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/500 (50%), Positives = 352/500 (70%), Gaps = 21/500 (4%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQ---RRGKMPPGPRKLPIIGNL------LHITGPVL-PH  1422
             N ++  +  SFL  ++ +  ++   ++ K+PPGP +LPIIG+L       H+ G +L PH
Sbjct  10    NFVALLILFSFLFTLFDKLLRKSLAKQEKLPPGPWRLPIIGSLPIIGSLHHLRGALLFPH  69

Query  1421  RALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNS  1242
             R L++LA KYG +M LQ+GEI AV+VSSP+M KE L+TH+LAFAT+ +  +  I  YN  
Sbjct  70    RTLKNLATKYGPIMYLQLGEIRAVIVSSPNMVKEILKTHELAFATKPQLTSIDITTYNYK  129

Query  1241  DIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPF-NVSER  1065
             DI   PYGD WRQMR IC+TELL+ ++V+SFSSI+ DEI RLL+ +RS+ G    N++E 
Sbjct  130   DIAFAPYGDKWRQMRNICVTELLSTKMVKSFSSIQKDEIMRLLSSIRSTNGSHLVNLTEL  189

Query  1064  IFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEI  885
             I  +T+S+ CR+AFG+V+  ++Q I   +D+    G FD AD+FPSWK LH + G KS++
Sbjct  190   ILRYTNSVTCRSAFGKVYTNQDQLINLLRDVLDTLGGFDVADLFPSWKLLHKMSGVKSKL  249

Query  884   LKTHRKTDSIIESIINDH---RNKLESGTGEDCI-----IDVLLKLMDSGNLQVPITHDN  729
             LK H+K D  +E+I+N+H   R+    G GE  +     +DVLL++ ++G LQ PIT D+
Sbjct  250   LKMHKKVDEALENIVNEHIKNRSLGCKGNGEKLVGGEDLVDVLLRVKENGELQFPITSDH  309

Query  728   IKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLP  549
             IKAII DMF AG+ETS  T +WA+SEMM+ P ++AKAQ EVR+VFKG   + E D+++L 
Sbjct  310   IKAIISDMFAAGTETSAATIIWALSEMMRRPNIMAKAQNEVRQVFKGNTTINEDDLDKLI  369

Query  548   YLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeepe  369
             YLK V+KETLR HPP+ L+  RECR++T IN GYTIP KT+V++N +AL  D + W++ E
Sbjct  370   YLKLVIKETLRLHPPSTLLP-RECRKQTYIN-GYTIPPKTRVLINTWALGRDSESWDDTE  427

Query  368   rfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGV  189
              FIPERFE++ VD+ G++F+++PFG+GRRICPG+ FG  N   PLA LLY+FDW LP G 
Sbjct  428   SFIPERFENSHVDYMGNYFEFIPFGSGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGA  487

Query  188   TAETLDMTEMLGLAVARKND  129
               E LDM E  GL+ A+  D
Sbjct  488   NPEDLDMIEKNGLSAAKHKD  507



>ref|XP_011081935.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=506

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 254/495 (51%), Positives = 355/495 (72%), Gaps = 12/495 (2%)
 Frame = -2

Query  1589  RSNIMENLISFA-----LFVSFLVLVYTQWKK----QRRGKMPPGPRKLPIIGNLLHITG  1437
             R  +ME  + F+     LF SF+ L+   W+K    ++  K+PP P KLP+IG+L H+ G
Sbjct  2     REQVMEIQLPFSFTTLLLFSSFIFLLIRAWEKLNSPKKYEKLPPSPPKLPVIGHLHHLVG  61

Query  1436  PVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSIL  1257
               LPH ALR +A+KYG ++ L++GE+SAVV+SS +  KE ++  D A A R E++   I+
Sbjct  62    G-LPHHALRRVAQKYGPVLYLKLGEVSAVVISSREATKEVVKLQDPACADRPESIGSKIM  120

Query  1256  LYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFN  1077
              Y+ +DI    Y +YWRQMRKICI ELL+ + V+SF SIR DE+ RL+  ++SS+G+  N
Sbjct  121   WYDYTDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDEVSRLMKSLQSSSGQAIN  180

Query  1076  VSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGN  897
             ++E++F FTSSI CRAAFG+V   R+  I   K    + G F+ AD+FPS K LH L  N
Sbjct  181   LTEKVFAFTSSITCRAAFGKVMRDRDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWN  240

Query  896   KSEILKTHRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAI  717
             K ++L+  RK D+I+++I+ +H+ K     G + I+DVLL++  +G LQ PIT+DNIKA+
Sbjct  241   KYKLLRMRRKLDTILDAILEEHKLKQSGEFGGEDIVDVLLRMQKTGELQFPITNDNIKAV  300

Query  716   IIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKT  537
             I DMF AG+ETS+TT  WAM+E+M+NPRV+AK QAE +E FKGK  +EESDV+ L YLK 
Sbjct  301   IFDMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEQKEAFKGKTTVEESDVQALKYLKL  360

Query  536   VVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfip  357
             V+KET R HPP PL+  R CR+E  +N GYTIP+K+KVM+N + +  DP+YW +PE F P
Sbjct  361   VIKETFRLHPPIPLLP-RACRDECKVN-GYTIPLKSKVMINIWGMGRDPEYWHQPETFQP  418

Query  356   erfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAET  177
             ERF++N +DF G++F+Y+PFGAGRRICPG+ FG AN   PLA LLY+FDWK+P+G+T + 
Sbjct  419   ERFDNNSIDFLGNNFEYIPFGAGRRICPGMNFGLANVELPLAKLLYHFDWKMPKGMTPDD  478

Query  176   LDMTEMLGLAVARKN  132
             +DMTE  G+AV+R+N
Sbjct  479   IDMTEAEGIAVSRRN  493



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   494 bits (1271),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 240/463 (52%), Positives = 334/463 (72%), Gaps = 10/463 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+PPGP +LP+IG+L H+ G  LPH  LRDLARK+G LM LQ+GE+  VV+SSP +AK  
Sbjct  33    KLPPGPWRLPLIGSLHHLKGK-LPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFATR + +A  I+ Y + DI   PYGDYWRQMRK+   ELL+ ++++S++ IR
Sbjct  92    LKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKMLKSYNMIR  151

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+ +LL+ +R S G   N++E++  FTS + CR AFG++ + R++ I   ++I  L+G
Sbjct  152   KDELSKLLSSIRLSTGSAVNITEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSG  211

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-------GED  798
              FD  D+FPSWK LH +   K+ +   H K D I+E+IIN+H+    +G        GED
Sbjct  212   GFDVCDLFPSWKLLHNMSNMKARLTNVHHKYDQIMENIINEHKENHAAGIKGNNEFGGED  271

Query  797   CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKA  618
              +ID LL++ ++  LQ PI +DN+KA+I+D+F AG+ETS T  +WA+SEMMK+  V+AKA
Sbjct  272   -MIDALLRVKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSEMMKHQNVMAKA  330

Query  617   QAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             QAEVR+VFK KE L+E+D+++LPYLK+V+KETLR HPP PL+  RECRE+T I+ GYT+P
Sbjct  331   QAEVRQVFKEKENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEID-GYTVP  389

Query  437   VKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFG  258
             +  +VMVNA+A+  DP+ WE+PE F PERFE+  VD  G+H+Q++PFG+GRR+CPG++FG
Sbjct  390   LNARVMVNAWAIGRDPESWEDPESFKPERFENISVDLTGNHYQFIPFGSGRRMCPGMSFG  449

Query  257   FANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
               NT  PLA  LY FDWKLP+ V A     TE   +  A K+D
Sbjct  450   LVNTGHPLAQFLYQFDWKLPDKVNANDFSTTETSRVFAASKDD  492



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   493 bits (1270),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 332/466 (71%), Gaps = 10/466 (2%)
 Frame = -2

Query  1505  RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMA  1326
             +  K+PPGP +LP+IGNL H+ G  LPH  LRDLARK+G LM LQ+GE+  VV+SSP +A
Sbjct  30    KNTKLPPGPWRLPLIGNLHHLKGK-LPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRIA  88

Query  1325  KEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFS  1146
             K  L+THDLAFATR + +A  I+ Y + DI   PYGDYWRQMRK+   ELLN ++V+S++
Sbjct  89    KAVLKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLNNKMVKSYN  148

Query  1145  SIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISV  966
              IR DE+ +LL+ +R + G   N++E++  FTS + CR AFG++ + R++ I   ++I  
Sbjct  149   MIRKDELSKLLSSIRLATGSAVNITEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILA  208

Query  965   LTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-------  807
             L+G FD  D+FPSWK L  +   K+ +   H K D I+E+IIN+H+    +G        
Sbjct  209   LSGGFDVCDLFPSWKLLQNMSNMKARLTNVHHKYDQIMENIINEHKQNHAAGIKGNNEFG  268

Query  806   GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVL  627
             GED +ID LL+  ++  LQ PI +DN+KA+I+D+F AG+ETS T  +WA++EMMK+P V+
Sbjct  269   GED-MIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALTEMMKHPNVM  327

Query  626   AKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGY  447
             AKAQAEVR+VFK  E  +E+D+++LPYLK+V+KETLR HPP PL+  RECRE+T I+ GY
Sbjct  328   AKAQAEVRQVFKDNENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEID-GY  386

Query  446   TIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGL  267
             T+P+  +VMVNA+A+  DP+ WE+PE F PERFE+  VD  G+H+Q++PFG+GRR+CPG+
Sbjct  387   TVPLNARVMVNAWAIGRDPESWEDPESFKPERFENVAVDLTGNHYQFIPFGSGRRMCPGM  446

Query  266   AFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +FG  NT  PLA  LY FDWKLP+ V A     TE   +  A K+D
Sbjct  447   SFGLVNTGHPLAQFLYQFDWKLPDKVNANDFRTTETSRVFAASKDD  492



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   493 bits (1269),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 246/485 (51%), Positives = 339/485 (70%), Gaps = 10/485 (2%)
 Frame = -2

Query  1559  FALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGL  1383
             F   + +L   Y + K     K+PPGP+KLP+IGNL  +     LPHR LRDLA KYG L
Sbjct  14    FFWVLHWLAKYYYKPKTTLSHKLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPL  73

Query  1382  MSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQ  1203
             M LQ+GEIS+VVVSSP+MAKE ++THDLAF  R + L   IL Y  SDI   PYGDYWRQ
Sbjct  74    MHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQILTYGQSDIAFAPYGDYWRQ  133

Query  1202  MRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAF  1023
             M+KIC++ELL+ + V+SFS IR DE  + +  VR+S G P N++ +I+   SS I R AF
Sbjct  134   MKKICVSELLSAKRVQSFSDIREDETAKFIESVRTSEGSPVNLTNKIYSLVSSAISRVAF  193

Query  1022  GEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESI  843
             G     +E+F+   K++ V+   F+  D+FPS K LH + G K+++ K   + D I+++I
Sbjct  194   GNKCKDQEEFVSLVKELVVVGAGFELDDLFPSMK-LHLINGRKAKLEKMQEQVDKIVDNI  252

Query  842   INDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             + +H+ K E           E+ ++DVLL++  S NL++ IT  NIKAII+D+F AG++T
Sbjct  253   LKEHQEKRERARREGRVDLEEEDLVDVLLRIQQSDNLEIKITTTNIKAIILDVFTAGTDT  312

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPP  504
             S +T  WAM+EMM+NPRV  KAQAEVR+ F+  +++ E+DVE+L YLK V+KETLR H P
Sbjct  313   SASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIINETDVEELIYLKLVIKETLRLHTP  372

Query  503   TPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFN  324
             +PL+  REC + T+I+ GY IPVKTKVM+NA+A+A DPQYW + ERF+PERF+ + +DF 
Sbjct  373   SPLLLPRECSKRTIID-GYEIPVKTKVMINAWAIARDPQYWTDAERFVPERFDGSSIDFK  431

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
             G++F+Y+PFGAGRR+CPG+  G AN + PLA LLY+F+W+LP  +  E +DM E  GL V
Sbjct  432   GNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYHFNWELPNEMKPEYMDMVENFGLTV  491

Query  143   ARKND  129
              RKN+
Sbjct  492   GRKNE  496



>ref|XP_009623934.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   493 bits (1268),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 257/490 (52%), Positives = 350/490 (71%), Gaps = 11/490 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQR--RGKMPPGPRKLPIIGNLLHITGPVLP-HRALRDLAR  1398
              IS  +FVSF++ ++  WK  +     +PPGP  LP+IGNL  +    LP H   R L+R
Sbjct  10    FISVLIFVSFIIRLFQIWKASKTFNKLLPPGPWSLPLIGNLHLLMNGRLPVHHTFRSLSR  69

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG +  L++GEIS +VVSSP+MAKE ++T DL FATR E ++G I+ YN +DI+  PYG
Sbjct  70    RYGPIFHLRLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYNYTDIITCPYG  129

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPF-NVSERIFLFTSSI  1041
             D+WR MRK+CI ELL+ ++V+SF+SIR  E+  L++ + S       N+S+++F FTSS+
Sbjct  130   DHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLISSINSMPDDSLINLSDKMFWFTSSV  189

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
              CR+AFG+V   + + I   KDI+ L   FD ADMFPS K LH + G KS++LK H K D
Sbjct  190   TCRSAFGKVIHDQHKLIMLVKDIASLAAGFDLADMFPSRKWLHKITGLKSKMLKVHTKVD  249

Query  860   SIIESIINDHRNKLESG------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             +I+E+IIN+HR    +G      TG + +IDVLL++M+SG L  P+T  NIK +I DMF 
Sbjct  250   AILENIINEHRESRTNGKKGNGETGGEDLIDVLLRVMESGELGTPLTKKNIKGVIFDMFL  309

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AG+ETS+TT +WA++EM++NP V+AKAQ EVREV KGK   E+ D+E+L YL  V+KETL
Sbjct  310   AGAETSSTTIIWALAEMIRNPSVMAKAQLEVREVLKGKRTFEDIDLEELKYLNLVIKETL  369

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  RECREET I+  YTIP+KT+V+VN +A+  + +YW  PE FIPERFE+N
Sbjct  370   RLHPPVPLLLPRECREETKID-KYTIPIKTRVLVNVWAMGRESKYWHNPESFIPERFENN  428

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G+HF+++PFGAGRRICPGL FG  N   PLA LLY++DWK P G+T + LDMTE 
Sbjct  429   SIDFKGNHFEFIPFGAGRRICPGLLFGLVNVGHPLAQLLYHYDWKTPPGITPDNLDMTET  488

Query  158   LGLAVARKND  129
             +G+A  RK+D
Sbjct  489   IGVAGGRKDD  498



>ref|XP_009623936.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   492 bits (1266),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 260/492 (53%), Positives = 354/492 (72%), Gaps = 15/492 (3%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQR--RGKMPPGPRKLPIIGNLLHITGPVLP-HRALRDLAR  1398
              IS  +F+SF+       K  R    ++PPGP  LP+IGNL  +    LP H  LR L++
Sbjct  10    FISLLIFLSFIFRFVLIRKNSRIVTKRLPPGPWSLPLIGNLHQLMNGRLPIHHTLRSLSQ  69

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG +  L +GEIS +VVSSP+MAKE ++T DL FATR E ++G I+ YN +DI   PYG
Sbjct  70    RYGPIFHLCLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYNYTDIGTCPYG  129

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPF-NVSERIFLFTSSI  1041
             +YWR MRK+C+ ELL+ ++V+SF+SIR +E+  L++ + S+      N+S+++F FTSS+
Sbjct  130   EYWRNMRKVCVLELLSAKMVKSFNSIRQEEMSSLISSINSTPDDSLINLSDKMFWFTSSV  189

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
              CR+AFG+V   +++ I   KD+++L G FD AD+FPS K LH + G KS++LK H K D
Sbjct  190   TCRSAFGKVIHDQDKLIMLVKDVTLLAGGFDLADLFPSRKWLHEISGLKSKMLKVHTKID  249

Query  860   SIIESIINDHRNKL--------ESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDM  705
              I+E+IIN+HRN          ESG GED +IDVLL++M+SG L  PIT+ NIK +I DM
Sbjct  250   VILENIINEHRNNRTIGKKGNGESG-GED-LIDVLLRVMESGELGTPITNKNIKGVIFDM  307

Query  704   FGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKE  525
             F AG+ETS+TT +WA++EM++NP V+AKAQ EVREV KGK   E+SD+E+L YLK V+KE
Sbjct  308   FLAGAETSSTTIIWALAEMIRNPSVMAKAQLEVREVLKGKRTFEDSDIEELKYLKLVIKE  367

Query  524   TLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfE  345
             TLR HPP PL+  RECREET I   YTIP+KT+V+VNA+A+  D +YW + E FIPERFE
Sbjct  368   TLRLHPPIPLLLPRECREETKIE-QYTIPIKTRVLVNAWAIGRDTRYWHDSESFIPERFE  426

Query  344   DNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMT  165
             +N +DF G+HF+++PFGAGRR+CPGL FG  N   PLA LLY+FDWK P G+++++ DMT
Sbjct  427   NNSIDFKGNHFEFIPFGAGRRMCPGLLFGLVNVGHPLAQLLYHFDWKTPPGISSDSFDMT  486

Query  164   EMLGLAVARKND  129
             E  G+   RKND
Sbjct  487   ETDGVTARRKND  498



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   491 bits (1264),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/490 (50%), Positives = 349/490 (71%), Gaps = 13/490 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             NL+SF L  SFL +++ + ++ ++  +PPGP +LP+IG+L H+     PHR  RDLARKY
Sbjct  4     NLVSFILLFSFLFIIFRKLRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKY  63

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G +M L++GE+  V++SSP  +K+ L+THDLAFA+R +  +  I++YNN DI    YGDY
Sbjct  64    GPVMYLELGEVPTVIISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDY  123

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAG-RPFNVSERIFLFTSSIIC  1035
             W+QMRKICI ELL+ ++V+SFSSIR DE+  +L+ + S  G    N++E I  FTSS+ C
Sbjct  124   WKQMRKICIMELLSAKMVKSFSSIRKDELSSVLSSIDSVRGCCEVNMTEIIVRFTSSVTC  183

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             R  FG++   R++ I   KD   L G FD  D FPSWK L+ + G KS+++K H+K DS+
Sbjct  184   RLVFGKLCRDRDELINLMKDALFLVGGFDIGDFFPSWKLLYKMSGAKSKLVKMHQKVDSV  243

Query  854   IESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             +E I+N+H    E+G        GED ++DV L++ ++  LQ PIT+D+IKA+I+DMF A
Sbjct  244   LERIVNEHIKNREAGIKGNGAHGGED-LVDVFLRIKENDQLQFPITNDHIKAVILDMFTA  302

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ETS+T  +WA+SE+MK+P V+AKAQ+EVR+ FK K   +E D++ LPYLK V+KETLR
Sbjct  303   GTETSSTAIIWALSELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIKETLR  362

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              H P+  I  RECREET ++ GYTIP K  V+VN +A+  DP+ W++PE FIPERFE++ 
Sbjct  363   LHAPS--IVHRECREETTVD-GYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFENSP  419

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGV-TAETLDMTEM  159
             +D+ G++++++PFGAG+RICPG+ FG AN   PLA LLY+F+W LP G    + LDM+E 
Sbjct  420   IDYLGNNYEFLPFGAGKRICPGMQFGIANVKQPLARLLYHFNWGLPYGTNNPKHLDMSEK  479

Query  158   LGLAVARKND  129
              GL+ A++ D
Sbjct  480   SGLSAAKEKD  489



>ref|XP_004249812.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
 ref|XP_010312277.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=511

 Score =   491 bits (1263),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 272/476 (57%), Positives = 349/476 (73%), Gaps = 12/476 (3%)
 Frame = -2

Query  1523  TQWKKQRR--GKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISA  1353
              QWKK R    K+PPGP KLP IG++ H+     LPH AL +L +KYG  M LQ+GEIS 
Sbjct  24    VQWKKSRNLNKKLPPGPWKLPFIGSVHHLALEGGLPHHALTNLGKKYGPFMHLQVGEIST  83

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVVSS DMA+E L+THDLAFA+R + LA  I+LY ++DI    YGDYWRQMRK+C+ ELL
Sbjct  84    VVVSSMDMAREVLKTHDLAFASRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELL  143

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVFDGREQ  996
               + VRSFSSIR DE  RL+  +RSS  G P NV+ERI  + SSI C+ AFGE+   +E+
Sbjct  144   TTKNVRSFSSIRRDEASRLVQFIRSSTCGEPINVTERISWYQSSITCKTAFGELLKDQEK  203

Query  995   FIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLE  816
             F+   ++ + + G F  AD+FPS K L  L G KS ILK H+  D I+E +IN+H+  L 
Sbjct  204   FLGILREFTEVAGGFSTADIFPSIKILQVLSGLKSRILKFHKNVDVIVEDVINEHKKNLA  263

Query  815   SGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
             SG       G + ++DVLL+L +SG L++PIT+DNIKAIIID+F AG+ET+TTT++WAM+
Sbjct  264   SGKKGNGAFGGENLVDVLLRLKESGELKIPITNDNIKAIIIDLFIAGTETTTTTTIWAMT  323

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDV-EQLPYLKTVVKETLRCHPPTPLIATREC  477
             EM++NP VLAKAQ EVRE FKGKE +   DV E+L YLK VVKETLR HPP PL+  REC
Sbjct  324   EMIRNPSVLAKAQTEVREAFKGKEEIFNEDVIEELKYLKQVVKETLRLHPPLPLLIPREC  383

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
             REET IN GYTIP+KT+V+VN Y++  DP+YWE+ E FIPERFE + VDF G++F+Y+PF
Sbjct  384   REETNIN-GYTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNFEYLPF  442

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G+GRR+CP L+FG  N   PLA+LLY+FDWKLP+ V  E +DM E  G+A ARK++
Sbjct  443   GSGRRMCPALSFGLINVYLPLANLLYHFDWKLPDCVKLEDMDMNEFSGIAAARKSE  498



>ref|XP_004249519.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=510

 Score =   490 bits (1262),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 267/476 (56%), Positives = 349/476 (73%), Gaps = 13/476 (3%)
 Frame = -2

Query  1523  TQWKKQRR--GKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISA  1353
              + KK R    K+PPGP KLPIIG++ H+     LPH AL  L +K+G LM LQ+GEIS 
Sbjct  24    VELKKSRNLNKKLPPGPWKLPIIGSIHHLALEDGLPHHALTKLGKKHGPLMHLQLGEIST  83

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             +VVSS +MA+E ++ HDLAFA+R + ++  I+LY ++DI    YGDYWRQMRKIC+ EL 
Sbjct  84    IVVSSMEMAREVMKIHDLAFASRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELF  143

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA-GRPFNVSERIFLFTSSIICRAAFGEVFDGREQ  996
               + VRSFSSIR +E   L+  +RSS  G P NV+++I  + SSI C+AAFGE+   +E+
Sbjct  144   TAKNVRSFSSIRREEGSNLVQFIRSSTRGEPINVTKQISWYESSITCKAAFGELLKDQEK  203

Query  995   FIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLE  816
             FI   ++++ LTG F  A++FPS K LH L G +S ILK H   D+I+E II+DH+  + 
Sbjct  204   FIGIVRELAELTGGFSVANIFPSIKILHVLSGVRSRILKVHENVDAIVEDIISDHKRNIA  263

Query  815   SGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAM  657
             SG        GED ++DVLL+LM+SG L++PIT+DNIKAI+ID+F AG+ETSTTT++WAM
Sbjct  264   SGKRGNGAFGGED-LVDVLLRLMESGALKIPITNDNIKAIMIDLFSAGTETSTTTTIWAM  322

Query  656   SEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATREC  477
             +EM++NP VLAKAQ EVRE FKGKE   E  +E+L YLK VVKET R HPP PL+  REC
Sbjct  323   TEMIRNPSVLAKAQTEVREAFKGKETSNEDVIERLKYLKQVVKETFRLHPPLPLLIPREC  382

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
             REET IN GYTIP+KT+V+VN Y++  DP+YWE+ E FIPERFE + VDF G++F+Y+PF
Sbjct  383   REETNIN-GYTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNFEYLPF  441

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GAGRRICPG+ FG  N   PLA+LLY+FDWKLP GV  E +DM E  G+  ARK++
Sbjct  442   GAGRRICPGITFGLINVYLPLANLLYHFDWKLPHGVKLEDVDMNEFSGITAARKSE  497



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   489 bits (1259),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/488 (51%), Positives = 344/488 (70%), Gaps = 11/488 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             NLIS  LF SF  ++  +W   +  K+PPGP +LP IG+L H+ G  LPH  LRDLARKY
Sbjct  9     NLISLFLFFSFHFILVKKWN-AKIPKLPPGPWRLPFIGSLHHLKGK-LPHHNLRDLARKY  66

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GEI  VV+SSP +AK  L+THDLAFATR   ++  I+ Y + DI   P+GDY
Sbjct  67    GPLMYLQLGEIPVVVISSPRVAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDY  126

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQMRKI   ELL+ ++++S+S IR DE+ +LL+ +R   G   N++E++  FTS + CR
Sbjct  127   WRQMRKILTQELLSNKMLKSYSLIRKDELSKLLSSIRLETGSAVNINEKLLWFTSCMTCR  186

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
              AFG++ + R++ I   ++I  L+G FD  D+FPSWK LH +   K+ +   H K D ++
Sbjct  187   LAFGKICNDRDELIMLIREILTLSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVM  246

Query  851   ESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             E+IIN+H+    +G        GED +ID LL+  ++  LQ PI +DN+KA+I+D+F AG
Sbjct  247   ENIINEHQENHAAGIKGNNEFGGED-MIDALLRAKENNELQFPIENDNMKAVILDLFIAG  305

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             +ETS T  +WA+SE+MK+P V+AKAQAEVR+VFK  E  +E+D+++LPYLK+V+KETLR 
Sbjct  306   TETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRM  365

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP PL+  RECR++T I+ GYT+P+K +VMVNA+A+  DP+ WE+PE F PERFE+  V
Sbjct  366   HPPVPLLGPRECRDQTEID-GYTVPIKARVMVNAWAIGRDPESWEDPESFKPERFENTSV  424

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             D  G+H+Q++PFG+GRR+CPG++FG  NT  PLA LLY FDWKLP+ V A     TE   
Sbjct  425   DLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSR  484

Query  152   LAVARKND  129
             +  A K+D
Sbjct  485   VFAASKDD  492



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 338/473 (71%), Gaps = 13/473 (3%)
 Frame = -2

Query  1520  QWKKQRRGKMPPGPRKLPIIGNLLHIT--GPVLPHRALRDLARKYGGLMSLQIGEISAVV  1347
             +WK Q    +PPGP KLP IG+L H+   GP LPH  L +LA++YG LM LQ+GE   V 
Sbjct  24    KWKTQELN-LPPGPWKLPFIGSLHHLVFAGP-LPHHGLTNLAKRYGPLMLLQLGEQPTVF  81

Query  1346  VSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNP  1167
             +SSP MAKE L+THDLAFATR +     I+ Y ++DI   PYG+YWRQ+RKIC+ ELL+ 
Sbjct  82    ISSPQMAKEVLKTHDLAFATRPKLTFAEIIKYGSTDIAFSPYGEYWRQIRKICVMELLSA  141

Query  1166  RLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQ  987
             ++V SFSSIR DE+  +++ +R     P N++E++  FTSS++CR+A G++   + + I 
Sbjct  142   KMVNSFSSIREDELSNMISWIRLRPNIPVNLTEKVKWFTSSVVCRSALGKICKDQNKLII  201

Query  986   QTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT  807
               ++I  L  S +FAD FP WK LH L G+K+ +LK H K D I++ I+N+H+    +G 
Sbjct  202   LMREILSLAISVNFADFFPRWKFLHDLGGSKTRLLKEHHKIDEILQDIVNEHKQNRVNGK  261

Query  806   -------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEM  648
                    GED +IDVLL++ +SG  Q+PIT DNIKA+I+DMF AG+ETS+TT +WA++EM
Sbjct  262   MGNGEFGGED-LIDVLLRVRESGQHQLPITDDNIKAVIVDMFSAGTETSSTTIIWALAEM  320

Query  647   MKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREE  468
             MK P VLAKAQAEVR+  KGK+  +  D+++L YLK V+KETLR HPP PL+  REC EE
Sbjct  321   MKKPSVLAKAQAEVRQAMKGKKGFQLIDLDELKYLKLVIKETLRMHPPIPLLIPRECMEE  380

Query  467   TVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAG  288
             T IN G+ IP+KT+V+VN +A+  +P+ WE+PE F+PERFE+N +DF G+H Q++PFGAG
Sbjct  381   TKIN-GFNIPLKTRVIVNIWAIGRNPESWEDPESFMPERFENNPIDFTGNHHQFIPFGAG  439

Query  287   RRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RR+CPG+ FG  N    LA LL++FDWKLP G + + LDMTE  G++  RK+D
Sbjct  440   RRMCPGMLFGLTNVAQLLAQLLHHFDWKLPNGQSPQDLDMTESPGVSATRKDD  492



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 246/485 (51%), Positives = 339/485 (70%), Gaps = 10/485 (2%)
 Frame = -2

Query  1559  FALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGL  1383
             F LFV   +  Y++ KK    K+PPGP K P+IGNL  +      PH AL +L+ KYG L
Sbjct  13    FLLFVLHWLAKYSKTKKSH-SKLPPGPMKFPLIGNLPQLAMSKKRPHHALHELSHKYGPL  71

Query  1382  MSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQ  1203
             M +Q+GEIS V+VSSP +AKE ++THD AFA R + L+  I+ Y + DIV  PYGD+WRQ
Sbjct  72    MHIQLGEISTVIVSSPKLAKEIMKTHDAAFANRPKLLSPEIMAYGSKDIVFSPYGDFWRQ  131

Query  1202  MRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAF  1023
             MRKIC+ ELL+ + V+SFS IR DE  +L+  ++SS G   N++ RIF   SS I RAAF
Sbjct  132   MRKICVFELLSAKRVQSFSYIREDETKKLIQSIQSSTGSTINLTSRIFSMVSSNISRAAF  191

Query  1022  GEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESI  843
             G+    +++F+   + +  ++  F   D+FPS K LH L G K ++ K H++ D IIE+I
Sbjct  192   GDKSKDQDEFVDLVRKVVEMSSGFGVDDLFPSIKPLHILSGMKPKLEKIHKRVDKIIENI  251

Query  842   INDHRNKLESGTGEDC-------IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             I  H+ K E    +D        ++DVLL++  S NL + IT +NIKA+I D+F AG++T
Sbjct  252   IRQHQEKRERAKEDDNNEVDNEDLLDVLLRVQQSDNLDIKITTNNIKAVIWDVFVAGTDT  311

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPP  504
             ++TT  WAMSEMMKNP V  KAQAE+RE FKGK+++ ESD+ +L Y K V+KET+R HPP
Sbjct  312   TSTTIEWAMSEMMKNPSVREKAQAELREAFKGKKIISESDLNELTYFKLVIKETMRLHPP  371

Query  503   TPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFN  324
             +PL+  REC E T+I+ GY IP  TKVM+NA+A+A DPQYW + E FIPERF+ + +DF 
Sbjct  372   SPLLVPRECTELTIID-GYEIPKNTKVMINAWAVARDPQYWTDAEMFIPERFDGSLIDFK  430

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
             G++F+Y+PFGAGRR+CPG++FG A+ + PLA LLY+F+W+LP  +  E LDMTE +GLAV
Sbjct  431   GNNFEYIPFGAGRRMCPGMSFGIASVMLPLALLLYHFNWELPNQMKPEDLDMTENVGLAV  490

Query  143   ARKND  129
              R+N+
Sbjct  491   GRENE  495



>emb|CDP07887.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   488 bits (1255),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 245/479 (51%), Positives = 345/479 (72%), Gaps = 37/479 (8%)
 Frame = -2

Query  1538  LVLVYTQWKKQRRG-KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGE  1362
             ++ +  +WK+ +   K+PP P KLP+IGN+ H+ G   PH ALR LAR++G LM LQ+GE
Sbjct  17    VLCLIKEWKRSKAAQKLPPSPSKLPVIGNMHHLVGSP-PHHALRKLARQHGALMYLQLGE  75

Query  1361  ISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICIT  1182
             IS++VVSSP +AKE ++THDLAFA RAE L   IL+YN+SDI   PYGDYWRQMRKIC  
Sbjct  76    ISSIVVSSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCPYGDYWRQMRKICTL  135

Query  1181  ELLNPRLVRSFSSIRHDEIHRLLADVR--SSAGRPFNVSERIFLFTSSIICRAAFGEVF-  1011
             ELL+ + VRSF SIR DE   LLA V+  ++AG+  N+SE+++ +TSS++CRAAFG+V  
Sbjct  136   ELLSAKNVRSFGSIRQDEASHLLASVQALAAAGKLINISEKLYSYTSSMVCRAAFGKVSK  195

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
             D   +F+Q T + + L+ +FD +D+FPS+K LHPL   KS+++K H K D ++ +II+ H
Sbjct  196   DLHREFLQLTSESAPLSSTFDISDLFPSFKILHPLLSVKSQLVKIHLKMDKLLGNIIDQH  255

Query  830   -----RNKLESG-TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
                  R  + +G +G + +IDVLL++ +SG+LQ PIT++NIKAI+ID+F AG+ETS+TT 
Sbjct  256   VDNRARTNMATGESGNEDLIDVLLRVKESGDLQFPITNNNIKAIVIDVFSAGTETSSTTV  315

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WAMSEM++NP V+AKAQ+E+R  FKGK+ +EE+D+++L                     
Sbjct  316   EWAMSEMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQEL---------------------  354

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
               +C  E     GYTIPVKT+V+VNA+A+  DP+YW++PE F P+RF+ N VDF G+HF+
Sbjct  355   KEQCEIE-----GYTIPVKTRVLVNAWAIGRDPEYWDDPESFKPDRFKTNPVDFTGTHFE  409

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             Y+PFGAGRR+CPG++FG AN   PLA LLY+F+WKLP G+    LDM+E +G+  +RK+
Sbjct  410   YLPFGAGRRMCPGISFGLANVDLPLALLLYHFNWKLPNGLDPCDLDMSETVGITASRKD  468



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   488 bits (1257),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 239/463 (52%), Positives = 331/463 (71%), Gaps = 10/463 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+PPGP +LP IG+L H+ G  LPH  LRDLARKYG LM LQ+GEI  VV+SSP +AK  
Sbjct  33    KLPPGPWRLPFIGSLHHLKGK-LPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFATR   ++  I+ Y + DI   P+GDYWRQMRKI   ELL+ ++++S+S IR
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+ +LL+ +R   G   N++E++  FTS + CR AFG++ + R++ I   ++I  L+G
Sbjct  152   KDELSKLLSSIRLETGSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSG  211

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-------GED  798
              FD  D+FPSWK LH +   K+ +   H K D ++E+IIN+H+    +G        GED
Sbjct  212   GFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGED  271

Query  797   CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKA  618
              +ID LL+  ++  LQ PI +DN+KA+I+D+F AG+ETS T  +WA+SE+MK+P V+AKA
Sbjct  272   -MIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKA  330

Query  617   QAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             QAEVR+VFK  E  +E+D+++LPYLK+V+KETLR HPP PL+  RECR++T I+ GYT+P
Sbjct  331   QAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEID-GYTVP  389

Query  437   VKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFG  258
             +K +VMVNA+A+  DP+ WE+PE F PERFE+  VD  G+H+Q++PFG+GRR+CPG++FG
Sbjct  390   IKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCPGMSFG  449

Query  257   FANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
               NT  PLA LLY FDWKLP+ V A     TE   +  A K+D
Sbjct  450   LVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDD  492



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   488 bits (1256),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 239/463 (52%), Positives = 331/463 (71%), Gaps = 10/463 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+PPGP +LP IG+L H+ G  LPH  LRDLARKYG LM LQ+GEI  VV+SSP +AK  
Sbjct  33    KLPPGPWRLPFIGSLHHLKGK-LPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THDLAFATR   ++  I+ Y + DI   P+GDYWRQMRKI   ELL+ ++++S+S IR
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+ +LL+ +R   G   N++E++  FTS + CR AFG++ + R++ I   ++I  L+G
Sbjct  152   KDELSKLLSSIRLETGSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSG  211

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-------GED  798
              FD  D+FPSWK LH +   K+ +   H K D ++E+IIN+H+    +G        GED
Sbjct  212   GFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGED  271

Query  797   CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKA  618
              +ID LL+  ++  LQ PI +DN+KA+I+D+F AG+ETS T  +WA+SE+MK+P V+AKA
Sbjct  272   -MIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKA  330

Query  617   QAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             QAEVR+VFK  E  +E+D+++LPYLK+V+KETLR HPP PL+  RECR++T I+ GYT+P
Sbjct  331   QAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEID-GYTVP  389

Query  437   VKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFG  258
             +K +VMVNA+A+  DP+ WE+PE F PERFE+  VD  G+H+Q++PFG+GRR+CPG++FG
Sbjct  390   IKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCPGMSFG  449

Query  257   FANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
               NT  PLA LLY FDWKLP+ V A     TE   +  A K+D
Sbjct  450   LVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDD  492



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   488 bits (1256),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 344/487 (71%), Gaps = 11/487 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKY  1392
             +I+F +F+    LV T +K++   K+PPGP +LPIIGNL  +     LP +AL+ L RKY
Sbjct  9     VITFFVFLLLHWLVKT-YKQKSSHKLPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKY  67

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GEIS +VVSSP MA E ++THD+ F  R + LA   ++Y  +DI   PYGDY
Sbjct  68    GPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDY  127

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQ+RKIC  ELL+ + V+SFS IR DE  +L+  + SSAG P ++S ++F    + + R
Sbjct  128   WRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSAGSPIDLSGKLFSLLGTTVSR  187

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             AAFG+  D +++F+   +    +TG F+  DMFPS K LH L   K+++   H++ D I+
Sbjct  188   AAFGKENDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVEHVHQRADKIL  247

Query  851   ESIINDH---RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             E I+  H   R +++ G G +     ++DVLL+L +SG+L+VP+T +NIKA+I ++F AG
Sbjct  248   EDILRKHMEKRTRVKEGNGSEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFAAG  307

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             ++TS +T  WAMSEMMKNP+V  KAQAE+R++FKGKE++ E+D+E+L YLK+V+KETLR 
Sbjct  308   TDTSASTLEWAMSEMMKNPKVKEKAQAELRQIFKGKEIIRETDLEELSYLKSVIKETLRL  367

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP+ LI  REC + T I+ GY IP+KTKVM+N +A+  DPQYW + +RFIPERF D+ +
Sbjct  368   HPPSQLIP-RECIKSTNID-GYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFNDSSI  425

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G+ F+Y+PFGAGRR+CPG+ FG A+   PLA LLY+F+W+LP  +  E LDM E  G
Sbjct  426   DFKGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMDEHFG  485

Query  152   LAVARKN  132
             + VARKN
Sbjct  486   MTVARKN  492



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   488 bits (1256),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 248/469 (53%), Positives = 334/469 (71%), Gaps = 14/469 (3%)
 Frame = -2

Query  1502  RGKMPPGPRKLPIIGNLLHITGPV-LPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMA  1326
             + K+PPGP +LPIIG+L H+ G +  PHR L++LA KYG +M LQ+GEI AV+VSSP M 
Sbjct  34    KEKLPPGPWRLPIIGSLHHLRGALSFPHRTLKNLATKYGPIMYLQLGEIPAVIVSSPIMV  93

Query  1325  KEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFS  1146
             KE L+TH+LAFAT+ +  +  I  YN  DI   PYGD WRQMR IC+TELL  + V+SFS
Sbjct  94    KEILKTHELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLGTKTVKSFS  153

Query  1145  SIRHDEIHRLLADVRSSAG-RPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDIS  969
             SIR DEI RLL+ +RS+ G R  N++E I  +T+S+ CR+AFG+V   +   I   +D+ 
Sbjct  154   SIRKDEITRLLSSIRSTNGTRLVNLTELILRYTNSVTCRSAFGKVCTNQHHLINLLRDVL  213

Query  968   VLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT------  807
                G FD +D+FPSWK LH + G KSE+L+ H+K D  +E+I+N+H      G       
Sbjct  214   DTLGGFDVSDLFPSWKLLHKMSGVKSELLRMHKKVDEALENIVNEHIKNRALGCKGNGDK  273

Query  806   ---GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNP  636
                GED ++DVLL++ ++G LQ PIT D+IKAII DMF AG+ETS  T +WA+SEMM+ P
Sbjct  274   LIGGED-LVDVLLRIKENGELQFPITSDHIKAIISDMFAAGTETSAATIIWALSEMMRKP  332

Query  635   RVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVIN  456
             +++AKAQ EVR+VFKGK    E D+++L YLK V+KETLR HPP+ L+  RECR++T IN
Sbjct  333   KIMAKAQNEVRQVFKGKITFYEDDLDKLTYLKLVIKETLRLHPPSTLLP-RECRKQTYIN  391

Query  455   GGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRIC  276
              GYTIP KT+V++N +AL  D + W++PE FIPERFE++ VD+ G++++++PFG+GRRIC
Sbjct  392   -GYTIPPKTRVLINTWALGRDSESWDDPESFIPERFENSPVDYMGNYYKFIPFGSGRRIC  450

Query  275   PGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             PG+ FG  N   PLA LLY+FDW LP G   E LDM E  GL+ A+  D
Sbjct  451   PGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDMIEKNGLSAAKHRD  499



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 343/487 (70%), Gaps = 11/487 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKY  1392
             +I+F +F+    LV T +K++   K+PPGP +LPIIGNL  +     LP +AL+ L RKY
Sbjct  9     VITFFVFLLLHWLVKT-YKQKSSHKLPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKY  67

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GEIS +VVSSP MA E ++THD+ F  R + LA   ++Y  +DI   PYGDY
Sbjct  68    GPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDY  127

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQ+RKIC  ELL+ + V+SFS IR DE  +L+  + SSAG P ++S ++F    + + R
Sbjct  128   WRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSAGSPIDLSGKLFSLLGTTVSR  187

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             AAFG+  D +++F+   +    +TG F+  DMFPS K LH L   K+++   H++ D I+
Sbjct  188   AAFGKENDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVEHVHQRADKIL  247

Query  851   ESIINDH---RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             E I+  H   R +++ G G +     ++DVLL+L +SG+L+VP+T +NIKA+I ++F AG
Sbjct  248   EDILRKHMEKRTRVKEGNGSEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFAAG  307

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             ++TS +T  WAMSEMMKNP+V  KAQAE+R++FKGKE++ E+D+E+L YLK+V+KETLR 
Sbjct  308   TDTSASTLEWAMSEMMKNPKVKEKAQAELRQIFKGKEIIRETDLEELSYLKSVIKETLRL  367

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP+ LI  REC   T I+ GY IP+KTKVM+N +A+  DPQYW + +RFIPERF D+ +
Sbjct  368   HPPSQLIP-RECIISTNID-GYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFNDSSI  425

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G+ F+Y+PFGAGRR+CPG+ FG A+   PLA LLY+F+W+LP  +  E LDM E  G
Sbjct  426   DFKGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMDEHFG  485

Query  152   LAVARKN  132
             + VARKN
Sbjct  486   MTVARKN  492



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 243/469 (52%), Positives = 339/469 (72%), Gaps = 11/469 (2%)
 Frame = -2

Query  1511  KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPD  1332
             + +  ++PPGP +LP IG+L H+ G  LPHR+L+ LA+KYG LM LQ+G++  +++SSP 
Sbjct  33    RNQNQRLPPGPWRLPFIGSLHHLIGGELPHRSLKKLAQKYGPLMYLQLGQVPTIIISSPR  92

Query  1331  MAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRS  1152
             +AKE L+THDLAFA R +  + +I+ YNN D+V   YGDYWRQMRKICI ELL+ ++V+S
Sbjct  93    IAKEVLKTHDLAFANRPQLTSSTIIFYNNIDMVFSQYGDYWRQMRKICIVELLSSKMVKS  152

Query  1151  FSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDI  972
             FS IR  E+  L++ +RS      N++E+IF+FT+S+ CR+AFG++   R +F    K++
Sbjct  153   FSGIREKELSSLISSIRSMT--EVNITEKIFMFTNSVTCRSAFGKICKDRGEFRTLLKEV  210

Query  971   SVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH------RNKLESG  810
              +L G F  AD+FP WK LH L G +S ++  HRK D I+E+IIN+H       NK    
Sbjct  211   LLLAGGFFVADLFPCWKLLHNLSGMESRLVNAHRKVDEIMENIINEHIANRAAGNKRNGE  270

Query  809   TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
              G++ ++DV L++ +   L  PIT+D+IKA++ D+F  G+ETS+T  +WA++E+MKNP V
Sbjct  271   FGDEDLVDVFLRIKEKDQLHFPITNDHIKAMLFDIFLGGTETSSTVLIWALAELMKNPNV  330

Query  629   LAKAQAEVREVFKGKEMLEESD--VEQLPYLKTVVKETLRCHPPTPLIATRECREETVIN  456
             +AKAQ+EVR+VFKGK++ +E D  VE+L YLK V+ ETLR H P PL+  RECREET I 
Sbjct  331   MAKAQSEVRQVFKGKKIYDEEDNIVEKLSYLKLVIMETLRLHTPAPLMGPRECREETNI-  389

Query  455   GGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRIC  276
              GY IP KTKV+VNA+ALA D + W +PE FIPERF+++ +DF G++F+Y+PFG GRRIC
Sbjct  390   AGYNIPNKTKVLVNAWALARDVESWNDPESFIPERFDNSSIDFMGNYFEYIPFGTGRRIC  449

Query  275   PGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             PG+ FG AN   PLA LLYNF+WKLP G+  + LDMTE  GL  A++ D
Sbjct  450   PGIQFGLANIGVPLAQLLYNFEWKLPYGINPQDLDMTETHGLTGAKQKD  498



>ref|XP_006452553.1| hypothetical protein CICLE_v10008076mg [Citrus clementina]
 ref|XP_006474925.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65793.1| hypothetical protein CICLE_v10008076mg [Citrus clementina]
Length=502

 Score =   485 bits (1249),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 245/485 (51%), Positives = 333/485 (69%), Gaps = 10/485 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGK-------MPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             +F +F++FLV V+   K ++  K       +PPGPRKLP+IGNL  + G  LPH  L+DL
Sbjct  7     TFQIFLAFLVFVFILLKLEKTSKTNNTTSNLPPGPRKLPVIGNLHQLVGS-LPHHGLKDL  65

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A+KYG LM LQ+GE+S +VVSSP+ AK+ ++THD+ FA R   LA  I+ Y+NS I+  P
Sbjct  66    AKKYGPLMHLQLGEVSTIVVSSPEFAKQLMKTHDVTFALRPPVLAAKIMSYDNSGIIFSP  125

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             YGD WRQ+RKIC++ELL+ + V+SF SIR  E+  L+  + S+ G   N++E++F     
Sbjct  126   YGDCWRQLRKICVSELLSAKRVQSFRSIREAEVCNLINWISSNEGSVINLTEKVFSLMYG  185

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             I  RAAFG     +E F+   ++ + +   F+ AD+FPS++ L  + G +S   K H++ 
Sbjct  186   ITSRAAFGNKSSEQEAFVSVMEETTKVISGFNIADLFPSFELLQWVTGFRSHAEKLHQQA  245

Query  863   DSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             D I+ESIINDH+        +  ++DVLLK+ + GNL++P++  NIKA+I D+FGAGSET
Sbjct  246   DRIVESIINDHKKCETKNESDRDLVDVLLKIQEDGNLELPLSTHNIKAVISDIFGAGSET  305

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPP  504
             S TT  WAM EMMKNP V+ KAQAEVREVF  K  ++E+ + ++ YLK VVKETLR  P 
Sbjct  306   SATTVDWAMCEMMKNPGVMKKAQAEVREVFNRKGKIDETGISEMKYLKLVVKETLRLRPS  365

Query  503   TPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFN  324
              PLI  REC E   IN G+ IPVK +++VN++A   DP YW +PE FIPERF D+ VDF 
Sbjct  366   APLIP-RECGESCEIN-GFNIPVKARIIVNSWATGRDPMYWTQPESFIPERFIDHSVDFK  423

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
             GS+F+Y+PFGAGRRICPG+ +G AN   PLA LLY+FDWKLP G+  E L+MTE  G+ V
Sbjct  424   GSNFEYIPFGAGRRICPGMLYGLANVEFPLAMLLYHFDWKLPNGMNHEDLEMTETFGVTV  483

Query  143   ARKND  129
              RK D
Sbjct  484   RRKQD  488



>emb|CDP07882.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   486 bits (1252),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 258/489 (53%), Positives = 360/489 (74%), Gaps = 11/489 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKK-QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             NLI+F LF++F++ ++ +W++ Q   K+PP P KLPIIGN+ H+ G   PH+AL  LA+K
Sbjct  6     NLIAFFLFLAFVLALFKEWRRSQAAKKLPPSPSKLPIIGNMHHLIGSQ-PHQALTKLAQK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             +G LM LQ+GEIS+++VSS  +AKE ++THDL+FA R+E L   I++YN+SDI   PYGD
Sbjct  65    HGALMHLQLGEISSIIVSSSHLAKEIMKTHDLSFANRSEILLSKIIMYNSSDIGFCPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR--SSAGRPFNVSERIFLFTSSI  1041
             Y RQ+RKIC  ELL+ + V+SF SIR DE   L+  +R  + AG   + ++++  +T S 
Sbjct  125   YLRQVRKICALELLSAKKVQSFGSIRQDEALHLVKSIRNLADAGEVIHFTDKVHSYTCST  184

Query  1040  ICRAAFGEVF-DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             +CRAAFG+V  D   +F+Q   +I  L+ +FD +D+ PS+K LHPL   K +++K H K 
Sbjct  185   VCRAAFGKVSKDVHSKFLQLMCEIVPLSSTFDISDLLPSFKMLHPLLSVKRQLVKIHLKM  244

Query  863   DSIIESIINDHRNKLESGT-----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             D ++ +II+ H N L+        G + +IDVLL++  SG+LQ+PIT+DNIKAI+ID+F 
Sbjct  245   DRLLVNIIDQHTNNLQRNMSTGEYGNEDLIDVLLRVKHSGDLQIPITNDNIKAIVIDVFS  304

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AG+ETS+TT  WAMSEM++NP V+AKAQ+E+R  FKGK+M EE DV++L YLK V++ETL
Sbjct  305   AGTETSSTTVDWAMSEMIRNPSVMAKAQSEIRTAFKGKQMFEEDDVQELKYLKLVIRETL  364

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  RECREE  I+ GY IPV+T+V+VNA+A+  DPQYW++PE F PERFE+N
Sbjct  365   RLHPPLPLLVPRECREECEID-GYVIPVQTRVLVNAWAMGRDPQYWDDPESFKPERFENN  423

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              VDF G+HF+Y+PFGAGRR+CPG+ FG AN   PLA LLY+F+WKLP G+    LDM+E 
Sbjct  424   PVDFAGTHFEYLPFGAGRRMCPGIQFGLANVYVPLAFLLYHFNWKLPNGLDPNDLDMSES  483

Query  158   LGLAVARKN  132
              G+  +RK+
Sbjct  484   TGITASRKD  492



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 260/492 (53%), Positives = 343/492 (70%), Gaps = 14/492 (3%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRR----GKMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             N I+  +F++F++ +  +W K +      K+PPGP+K+P IGNL ++ G  LPH AL  L
Sbjct  6     NWIASFIFLAFILTLGKKWMKSKTVNATQKLPPGPKKIPFIGNLHNLLGS-LPHHALAKL  64

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A+K+G LM LQ+GE+SAVVVSSP  AKE L+THD  F  R E L G I+ Y++S I    
Sbjct  65    AKKHGDLMHLQLGEVSAVVVSSPHSAKEILKTHDHVFVDRPEILVGKIICYDSSSIAFSQ  124

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS--AGRPFNVSERIFLFT  1050
             YGDYWRQMRKIC  E+L+ + VRSF SIR DE+  L++ +R S   G+P N++E I  FT
Sbjct  125   YGDYWRQMRKICAMEVLSAKSVRSFGSIRQDEVLHLISSIRGSTIGGQPINLTEEISSFT  184

Query  1049  SSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHR  870
             SS+ICRAA G+VF  R   I+  K++   T  FD +D+FPS K LH L   K  + K H 
Sbjct  185   SSMICRAACGKVFRERITLIELMKEVLSRTSGFDISDLFPSKKILHHLSSMKPTLQKLHH  244

Query  869   KTDSIIESIINDH-----RNKLESGT-GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIID  708
             K D I+ES+IN+H     R+K  +G  G++ +IDVLL++ +SG+LQ PIT+  IKAI+ D
Sbjct  245   KIDVILESVINEHIENLARSKTVNGEFGQEDLIDVLLRIKESGDLQFPITNKTIKAIMFD  304

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             MF  G+ETS T   WAMSEM++NP V++KAQ E+R+ F GKE +EE D+E L YLK V+K
Sbjct  305   MFTGGTETSATLVEWAMSEMIRNPNVMSKAQNEIRKAFLGKEKIEEMDIEGLRYLKLVIK  364

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR HPP PL+   ECR++  I+ GY IP KT+V VNA+A+  DP+YW++PE F PERF
Sbjct  365   ETLRLHPPLPLLVPMECRKQCEID-GYIIPSKTRVFVNAWAIQRDPKYWDDPESFKPERF  423

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
              +N VDF G+ F+Y+PFG GRRICPG++FG AN   PLA LLYNFDWKLP G+ +  LDM
Sbjct  424   HNNPVDFTGTQFEYLPFGGGRRICPGISFGLANVEFPLAQLLYNFDWKLPGGINSNGLDM  483

Query  167   TEMLGLAVARKN  132
             TE  G+   RKN
Sbjct  484   TETCGITAPRKN  495



>ref|XP_004243471.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 241/474 (51%), Positives = 342/474 (72%), Gaps = 14/474 (3%)
 Frame = -2

Query  1520  QWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVS  1341
             +W+K +  ++PPGP +LPIIG++ H+T   LPH+ L+ L+ KYG +M LQ+GE+  VVVS
Sbjct  22    KWRKPK-NRLPPGPWRLPIIGSVHHLTSG-LPHQVLKKLSFKYGPIMYLQLGEVPTVVVS  79

Query  1340  SPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRL  1161
             S  MAK+ L+THDLAFA+R ET+ G I+ YN  DI   PYGDYWR MRK+ + ELL+ ++
Sbjct  80    SSHMAKQILKTHDLAFASRPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKM  139

Query  1160  VRSFSSIRHDEIHRLLADVRS-SAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
             V+SFS IR DE+  LL+ +RS +   P N+ E++  F ++  CR+AFG V   + + I  
Sbjct  140   VKSFSPIRQDELSNLLSSIRSMNLDSPINLVEKLLWFMNAATCRSAFGNVCKDQRELITL  199

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG--  810
                   L+G F+ AD+FPS K LH + G +S+++    K D ++++IIN HR    +G  
Sbjct  200   IHQAQSLSGGFELADLFPSKKYLHGISGMESKLMNARYKIDQVLDNIINVHRENRANGKS  259

Query  809   ----TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                 +G + +IDV L++M+SG   VP+T+DNIKA+I+DMF AGS+TS++T +WA+SE+M+
Sbjct  260   CNGESGAEDLIDVFLRVMESGQFPVPLTNDNIKAVILDMFVAGSDTSSSTVIWALSELMR  319

Query  641   NPRVLAKAQAEVREVFKGKEMLE---ESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             NP ++AKAQAEVREV  GK+  +   ++D+E + YL  V+KETLR HPPTPL+  RECRE
Sbjct  320   NPNIMAKAQAEVREVM-GKKTCDDDIDTDLENVSYLMLVIKETLRLHPPTPLLVPRECRE  378

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
             ET I+  +TIP+K+KVMVN +A+  DP+ WE PE F+PERFE++ ++F G+HF+++PFGA
Sbjct  379   ETKID-EFTIPLKSKVMVNVWAIGRDPENWENPECFVPERFENSSIEFTGNHFEFLPFGA  437

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRRICPG+ FG A    PLAHLLYNFDWKLP+G++A  LDMTE  G++  R+ D
Sbjct  438   GRRICPGIQFGLALVTLPLAHLLYNFDWKLPQGISASDLDMTEANGISARREKD  491



>ref|XP_007156881.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
 gb|ESW28875.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
Length=504

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 244/490 (50%), Positives = 341/490 (70%), Gaps = 12/490 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLV-YTQWKKQRRGKMPPGPRKLPIIGNL--LHITGPVLPHRALRDLAR  1398
             +ISF+LF     LV + + K     K+PPGP++LPIIGNL  L + G  LPHRAL+ L+ 
Sbjct  9     VISFSLFFLLNWLVKHYKLKSHVSLKLPPGPKRLPIIGNLHQLAVAGS-LPHRALQKLSH  67

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+GEISAVV SSP+M KE  +THD+AF  R + ++G IL Y   D+V  PYG
Sbjct  68    EYGPLMHLQLGEISAVVASSPEMVKEITKTHDVAFLQRPQFISGQILSYGGIDVVFAPYG  127

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQMRKI ++ELL+ + V+SFS IR DE  + +  +R+SAG P N+S RIF   S+ +
Sbjct  128   DYWRQMRKIFVSELLSTKRVQSFSFIREDETEKFIDSIRTSAGSPINLSSRIFSLVSTSV  187

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              RAAFG +     +F+   K +    G FD AD+FPS K++H + G K+++ K   + D 
Sbjct  188   SRAAFGNISKDHIEFMLLIKKVMGSVGGFDLADLFPSMKSIHFITGKKAKLEKLLNQVDR  247

Query  857   IIESIINDHRNKLESGT------GEDCIIDVLLKLMDS-GNLQVPITHDNIKAIIIDMFG  699
              +ESI+ +H+ K            ++ ++DVLL    +   L + +T  N+KA+I+D+F 
Sbjct  248   FLESIVREHQEKQRRAKEGRVQIKDEDLVDVLLTFQQTDAALDIKMTTRNVKALILDIFA  307

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
              G +TS +T  WAM+EMM++PRV+ KAQAE+RE  + KE++ E D+EQLPYLK VVKETL
Sbjct  308   GGIDTSGSTIEWAMTEMMRSPRVMKKAQAELREALREKEIIHEKDLEQLPYLKLVVKETL  367

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPPTPL+  REC E T+I+ GY IPVKTKVM+N +A+  DP+YW + E+F+PERFE +
Sbjct  368   RLHPPTPLLIPRECSERTIID-GYEIPVKTKVMINVWAICRDPKYWSDAEKFVPERFEGS  426

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              +DF G++F+Y+PFGAGRRICPG++FG A+ + PLA LLY+F+W+LP  +T E++D  E 
Sbjct  427   SIDFKGNNFEYLPFGAGRRICPGISFGLASIMLPLARLLYHFNWELPNSMTPESIDTIER  486

Query  158   LGLAVARKND  129
              G+A+ RKND
Sbjct  487   FGMAIGRKND  496



>ref|XP_006341699.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=501

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 256/487 (53%), Positives = 343/487 (70%), Gaps = 10/487 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYG  1389
             + S  LF+SF++L+  Q  K    K+PPGP KLP IGNL  +    LPH   RDL+RKYG
Sbjct  7     ITSLVLFLSFILLLRKQ-SKIFNKKLPPGPWKLPFIGNLHQLMNGRLPHHTFRDLSRKYG  65

Query  1388  GLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYW  1209
              +  L++GE+S VVVSSPD AKE ++  DL FATR + L G I++YN+SDI   PYGDYW
Sbjct  66    PIFHLRLGEVSHVVVSSPDTAKEIMKIQDLHFATRPQLLFGEIIMYNHSDIGTCPYGDYW  125

Query  1208  RQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRA  1029
             R MRK+C  ELL+ ++VRSF SIR  E+  L++ + S      N++++IF FT  + CR+
Sbjct  126   RNMRKVCTLELLSTKMVRSFDSIRQAEMSSLISSINSMPDSLINLTDKIFWFTGPVTCRS  185

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG++  G+++ I   KDI++L G FD  D+FPS K LH + G KS+ILK H + D+I+E
Sbjct  186   AFGKIIHGQDKLIMLLKDITLLAGGFDLTDVFPSRKWLHGICGLKSKILKVHNEMDAILE  245

Query  848   SIINDH-RNKLE------SGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             +IIN+H RN+           GED +IDVLL++M+SG L  PIT++NIKA+I DMF AG+
Sbjct  246   NIINEHCRNRANGKKGNSESEGED-LIDVLLRVMESGELGTPITNNNIKAVIFDMFLAGA  304

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             ETS+TT +WA +EM++NP ++AKAQ EVREV KGK++ E+ D+E+L YLK V+KETLR H
Sbjct  305   ETSSTTIIWAFAEMIRNPSIMAKAQLEVREVLKGKKVFEDIDLEELKYLKLVIKETLRLH  364

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
             PP PL+  RECREET I G YTIP+KT+V+VNA+A+  DP+YW   E FIPERF+++ +D
Sbjct  365   PPLPLLLPRECREETRI-GEYTIPIKTRVLVNAWAIGRDPKYWHNSESFIPERFDNSSID  423

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             F G+HF+++PFGAGRR+CPG  F   N    LA LLY+FDWK P     E  DMT   G 
Sbjct  424   FRGNHFEFIPFGAGRRMCPGWLFCLMNVEHSLAQLLYHFDWKSPYEGPLENFDMTVTNGA  483

Query  149   AVARKND  129
                RK+D
Sbjct  484   TARRKDD  490



>gb|KHN42275.1| Cytochrome P450 71D8 [Glycine soja]
Length=511

 Score =   483 bits (1242),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 337/472 (71%), Gaps = 6/472 (1%)
 Frame = -2

Query  1529  VYTQWKKQRR--GKMPPGPRKLPIIGNLLHITGP-VLPHRALRDLARKYGGLMSLQIGEI  1359
             +Y Q  K R    K+PPGP KLP+IGNL  + G   LPH  L++L+RKYG LM LQ+GEI
Sbjct  23    IYKQKIKVRSVVHKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEI  82

Query  1358  SAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITE  1179
             SAVVVSS DMAKE ++THDL F  R E L   I+ Y+++DI   PYGDYWRQMRKIC  E
Sbjct  83    SAVVVSSSDMAKEIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLE  142

Query  1178  LLNPRLVRSFSSIRHDEIHRLLADVR--SSAGRPFNVSERIFLFTSSIICRAAFGEVFDG  1005
             LL+ + V+SFS IR +E+ +L+  ++  + AG P NVS+ +F   S++I RAAFG+  + 
Sbjct  143   LLSAKRVQSFSFIREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKKSEY  202

Query  1004  REQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN  825
              ++ +   K    LTG FD AD+FPS K +H +   K+++    ++ D I+E+IIN H++
Sbjct  203   EDKLLALLKKAVELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQS  262

Query  824   KLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                 G  E+ ++DVLL++  SG+L++ +T +NIKA+I D+FGAG++TS T   WAMSE+M
Sbjct  263   NHGKGEAEENLVDVLLRVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELM  322

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             KNPRV+ KAQAE+RE F+GK+ + ESDV +L YLK+V+KET+R HPP PL+  RECRE  
Sbjct  323   KNPRVMKKAQAEIREAFRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPC  382

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              I GGY IP+KTKV+VNA+AL  DP++W + E+FIPERF+    DF GS+F+Y+PFGAGR
Sbjct  383   KI-GGYEIPIKTKVIVNAWALGRDPKHWYDAEKFIPERFDGTSNDFKGSNFEYIPFGAGR  441

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             R+CPG+  G AN   PL  LLY+FDW+LP G+  E LDMTE  G AV RKN+
Sbjct  442   RMCPGILLGIANVELPLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNN  493



>ref|XP_006341698.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   482 bits (1241),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 250/489 (51%), Positives = 350/489 (72%), Gaps = 11/489 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQR--RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             L  FA  + FL L+   WK+ +    K+PPGP +LP IGNL  +    LPH   RDL++ 
Sbjct  7     LFIFASLLLFLSLILLLWKQSKTLNKKLPPGPWRLPFIGNLHQLMNGRLPHHTFRDLSQN  66

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG +  L++GE+S VVVSSPD+AKE ++  DL FATR + + G I++YN SDI   PYGD
Sbjct  67    YGPIFHLRLGEVSHVVVSSPDIAKEIMKIQDLNFATRPQLMVGEIIMYNYSDIGTCPYGD  126

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWR MRK+CI ELL+ ++V+SF SIR  E+  L++ + S      N+S++IF FT S+ C
Sbjct  127   YWRSMRKVCILELLSTKMVKSFDSIRQAEMSSLISSINSMPDSLINLSDKIFWFTGSVTC  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             R+AFG++ +G+++ I   KDI++L G+ + AD+FPS K LH ++G KS+ILK H++ D I
Sbjct  187   RSAFGKIINGQDKLIMLIKDITLLAGATELADLFPSRKWLHQIYGLKSKILKVHKEADVI  246

Query  854   IESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             +E+IIN+H+    +G        GED ++DVLL++M+SG L  PIT++NIKA+I DMF A
Sbjct  247   LENIINEHQKNRANGKKGNSEYGGED-LVDVLLRVMESGELGTPITNNNIKAVIFDMFVA  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+ETS+   +WA++EM++NP ++AKA+ EVREV KGK + E++D+E+L YLK V+KETLR
Sbjct  306   GAETSSAIIIWALAEMIRNPSIMAKAKFEVREVLKGKTIFEDTDLEELKYLKLVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECREET I G YTIP+KT+V++NA+A+  DP+YW  PE FIPERF+++ 
Sbjct  366   LHPPFPLLLPRECREETRI-GEYTIPIKTRVLINAWAIGRDPEYWHNPESFIPERFDNSS  424

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G+HF+++PFGAGRR+CPG  FG  N   PLA LLY+FDW+ P     E  DMTE  
Sbjct  425   IDFRGNHFEFIPFGAGRRMCPGWLFGLMNVEHPLAQLLYHFDWRTPYEGPLENFDMTETD  484

Query  155   GLAVARKND  129
             G+   RK+D
Sbjct  485   GITAIRKDD  493



>ref|XP_003516584.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN36163.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   482 bits (1241),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 240/489 (49%), Positives = 348/489 (71%), Gaps = 11/489 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLV-YTQWKKQRRGKMPPGPRKLPIIGNL--LHITGPVLPHRALRDLAR  1398
             +I+ +LF+    L  Y + K     K+PPGP+KLP+IGN+  L + G  LPHRAL+ LA 
Sbjct  9     VIALSLFILLNWLAKYLKLKPNVAHKLPPGPKKLPLIGNMHQLAVAGS-LPHRALQKLAH  67

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
              YG LM LQ+GEISAVVVSSP+MAKE  +THD+AF  R + ++  IL Y   D+V  PYG
Sbjct  68    IYGPLMHLQLGEISAVVVSSPNMAKEITKTHDVAFVQRPQIISAQILSYGGLDVVFAPYG  127

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQMRK+ ++ELL+ + V+SFS IR DE  + +  +R+S G P N++ ++F   S+ +
Sbjct  128   DYWRQMRKVFVSELLSAKRVQSFSFIREDETAKFIDSIRASEGSPINLTRKVFSLVSASV  187

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              RAA G     +++F+   + +    G FD AD+FPS K++H + G+K+++ K   + D 
Sbjct  188   SRAAIGNKSKDQDEFMYWLQKVIGSVGGFDLADLFPSMKSIHFITGSKAKLEKLLNRVDK  247

Query  857   IIESIINDH-RNKLESGTG-----EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             ++E+I+ +H   ++ +  G     ++ ++DVLL++  +  L + +T  ++KA+I+D+F A
Sbjct  248   VLENIVREHLERQIRAKDGRVEVEDEDLVDVLLRIQQADTLDIKMTTRHVKALILDVFAA  307

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G +TS +T  WAM+EMMKN RV  KAQAE+R+VF  K+++ ESD+EQL YLK V+KETLR
Sbjct  308   GIDTSASTLEWAMTEMMKNSRVREKAQAELRKVFGEKKIIHESDIEQLTYLKLVIKETLR  367

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  REC EET+I GGY IPVKTKVM+N +A+  DP+YW + ERF+PERFED+ 
Sbjct  368   LHPPTPLLIPRECSEETII-GGYEIPVKTKVMINVWAICRDPKYWTDAERFVPERFEDSS  426

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F+Y+PFGAGRRICPG+ FG A+ + PLA LL +F+W+LP+G+  E++DMTE  
Sbjct  427   IDFKGNNFEYLPFGAGRRICPGITFGLASIMLPLAQLLLHFNWELPDGMKPESIDMTERF  486

Query  155   GLAVARKND  129
             GLA+ RK+D
Sbjct  487   GLAIGRKHD  495



>ref|XP_006339045.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   482 bits (1241),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 262/476 (55%), Positives = 343/476 (72%), Gaps = 13/476 (3%)
 Frame = -2

Query  1523  TQWKKQRR--GKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISA  1353
              +WKK R    K+PPGP KLP +G++ H+     LPH AL  L +K+G  M LQ+GEIS 
Sbjct  24    VEWKKSRNLNKKLPPGPWKLPFLGSIHHLALEGGLPHHALTKLGKKHGPFMHLQLGEIST  83

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             +VVSS +MA+E ++ HDLAFA+R + ++  ++ YN++DIV  PYGDYWRQMRKIC  EL 
Sbjct  84    IVVSSLEMAREVMKIHDLAFASRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELF  143

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSA-GRPFNVSERIFLFTSSIICRAAFGEVFDGREQ  996
             + + VRSFSSIR +E   L+  + SS  G   NV+ERI  + SS  C+AAFGE+   +E+
Sbjct  144   SAKNVRSFSSIRREEASSLVQFIGSSPRGETINVTERISWYESSNTCKAAFGELLKDQEK  203

Query  995   FIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLE  816
             FI   ++++ LTG F  A++FPS K LH L G +S I+K H+  D I+E IIN+H+  + 
Sbjct  204   FIGIVRELAELTGGFSVANIFPSIKILHVLSGLRSRIMKVHKNVDVIVEDIINEHKKNIA  263

Query  815   SGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAM  657
             SG        GED ++DVLL+L +SG L+ PIT+DNIKAI+ID+F AG+ETSTTT++W M
Sbjct  264   SGKKGNGAFGGED-LVDVLLRLRESGELKTPITNDNIKAIMIDLFAAGTETSTTTTIWTM  322

Query  656   SEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATREC  477
             +EMM+NP VLAKAQ EVRE FKGKE   E  +E L YLK VVKE+LR HPP PL+  REC
Sbjct  323   TEMMRNPSVLAKAQVEVREAFKGKETFNEDIIEDLKYLKQVVKESLRLHPPAPLLVPREC  382

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
             REET IN GYTIP+KT+V+VN  A+  DPQYWE+ E FIPERFE + VDF G++F+Y+PF
Sbjct  383   REETNIN-GYTIPLKTRVLVNVSAIMRDPQYWEDAESFIPERFEQSSVDFMGNNFEYLPF  441

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GAGRR+CP + FG  N   PLA LLY+FDWKLP+G+  E LDMTE  G+  +RK++
Sbjct  442   GAGRRMCPAITFGLINVYLPLAKLLYHFDWKLPDGLKPENLDMTECDGINASRKSE  497



>ref|XP_003529672.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=522

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 337/472 (71%), Gaps = 6/472 (1%)
 Frame = -2

Query  1529  VYTQWKKQRR--GKMPPGPRKLPIIGNLLHITGP-VLPHRALRDLARKYGGLMSLQIGEI  1359
             +Y Q  K R    K+PPGP KLP+IGNL  + G   LPH  L++L+RKYG LM LQ+GEI
Sbjct  34    IYKQKIKVRSVVHKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEI  93

Query  1358  SAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITE  1179
             SAVVVSS DMAKE ++THDL F  R E L   I+ Y+++DI   PYGDYWRQMRKIC  E
Sbjct  94    SAVVVSSSDMAKEIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLE  153

Query  1178  LLNPRLVRSFSSIRHDEIHRLLADVR--SSAGRPFNVSERIFLFTSSIICRAAFGEVFDG  1005
             LL+ + V+SFS IR +E+ +L+  ++  + AG P NVS+ +F   S++I RAAFG+  + 
Sbjct  154   LLSAKRVQSFSFIREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKKSEY  213

Query  1004  REQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN  825
              ++ +   K    LTG FD AD+FPS K +H +   K+++    ++ D I+E+IIN H++
Sbjct  214   EDKLLALLKKAVELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQS  273

Query  824   KLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                 G  E+ ++DVLL++  SG+L++ +T +NIKA+I D+FGAG++TS T   WAMSE+M
Sbjct  274   NHGKGEAEENLVDVLLRVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELM  333

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             KNPRV+ KAQAE+RE F+GK+ + ESDV +L YLK+V+KET+R HPP PL+  RECRE  
Sbjct  334   KNPRVMKKAQAEIREAFRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPC  393

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              I GGY IP+KTKV+VNA+AL  DP++W + E+FIPERF+    DF GS+F+Y+PFGAGR
Sbjct  394   KI-GGYEIPIKTKVIVNAWALGRDPKHWYDAEKFIPERFDGTSNDFKGSNFEYIPFGAGR  452

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             R+CPG+  G AN   PL  LLY+FDW+LP G+  E LDMTE  G AV RKN+
Sbjct  453   RMCPGILLGIANVELPLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNN  504



>ref|XP_006352953.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 242/470 (51%), Positives = 342/470 (73%), Gaps = 8/470 (2%)
 Frame = -2

Query  1520  QWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVS  1341
             +WK+  +  +PPGP KLP+IG+L H+ G  LPH  LR+L++KYG LM L++GEI AV+VS
Sbjct  26    KWKEMNQRLLPPGPWKLPLIGSLHHLIG-ALPHHVLRNLSKKYGPLMHLKLGEIDAVIVS  84

Query  1340  SPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRL  1161
             SP +AK+ L+ HDL+FA R + +A  I+ Y  +DI    YGDYW+QMRKIC +ELL+ ++
Sbjct  85    SPHLAKQVLKVHDLSFAARPKLVASDIVFYRQNDIAFAEYGDYWKQMRKICTSELLSSKI  144

Query  1160  VRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQT  981
             V+SFS IR DE+H L+A + S      N+SE++   TSS+ICR+AFG+V+D R+  +   
Sbjct  145   VKSFSLIRQDEVHNLVASICSMPNVVVNMSEKVLQLTSSVICRSAFGKVWDDRDNLLMIM  204

Query  980   KDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHR-NKLESGTG  804
             +++  L   FD  D+FPSWK LH + G ++ ++  H K D I+E+IINDH+ +K   G G
Sbjct  205   RELLALLAGFDVVDLFPSWKLLHKISGKRNRLMNMHYKLDVILENIINDHKQSKANGGKG  264

Query  803   E-----DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKN  639
                   + +IDVLL++M++  LQ P+T+DNIKA+I+D+F  G+ETS TT  W +SE+MKN
Sbjct  265   NNEFEGENLIDVLLRVMENDELQFPMTNDNIKAVILDIFFRGTETSATTIQWTLSELMKN  324

Query  638   PRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVI  459
             P V+AK Q EVR+ F  K++ +++ +++L YLK V+KETLR HPP PL+  RECREET I
Sbjct  325   PNVMAKVQEEVRKTFDRKKVYDDNILKELKYLKLVIKETLRLHPPGPLLPPRECREETTI  384

Query  458   NGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRI  279
               GYTI +KTK++VN +A+  DP+ W++PE F+PERFE++ VDF G+H+Q++PFGAG R+
Sbjct  385   E-GYTISLKTKLIVNCWAMGRDPESWDDPENFMPERFENSCVDFKGNHYQFIPFGAGSRM  443

Query  278   CPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             CPG+ FG AN + PLA LLY+FDW+LP G   E LDMTE LGL+  RK+D
Sbjct  444   CPGMHFGLANVVYPLAQLLYHFDWQLPYGQQPEDLDMTETLGLSATRKHD  493



>gb|AFK45297.1| unknown [Lotus japonicus]
Length=489

 Score =   480 bits (1236),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 240/448 (54%), Positives = 321/448 (72%), Gaps = 7/448 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGP-VLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             K+PPGP KLP+IGNL  +     LPH +LR+LA KYG LM LQ+GE S VVVSSPDMAKE
Sbjct  37    KLPPGPWKLPLIGNLHQMAAAGSLPHHSLRELANKYGPLMHLQLGESSTVVVSSPDMAKE  96

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              ++TH LAFA R E L+  IL Y ++DI   PYGDYWRQMRKIC  ELL+ + V+SFS I
Sbjct  97    IMKTHGLAFAQRPELLSPKILAYGSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFI  156

Query  1139  RHDEIHRLLADVR--SSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISV  966
             R DE+ +L+  +   +SAG PFN+S+ +F   ++ + R  FG+  +  ++ +   K    
Sbjct  157   REDEVAKLIQSIHLSASAGSPFNLSKSVFSLVNTFLSRVVFGKKSECEDELLSLIKKAVE  216

Query  965   LTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGEDCIID  786
             LT  FD A++FPS+K LH +   ++++   H+K D I +SI+N+H++  + G GE+ ++D
Sbjct  217   LTAGFDVAELFPSFKPLHLITRMEAKLENMHKKLDKIFDSIVNEHQS--DHGKGEN-LVD  273

Query  785   VLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEV  606
             VLL++  SGNL +PIT +NIKA+I D+  AG++TS T   WAM+E+MKNPRV  KAQAE+
Sbjct  274   VLLRMQHSGNLYIPITVNNIKAVIWDIIAAGTDTSATALEWAMAELMKNPRVREKAQAEL  333

Query  605   REVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTK  426
             RE FKGK+ + E+D+ +L YLK+V+KETLR HPP PL+  RECRE   I GGY IPVKTK
Sbjct  334   REAFKGKKTINETDLCKLSYLKSVIKETLRLHPPAPLLVPRECREACKI-GGYEIPVKTK  392

Query  425   VMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANT  246
             V+VNA+AL  DP +W + E+FIPERF +  VDF G++F+Y+PFGAGRRICPG+  G AN 
Sbjct  393   VIVNAWALGRDPNHWYDAEKFIPERFHETSVDFKGNNFEYIPFGAGRRICPGILLGLANI  452

Query  245   ISPLAHLLYNFDWKLPEGVTAETLDMTE  162
               PLA  LY+FDW LP G+ +E LDM E
Sbjct  453   ELPLAAFLYHFDWALPNGMKSEDLDMIE  480



>gb|AAK62343.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=473

 Score =   479 bits (1232),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 244/458 (53%), Positives = 317/458 (69%), Gaps = 30/458 (7%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PPGP K+PI+G++LH+ G   PH  LRDLA+KYG +M LQ GEISAVVV+S +MAKE 
Sbjct  31    QLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVVTSREMAKEV  89

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THD+ FA+R + +A  I+ YN SDI   PYGD+WRQMRKIC+ ELLN + VRSFSSIR
Sbjct  90    LKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIR  149

Query  1136  HDEIHRL--LADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVL  963
              DE+ RL       SS+G   N ++RI  F SS+ CR+AFG+V  G++ F ++ +++  L
Sbjct  150   RDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGL  209

Query  962   TGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGEDCIIDV  783
                FD AD+FPS+K LH L G K ++L  H K D+I+E +IN+H+  L +G         
Sbjct  210   AEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG---------  260

Query  782   LLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVR  603
                                   + DMF AG+ETS+TT++WAM+EMMKNP V  KAQAEVR
Sbjct  261   -----------------KTNGALGDMFAAGTETSSTTTVWAMAEMMKNPNVFNKAQAEVR  303

Query  602   EVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKV  423
             E FK K   +E D E+L YLK V+KETLR HPP+PL+  RECRE+T IN GYTIP KTKV
Sbjct  304   ETFKDKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECREDTDIN-GYTIPAKTKV  362

Query  422   MVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTI  243
             MVN +AL  DP+YW++ E F PERFE   VDF G++F+++PFG GRRICPG++FG AN  
Sbjct  363   MVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRRICPGMSFGLANLY  422

Query  242   SPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              PLA LLY+FDWKLP G+    LD+TE+ G+ +ARK D
Sbjct  423   LPLAQLLYHFDWKLPSGMMPGDLDLTELAGITIARKGD  460



>gb|AGN04217.1| cytochrome P450 [Salvia miltiorrhiza]
Length=502

 Score =   479 bits (1234),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 243/481 (51%), Positives = 338/481 (70%), Gaps = 7/481 (1%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGK----MPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             +  L  SF+  +   W K +  K    +PP P KLP+IG++  + G  LPH+AL+  A+K
Sbjct  12    TLLLLSSFIFFLLKAWTKPKSPKAHQNLPPSPPKLPVIGHIHLLVGD-LPHKALQRQAQK  70

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             +G +M LQ+GE+ AVV+SS +  +E L+  D A A R E++A  IL Y+ +DI    Y +
Sbjct  71    HGPVMHLQLGEVPAVVISSREATREVLKVQDPACADRPESIASKILWYDYTDIAFSAYNE  130

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWRQMRKICI ELL+ + V+SF  IR DE  RL+ ++  S+G   +++++IF FTS+I C
Sbjct  131   YWRQMRKICIVELLSSKNVKSFGHIRRDESSRLMKNLECSSGNAIDLTDKIFTFTSTITC  190

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAAFG+V   R+  I   K+   + G F+ AD+FPSWK L+ L  +K  + +   K D+I
Sbjct  191   RAAFGKVMTDRDGLIALFKEAVAMAGGFELADLFPSWKLLNVLSWSKYRLWRMRGKLDAI  250

Query  854   IESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTT  675
             ++ II++H+ K     G + I+DVL+++  +G L+ PIT DNIKA+I DMF AG+ETS+T
Sbjct  251   LDGIIDEHKLKQSGEFGGEDIVDVLIRMQQTGELKFPITTDNIKAVIFDMFVAGTETSST  310

Query  674   TSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPL  495
             T++WAMSEMM+NPRV+ KAQAEVR   KGK  +EESDV++L YLK V+KET R HPP PL
Sbjct  311   TTVWAMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVIKETFRLHPPIPL  370

Query  494   IATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSH  315
             +  R+ REE  ++ GY+IP+KTKVM+N +++  DPQYWE+PE F PERFE++  DF G+ 
Sbjct  371   LP-RQTREECKVD-GYSIPIKTKVMLNIWSMGRDPQYWEQPEMFQPERFENSPKDFIGND  428

Query  314   FQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             F+Y+PFGAGRRICPGL FG AN   PLA +LY+FDWKLP+G++ E LDM+E  GL V+RK
Sbjct  429   FEYIPFGAGRRICPGLNFGLANIELPLAKMLYHFDWKLPKGMSCERLDMSEGEGLTVSRK  488

Query  134   N  132
              
Sbjct  489   K  489



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 238/472 (50%), Positives = 336/472 (71%), Gaps = 13/472 (3%)
 Frame = -2

Query  1514  KKQRRGK-MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSS  1338
             KK R  K +PPGP +LPIIG++ H+T  + PH  L++L++K+G +M LQ+GE+  +VVSS
Sbjct  28    KKSRNKKILPPGPWRLPIIGSVHHLTKGI-PHHVLKNLSQKFGPIMYLQLGEVPTIVVSS  86

Query  1337  PDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLV  1158
             P MA++ ++THDLAFA+R++T+ G I  Y+ +DI   PYG+YWR MRK+CI ELL+ ++V
Sbjct  87    PHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELLSAKMV  146

Query  1157  RSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVF-DGREQFIQQT  981
             +SFS IR DE+  L++ ++S    P NVSE++F F +S+ CR++FG+   D  E  I   
Sbjct  147   KSFSPIRLDELSSLVSSIKSMKNTPINVSEKLFWFMNSVTCRSSFGKACKDQNEAMISLI  206

Query  980   KDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRN--------  825
               +  L G F+ AD++PS K L  + G  S++++   K D++++ +I+ HR         
Sbjct  207   HGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHRENHANGKKC  266

Query  824   KLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
               E G+ ED +IDV  ++M +G L   +T++NIKA+I+DMF AGS+TS++T  WA+SEMM
Sbjct  267   NAECGSNED-LIDVFFRVMGTGELPFTLTNNNIKAVILDMFVAGSDTSSSTVTWALSEMM  325

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             K+P V+AKAQAEVREVFKGK+  ++ D+E++ YLK V+KETLR HPPTPL+  RECREET
Sbjct  326   KSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVIKETLRLHPPTPLLVPRECREET  385

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              I+ GY IPVK+KV+VN +A+  DP+ WE+ E FIPERFE++ VDF+G+HFQ++PFGAGR
Sbjct  386   EID-GYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERFENSSVDFSGTHFQFLPFGAGR  444

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             R CPG  FG A    PLAHLLYNF+W LP G+    LDM E  G+   R  D
Sbjct  445   RTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANGMTARRDKD  496



>gb|AJD25162.1| cytochrome P450 CYP71D374 [Salvia miltiorrhiza]
Length=502

 Score =   479 bits (1232),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 244/485 (50%), Positives = 343/485 (71%), Gaps = 4/485 (1%)
 Frame = -2

Query  1583  NIMENLISFALFVSFLVLVYTQWKKQRRGK-MPPGPRKLPIIGNLLHITGPVLPHRALRD  1407
             N    L+  + F+ FL+  +T+ K  +  + +PP P KLP+IG++  + G  LPH+AL+ 
Sbjct  8     NFTTTLLLLSSFIFFLLKAWTKPKSPKAHQNLPPSPPKLPVIGHIHLLVGD-LPHKALQR  66

Query  1406  LARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLG  1227
              A+K+G +M LQ+GE+ AVV+SS +  +E L+  D A A R E++A  IL Y+ +DI   
Sbjct  67    QAQKHGPVMHLQLGEVPAVVISSREATREVLKVQDPACADRPESIASKILWYDYTDIAFS  126

Query  1226  PYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTS  1047
              Y +YWRQMRKICI ELL+ + V+SF  IR DE  RL+  +  S+G   +++++IF FTS
Sbjct  127   AYNEYWRQMRKICIVELLSSKNVKSFGHIRRDESSRLMKSLECSSGNAIDLTDKIFTFTS  186

Query  1046  SIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRK  867
             +I CRAAFG+V   R+  I   K+   + G F+ AD+FPSWK L+ L  +K  + +   K
Sbjct  187   TITCRAAFGKVMTDRDGLIALFKEAVAMAGGFELADLFPSWKLLNVLSWSKYRLWRMRGK  246

Query  866   TDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSE  687
              D+I++ II++H+ K     G + I+DVL+++  +G L+ PIT DNIKA+I DMF AG+E
Sbjct  247   LDAILDGIIDEHKLKQSGEFGGEDIVDVLIRMQQTGELKFPITTDNIKAVIFDMFVAGTE  306

Query  686   TSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHP  507
             TS+TT++WAMSEMM+NPRV+ KAQAEVR   KGK  +EESDV++L YLK V+KET R HP
Sbjct  307   TSSTTTVWAMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVIKETFRLHP  366

Query  506   PTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDF  327
             P PL+  R+ REE  ++ GY+IP+KTKVM+N +++  DPQYWE+PE+F PERFE++  DF
Sbjct  367   PIPLLP-RQTREECKVD-GYSIPIKTKVMLNIWSMGRDPQYWEQPEKFQPERFENSPKDF  424

Query  326   NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLA  147
              G+ F+Y+PFGAGRRICPGL FG AN   PLA +LY+FDWKLP+G++ E LDM+E  GL 
Sbjct  425   IGNDFEYIPFGAGRRICPGLNFGLANIELPLAKILYHFDWKLPKGMSYERLDMSEGEGLT  484

Query  146   VARKN  132
             V+RK 
Sbjct  485   VSRKK  489



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 237/467 (51%), Positives = 325/467 (70%), Gaps = 12/467 (3%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITG-PVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             K+PPGP KLP+IGNL  I     LPHRA + LA KYG ++ L++GE SAVV+SSP +AKE
Sbjct  33    KLPPGPMKLPLIGNLHQIAALGSLPHRAFKQLAHKYGPIVHLKLGETSAVVISSPKLAKE  92

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              L+THD+ FA R    A  I+ Y + DI   PYGDYWRQMRKIC+ ELL+ + V+SFS I
Sbjct  93    ILKTHDVIFANRPHLQASHIMTYGSKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYI  152

Query  1139  RHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLT  960
             R DE    +  ++SS G   N++ RIF   SS + R+AFG+  + +++F+   +      
Sbjct  153   REDETRNFIKSIQSSEGSSVNLTNRIFSLVSSTVSRSAFGDKTEDQDEFVSVIRKAIESV  212

Query  959   GSFDFADMFPSWKA-LHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG---------  810
             G  + AD+FPS K+ +  L G KS++LK H+K D I+E I+  H+ K             
Sbjct  213   GGLEPADLFPSMKSIIQMLTGTKSKVLKMHKKADKILEIIVRKHQEKQRRAKEGKVSSDE  272

Query  809   TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
               ++ ++DVLL++ +SG+L++PIT  NIKA+I D F AG++T+T+T +WAMSE+MKNP V
Sbjct  273   VEQEDLVDVLLRIQESGSLEIPITTSNIKAVIFDAFAAGTDTTTSTIVWAMSELMKNPSV  332

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
             + KAQAE+RE  KGKE++ E+D+++LPYLK V+KETLR H PTPL+  REC E T I+ G
Sbjct  333   MNKAQAEIREACKGKEIISENDIQELPYLKLVIKETLRLHSPTPLLLPRECTELTNID-G  391

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             Y IP KTKVM+N +A+A DPQYW + E F PERFE + +DF G++F+Y+PFGAGRRICPG
Sbjct  392   YDIPKKTKVMINVWAMARDPQYWTDAEMFNPERFEGSSIDFRGNNFEYLPFGAGRRICPG  451

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             L FG A  + P+A LLY+F+W+LP  +    LDMTE  GLA+ +K+D
Sbjct  452   LQFGIAGIMLPVALLLYHFNWELPNKMKPMDLDMTEHYGLAIGKKSD  498



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   477 bits (1228),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 339/472 (72%), Gaps = 11/472 (2%)
 Frame = -2

Query  1517  WKKQRRGK----MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAV  1350
             W+K +  +    +PPGPRKLPIIGN+  + G  LPH  LRDLA+K+GG+M LQ+GE+S +
Sbjct  2     WRKSKTKEATKNLPPGPRKLPIIGNIHQLIGS-LPHHCLRDLAKKHGGIMHLQLGEVSNI  60

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             V+SSP+ AKE ++THD+ FA R   LA SI+ YN +DI   PY DYWRQ+RKICI ELL+
Sbjct  61    VISSPEAAKEVMKTHDIVFAQRPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLS  120

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              + V+SF  IR +E+  L+  + SS+G+ FN S ++F  T  I  RA FGE  + +E+FI
Sbjct  121   AKRVQSFRFIREEEVSNLITAISSSSGKAFNFSRKLFSLTYGIAARATFGEKCEDQEEFI  180

Query  989   QQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG  810
                ++I+ + G F  AD+FPS K LH + G +S +++  ++ D +I +II+DHR K ++G
Sbjct  181   PIVEEITEVAGGFSLADLFPSVKFLHSISGMRSRLIRLQKEADRVIGNIIDDHRAKNKTG  240

Query  809   T--GE---DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                GE   D ++DVLL+L + GNL+ P+T DNIKA+I+D+F AGSETS+TT  WAMSEM+
Sbjct  241   KVGGEGQDDDLVDVLLRLQEHGNLEFPLTTDNIKAVILDIFVAGSETSSTTVEWAMSEML  300

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             +NPRV+ KAQ EVR++F  K  +EE+D+++  YLK V+KETLR HPP PL+  RE  E+ 
Sbjct  301   RNPRVMYKAQEEVRKLFDKKGNVEETDLQESKYLKLVIKETLRLHPPAPLLLPRESTEKC  360

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
              IN GY IP K+KV+VNA+A+  DP +W E E F PERF D+ +D+ G++F+++PFGAGR
Sbjct  361   EIN-GYDIPEKSKVIVNAWAIGRDPNHWTEAETFYPERFLDSSIDYKGNNFEFIPFGAGR  419

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             R+CPG+ FG AN   PLA LLY+FDW+LP G+ AETLDM E  G  V RKND
Sbjct  420   RMCPGILFGIANVELPLAQLLYHFDWELPSGLKAETLDMIESFGATVRRKND  471



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   477 bits (1228),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 343/470 (73%), Gaps = 9/470 (2%)
 Frame = -2

Query  1514  KKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSP  1335
             K +++ ++PPGP +LP IG+L H+ G    H  LR+LA++YG LM LQ+GEI  V++SS 
Sbjct  24    KNKKQTRLPPGPWRLPFIGSLHHLIGRGHLHPNLRNLAQRYGPLMYLQLGEIPVVIISSS  83

Query  1334  DMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVR  1155
              +AKE L THDLAFA R ++ + +I+ YNN DIV  PY +Y +QMRKIC  +L + ++V+
Sbjct  84    TIAKELLTTHDLAFADRPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVK  143

Query  1154  SFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKD  975
             SFS+IR DEI  L++ +RS+   P N++E+IF FT+S+ C AAFG++F  R++FI+  KD
Sbjct  144   SFSTIRKDEISSLISSIRSTRDSPINMTEKIFWFTNSVTCSAAFGKMFKDRDEFIKLLKD  203

Query  974   ISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH------RNK-LE  816
             I +L   F   D+FPSWK LH L G +S ++  H+K D I+E I+ +H      RNK + 
Sbjct  204   ILILASGFCVTDLFPSWKLLHKLSGAESRLMNAHKKVDEIMEDILKEHLENKANRNKGIG  263

Query  815   SGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNP  636
                G + ++DVLLK+M+   L+ PIT+D+IKA+I+D+F AGSETS+T ++W +SEMMKN 
Sbjct  264   DQFGGEDLVDVLLKVMEDAELECPITNDHIKAVILDIFIAGSETSSTITIWVLSEMMKNS  323

Query  635   RVLAKAQAEVREVFKGKEMLE-ESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVI  459
              ++AKAQ EVR+V +GK+  + E D+E+L YLK V+KETLR H P PL+  RECRE+T I
Sbjct  324   TIMAKAQKEVRQVLRGKKNYDNEEDLEKLTYLKLVIKETLRLHTPAPLLGPRECREQTNI  383

Query  458   NGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRI  279
             + GYTIP+KTK++VNA+ALA DP+ W +PE FIPERFE++ +DF G+HF+++PFGAGRR+
Sbjct  384   D-GYTIPLKTKILVNAWALARDPESWHDPECFIPERFENSSIDFLGNHFEFIPFGAGRRM  442

Query  278   CPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             CPG+ FG  N    LA LLY+F+W+LP G+  + LDMTE  GL+  ++ D
Sbjct  443   CPGVLFGLTNVELSLAQLLYHFEWELPYGMKPKDLDMTETYGLSGGKQRD  492



>ref|XP_003517259.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   477 bits (1228),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 336/488 (69%), Gaps = 14/488 (3%)
 Frame = -2

Query  1559  FALFVSFLVLVYTQW-----KKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLAR  1398
              ++ ++F V +   W     K++ R K+PP P +LPIIGNL  +     LP +AL+ L R
Sbjct  6     LSIVITFFVFLLLHWLVKIYKQKSRYKLPPSPWRLPIIGNLHQLALAASLPDQALQKLVR  65

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG LM LQ+GEISA+VVSSP MA E ++THD+ F  R + LA   ++Y  +DIV  PYG
Sbjct  66    KYGPLMHLQLGEISALVVSSPKMAMEVMKTHDVHFVQRPQLLAPQFMVYGATDIVFAPYG  125

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQ+RKIC  ELL+ + V+SFS IR DE  +L+  + SSAG   ++S ++F    + +
Sbjct  126   DYWRQIRKICTLELLSAKRVQSFSHIRQDENRKLIQSIHSSAGSSIDLSGKLFSLLGTTV  185

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              RAAFG+  D +++ +   +    +TG F+  DMFPS K LH L   K+++   H++ D 
Sbjct  186   SRAAFGKENDDQDELMSLVRKAITMTGGFELDDMFPSLKPLHLLTRQKAKVEHVHQRADK  245

Query  857   IIESIINDHRNKLESG------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             I+E I+  H  K   G        ++ ++DVLL+L +SG+L+VP+T +NIKA+I ++F +
Sbjct  246   ILEDILRKHMEKRTIGKEGSNEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFAS  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++T  +T  WAMSEMMKNPRV  KAQAE+R+ FKGKE++ E+D+E+L YLK+V+KETLR
Sbjct  306   GTDTPASTLEWAMSEMMKNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP+ LI  REC + T I+ GY IP+KTKVM+N +A+  DPQYW + ERFIPERF+D+ 
Sbjct  366   LHPPSQLIP-RECIKSTNID-GYDIPIKTKVMINTWAIGRDPQYWSDAERFIPERFDDSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G+ F+Y+PFGAGRR+CPG+ FG A+   PLA LLY+F+W+LP  +    LDM E+ 
Sbjct  424   IDFKGNSFEYIPFGAGRRMCPGITFGLASITLPLALLLYHFNWELPNKMKPADLDMDELF  483

Query  155   GLAVARKN  132
             GL V RKN
Sbjct  484   GLTVVRKN  491



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   475 bits (1222),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 238/470 (51%), Positives = 326/470 (69%), Gaps = 11/470 (2%)
 Frame = -2

Query  1514  KKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISAVVVSS  1338
             K +   K+PPGP KLPIIGNL  +     LPH AL+ LARKYG LM LQ+GEIS +VVSS
Sbjct  26    KPKSSHKLPPGPWKLPIIGNLHQVALAASLPHHALQKLARKYGPLMHLQLGEISTLVVSS  85

Query  1337  PDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLV  1158
             P MA E ++THDLAF  R + LA   + Y  +DI   PYG+YWRQMRKIC  ELL+ + V
Sbjct  86    PKMAMEIMKTHDLAFVQRPQLLAPQYMAYGATDIAFAPYGEYWRQMRKICTLELLSAKRV  145

Query  1157  RSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTK  978
             +SFS IR DE  +L+  ++SSAG P ++S ++F    + + RAAFG   D +++F+   +
Sbjct  146   QSFSHIRQDENRKLIQSIQSSAGSPIDLSSKLFSLLGTTVSRAAFGNKNDDQDEFMSLVR  205

Query  977   DISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH-----RNKLES  813
                 +TG F+  DMFPS K LH L G K+++ + H++ D I+E I+  H     R K E 
Sbjct  206   KAVAMTGGFELDDMFPSLKPLHLLTGQKAKVEEIHKRADRILEDILRKHVEKRTRAKEEG  265

Query  812   GTGE---DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMK  642
                E   + ++DVLL++  SG+L+V +T  ++KA+I D+F AG++TS +T  WAM+EMMK
Sbjct  266   NNSEAQQEDLVDVLLRIQQSGSLEVQMTTGHVKAVIWDIFAAGTDTSASTLEWAMAEMMK  325

Query  641   NPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETV  462
             NPRV  KAQA +R+ FKGKE + E+D+E+L YLK+V+KETLR HPP+ LI  REC + T 
Sbjct  326   NPRVREKAQAVIRQAFKGKETIRETDLEELSYLKSVIKETLRLHPPSQLIP-RECIKSTN  384

Query  461   INGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRR  282
             I+ GY IP+K+KVM+N +A+  DPQYW + ERFIPERF+ + +DF G+ ++Y+PFGAGRR
Sbjct  385   ID-GYEIPIKSKVMINTWAIGRDPQYWSDAERFIPERFDGSYIDFKGNSYEYIPFGAGRR  443

Query  281   ICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             +CPG+ FG A+   PLA LLY+F+W+LP  +  E LDM E  G+ V RKN
Sbjct  444   MCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMNEHFGMTVGRKN  493



>sp|D5JBX1.1|GAO_BARSP RecName: Full=Germacrene A oxidase; Short=BsGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Barnadesia spinosa]
 gb|ADF43083.1| germacrene A oxidase [Barnadesia spinosa]
Length=496

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/480 (49%), Positives = 336/480 (70%), Gaps = 8/480 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             +  A+FV F++       K  +  +P   R LPIIG++ H+ G  LPHR + D+ARKYG 
Sbjct  9     LGLAVFV-FILFKLLTGSKSTKNSLPEAWR-LPIIGHMHHLVG-TLPHRGVTDMARKYGS  65

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWR
Sbjct  66    LMHLQLGEVSTIVVSSPRWAKEVLTTYDITFANRPETLTGEIVAYHNTDIVLSPYGEYWR  125

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRA  1029
             Q+RK+C  ELL+ + V+SF S+R +E   L+ +VRSS +G P ++SE IF   ++I+ RA
Sbjct  126   QLRKLCTLELLSAKKVKSFQSLREEECWNLVKEVRSSGSGSPVDLSESIFKLIATILSRA  185

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG+    + +F +  K+I  LTG FD AD+FPS K LH L G ++++   H K DS+I 
Sbjct  186   AFGKGIKDQREFTEIVKEILRLTGGFDVADIFPSKKILHHLSGKRAKLTNIHNKLDSLIN  245

Query  848   SIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
             +I+++H     + + ++ ++DVLL+L DS  L  P+T DN+KA+I+DMFGAG++TS+ T 
Sbjct  246   NIVSEHPGS-RTSSSQESLLDVLLRLKDSAEL--PLTSDNVKAVILDMFGAGTDTSSATI  302

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WA+SE+++ PR + K Q E+R+   GKE ++E D+++L YLK V+KETLR HPP PL+ 
Sbjct  303   EWAISELIRCPRAMEKVQTELRQALNGKERIQEEDIQELSYLKLVIKETLRLHPPLPLVM  362

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
              RECRE  V+  GY IP KTK++VN +A+  DP+YW++ E F+PERFE++ ++  GS ++
Sbjct  363   PRECREPCVL-AGYEIPTKTKLIVNVFAINRDPEYWKDAETFMPERFENSPINIMGSEYE  421

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             Y+PFGAGRR+CPG A G AN   PLAH+LY F+WKLP G   + LDM+E  G  V RK++
Sbjct  422   YLPFGAGRRMCPGAALGLANVELPLAHILYYFNWKLPNGARLDELDMSECFGATVQRKSE  481



>gb|KHN36164.1| Cytochrome P450 71D8 [Glycine soja]
Length=503

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 237/488 (49%), Positives = 335/488 (69%), Gaps = 14/488 (3%)
 Frame = -2

Query  1559  FALFVSFLVLVYTQW-----KKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLAR  1398
              ++ ++F V +   W     K++ R K+PP P +LPIIGNL  +     LP +AL+ L R
Sbjct  6     LSIVITFFVFLLLHWLVKIYKQKSRYKLPPSPWRLPIIGNLHQLALAASLPDQALQKLVR  65

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG LM LQ+GEIS +VVSSP MA E ++THD+ F  R + LA   ++Y  +DIV  PYG
Sbjct  66    KYGPLMHLQLGEISTLVVSSPKMAMEVMKTHDVHFVQRPQLLAPQFMVYGATDIVFAPYG  125

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             DYWRQ+RKIC  ELL+ + V+SFS IR DE  +L+  + SSAG   ++S ++F    + +
Sbjct  126   DYWRQIRKICTLELLSAKRVQSFSHIRQDENRKLIQSIHSSAGSSIDLSGKLFSLLGTTV  185

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              RAAFG+  D +++ +   +    +TG F+  DMFPS K LH L   K+++   H++ D 
Sbjct  186   SRAAFGKENDDQDELMSLVRKAITMTGGFELDDMFPSLKPLHLLTRQKAKVEHVHQRADK  245

Query  857   IIESIINDHRNKLESG------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             I+E I+  H  K   G        ++ ++DVLL+L +SG+L+VP+T +NIKA+I ++F +
Sbjct  246   ILEDILRKHMEKRTIGKEGSNEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFAS  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++T  +T  WAMSEMMKNPRV  KAQAE+R+ FKGKE++ E+D+E+L YLK+V+KETLR
Sbjct  306   GTDTPASTLEWAMSEMMKNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP+ LI  REC + T I+ GY IP+KTKVM+N +A+  DPQYW + ERFIPERF+D+ 
Sbjct  366   LHPPSQLIP-RECIKSTNID-GYDIPIKTKVMINTWAIGRDPQYWSDAERFIPERFDDSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G+ F+Y+PFGAGRR+CPG+ FG A+   PLA +LY+F+W+LP  +    LDM E+ 
Sbjct  424   IDFKGNSFEYIPFGAGRRMCPGITFGLASITLPLALILYHFNWELPNKMKPADLDMDELF  483

Query  155   GLAVARKN  132
             GL V RKN
Sbjct  484   GLTVVRKN  491



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 242/487 (50%), Positives = 334/487 (69%), Gaps = 8/487 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITG-PVLPHRALRDLARKY  1392
             +I F +F+           K+   K+PPGP KLP IGNL  I     LPHRA + LA KY
Sbjct  9     VIPFFVFLMLRFFAKYYMLKKFGHKLPPGPMKLPFIGNLHQIASLGSLPHRAFQQLAHKY  68

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G +M L++G+IS +V++SP +AKE L+THD+ FA R    +  I+ Y + DI   PYGDY
Sbjct  69    GPIMHLKLGQISTIVITSPKLAKEILKTHDIVFANRPHLESAHIMSYGSKDIAFSPYGDY  128

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             +RQMRKIC+ ELL+ + V+SFS IR DE +  +  ++SSAG   N++ RIF   SSI+ R
Sbjct  129   YRQMRKICMLELLSAKRVQSFSYIREDETNIFIELIKSSAGSEVNLTNRIFSLVSSIVSR  188

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWK-ALHPLFGNKSEILKTHRKTDSI  855
             +AFG+  + +++F++  +      G  + AD+FPS K  +H L GNKS++ K  +++D I
Sbjct  189   SAFGDKTEDQDEFVRVIRKTIESVGGLEPADLFPSMKYIIHVLTGNKSKLEKMQKQSDKI  248

Query  854   IESIINDHRNK---LESGTGEDC--IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             +E I+  H+ K    + G+ E+   ++DVLL++  SG L +PIT  NIKAII D F AG+
Sbjct  249   LEIIVGKHQEKQRRAKEGSDEEQEDLVDVLLRVQQSGTLDIPITTSNIKAIIFDTFAAGT  308

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             +T+T+T +WAM+E+MKNPRV+ K Q+E+R+  KGKE++ E DV+ LPYLK V+KETLR H
Sbjct  309   DTTTSTIVWAMAELMKNPRVMEKLQSELRDACKGKEIITEVDVQDLPYLKLVIKETLRLH  368

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
              PTPL+  RE  + T I GGY IP KTKVMVN +A+A DP YW + E FIPERF+ N +D
Sbjct  369   SPTPLLLPRESTQLTNI-GGYDIPKKTKVMVNVWAMARDPYYWNDAEMFIPERFDANSID  427

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             + G+HF+Y+PFGAGRRICPG++FG A  + PLA LLY+FDWKLP  +  + LDMTE  GL
Sbjct  428   YKGNHFEYLPFGAGRRICPGMSFGIAGIMLPLALLLYHFDWKLPNQMKPQDLDMTEHYGL  487

Query  149   AVARKND  129
             A+ RK D
Sbjct  488   AIGRKTD  494



>ref|XP_004295868.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/486 (50%), Positives = 338/486 (70%), Gaps = 8/486 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             +++F+LFV  ++ + ++ K K     +PPGPR+LP IGN+  + G  LPHR+LR+LA KY
Sbjct  11    ILTFSLFVVMVLKIASRGKTKSSSSNLPPGPRELPFIGNIHQLAGS-LPHRSLRNLANKY  69

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM L++GE+S VVVSS + AKE ++THD  FA+R   LA  I+ YN+++IV   YGDY
Sbjct  70    GPLMHLRLGEVSTVVVSSAEFAKEVMKTHDATFASRPHLLAADIVSYNSTNIVFAKYGDY  129

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQ+RKIC  E+L+P+ V+S+  IR +E+  L+  + S A  P N++E+I+L T +I  R
Sbjct  130   WRQLRKICTLEVLSPKRVQSYRPIREEEMLNLIKWIASKARSPINLTEKIYLSTYTITTR  189

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             AAFG+     E+FI   K+   L G FD AD+FPS+  LH + G + ++ +  +KTD I+
Sbjct  190   AAFGKKSKYHEEFIDAVKEGIQLAGGFDLADVFPSYSLLHMITGMRPKLQRLQKKTDRIL  249

Query  851   ESIINDHRNKLESGTGE----DCIIDVLLKL-MDSGNLQVPITHDNIKAIIIDMFGAGSE  687
             E+II +H  K  S  GE    + +I+VLLK   D+  L+  +T DNIKA+I+D+FGAGSE
Sbjct  250   ENIIKEHTEKATSQGGEREAQEHLIEVLLKFHKDNCGLEFNLTTDNIKAVILDIFGAGSE  309

Query  686   TSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHP  507
             TS T   WAMSEM+KNP+++ +AQ EVREVF     + E+ ++++ YL +++KETLR HP
Sbjct  310   TSATAVDWAMSEMVKNPQIMKRAQDEVREVFNRLGHVSETGIKEMKYLNSIIKETLRLHP  369

Query  506   PTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDF  327
               PL+  RECRE   I GGY IPVKTKV+VN +A+  DP+YW EPERF P+RF D+ VDF
Sbjct  370   SAPLLIPRECRETCEI-GGYEIPVKTKVVVNGWAIGRDPKYWTEPERFYPDRFLDSSVDF  428

Query  326   NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLA  147
              G++F+++PFGAGRR+CPG+ +G AN   PLA LLY+FDWK P+G   E LDM E  G+ 
Sbjct  429   RGTNFEFIPFGAGRRMCPGITYGLANVELPLAMLLYHFDWKRPDGKKHEDLDMAEAFGIT  488

Query  146   VARKND  129
             V RK +
Sbjct  489   VGRKEN  494



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 237/482 (49%), Positives = 340/482 (71%), Gaps = 18/482 (4%)
 Frame = -2

Query  1538  LVLVYTQWKKQ----RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQ  1371
             ++++  +W+K     ++ ++PPGP +LP+IG+L H+ G   PHR  RDLARKYG +M L+
Sbjct  22    IIVLVRKWRKSETSSQKQRLPPGPWRLPLIGSLHHLIG-AHPHRIFRDLARKYGPVMYLE  80

Query  1370  IGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKI  1191
             +GE+  V++SSP  AKE L+THDLAFA R +  +  I++YNN DI    YGDYW+QMRKI
Sbjct  81    LGEVPTVIISSPSAAKETLKTHDLAFANRPQFTSTYIVMYNNKDIAFSEYGDYWKQMRKI  140

Query  1190  CITELLNPRLVRSFSSIRHDEIHRLLADVRSSAG-RPFNVSERIFLFTSSIICRAAFGEV  1014
             CI ELL+ R+V+SFSSIR DEI  LL+ V S  G    N++E+I  +   + CR  FG++
Sbjct  141   CIMELLSARMVKSFSSIRKDEISNLLSSVHSVKGTSEVNMTEKIVRYACFVTCRLVFGKL  200

Query  1013  FDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIIND  834
                RE  I   K + +L G  D  D+FPSWK L+ + G KS ++K H+  DS++E+I+N+
Sbjct  201   GKDREVLIDLMKKMLLLAGG-DVCDLFPSWKLLYKMTGAKSRLVKMHQVVDSVLENIVNE  259

Query  833   HRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTT  675
             H     +G        GED ++DV L++ ++  LQ PIT+D+IKA+I DMF AG+ETS+T
Sbjct  260   HIRSRAAGNKGNGEYGGED-LVDVFLRIQENDQLQFPITNDHIKAVIFDMFTAGTETSST  318

Query  674   TSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPL  495
               +WA+SE+MKNP V+AKAQ+EVR+ FKGK   +E D++ LPYL  VVKETLR H P   
Sbjct  319   AIVWALSELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVVKETLRLHAPG--  376

Query  494   IATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSH  315
             I  R+CRE+T I+ GYTIP +  V+VN +A+  DP+ W +PE FIPERFE++ +D+ G+H
Sbjct  377   ILHRQCREQTCID-GYTIPSRATVLVNTWAIGRDPEVWHDPESFIPERFENSSIDYMGNH  435

Query  314   FQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             F+++PFG+G+RICPG+ FG AN   PLA LLY+F+W+LP G + + LDM+++ G++VA++
Sbjct  436   FEFIPFGSGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDMSQIPGMSVAKE  495

Query  134   ND  129
              D
Sbjct  496   KD  497



>ref|XP_007020553.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12078.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=518

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 326/476 (68%), Gaps = 10/476 (2%)
 Frame = -2

Query  1532  LVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             LV  Q  K+   K+PPGP KLP+IGNL H     LPH  LRDLA+KYG LM L++GE+  
Sbjct  30    LVQAQKPKKSFTKLPPGPWKLPLIGNL-HQLVSTLPHYTLRDLAKKYGPLMWLKLGEVPT  88

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             +VVSS +MAKE +RTHD+ F  R   LA SI+ YN  DI+  PYG+YWRQM+KIC+TELL
Sbjct  89    LVVSSLEMAKEVMRTHDVTFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELL  148

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             +   V+SF SIR  E+  L+  + S+A  P N+SE+I+  T  I  RAAFG+     E+F
Sbjct  149   STNRVQSFQSIREQEVSALMEIISSNARSPVNLSEKIYSMTYGITARAAFGKKSGDEEEF  208

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK---  822
             I    ++S L G F  ADM+PS + L  + G + ++ K H+ +D I+E II+ H+ +   
Sbjct  209   ISIAIEVSKLAGGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNG  268

Query  821   -LESGTG----EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAM  657
                + TG    E+ ++DVLLKL   G+L  P+  DNIKA+I D+FGAGSE S+ T  WAM
Sbjct  269   MANTKTGNKKDEEDLVDVLLKLQQQGDLDFPLLKDNIKAVIQDIFGAGSEASSNTVEWAM  328

Query  656   SEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATREC  477
             SEM++NP+++ +AQAEVR VF GK  ++E  +E+L +LK +VKETLR +P  PL+  REC
Sbjct  329   SEMVRNPKLMKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPREC  388

Query  476   REETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPF  297
              E+ VI GGY IP KTKV+VNA+A+  DP YW+E E+F PERF D  +DF G++F+Y+PF
Sbjct  389   SEDCVI-GGYEIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERFIDKRIDFRGTNFEYIPF  447

Query  296   GAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GAGRR+CPG++F   N   PLA LLY+FDWKLP  +  + LDMTE  GL V RKND
Sbjct  448   GAGRRMCPGISFALPNIELPLAKLLYHFDWKLPNEMKCDDLDMTESFGLTVRRKND  503



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 232/473 (49%), Positives = 338/473 (71%), Gaps = 13/473 (3%)
 Frame = -2

Query  1520  QWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVS  1341
             +W++ ++  +PPGP +LP+IG+L H+     PHR  RDLARKYG +  L++GE+  V++S
Sbjct  21    KWRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVTYLELGEVPTVIIS  80

Query  1340  SPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRL  1161
             SP  +K+ L+THDLAFA+R +  +  I++YNN DI    YGDYW+QMRKICI ELL+ ++
Sbjct  81    SPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAKM  140

Query  1160  VRSFSSIRHDEIHRLLADVRSSAGR-PFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
             V+SFSSIR DE+  +L+ + S  G    N++E+I  FTSS+ CR  FG++   R++ I  
Sbjct  141   VKSFSSIRKDELSSVLSSMDSVGGSCEVNMTEKIVRFTSSVTCRLVFGKLCRDRDELINL  200

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGT-  807
              KD   L G FD  D FPSWK L+ + G KS+++K H+  D ++E I+N+H     +G  
Sbjct  201   MKDALFLVGGFDVGDFFPSWKLLYKMSGAKSKLVKMHQNIDLVLERIVNEHIKNRVAGIK  260

Query  806   ------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMM  645
                   GED ++D+ L++ ++  LQ PI +D+IKA+I+DMF AG+ETS+TT +WA+SE+M
Sbjct  261   GNGAYGGED-LVDIFLRIKENDQLQFPIINDHIKAVILDMFTAGTETSSTTIIWALSELM  319

Query  644   KNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREET  465
             K+P V+AKAQ+EVR+ FK K   +E D++ LPYLK V+KETLR H P+  I  RECREET
Sbjct  320   KHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIKETLRLHAPS--IVHRECREET  377

Query  464   VINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGR  285
             +++ GYTIP K  V+VN +A+  DP+ W++PE FIPERFE++ +D+ G++++++PFGAG+
Sbjct  378   IVD-GYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFENSPIDYLGNNYEFLPFGAGK  436

Query  284   RICPGLAFGFANTISPLAHLLYNFDWKLPEGV-TAETLDMTEMLGLAVARKND  129
             RICPG+ FG AN   PLA LLY+F+W LP G+ T + LDM+E  GL+ A++ D
Sbjct  437   RICPGMQFGLANVKQPLARLLYHFNWGLPCGINTPKDLDMSEKSGLSAAKEKD  489



>ref|XP_003517257.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 242/485 (50%), Positives = 340/485 (70%), Gaps = 10/485 (2%)
 Frame = -2

Query  1559  FALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGL  1383
             F+L +  L   Y + K     K+PPGP+KLP+IGNL  +     LPHR LRDLA KYG L
Sbjct  14    FSLVLHLLAKHYYKPKTTLSHKLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPL  73

Query  1382  MSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQ  1203
             M LQ+GEIS+VVVSSP+MAKE ++THDLAF  R + L   IL Y  +DIV  PYGDYWRQ
Sbjct  74    MHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQILTYGQNDIVFAPYGDYWRQ  133

Query  1202  MRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAF  1023
             M+KIC++ELL+ + V+SFS IR DE  + +  +R S G P N++ +I+   SS + R AF
Sbjct  134   MKKICVSELLSAKRVQSFSHIREDETSKFIESIRISEGSPINLTSKIYSLVSSSVSRVAF  193

Query  1022  GEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESI  843
             G+    +E+F+   + + +  G F+  D+FPS K LH + G K+++ K H + D I ++I
Sbjct  194   GDKSKDQEEFLCVLEKMILAGGGFEPDDLFPSMK-LHLINGRKAKLEKMHEQVDKIADNI  252

Query  842   INDHRNK----LESGT---GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             + +H+ K    L  G     E+ ++DVLL++  S NL++ I+  NIKA+I+D+F AG++T
Sbjct  253   LREHQEKRQRALREGKVDLEEEDLVDVLLRIQQSDNLEIKISTTNIKAVILDVFTAGTDT  312

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPP  504
             S +T  WAM+EMM+NPRV  KAQAEVR+ F+  +++ E+DV +L YLK V+KETLR H P
Sbjct  313   SASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIIHETDVGKLTYLKLVIKETLRLHAP  372

Query  503   TPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFN  324
             +PL+  REC E T+I+ GY IPVKTKVM+N +A+  DPQYW + ERF+PERF+ + +DF 
Sbjct  373   SPLLVPRECSELTIID-GYEIPVKTKVMINVWAIGRDPQYWTDAERFVPERFDGSSIDFK  431

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
             G++F+Y+PFGAGRR+CPG+ FG AN + PLA LLY+F+W+LP  +  E +DM+E  GL V
Sbjct  432   GNNFEYLPFGAGRRMCPGMTFGLANIMLPLALLLYHFNWELPNEMKPEDMDMSENFGLTV  491

Query  143   ARKND  129
              RK++
Sbjct  492   TRKSE  496



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   474 bits (1219),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 243/486 (50%), Positives = 341/486 (70%), Gaps = 8/486 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             +++F+LFV  ++ +  + K K     +PPGPR+LP IGN+  + G  LPHR+LR+LA KY
Sbjct  11    ILTFSLFVVMVLKITIRGKTKSSSSNLPPGPRELPFIGNIHQLAGS-LPHRSLRNLANKY  69

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM L++GEIS VVVSS + A+E ++THD+ FATR   LA  I+ YN ++IV   YGDY
Sbjct  70    GPLMHLRLGEISTVVVSSAEFAREVMKTHDVTFATRPYLLAADIVNYNCTNIVFAKYGDY  129

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQ+RKIC  E+L+P+ V+S+  IR +E+  L+  + S A  P N++E+I+  T +I  R
Sbjct  130   WRQLRKICTLEVLSPKRVQSYRPIREEEMLNLIKWIASKARSPINLTEKIYSSTYTITTR  189

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             AAFG+     E+FI   K+   L G FD AD+FPS++ LH + G + ++ + H+KTD I+
Sbjct  190   AAFGKKSKYHEEFIDCVKEGIQLGGGFDLADVFPSYRLLHMITGLRPKLERLHKKTDRIL  249

Query  851   ESIINDHRNKLESGTGE----DCIIDVLLKLM-DSGNLQVPITHDNIKAIIIDMFGAGSE  687
             E+II + R+K  S  GE    + +I+VLLK   D+G+L+  +T DNIKA+++D+F AGSE
Sbjct  250   ENIIKELRDKETSKGGESETQEHLIEVLLKFHEDNGSLEFTLTTDNIKAVMMDIFAAGSE  309

Query  686   TSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHP  507
             TS T   WAMSEM+KNP+++ +AQ EVREVF     + E+ ++++ YL +++KETLR HP
Sbjct  310   TSATAVDWAMSEMVKNPQIMKRAQDEVREVFNKLGHVSETGIKEMKYLNSIIKETLRLHP  369

Query  506   PTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDF  327
               PL+  RECRE   I GGY IPVKTKV+VN +A+  DP+YW EPERF P+RF D+ VDF
Sbjct  370   SAPLLIPRECRETCEI-GGYEIPVKTKVVVNGWAIGRDPKYWTEPERFYPDRFLDSSVDF  428

Query  326   NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLA  147
              G+ F+++PFGAGRR+CPG+ +G AN   PLA LLY+FDWKLP+G   E LDMTE  G+ 
Sbjct  429   RGTDFEFIPFGAGRRMCPGITYGLANVDLPLAMLLYHFDWKLPDGKKHEDLDMTEAFGIT  488

Query  146   VARKND  129
             V RK +
Sbjct  489   VGRKEN  494



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 238/483 (49%), Positives = 338/483 (70%), Gaps = 9/483 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQR-RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             LI+F LFV+   +    WKK + + K+PPGPRKLP+IGNL H     LPH  L++L+ KY
Sbjct  13    LIAFLLFVA---IALKLWKKSKIQYKLPPGPRKLPLIGNL-HQLSNSLPHHTLKNLSNKY  68

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G +M LQ+GE+SAV+VSSP +AKE L+THD+ FA R + L+  IL  N+  +   PYG  
Sbjct  69    GPMMHLQLGEVSAVIVSSPQVAKEVLKTHDIIFANRPQLLSVQILSNNSPTLSFSPYGAN  128

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGR-PFNVSERIFLFTSSIIC  1035
             WRQ+RK+C+ ELL+ + V+SF SIR +E+  L+  +     + P ++SE +F  T++I  
Sbjct  129   WRQLRKVCVLELLSAKRVQSFESIREEEVENLIEAISFIQPQVPIDISEMLFSMTNNITA  188

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAAFG+    +++FI+  K I+ L+G FD  D+FPS K  H L G +S + K H+  D I
Sbjct  189   RAAFGKKCKHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVRSALEKVHQNVDKI  248

Query  854   IESIINDHR-NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETST  678
              E II +H+ NK +    ED ++DVLL++ +SG+L++PI+ + +K++I+++F  G++TS+
Sbjct  249   FEDIIQEHKANKRDMLYKED-LVDVLLRVQESGDLEIPISRNTLKSVILEIFIGGTDTSS  307

Query  677   TTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTP  498
             T   WA+SEMMKNP+V+ KAQAEVR VFKGK  + ES++++L Y+K V+KETLR HPP P
Sbjct  308   TVLEWAISEMMKNPQVMEKAQAEVRRVFKGKSKITESEIQKLDYMKLVIKETLRMHPPAP  367

Query  497   LIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGS  318
             L+  RE  E+  I GGY IP KTKV++NA+A+   P++W+  E F PERF+D+ +DF G+
Sbjct  368   LLLPREAIEKCDI-GGYEIPAKTKVIINAWAIGRHPEHWKNAECFEPERFQDSDLDFIGT  426

Query  317   HFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVAR  138
             + +Y+PFG GRRICPG  FG AN   PLA LL++FDWKLP+G+ A  LDMTE  G  V R
Sbjct  427   NLEYIPFGGGRRICPGTLFGIANVELPLAKLLFHFDWKLPDGIEASNLDMTETFGATVGR  486

Query  137   KND  129
             KND
Sbjct  487   KND  489



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/473 (51%), Positives = 327/473 (69%), Gaps = 10/473 (2%)
 Frame = -2

Query  1523  TQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVV  1344
              Q  K+   ++PPGP KLP+IGNL H     LPH  L +LA+KYG LM L++GE+  +VV
Sbjct  27    AQKAKKSFTRLPPGPWKLPLIGNL-HQLVSTLPHHTLSNLAKKYGPLMWLKLGEVPTLVV  85

Query  1343  SSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPR  1164
             SSP+MAKE +RTHD+ F  R   LA SI+ YN  DI+  PYG+YWRQM+KIC+TELL+  
Sbjct  86    SSPEMAKEVMRTHDITFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTN  145

Query  1163  LVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
              V+SF SIR  E+  L+  + S+A  P N+SE+I+  T  I  RAAFG+     E+FI+ 
Sbjct  146   RVQSFQSIREQEVSALMEIISSNARSPVNLSEKIYSLTYGITARAAFGKKSGDEEEFIRI  205

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK----LE  816
               ++S L G F  ADM+PS + L  + G + ++ K H+ +D I+E II+ H+ +      
Sbjct  206   AIEVSKLAGGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMAN  265

Query  815   SGTG----EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEM  648
             + TG    E+ ++D+LLKL   G+L  P++ DNIKA+I D+FGAGSE S+ T  WAMSEM
Sbjct  266   TKTGNKKDEEDLVDILLKLQQQGDLDFPLSKDNIKAVIQDIFGAGSEASSNTVEWAMSEM  325

Query  647   MKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREE  468
             ++NP+++ +AQAEVR VF GK  ++E  +E+L +LK +VKETLR +P  PL+  REC E+
Sbjct  326   VRNPKLMKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRECSED  385

Query  467   TVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAG  288
              VI GGY IP KTKV+VNA+A+  DP YW+E E+F PERF D  +DF G++F+Y+PFGAG
Sbjct  386   CVI-GGYEIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERFIDKPIDFRGTNFEYIPFGAG  444

Query  287   RRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             RR+CPG++F   N   PLA+LLY+FDWKLP  +  E LDMTE  GL + RKND
Sbjct  445   RRMCPGISFALPNIELPLANLLYHFDWKLPNKMKCEDLDMTESFGLTIRRKND  497



>gb|KDP27295.1| hypothetical protein JCGZ_20283 [Jatropha curcas]
Length=500

 Score =   473 bits (1216),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 245/489 (50%), Positives = 337/489 (69%), Gaps = 10/489 (2%)
 Frame = -2

Query  1577  MENLI-SFALFVS---FLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLP-HRAL  1413
             MEN   SF + ++   F+++     +K +   +PPGPRKLPIIGN LH+     P H  L
Sbjct  1     MENQFPSFPMLLAAFFFILITLILSEKSKTKNLPPGPRKLPIIGN-LHLFSSSYPIHHRL  59

Query  1412  RDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIV  1233
             RDL++KYG +M L++G++S + + SP+ AKE ++T+D+ FA R    +  I+ YN  DI 
Sbjct  60    RDLSKKYGAVMHLKLGQVSTIGIGSPEAAKEMMKTNDVCFADRPCYQSAEIVTYNFLDIA  119

Query  1232  LGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLF  1053
               PY DYWRQ+RKIC  ELL+ + V+SF SIR +E+  L+ D+ SS+G+PFN+S+RIF  
Sbjct  120   YSPYEDYWRQLRKICTVELLSAKRVQSFRSIREEEVANLIRDISSSSGKPFNLSKRIFAL  179

Query  1052  TSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTH  873
             T SI  R +FG+    ++ FI   + I   TG FD AD+FPS K L      ++ ++  H
Sbjct  180   TYSITARVSFGDKCREQDAFISAAEKIMQTTG-FDLADLFPSLKFLGWFSEMRTRLMNAH  238

Query  872   RKTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
              + D IIESIINDHR   ++   ED I+DVLLKL D+GNLQ P+T+ NIKA+I+D+F AG
Sbjct  239   DEADRIIESIINDHRANKKTTETED-IVDVLLKLQDNGNLQFPLTNTNIKAVILDLFVAG  297

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             SETS+TT  WAMSE++KNPR+L+KAQ E+R +F  K  ++E  +++  YLK V+KETLR 
Sbjct  298   SETSSTTVEWAMSEVLKNPRILSKAQEELRRIFDKKGKVDEEGLQESHYLKLVIKETLRM  357

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP PL+  RECRE   +N GY IP KTKV+VNA+ALA DP YW EP+ F PERF D+ V
Sbjct  358   HPPGPLLLPRECRESCQLN-GYNIPAKTKVIVNAWALARDPNYWTEPDTFYPERFLDSTV  416

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM-L  156
             DF G++++++PFGAGRRICPG++F   N   PLA+ LY+FDW+LP G+  E LDM +   
Sbjct  417   DFKGNNYEFIPFGAGRRICPGISFATPNMELPLANFLYHFDWQLPGGMKLENLDMRDGDF  476

Query  155   GLAVARKND  129
             G  + R+ND
Sbjct  477   GSTITRRND  485



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 239/481 (50%), Positives = 342/481 (71%), Gaps = 16/481 (3%)
 Frame = -2

Query  1538  LVLVYTQWKKQ----RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQ  1371
             ++++  +W+      ++ ++PPGP +LP+IG+L H+ G   PHR  RDLARKYG +M L+
Sbjct  22    IIVLVRKWRNSETSSQKQRLPPGPWRLPLIGSLHHLIG-AHPHRIFRDLARKYGPVMYLE  80

Query  1370  IGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKI  1191
             +GE+  V++SSP  AKE L+THDLAF+ R +  +  I++YNN DI    YGDYW+QMRKI
Sbjct  81    LGEVPTVIISSPSAAKETLKTHDLAFSNRPQFTSTYIVMYNNKDIAFAEYGDYWKQMRKI  140

Query  1190  CITELLNPRLVRSFSSIRHDEIHRLLADVRSSAG-RPFNVSERIFLFTSSIICRAAFGEV  1014
             CI ELL+ R+V+SFSSIR DE+  LL+ V+S  G    N++E+I  F SS+ CR  FG++
Sbjct  141   CIMELLSARMVKSFSSIRKDELSSLLSSVQSVKGTSEVNMTEKIVRFASSVTCRLVFGKL  200

Query  1013  FDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIIND  834
                RE  I+  K   +L G  D  D+FPSWK L+ + G KS ++K H++ DS++++I+N+
Sbjct  201   SKDRELLIELMKKTLLLAGG-DVGDLFPSWKLLYKMSGAKSRLVKMHQEVDSVLDNIVNE  259

Query  833   H---RNKLESGTGE---DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTT  672
             H   R     G GE   + ++DV L++ ++  LQ PIT+D+IKA+I+DMF AG+ETS+T 
Sbjct  260   HIRSRADGNKGNGEYGGEDLVDVFLRIQENDQLQFPITNDHIKAVILDMFTAGTETSSTA  319

Query  671   SMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLI  492
              +WAMSE+MKNP V+AKAQ+EVR+ FKGK   +E D++ LPYL  VVKETLR H P+  I
Sbjct  320   IIWAMSELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVVKETLRLHAPS--I  377

Query  491   ATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHF  312
               RECRE+T I+ GYTIP K  V+VN +A+  DP+ W  PE FIPERFE++ +D+ G+HF
Sbjct  378   LHRECREQTCID-GYTIPSKATVLVNTWAIGRDPEVWNNPESFIPERFENSFIDYLGNHF  436

Query  311   QYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             +++PFG+G+RICPG+ FG AN   PLA LLY+F+W+LP G + + LDM+E  G++ A++ 
Sbjct  437   EFIPFGSGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDMSEKPGMSAAKEK  496

Query  131   D  129
             D
Sbjct  497   D  497



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   473 bits (1217),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 240/488 (49%), Positives = 332/488 (68%), Gaps = 9/488 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKY  1392
             +I F L      L      K    K+PPGPRKLP+IGNL  +     LPH AL++L+ KY
Sbjct  9     VIPFILLFLLHRLAKYYKPKTSLNKLPPGPRKLPLIGNLHQLAMSKKLPHYALKELSHKY  68

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GEIS V+VSSP +AKE ++THD+AFA R + L+  I+ Y + DIV  PYGDY
Sbjct  69    GPLMHLQLGEISTVIVSSPKLAKEVMKTHDVAFANRPKLLSPEIMAYGSKDIVFSPYGDY  128

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQMRKIC+ ELLN + V+SFS IR DE ++ +  ++SS     N++ RI    SS I R
Sbjct  129   WRQMRKICVLELLNAKRVQSFSYIREDETNKFIKSIQSSIDTTINLTSRILSMVSSTISR  188

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             AAFG+    +++F+   + +  L+G FD  D+FPS K LH + G + ++ K H++ D+I+
Sbjct  189   AAFGDKSKDQDEFVDLVRKVVELSGGFDVDDLFPSMKFLHVITGMRPKLEKIHKRADTIM  248

Query  851   ESIINDH---RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
              +I+  H   R + +     D     ++DVLL++  SG+L V IT +NIKA+I D+F AG
Sbjct  249   GNIVRQHEENRGRPKEDNNIDVQNEDLVDVLLRVQQSGSLDVQITTNNIKAVIWDVFVAG  308

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             ++T+ T   W MSE+MKNP V  KAQAE+R+V +GKE + E D+ +L YL  V+KET+R 
Sbjct  309   TDTTATIIEWTMSELMKNPSVREKAQAELRKVLRGKEKISEIDLHELTYLNLVIKETMRL  368

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP+PL+  REC E T+I GGY IP  TKVM+NA+ALA DP+YW + ERFIPERF+ + +
Sbjct  369   HPPSPLLVPRECSESTII-GGYEIPKNTKVMINAWALARDPEYWSDAERFIPERFDGSFI  427

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G++F+Y+PFGAGRR+CPG++FG A+ + PLA LLY+F+W+LP  +     DM E  G
Sbjct  428   DFKGNNFEYIPFGAGRRMCPGMSFGLASIMLPLALLLYHFNWELPNHMKPHDFDMIEHFG  487

Query  152   LAVARKND  129
             LAV RKN+
Sbjct  488   LAVGRKNE  495



>ref|XP_003520242.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=502

 Score =   473 bits (1216),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 235/464 (51%), Positives = 323/464 (70%), Gaps = 9/464 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             K+PPGP+KLPIIGNL  +     LPH ALRDLA+KYG LM LQ+GEISAVV SSP MAKE
Sbjct  30    KLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKKYGPLMHLQLGEISAVVASSPKMAKE  89

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              ++THD++F  R   + G ++ Y    I   PYGD+WRQMRK+C TELL+ + V+SF+SI
Sbjct  90    IVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSAKRVQSFASI  149

Query  1139  RHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF-IQQTKDISVL  963
             R DE  + +  +R SAG P N++ RIF    + I R AFG ++  +++F +   + I   
Sbjct  150   REDEAAKFIDLIRESAGSPINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVES  209

Query  962   TGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGEDC----  795
              G FD AD+FPS   L+ + G  + + K H++ D ++E+II DH  K +S   +      
Sbjct  210   GGGFDLADVFPSIPFLYFITGKMARLKKLHKQVDKVLENIIKDHHEKNKSAKEDGAEVED  269

Query  794   --IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAK  621
                ID+LL++     L + +T +NIKA+I+D+F AG++TS++T  W M+EMM+NP V  K
Sbjct  270   QDFIDLLLRIQQDDTLGIEMTTNNIKALILDIFAAGTDTSSSTLEWTMTEMMRNPTVREK  329

Query  620   AQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTI  441
             AQAE+R+ F+ K+++ ESD+EQL YLK V+KETLR HPPTPL+  REC + T+I+ GY I
Sbjct  330   AQAELRQTFREKDIIHESDLEQLTYLKLVIKETLRVHPPTPLLLPRECSQLTIID-GYEI  388

Query  440   PVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAF  261
             P KTKVMVNAYA+  DPQYW   +RFIPERFED+ +DF G++F+Y+PFG GRRICPG+  
Sbjct  389   PAKTKVMVNAYAICKDPQYWTHADRFIPERFEDSSIDFKGNNFEYLPFGGGRRICPGMTL  448

Query  260   GFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G A+ + PLA LLY+F+W+LP  +  E +DM E  GLA+ RKN+
Sbjct  449   GLASIMLPLALLLYHFNWELPNNMKPEDMDMAEHFGLAINRKNE  492



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 246/496 (50%), Positives = 336/496 (68%), Gaps = 16/496 (3%)
 Frame = -2

Query  1577  MENLISFALFVSF--LVLVYTQWKKQR------RGKMPPGPRKLPIIGNLLHIT-GPVLP  1425
             ME   SF +  SF  L+L  T+  KQ+        K+PPGP KLP+IGNL  +  G  LP
Sbjct  1     MEFKFSFLIISSFIFLILCLTKIYKQKIKVKNEVHKLPPGPWKLPLIGNLHQLALGGSLP  60

Query  1424  HRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNN  1245
             H  LRDL+ KYG LM LQ+GEISAVVVSSPD+AKE ++THDL+F  R E LA  IL Y++
Sbjct  61    HHTLRDLSNKYGPLMYLQLGEISAVVVSSPDLAKEIMKTHDLSFVQRPELLAPKILSYDS  120

Query  1244  SDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSER  1065
             +DIV  PYGDYWRQMRKIC ++LL+ + V  FSSIR +E+ +L+  ++ S   P NV++ 
Sbjct  121   TDIVYAPYGDYWRQMRKICTSQLLSAKRVHYFSSIREEEVQKLIQSIQVSLSLPLNVTKT  180

Query  1064  IFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEI  885
              F   S+ + RAAFG+     ++ +   K    +   FD AD+FPS+K +H +   K+++
Sbjct  181   AFSLVSTFVSRAAFGKKSKYEDELLSLLKQTVEMASGFDPADLFPSFKPIHLITRTKAKL  240

Query  884   LKTHRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDM  705
                 +K D I+ESII +H++    G   + ++DVLL++  S N  +PIT DN+KA++ DM
Sbjct  241   QNMQKKLDKILESIIKEHQSNSIHGKQGENLVDVLLRVQQSDNFDIPITDDNVKAVLWDM  300

Query  704   FGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKE  525
             F AGS+TS T   WAMSE+MKN RV+ KAQ+E+RE  KGK+ + ESD+ +L YLK+V+KE
Sbjct  301   FAAGSDTSATVIEWAMSELMKNSRVMKKAQSEIREAVKGKKRIYESDLHELSYLKSVIKE  360

Query  524   TLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfE  345
             T+R HPP  L+  RECRE   I+ GY IP+KT V+VNA+A+  DP++W + ++FIPERF 
Sbjct  361   TMRLHPPFTLLP-RECREACNID-GYEIPIKTSVIVNAWAIGRDPKHWYDAKKFIPERFN  418

Query  344   DN-GVDF----NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAE  180
             D+ G DF    N + F Y+PFG GRR+CPG++ G AN   PLA LLY+F+W+LP G+  E
Sbjct  419   DSTGFDFNKLNNNNSFDYMPFGGGRRMCPGISLGLANIELPLAALLYHFNWELPNGMKPE  478

Query  179   TLDMTEMLGLAVARKN  132
              LDMTE  G A AR+N
Sbjct  479   DLDMTEAFGAAAARRN  494



>sp|E1B2Z9.1|C7AV8_CICIN RecName: Full=Cytochrome P450 71AV8; AltName: Full=(+)-Valencene 
oxidase [Cichorium intybus]
 gb|ADM86719.1| valencene oxidase [Cichorium intybus]
Length=496

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 336/480 (70%), Gaps = 10/480 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             ++  +F+ F +L  T  KK     + P P +LPIIG++ H+ G  +PHR + +LARK+G 
Sbjct  11    LAVIIFIIFKLLTRTTSKKN----LLPEPWRLPIIGHMHHLIG-TMPHRGVMELARKHGS  65

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWR
Sbjct  66    LMHLQLGEVSTIVVSSPRWAKEVLTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  125

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSA-GRPFNVSERIFLFTSSIICRA  1029
             Q+RK+C  ELL+ + V+SF S+R +E   L+ D+RS+  G P N+SE IF   ++I+ RA
Sbjct  126   QLRKLCTLELLSNKKVKSFQSLREEECWNLVKDIRSTGQGSPINLSENIFKMIATILSRA  185

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG+    + +F +  K+I  LTG FD AD+FPS K LH L G ++++   H K D++I 
Sbjct  186   AFGKGIKDQMKFTELVKEILRLTGGFDVADIFPSKKLLHHLSGKRAKLTNIHNKLDNLIN  245

Query  848   SIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
             +II +H     + + ++ ++DVLL+L +S   + P+T DN+KA+I+DMFGAG++TS+ T 
Sbjct  246   NIIAEHPGN-RTSSSQETLLDVLLRLKESA--EFPLTADNVKAVILDMFGAGTDTSSATI  302

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WA+SE+++ PR + K Q E+R+   GKE ++E D+++L YLK V+KETLR HPP PL+ 
Sbjct  303   EWAISELIRCPRAMEKVQTELRQALNGKERIQEEDLQELNYLKLVIKETLRLHPPLPLVM  362

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
              RECRE  V+ GGY IP KTK++VN +A+  DP+YW++ E F+PERFE++ +   GS ++
Sbjct  363   PRECREPCVL-GGYDIPSKTKLIVNVFAINRDPEYWKDAETFMPERFENSPITVMGSEYE  421

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             Y+PFGAGRR+CPG A G AN   PLAH+LY F+WKLP G T E LDMTE  G  V RK +
Sbjct  422   YLPFGAGRRMCPGAALGLANVELPLAHILYYFNWKLPNGKTFEDLDMTESFGATVQRKTE  481



>gb|KHN36162.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   470 bits (1209),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 316/441 (72%), Gaps = 9/441 (2%)
 Frame = -2

Query  1430  LPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLY  1251
             LPHR LRDLA KYG LM LQ+GEIS+VVVSSP+MAKE ++THDLAF  R + L   IL Y
Sbjct  5     LPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQILTY  64

Query  1250  NNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVS  1071
               SDI   PYGDYWRQM+KIC++ELL+ + V+SFS IR DE  + +  VR+S G P N++
Sbjct  65    GQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDETAKFIESVRTSEGSPVNLT  124

Query  1070  ERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKS  891
              +I+   SS I R AFG     +E+F+   K++ V+   F+  D+FPS K LH + G K+
Sbjct  125   NKIYSLVSSAISRVAFGNKCKDQEEFVSLVKELVVVGAGFELDDLFPSMK-LHLINGRKA  183

Query  890   EILKTHRKTDSIIESIINDHRNKLESG-------TGEDCIIDVLLKLMDSGNLQVPITHD  732
             ++ K   + D I+++I+ +H+ K E           E+ ++DVLL++  S NL++ IT  
Sbjct  184   KLEKMQEQVDKIVDNILKEHQEKRERARREGRVDLEEEDLVDVLLRIQQSDNLEIKITTT  243

Query  731   NIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQL  552
             NIKAII+D+F AG++TS +T  WAM+EMM+NPRV  KAQAEVR+ F+  +++ E+DVE+L
Sbjct  244   NIKAIILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIINETDVEEL  303

Query  551   PYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeep  372
              YLK V+KETLR H P+PL+  REC + T+I+ GY IPVKTKVM+NA+A+A DPQYW + 
Sbjct  304   IYLKLVIKETLRLHTPSPLLLPRECSKRTIID-GYEIPVKTKVMINAWAIARDPQYWTDA  362

Query  371   erfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEG  192
             ERF+PERF+ + +DF G++F+Y+PFGAGRR+CPG+  G AN + PLA LLY+F+W+LP  
Sbjct  363   ERFVPERFDGSSIDFKGNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYHFNWELPNE  422

Query  191   VTAETLDMTEMLGLAVARKND  129
             +  E +DM E  GL V RKN+
Sbjct  423   MKPEYMDMVENFGLTVGRKNE  443



>ref|XP_003535170.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003535172.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003537208.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN08716.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN13522.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN28263.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/489 (49%), Positives = 333/489 (68%), Gaps = 12/489 (2%)
 Frame = -2

Query  1562  SFALFVS-FLVLVYTQ--WKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             S+ L +  F VL +    +K     K+PPGP+KLPIIGNL  +     LPH ALRDLA+K
Sbjct  5     SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEISAVV SSP MAKE ++THD++F  R   + G ++ Y    I   PYGD
Sbjct  65    YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             +WRQMRK+C TELL+ + V+SF+SIR DE  + +  +R SAG P N++ RIF    + I 
Sbjct  125   HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  1034  RAAFGEVFDGREQF-IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             R AFG ++  +++F +   + I    G FD AD+FPS   L+ L G  + + K H++ D 
Sbjct  185   RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  857   IIESIINDH--RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             ++E+II +H  +NK+    G +      ID+LL++     L + +T +NIKA+I+D+F A
Sbjct  245   VLENIIREHQEKNKIAKEDGAELEDQDFIDLLLRIQQDDTLDIQMTTNNIKALILDIFAA  304

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS +T  WAM+EMM+NPRV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R
Sbjct  305   GTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVIKETFR  364

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  REC + T+I+ GY IP KTKVMVNAYA+  D QYW + +RF+PERFE + 
Sbjct  365   VHPPTPLLLPRECSQPTIID-GYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERFEGSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F Y+PFG GRRICPG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  
Sbjct  424   IDFKGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHF  483

Query  155   GLAVARKND  129
             GLA+ RKN+
Sbjct  484   GLAIGRKNE  492



>ref|XP_003537212.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   471 bits (1211),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 239/489 (49%), Positives = 333/489 (68%), Gaps = 12/489 (2%)
 Frame = -2

Query  1562  SFALFVS-FLVLVYTQ--WKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             S+ L +  F VL +    +K     K+PPGP+KLPIIGNL  +     LPH ALRDLA+K
Sbjct  5     SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEISAV+ SSP MAKE ++THD++F  R   + G ++ Y    I   PYGD
Sbjct  65    YGPLMHLQLGEISAVIASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             +WRQMRK+C TELL+ + V+SF+SIR DE  + +  +R SAG P N++ RIF    + I 
Sbjct  125   HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  1034  RAAFGEVFDGREQF-IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             R AFG ++  +++F +   + I    G FD AD+FPS   L+ L G  + + K H++ D 
Sbjct  185   RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  857   IIESIINDH--RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             ++E+II +H  +NK+    G +      ID+LL++     L + +T +NIKA+I+D+F A
Sbjct  245   VLENIIREHQEKNKIAKEDGAELEDQDFIDLLLRIQQDDTLDIQMTTNNIKALILDIFAA  304

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS +T  WAM+EMM+NPRV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R
Sbjct  305   GTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVIKETFR  364

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  REC + T+I+ GY IP KTKVMVNAYA+  D QYW + +RF+PERFE + 
Sbjct  365   VHPPTPLLLPRECSQPTIID-GYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERFEGSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F Y+PFG GRRICPG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  
Sbjct  424   IDFKGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHF  483

Query  155   GLAVARKND  129
             GLA+ RKN+
Sbjct  484   GLAIGRKNE  492



>ref|XP_003520239.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   470 bits (1210),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 232/464 (50%), Positives = 325/464 (70%), Gaps = 9/464 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             K+PPGP+KLPIIGNL  +     LPH ALRDLA+KYG LM LQ+GEISAVV SSP MAKE
Sbjct  31    KLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKKYGPLMHLQLGEISAVVASSPKMAKE  90

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              ++THD++F  R   + G ++ Y    I   PYGD+WRQMRK+C TELL+ + V+SF+SI
Sbjct  91    IVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSAKRVQSFASI  150

Query  1139  RHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF-IQQTKDISVL  963
             R DE  + +  +R +AG P N++ +IF    + I R AFG ++  +++F +   + I   
Sbjct  151   REDEAAKFINSIREAAGSPINLTSQIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVES  210

Query  962   TGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH--RNKLESGTGEDC--  795
              G FD AD+FPS   L+ + G  +++ K H++ D ++E+II +H  + K+    G +   
Sbjct  211   GGGFDLADVFPSIPFLYFITGKMAKLKKLHKQVDKVLENIIREHQEKKKIAKEDGAEVED  270

Query  794   --IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAK  621
                ID+LLK+     + + +T +NIKA+I+D+F AG++TS +T  WAM+EMM+NPRV  K
Sbjct  271   QDFIDLLLKIQQDDTMDIEMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREK  330

Query  620   AQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTI  441
             AQAE+R+ F+ KE++ ESD+EQL YLK V+KET R HPPTPL+  REC + T+I+ GY I
Sbjct  331   AQAELRQTFREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIID-GYEI  389

Query  440   PVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAF  261
             P KTKVMVNAYA+  DP+YW + ERF+PERFED+ +DF G++F Y+PFG GRRICPG+  
Sbjct  390   PTKTKVMVNAYAICKDPKYWTDAERFVPERFEDSSIDFKGNNFNYLPFGGGRRICPGMTL  449

Query  260   GFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G A+ + PLA LLY+F+W+LP  +  E ++M E  GLA+ RKN+
Sbjct  450   GLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNE  493



>gb|KHN08718.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   470 bits (1209),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 242/489 (49%), Positives = 335/489 (69%), Gaps = 12/489 (2%)
 Frame = -2

Query  1562  SFALFVS-FLVLVYTQ--WKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             S+ L +  F VL +    +K     K+PPGP+KLPIIGNL  +     LPH ALRDLA+K
Sbjct  5     SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEISAVV SSP MAKE ++THD++F  R   + G ++ Y    I   PYGD
Sbjct  65    YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             +WRQMRK+C TELL+ + V+SF+SIR DE  + +  +R SAG P N++ RIF    + I 
Sbjct  125   HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  1034  RAAFGEVFDGREQF-IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             R AFG ++  +++F +   + I    G FD AD+FPS   L+ L G  + + K H++ D 
Sbjct  185   RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  857   IIESIINDH--RNKL---ESGTGEDC-IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             ++E+II +H  +NK+   ++   ED   ID+LLK+     L + +T +NIKA+I+D+F A
Sbjct  245   VLENIIREHQEKNKIAKEDAAELEDQDFIDLLLKIKQDDTLDIQMTTNNIKALILDIFAA  304

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS +T  WAM+EMM+NPRV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R
Sbjct  305   GTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVIKETFR  364

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  REC + T+I+ GY IP KTKVMVNAYA+  D QYW + +RF+PERFE + 
Sbjct  365   VHPPTPLLLPRECSQPTIID-GYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERFEGSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F Y+PFG GRRICPG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  
Sbjct  424   IDFKGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHF  483

Query  155   GLAVARKND  129
             GLA+ RKN+
Sbjct  484   GLAIGRKNE  492



>ref|XP_003535169.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   469 bits (1208),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 237/489 (48%), Positives = 333/489 (68%), Gaps = 12/489 (2%)
 Frame = -2

Query  1562  SFALFVS-FLVLVYTQ--WKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             S+ L +  F VL +    +K     K+PPGP+KLPIIGNL  +     LPH ALRDLA+K
Sbjct  5     SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEISAV+ SSP MAKE ++THD++F  R   + G ++ Y    I   PYGD
Sbjct  65    YGPLMHLQLGEISAVIASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             +WRQMRK+C TELL+ + V+SF+SIR DE  + +  +R SAG P N++ RIF    + I 
Sbjct  125   HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  1034  RAAFGEVFDGREQF-IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             R +FG ++  +++F +   + I    G FD AD+FPS   L+ L G  + + K H++ D 
Sbjct  185   RVSFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  857   IIESIINDH--RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             ++E+II +H  +NK+    G +      ID+LL++     L + +T +NIKA+I+D+F A
Sbjct  245   VLENIIREHQEKNKIAKEDGAELEDQDFIDLLLRIQQDDTLDIQMTTNNIKALILDIFAA  304

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS +T  WAM+EMM+NPRV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R
Sbjct  305   GTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVIKETFR  364

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  REC + T+I+ GY IP KTKVMVNAYA+  D QYW + +RF+PERF+ + 
Sbjct  365   VHPPTPLLLPRECSQPTIID-GYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERFQGSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F Y+PFG GRRICPG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  
Sbjct  424   IDFKGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHF  483

Query  155   GLAVARKND  129
             GLA+ RKN+
Sbjct  484   GLAIGRKNE  492



>gb|EYU21953.1| hypothetical protein MIMGU_mgv1a025918mg [Erythranthe guttata]
Length=498

 Score =   469 bits (1208),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 343/486 (71%), Gaps = 8/486 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKK----QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             N  +  +  SF+ L+   WKK    Q+  K+PP P KLP+IG+L H+ G  LPH ALR +
Sbjct  2     NFTTLVVVSSFIFLLIKLWKKPKSSQKYEKLPPSPPKLPVIGHLHHLVGG-LPHAALRRV  60

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             ++KYG ++ LQ+GEI AVV+SS D AK+ L+  D   A R E++   I+ Y+ +DI   P
Sbjct  61    SQKYGPVLHLQLGEIPAVVISSRDAAKQVLKDQDPGCAGRPESIGTKIMWYDYTDIAFSP  120

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSA--GRPFNVSERIFLFT  1050
             Y +YWRQMRKICI ELL+ + V+SF SIR +E+ R++  +RSSA  G   N++E++F  T
Sbjct  121   YNEYWRQMRKICILELLSAKNVKSFGSIRKEEVSRVIESLRSSARGGAAVNLTEKVFGLT  180

Query  1049  SSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHR  870
             S+I CRAAFGEV   R+  I   K    + G F+ AD+FPS K L+    NK ++L+  R
Sbjct  181   SAITCRAAFGEVLKDRDSLIFLLKKGVTMAGGFELADLFPSSKLLNIFSWNKLKLLRMRR  240

Query  869   KTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             + DSI++ I+ +H+ K     G + I+DVL+++  +G LQ PIT+DNIKA+I DMF AG+
Sbjct  241   RLDSILDVIVAEHKLKQNGEFGGEDIVDVLIRMQRNGELQFPITNDNIKAVIFDMFSAGT  300

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             ETS+TT  WAM+E+M+NPRV+AK QAE+RE  KGK  +EESD++ L YLK VVKET R H
Sbjct  301   ETSSTTMDWAMAELMRNPRVMAKVQAEIREALKGKNTVEESDLQGLKYLKLVVKETFRLH  360

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
             PP PL+  R CREE V   GY+IP+ +KVMVN +++  DPQYW++PE F PERFE++ VD
Sbjct  361   PPIPLLP-RACREEGVKVNGYSIPINSKVMVNIWSMGRDPQYWDKPESFEPERFENSAVD  419

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             F G+ F+Y+PFGAGRRICPG+ FG ANT  PLA +LY+FDW +PEG+T   +DMTE  G+
Sbjct  420   FQGNSFEYLPFGAGRRICPGMNFGLANTELPLAQILYHFDWSMPEGMTRGGIDMTEQEGI  479

Query  149   AVARKN  132
             AV+RKN
Sbjct  480   AVSRKN  485



>ref|XP_003535171.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   469 bits (1208),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 239/489 (49%), Positives = 333/489 (68%), Gaps = 12/489 (2%)
 Frame = -2

Query  1562  SFALFVS-FLVLVYTQ--WKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             S+ L +  F VL +    +K     K+PPGP+KLPIIGNL  +     LPH ALRDLA+K
Sbjct  5     SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEISAVV SSP MAKE ++THD++F  R   + G ++ Y    I   PYGD
Sbjct  65    YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             +WRQMRK+C TELL+ + V+SF+SIR DE  + +  +R SAG P N++ RIF    + I 
Sbjct  125   HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  1034  RAAFGEVFDGREQF-IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             R AFG ++  +++F +   + I    G FD AD+FPS   L+ L G  + + K H++ + 
Sbjct  185   RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVNK  244

Query  857   IIESIINDH--RNKLESGTGEDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             ++E+II +H  +NK+    G +      ID+LL++     L + +T +NIKA+I+D+F A
Sbjct  245   VLENIIREHQEKNKIAKEDGAELEDQDFIDLLLRIQQDDTLDIQMTTNNIKALILDIFAA  304

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS +T  WAM+EMM+NPRV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R
Sbjct  305   GTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVIKETFR  364

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPPTPL+  REC + T+I+ GY IP KTKVMVNAYA+  D QYW + +RF+PERFE + 
Sbjct  365   VHPPTPLLLPRECSQPTIID-GYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERFEGSS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F Y+PFG GRRICPG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  
Sbjct  424   IDFKGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHF  483

Query  155   GLAVARKND  129
             GLA+ RKN+
Sbjct  484   GLAIGRKNE  492



>gb|ACD42776.1| cytochrome P450 71D1 [Catharanthus roseus]
Length=507

 Score =   469 bits (1208),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 240/460 (52%), Positives = 332/460 (72%), Gaps = 9/460 (2%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFL  1314
             +PPGP KLPI+GNL ++    +PHR LRDLA+K+G LM L++GE +A+VVSSP MAKE L
Sbjct  38    LPPGPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIVVSSPRMAKEVL  97

Query  1313  RTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRH  1134
             +THDL+F  R    A  IL Y+NSD+V   YGD WRQMRKI + ELL+ + VRSF  IR 
Sbjct  98    KTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWRQMRKIFVLELLSTKRVRSFQPIRQ  157

Query  1133  DEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGS  954
             DE  RL+  ++ S G+  ++SE+I  +T+S++ RAAFG+V D    F++  K+ S + G 
Sbjct  158   DEGSRLVXLIKESVGKSIDLSEKINSYTTSMVARAAFGKVNDAGVTFLKLVKEASEVAGG  217

Query  953   FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG------TGEDCI  792
             FD AD+FPS+K L+  F ++S++LK H KTD I+E +I++H    E G       G++ +
Sbjct  218   FDPADIFPSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNHEMGKKANGENGKEDV  277

Query  791   IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQA  612
             ID+LL + DSG LQ P   +N+KA I DMF AG+ETS++T  WAMSE+++NP V+AKAQ 
Sbjct  278   IDILLSIKDSGELQFPFQMNNVKAFIFDMFAAGTETSSSTVEWAMSELIRNPDVMAKAQN  337

Query  611   EVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVK  432
             EVR+V KGK++++ES +++L YLK +VKE LR HP +PL+  RECRE+  I+ GY IPVK
Sbjct  338   EVRQVLKGKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPRECREDCQID-GYDIPVK  396

Query  431   TKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFA  252
             T+V VN +A+A D +YW++PE FIPERFE+   DF G++F+Y+PFG+GRR+CPG+ FG A
Sbjct  397   TRVFVNIWAIARDDKYWKDPESFIPERFENTCFDFTGNNFEYLPFGSGRRMCPGMTFGLA  456

Query  251   NTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             N    LA LLY+F+WKLP GV    +DMTE +GL   +K+
Sbjct  457   NVDLVLALLLYHFNWKLPPGVN--DIDMTERVGLGATKKH  494



>gb|KEH34014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 331/488 (68%), Gaps = 11/488 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRG----KMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             +S+  F   L +V  +  K+ +      +P GPRKLPIIGN+ H      PHR LRDLAR
Sbjct  8     LSYIFFFILLAIVVQKVGKKLKNTDPFNLPNGPRKLPIIGNI-HNLLSSQPHRKLRDLAR  66

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             +YG LM LQ+GEIS +V+SSPD A+E ++THD+ FATR + L+  ++ YN++ IV  PYG
Sbjct  67    EYGPLMHLQLGEISFIVISSPDCAREVMKTHDINFATRPQGLSSDLIAYNSTGIVSSPYG  126

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKIC  ELL+ + V S+  IR +E   L+  + S  G P N+++ +     +I+
Sbjct  127   NYWRQLRKICTLELLSLKRVNSYQPIREEEFSNLVKWIASKEGSPINLTQAVLSSIYTIV  186

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              ++AFG+ F  +E+FI   K+I  +   FD A++FPS   +H   G + ++ + HR  D 
Sbjct  187   SKSAFGKKFKDQEKFISAEKEILKIAAGFDLAELFPSITWMHFFTGLRPKLERVHRVVDQ  246

Query  857   IIESIINDHRNKLESG-----TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             I+E+IIN+H+     G       ++ ++DVLLK  D  N +  +T DNIKAII+D+FGAG
Sbjct  247   IMENIINEHKEAKSKGEFDQVESDEDLVDVLLKYQDGNNKEFFLTIDNIKAIIMDIFGAG  306

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
              ETS +T  WAM+EM+KNPR++ KAQAEVRE+F  K  +EE+ + +L YLK++VKETLR 
Sbjct  307   GETSASTIDWAMAEMVKNPRIMKKAQAEVREIFNMKGRVEENCINELNYLKSIVKETLRL  366

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPP PL+  REC +   I+ GY IP KTKV+VNA+A+A DP YW EPERF PERF D+ +
Sbjct  367   HPPAPLLIPRECAQSCKID-GYDIPTKTKVIVNAWAIARDPNYWTEPERFYPERFIDSDI  425

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             D+ GS+F+Y+PFGAGRRICPG  FG  +    LA LLY+FDWKLP G+ +E LDMTE  G
Sbjct  426   DYKGSNFEYIPFGAGRRICPGSIFGLRSVELALAKLLYHFDWKLPNGIKSEELDMTEKFG  485

Query  152   LAVARKND  129
             + V RK+D
Sbjct  486   ITVCRKDD  493



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   469 bits (1208),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 332/482 (69%), Gaps = 20/482 (4%)
 Frame = -2

Query  1526  YTQWKK--QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             +  WKK   R  K+PPGP KLP+IG+L HI    LPHR+ ++LA+KYG LM  ++GE++A
Sbjct  23    HKGWKKFSTRSRKLPPGPWKLPVIGHLHHIG--TLPHRSFQELAKKYGPLMHFKLGEVTA  80

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             VVVSSP ++KE L+ HD  FA R E +AG IL YN+S+I    YGDYWRQMRKICI ELL
Sbjct  81    VVVSSPTLSKEVLKVHDPTFADRPENIAGEILWYNSSNISFSQYGDYWRQMRKICILELL  140

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + + V+SF SIR+DE+  L+  + +S+G P +++E+IF+ TSSI CRAAFG+V   ++Q 
Sbjct  141   SAKNVKSFGSIRNDEVSHLVDSIGASSGAPVDLTEKIFMLTSSITCRAAFGKVCRDKDQL  200

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL--  819
             I+  K+   L   FD +D++PS K L  +  N+ ++L+  RK D I++ II +HR  L  
Sbjct  201   IEMFKEGITLVSGFDVSDLYPSSKILRAISCNRRKLLRMRRKLDLILDDIIGEHRRNLAK  260

Query  818   ---------ESGTGE---DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTT  675
                        G GE   + ++DVLL++  SG L+ PIT DNIKA+I D+F AG+ETS+T
Sbjct  261   IAADKDNLERRGNGEFGNEDLVDVLLRVQQSGELEFPITDDNIKAVIYDIFAAGTETSST  320

Query  674   TSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPL  495
             T  W M+E+++NP V+ K Q E+R+ FKG + +E++DV+ L YLK V+KE LR H P PL
Sbjct  321   TVDWIMAELIRNPHVMGKVQNEIRQTFKGNKTIEDADVQNLKYLKLVIKEGLRLHAPIPL  380

Query  494   IATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSH  315
             I  R  RE+T I  GY IP + KV+VNA+ +  DP+ W  PE F PERF++N  DF G+H
Sbjct  381   IP-RVSREDTEI-AGYLIPARAKVLVNAWGMGRDPEIWSNPESFEPERFDNNSTDFTGNH  438

Query  314   FQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             F+Y+PFGAGRR+CPG+ FG A+   PLAHLLYNFDWKLP+G++   LDM E   +  AR+
Sbjct  439   FEYIPFGAGRRMCPGMTFGLASVELPLAHLLYNFDWKLPDGMSPNDLDMVERPAITAARR  498

Query  134   ND  129
              +
Sbjct  499   QN  500



>gb|KHN39921.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/475 (49%), Positives = 328/475 (69%), Gaps = 10/475 (2%)
 Frame = -2

Query  1526  YTQWKKQRRGKMPPGPRKLPIIGNLLHITGP-VLPHRALRDLARKYGGLMSLQIGEISAV  1350
             Y + K      +PPGP+KLPIIGNL  +     LPH AL+ L++KYG LM LQ+GEISAV
Sbjct  22    YYKLKTNVSHTLPPGPKKLPIIGNLHQLAAAGSLPHHALKKLSKKYGPLMHLQLGEISAV  81

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             V SSP MAKE ++THD++F  R   +AG I+ Y    I    YGD+WRQMRKIC+TE+L+
Sbjct  82    VASSPKMAKEIVKTHDVSFLQRPYFVAGEIMTYGGLGIAFAQYGDHWRQMRKICVTEVLS  141

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              + V+SF+SIR DE  + +  +R SAG   N++ RIF    + I R AFG ++  +++F+
Sbjct  142   VKRVQSFASIREDEAAKFINSIRESAGSTINLTSRIFSLICASISRVAFGGIYKEQDEFV  201

Query  989   QQ-TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK---  822
                 + I  + G FD AD+FPS   L+ + G  +++ K H++ D ++E+I+ +H+ K   
Sbjct  202   VSLIRRIVEIGGGFDLADLFPSIPFLYFITGKMAKLKKLHKQVDKLLETIVKEHQEKHKR  261

Query  821   -LESGT--GEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
               E G    ++  IDVLL++   S  L + +T +NIKA+I+D+F AG++TS +T  WAM+
Sbjct  262   AKEDGAEIEDEDYIDVLLRIQQQSDTLNINMTTNNIKALILDIFAAGTDTSASTLEWAMA  321

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             EMM+NPRV  KAQAE+R+ F+GKE++ ESD+EQL YLK V+KET R HPPTPL+  REC 
Sbjct  322   EMMRNPRVREKAQAELRQAFRGKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECS  381

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             + T+I+ GY IP KTKVMVN YA+  DP+YW + E F+PERFE + +DF G++F+Y+PFG
Sbjct  382   QLTIID-GYEIPAKTKVMVNVYAVCKDPKYWVDAEMFVPERFEASSIDFKGNNFEYLPFG  440

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              GRRICPG+ FG A  + PLA LLY+F+W+LP  +  E +DM E  G+A+ RKN+
Sbjct  441   GGRRICPGMTFGLATIMLPLALLLYHFNWELPNKIKPENMDMAEQFGVAIGRKNE  495



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   468 bits (1205),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 240/497 (48%), Positives = 336/497 (68%), Gaps = 16/497 (3%)
 Frame = -2

Query  1577  MENLISFALFVSFLVLVYTQW------KKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHR  1419
             ME  +SF L + F VL+   W       K    K+PPGPRKLP+IGNL  +     LPH 
Sbjct  4     MEVQLSFVL-IPFFVLLLLHWLTKHYKPKTIAYKLPPGPRKLPLIGNLHQLAFASKLPHH  62

Query  1418  ALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSD  1239
             AL+ L+ KYG LM LQ+GEIS V+VSSP  AKE ++THD+ FA R + L+  IL Y   D
Sbjct  63    ALKILSHKYGPLMHLQLGEISTVIVSSPKFAKEVMKTHDVVFANRPKLLSPQILAYGFKD  122

Query  1238  IVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIF  1059
             IV  PYGDYWRQMRKIC+ E+L+ + V+SFS IR DE  + +  ++S +G   N++ RIF
Sbjct  123   IVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDETTKFIKSIKSFSGSTINLTSRIF  182

Query  1058  LFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILK  879
                +SII RAAFG+  + +++F+   +    L+G  +  D+FPS K +H L G KS+  K
Sbjct  183   SVINSIISRAAFGDKSEDQDEFVSLIRKAIALSGGLELDDLFPSMKPIHILTGMKSKFEK  242

Query  878   THRKTDSIIESIINDHRNKLESGTGEDCI-------IDVLLKLMDSGNLQVPITHDNIKA  720
              H++ D I+++++  H  K      E  I       +DVLL++  SG+L + +T +NIKA
Sbjct  243   IHKRVDKILDNVVRKHEEKRAITKDEKKIEAEKEDLVDVLLRVQQSGSLDIQMTINNIKA  302

Query  719   IIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLK  540
             +I D+F AG++TS+TT  W+MSEMMKNPRV  KAQAE+RE F+GK+ + E+D+ QL YL 
Sbjct  303   VIWDIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELREAFRGKDKICETDMHQLTYLN  362

Query  539   TVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfi  360
              V+KETLR HPP+PL+  REC E T I+ GY IP KT +++NA+A+  DP++W + ERFI
Sbjct  363   LVIKETLRLHPPSPLLVPRECYELTNID-GYDIPKKTTILINAWAMGRDPEHWSDAERFI  421

Query  359   perfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAE  180
             PERF+ + +DF G++F+Y+PFGAGRR+CPG++FG A+ + PLA LLY+F+W+LP  +   
Sbjct  422   PERFDGSFIDFKGNNFEYIPFGAGRRMCPGMSFGLASVMFPLALLLYHFNWELPNHMKPH  481

Query  179   TLDMTEMLGLAVARKND  129
               DM E  G+ V RKN+
Sbjct  482   DFDMIEHFGMTVGRKNE  498



>dbj|BAM68816.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia schmidtiana]
Length=496

 Score =   468 bits (1204),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 229/480 (48%), Positives = 332/480 (69%), Gaps = 7/480 (1%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             I+ A  V F++  +    K  +  +P  P +LPIIG++ H+ G + PHR L DLARKYG 
Sbjct  16    IALATIVFFVIYKFATRSKSTKNSLPE-PWRLPIIGHMHHLIGTI-PHRGLMDLARKYGS  73

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GE+S +VVSSP  AKE L THD+ FATR +TL G I+ Y+N+DI+  PYG+YWR
Sbjct  74    LMHLQLGEVSTIVVSSPKWAKEILTTHDITFATRPDTLTGEIIAYHNTDIIFAPYGEYWR  133

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRA  1029
             Q+RK+C  ELL+ + V+S+ S+R +E   L+ ++++S +GRP N+SE IF   ++I+CRA
Sbjct  134   QVRKLCTLELLSAKKVKSYKSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILCRA  193

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG+    ++ F +  K++S  TG FD AD+FPS K LH L G ++ +   H+K D++I 
Sbjct  194   AFGKGIKDQKAFTENMKEMSKETGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNVIN  253

Query  848   SIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
             +++ +H  K  S T E+ ++DVLL+L DS   Q  +T DN+KAII+DMF AG++TS  T 
Sbjct  254   NVVAEHTVKASSKT-EETLLDVLLRLKDSAEFQ--LTADNVKAIIMDMFVAGTDTSAVTI  310

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WA+SE++K PR + K QAE+R+  KGKE + + D+ +L YL  V+KETLR HPP PL++
Sbjct  311   EWAISELIKCPRAMEKVQAELRKALKGKEKIHDEDIHELSYLNLVIKETLRLHPPLPLVS  370

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
              +EC ++  +  GY IP KTK++VN +A+  DP++W++ E FIPERFE++     G+ ++
Sbjct  371   RKECHQQVNL-AGYDIPNKTKLIVNVFAINRDPEFWKDAETFIPERFENSSTTVMGAEYE  429

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             Y+PFG GRR+CPG A G AN   PLA +LY+F+WKLP GV+ E +DMTE  G  V R  +
Sbjct  430   YLPFGGGRRMCPGAALGLANVQLPLATILYHFNWKLPNGVSYEEIDMTERFGATVERNTE  489



>emb|CDP07881.1| unnamed protein product [Coffea canephora]
Length=844

 Score =   479 bits (1234),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 246/465 (53%), Positives = 343/465 (74%), Gaps = 11/465 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PP P KLP+IGN+  + G   P  ALR LA+K+G LM LQ+GEIS++V+SSP +A+E 
Sbjct  371   ELPPSPWKLPLIGNMHRLIGSP-PQHALRRLAQKHGSLMHLQLGEISSIVISSPRLAEEV  429

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             ++ HDLAFA+RAE L   I  YN SD+V  PYG+YWRQMRKIC  ELL+ + VRSF S+R
Sbjct  430   MKNHDLAFASRAEILVTKIGRYNCSDVVSSPYGEYWRQMRKICTLELLSAKRVRSFGSVR  489

Query  1136  HDEIHRLLADVRS--SAGRPFNVSERIFLFTSSIICRAAFGEVF-DGREQFIQQTKDISV  966
              DE   L++ +++    G   N+SE + L+TSS++CRAAFG+V  D +  F+Q  K+  +
Sbjct  490   KDEAFHLISSIKALVGTGEQINLSELVSLYTSSVLCRAAFGKVSKDDQNAFLQLIKESLL  549

Query  965   LTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH-----RNKLESGTG-  804
             L+ +FDF+D+FPS K LHPL   KS+++  H   D +++ II+ H     R KL SG   
Sbjct  550   LSSAFDFSDLFPSLKILHPLLSVKSKMVHVHHMIDMMLDGIIDQHIDDQGRPKLASGESY  609

Query  803   EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLA  624
             ++ +IDVLL++ D  NLQVPIT DNIKA++IDMF  G+ETS+TT  WAM+EM+++P V+A
Sbjct  610   QEDLIDVLLRVKDGDNLQVPITKDNIKAVLIDMFAGGTETSSTTVEWAMAEMIRSPDVMA  669

Query  623   KAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYT  444
             KAQ E+R+  KGK+ +EE+D++Q  YLK V+KETLR HPP PL+  RECREE  ++ GY 
Sbjct  670   KAQNEIRKALKGKKAVEETDIQQARYLKLVIKETLRLHPPLPLLVPRECREECELH-GYV  728

Query  443   IPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLA  264
             IPVKT+VM+NA+A+  DP+YW++ + F PERFE++  DF+G+HF+Y+PFGAGRR+CPG++
Sbjct  729   IPVKTRVMINAWAIGRDPEYWDDADGFKPERFENSAADFSGTHFEYLPFGAGRRMCPGIS  788

Query  263   FGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             FG AN   PLA LLY+FDW+LP  + +  LDMTE +G+  +RKN+
Sbjct  789   FGLANVELPLALLLYHFDWQLPNDLNSNDLDMTETIGITASRKNN  833


 Score =   313 bits (801),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/339 (48%), Positives = 236/339 (70%), Gaps = 10/339 (3%)
 Frame = -2

Query  1427  PHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYN  1248
             PH ALR LA+K+G LM LQ+GEIS +VVSSP +AKE ++THDL FA RAE LA  I+ YN
Sbjct  9     PHYALRKLAQKHGPLMHLQLGEISTIVVSSPRLAKEIMKTHDLDFANRAEFLACKIVCYN  68

Query  1247  NSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRS--SAGRPFNV  1074
              SDIV  PYG+YWRQMRKIC  ELL+ + VRSF  IR DE   L++ +++  +AG   N+
Sbjct  69    CSDIVCAPYGEYWRQMRKICTLELLSTKNVRSFGCIRLDEAKHLISSIQAHAAAGELINL  128

Query  1073  SERIFLFTSSIICRAAFGEVFDGREQ-FIQQTKDISVLTGSFDFADMFPSWKALHPLFGN  897
             ++ +  +TSS++  AAF +V    +  F++    +  L  +   +D+FPS++ LHPL   
Sbjct  129   TDHLSTYTSSMVLTAAFRKVSKVHQMTFLRLLNMVRRLGRAVTVSDLFPSYRILHPLSRV  188

Query  896   KSEILKTHRKTDSIIESIINDHRNKLE------SGTGEDCIIDVLLKLMDSGNLQVPITH  735
             K +++K H++ D I ++II +H   L+        +G + ++DVLL++ +SG+L  P+T+
Sbjct  189   KPKLMKVHQRIDKIFDTIIAEHVENLKRTKRGMGESGNEDLVDVLLRVKESGDLTFPVTN  248

Query  734   DNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQ  555
             +NIKA++ D+F  G+ETS+TT  WAMSEM++NP V+A AQ E+R+ F G + +EE+DVE+
Sbjct  249   NNIKAVLTDIFTGGTETSSTTVEWAMSEMIRNPNVMATAQNEIRKAFMGMKTIEETDVEK  308

Query  554   LPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             LPYLK V+KETLR HPP PL+  R CRE+  I+ GY +P
Sbjct  309   LPYLKLVIKETLRLHPPIPLLVPRGCREQCEID-GYIVP  346



>ref|XP_011073878.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=519

 Score =   468 bits (1205),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 247/510 (48%), Positives = 338/510 (66%), Gaps = 26/510 (5%)
 Frame = -2

Query  1595  LDRSNIMENLISFALFVSFLVLVYTQWKKQRR----GKMPPGPRKLPIIGNLLHITGPVL  1428
             +D   +  N+ +  LF S ++ +   WKK +       +PPGP KLPIIG+  H+ G  L
Sbjct  1     MDFQFLATNITTLFLFFSVVLFIRRSWKKSKDKNEPANLPPGPPKLPIIGHA-HLLG-TL  58

Query  1427  PHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYN  1248
             P R+ + LA+ YG +M L++GE+S +V+SSP +AKE L+T D  FA R E++A  I+ Y+
Sbjct  59    PFRSFKTLAKTYGDIMHLKLGEVSTIVISSPAIAKEALKTRDPMFADRPESVAAKIMWYD  118

Query  1247  NSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSE  1068
               DI   PY +YWRQMRKICI ELL+ + VRSF SIR+DEI  L+  +RSSAG   +++E
Sbjct  119   YVDIAFSPYNEYWRQMRKICIVELLSAKNVRSFGSIRNDEIALLMQTIRSSAGSVIDLTE  178

Query  1067  RIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSE  888
             RIF  TSSI CRAA+G+V   R+  I+   D  V  G F  AD+FPS K L+ L  NK  
Sbjct  179   RIFKLTSSITCRAAYGKVCRDRDALIKLMNDSIVFAGGFMLADLFPSSKLLNVLSWNKMR  238

Query  887   ILKTHRKTDSIIESIINDHRNKL---------------ESGTGE---DCIIDVLLKLMDS  762
             +++  RK D I++ IIN+H+  L                 G GE   + ++DVLL+L  S
Sbjct  239   LVRMRRKLDVILDDIINEHKVNLARIRSTEVSEKGDVTRRGNGELGNEDLVDVLLRLQGS  298

Query  761   GNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKE  582
             G L+ PI +DNIKA+I DMF   +ETS++T  WAM E+++NPRV AKAQAEVR+ FK   
Sbjct  299   GELKFPIANDNIKAVIYDMFSGATETSSSTLDWAMVELVRNPRVRAKAQAEVRQAFKDGR  358

Query  581   MLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYAL  402
              ++E++V +L YLK VVKE LR HP TPL+  R  RE++ IN GY IP KTKV+VN + +
Sbjct  359   SIDENEVGKLKYLKLVVKEVLRLHPATPLVP-RASREDSEIN-GYYIPAKTKVLVNNWGM  416

Query  401   ATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLL  222
               +P Y+   E F PERFE NG+DFNG++F+Y+PFGAG+R+CPG+ FG A+   PLAHLL
Sbjct  417   GRNPNYFPNAESFEPERFESNGIDFNGANFEYLPFGAGKRMCPGMTFGLASVELPLAHLL  476

Query  221   YNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             YNF+W+LP+G+    LDMTE  G++  RK+
Sbjct  477   YNFNWELPKGIKPSDLDMTENPGISAPRKH  506



>ref|XP_011081932.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=505

 Score =   467 bits (1202),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 342/490 (70%), Gaps = 24/490 (5%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGKMPPGPRKLP----------IIGNLLHITGPVLPHRAL  1413
             +  LF SF+  +   WKK +       PRK            +IG+L H+ G  LPHRA 
Sbjct  12    ALLLFPSFIFFLIMAWKKSK------SPRKYEKLPPGPPKLPVIGHLHHLAGE-LPHRAY  64

Query  1412  RDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIV  1233
             R +A KYG ++ LQ+GE+SAVV+SS +  KE L+  D A A R E++   I+ Y+  D+ 
Sbjct  65    RRIAHKYGPVIHLQLGEVSAVVISSREATKEVLKDQDPACANRPESIGIQIMWYDYVDMT  124

Query  1232  LGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLF  1053
               PY  YWRQMRKIC  ELL+ + VRSF  IR +E+  LL  +RSS+G   N+++++F F
Sbjct  125   FSPYNGYWRQMRKICTLELLSAKNVRSFGYIRQEELSLLLESLRSSSGEAINLTQKVFAF  184

Query  1052  TSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTH  873
             TSS+ICRA+ G+V   R++ I+  K    + G F+ AD+FPS K +H L  NK ++L+  
Sbjct  185   TSSVICRASLGKVMRDRDKLIEMLKKAVAMAGGFELADLFPSSKLMHVLCWNKYKLLRMR  244

Query  872   RKTDSIIESIINDHRNKLESGT---GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMF  702
             RK D+I++ I+ +H+ K +SG    GED I+DVLL++  +G LQ PIT+DNIKA+I DMF
Sbjct  245   RKLDAILDVILEEHKLK-KSGDVSRGED-IVDVLLRMQKNGELQFPITNDNIKAVIFDMF  302

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
              AG+ETS+TT  WAM+E+M+NPRV+AK QAEVRE FKGK  +EESDV+ L YLK V+KET
Sbjct  303   SAGTETSSTTIDWAMAELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALKYLKLVIKET  362

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
              R HPP PL+  R CR+E  +N GY+IP+K+KV++N +A+  DP+YW +PE F PERF++
Sbjct  363   FRLHPPIPLLP-RACRDECEVN-GYSIPLKSKVLINIWAMGRDPEYWHQPETFQPERFDN  420

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             + +DF G++ +Y+PFGAGRRICPG+ FG AN   PLA LLY+FDWK+P+G+T + +DMTE
Sbjct  421   SCIDFLGNNLEYIPFGAGRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMTPDDVDMTE  480

Query  161   MLGLAVARKN  132
               G+A+ARKN
Sbjct  481   AEGIAIARKN  490



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   466 bits (1200),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 236/460 (51%), Positives = 328/460 (71%), Gaps = 7/460 (2%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFL  1314
             +PPGP KLPIIGN+ ++ G  LPH  L++LA+KYG LM LQ+GE++ +VV+S ++AKE +
Sbjct  17    LPPGPLKLPIIGNIHNLVGS-LPHHRLQNLAKKYGPLMHLQLGEVTTIVVTSAEIAKEVM  75

Query  1313  RTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRH  1134
             R HD+ F+ R   LA +I+ YN + IV  PYG+YWRQ+RKIC+ ELL+ + V+SF SIR 
Sbjct  76    RAHDIVFSNRPSILAANIISYNATSIVFSPYGEYWRQLRKICVLELLSAKRVQSFKSIRE  135

Query  1133  DEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGS  954
             +E+  ++  + SS+    N+S  +F  T SI  RAAFG++   +E FI   ++I  + G 
Sbjct  136   EEVSNIVRRISSSSDSLINLSRMLFSLTYSITSRAAFGKIRKEQEAFIPLVEEIIEVGGG  195

Query  953   FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHR-NKLESGTGE----DCII  789
             F  AD+FPS K L+ + G KS + + H++ D I+E+IIN+HR +K  +  G     D ++
Sbjct  196   FSIADLFPSIKLLNRINGMKSRVERLHQEADKILENIINEHRASKARAKPGSKGEADDLV  255

Query  788   DVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAE  609
             DVLL + + G+L   +T +NIKA+I+D+F AGSETS+TT  WAMSE++KN  V+ KAQAE
Sbjct  256   DVLLNIQEQGDLGFALTTNNIKAVILDLFIAGSETSSTTVEWAMSELLKNTSVMKKAQAE  315

Query  608   VREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKT  429
             +R+VFK K  ++E  V +L YLK +VKETLR HPP PL+  RE  E   IN GY IPVK+
Sbjct  316   LRQVFKNKGYVDEEGVCELNYLKLIVKETLRLHPPVPLLVPRENSELCEIN-GYFIPVKS  374

Query  428   KVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFAN  249
             +V++N +A+  DP YW+EPERF PERF DN +D+ GS+F+++PFGAGRRICPG+ FG AN
Sbjct  375   RVLINVWAIGRDPNYWKEPERFNPERFLDNSIDYKGSNFEFIPFGAGRRICPGILFGIAN  434

Query  248   TISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
                PLA+LLY+FDWKLP  +  E L+MTE  G+AV RKND
Sbjct  435   VELPLANLLYHFDWKLPGEINPENLEMTEASGIAVRRKND  474



>ref|XP_004511999.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   467 bits (1201),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 241/497 (48%), Positives = 336/497 (68%), Gaps = 16/497 (3%)
 Frame = -2

Query  1577  MENLISFALFVSFLVLVYTQW------KKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHR  1419
             ME  +SF L + F VL+   W       K    K+PPGPRKLP+IGNL  +     LPH 
Sbjct  1     MEVQLSFVL-IPFFVLLLVHWLTKHYKPKTIAYKLPPGPRKLPLIGNLHQLAFASKLPHH  59

Query  1418  ALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSD  1239
             AL+ L+ KYG LM LQ+GEIS VVVSSP +AKE ++THD+ FA R + L+  IL Y   D
Sbjct  60    ALKILSHKYGPLMHLQLGEISTVVVSSPKLAKEVMKTHDVVFANRPKLLSPQILAYGFKD  119

Query  1238  IVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIF  1059
             IV  PYGDYWRQMRKIC+ E+L+ + V+SFS IR DE  + +  ++S +G   N++ RIF
Sbjct  120   IVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDETTKFIKSIKSFSGSTINLTSRIF  179

Query  1058  LFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILK  879
                +SII RAAFG+  + +++F+   +    ++G  +  D+FPS K ++ L G KS+  K
Sbjct  180   SVINSIISRAAFGDKSEDQDEFVSLIRKAIAMSGGLELDDLFPSMKPINILTGMKSKFEK  239

Query  878   THRKTDSIIESIINDHRNKLESGTGEDCI-------IDVLLKLMDSGNLQVPITHDNIKA  720
              H++ D I++++I  H  K      E  I       +DVLL++  SG+L + +T +NIKA
Sbjct  240   IHKRIDKILDNVIRKHEEKRTITKDEKKIEAEKEDLVDVLLRVQQSGSLDIQMTINNIKA  299

Query  719   IIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLK  540
             +I D+F AG++TS+TT  W+MSEMMKNPRV  KAQAE+R+ F+GK+ + ESD+ QL YL 
Sbjct  300   VIWDIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELRQAFRGKDKICESDMHQLTYLN  359

Query  539   TVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfi  360
              V+KETLR HPP+PL+  REC E T I+ GY IP KT +++NA+    DPQYW + ERFI
Sbjct  360   LVIKETLRLHPPSPLLVPRECYELTNID-GYDIPKKTIILINAWTKGRDPQYWSDAERFI  418

Query  359   perfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAE  180
             PERF+ + +DF G++F+Y+PFGAGRR+CPG++FG A+ + PLA LLY+F+W+LP  +  +
Sbjct  419   PERFDGSFIDFKGNNFEYIPFGAGRRMCPGMSFGLASVMFPLALLLYHFNWELPNHMKPD  478

Query  179   TLDMTEMLGLAVARKND  129
               DM E  G+ V RKN+
Sbjct  479   HFDMIEHFGMTVGRKNE  495



>ref|XP_003537216.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=508

 Score =   467 bits (1201),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 232/475 (49%), Positives = 328/475 (69%), Gaps = 10/475 (2%)
 Frame = -2

Query  1526  YTQWKKQRRGKMPPGPRKLPIIGNLLHITGP-VLPHRALRDLARKYGGLMSLQIGEISAV  1350
             Y + K      +PPGP+KLPIIGNL  +     LPH AL+ L++KYG LM LQ+GEISAV
Sbjct  22    YYKLKTNVSHTLPPGPKKLPIIGNLHQLAAAGSLPHHALKKLSKKYGPLMHLQLGEISAV  81

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             V SSP MAKE ++THD++F  R   +AG I+ Y    I    YGD+WRQMRKIC+TE+L+
Sbjct  82    VASSPKMAKEIVKTHDVSFLQRPYFVAGEIMTYGGLGIAFAQYGDHWRQMRKICVTEVLS  141

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              + V+SF+SIR DE  + +  +R SAG   N++ RIF    + I R AFG ++  +++F+
Sbjct  142   VKRVQSFASIREDEAAKFINSIRESAGSTINLTSRIFSLICASISRVAFGGIYKEQDEFV  201

Query  989   QQ-TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK---  822
                 + I  + G FD AD+FPS   L+ + G  +++ K H++ D ++E+I+ +H+ K   
Sbjct  202   VSLIRRIVEIGGGFDLADLFPSIPFLYFITGKMAKLKKLHKQVDKLLETIVKEHQEKHKR  261

Query  821   -LESGT--GEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMS  654
               E G    ++  IDVLL++   S  L + +T +NIKA+I+D+F AG++TS +T  WAM+
Sbjct  262   AKEDGAEIEDEDYIDVLLRIQQQSDTLNINMTTNNIKALILDIFAAGTDTSASTLEWAMT  321

Query  653   EMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECR  474
             E+M+NPRV  KAQAE+R+ F+GKE++ ESD+EQL YLK V+KET R HPPTPL+  REC 
Sbjct  322   EVMRNPRVREKAQAELRQAFRGKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECS  381

Query  473   EETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFG  294
             + T+I+ GY IP KTKVMVN YA+  DP+YW + E F+PERFE + +DF G++F+Y+PFG
Sbjct  382   QLTIID-GYEIPAKTKVMVNVYAVCKDPKYWVDAEMFVPERFEASSIDFKGNNFEYLPFG  440

Query  293   AGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              GRRICPG+ FG A  + PLA LLY+F+W+LP  +  E +DM E  G+A+ RKN+
Sbjct  441   GGRRICPGMTFGLATIMLPLALLLYHFNWELPNKIKPENMDMAEQFGVAIGRKNE  495



>ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39572.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 244/481 (51%), Positives = 333/481 (69%), Gaps = 12/481 (2%)
 Frame = -2

Query  1541  FLVLVYTQWKKQRRG-----KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMS  1377
             F+ +V   WK+          +PPGP KLP+IGN+  + G  LPH  LRDLA+KYG +M 
Sbjct  12    FIYMVLKLWKRSNSKHSTLKNLPPGPTKLPLIGNMHQLLGS-LPHHRLRDLAKKYGSIMH  70

Query  1376  LQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMR  1197
             LQ+GE+  VVVSSP+ AKE ++THD+ FA R   LA S++ YN +DI   PY DYWRQ+R
Sbjct  71    LQLGEVPHVVVSSPEAAKEVMKTHDIVFAQRPFLLAASVITYNFTDIAFSPYSDYWRQLR  130

Query  1196  KICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGE  1017
             KIC+ ELL+ + V+SF SIR +E+  L+  + S +G+PFN S ++F  T  I  RA+FG+
Sbjct  131   KICVLELLSAKRVQSFRSIREEEVSNLINTLTSFSGKPFNFSRKLFSSTYGIAARASFGK  190

Query  1016  VFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIIN  837
              +  +E+FI+  + ++ + G F  AD+FPS   LH + G KS +L+     D+I+E+II+
Sbjct  191   KYKDQEEFIKVAQQMTEVAGGFSLADLFPSIAFLHVISGMKSRLLRLRDDGDNILENIID  250

Query  836   DHRNK----LESGTGE-DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTT  672
             DHR +      SG GE D ++DVLL+    G L+ P+T +NIKA+I+D+F AGSETS+TT
Sbjct  251   DHRARNMTGKTSGEGEDDDLVDVLLRFQKGGQLEFPLTTNNIKAVILDIFIAGSETSSTT  310

Query  671   SMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLI  492
               WAMSEM++NPRV+ KAQ EVR VF  K  ++E+++ +L YLK V+KETLR HPP PL+
Sbjct  311   VEWAMSEMLRNPRVMEKAQEEVRRVFGKKGNVDEAELHELNYLKLVIKETLRLHPPAPLL  370

Query  491   ATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHF  312
               RE RE   IN GY IPV +KV+VNA+A+  DP  W E E F PERF D+ +D+ G++F
Sbjct  371   LPRESRESCEIN-GYYIPVNSKVIVNAWAIGRDPNNWTEAETFYPERFLDSAIDYKGNYF  429

Query  311   QYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             +++PFGAGRR+CPG+ FG AN   PLA  LY+FDWKLP+G+ AE+LDM E  G  V RKN
Sbjct  430   EFIPFGAGRRMCPGILFGMANVELPLAQFLYHFDWKLPDGLEAESLDMMEGFGATVRRKN  489

Query  131   D  129
             D
Sbjct  490   D  490



>gb|AAO32822.1| cytochrome P450 71D1, partial [Catharanthus roseus]
Length=495

 Score =   466 bits (1199),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 333/460 (72%), Gaps = 9/460 (2%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFL  1314
             +PPGP KLPI+GNL ++    +PHR LRDLA+K+G LM L++GE +A+VVSSP MAKE L
Sbjct  26    LPPGPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIVVSSPRMAKEVL  85

Query  1313  RTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRH  1134
             +THDL+F  R    A  IL Y+NSD+V   YGD WR+MRKI + ELL+ + VRSF  IR 
Sbjct  86    KTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWREMRKIFVLELLSTKRVRSFQPIRQ  145

Query  1133  DEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGS  954
             DE  RL++ ++ S G+  ++SE+I  +T+S++ RAAFG+V D    F++  K+ S + G 
Sbjct  146   DEGSRLVSLIKESVGKSIDLSEKINSYTTSMVARAAFGKVNDAGVTFLKLVKEASEVAGG  205

Query  953   FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG------TGEDCI  792
             FD AD+FPS+K L+  F ++S++LK H KTD I+E +I++H    E G       G++ +
Sbjct  206   FDPADIFPSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNHEMGKKANGENGKEDV  265

Query  791   IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQA  612
             ID+LL + DSG LQ P   +N+KA+I DMF AG+ETS++T  WAMSE+++NP V+AKAQ 
Sbjct  266   IDILLSIKDSGELQFPFQMNNVKALIFDMFAAGTETSSSTVEWAMSELIRNPDVMAKAQN  325

Query  611   EVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVK  432
             EVR+V KGK++++ES +++L YLK +VKE LR HP +PL+  REC E+  I+ GY IPVK
Sbjct  326   EVRQVLKGKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPRECGEDCQID-GYDIPVK  384

Query  431   TKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFA  252
             T+V VN +A+A D +YW++PE FIPERFE+   DF G++F+Y+PFG+GRR+CPG+ FG A
Sbjct  385   TRVFVNIWAIARDDKYWKDPESFIPERFENTCFDFTGNNFEYLPFGSGRRMCPGMTFGLA  444

Query  251   NTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             N    LA LLY+F+WKLP GV    +DMTE +GL   +K+
Sbjct  445   NVDLVLALLLYHFNWKLPPGVN--DIDMTERVGLGATKKH  482



>gb|KDP39254.1| hypothetical protein JCGZ_01011 [Jatropha curcas]
Length=510

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 319/458 (70%), Gaps = 6/458 (1%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFL  1314
             +PPGP KLPIIGN+  + G  LPH++L+ L+ KYG LM L++GE+S V+VSSP++AK+ L
Sbjct  38    LPPGPWKLPIIGNVHQLLG-SLPHQSLQKLSGKYGPLMHLKLGEVSTVIVSSPEIAKQVL  96

Query  1313  RTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRH  1134
             +THDL FA R   LA  I+ Y+++ IV  PYG YWRQ+RKIC  ELL+P+ V+SF  IR 
Sbjct  97    KTHDLDFAERPPNLAPKIISYDSTHIVFSPYGAYWRQLRKICTMELLSPKRVQSFRFIRE  156

Query  1133  DEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGS  954
             DE+  L+  + S  G   N+SE IF  T  I  RAAFG+ ++ +E FIQ   ++S +   
Sbjct  157   DEVLNLIKTISSLEGSLINISEMIFSLTYGITSRAAFGKKYEDQETFIQVITEVSKIAAG  216

Query  953   FDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKL---ESGTGEDCIIDV  783
             F  AD++PS K L    G + ++ K H K D I+E I+ +HRNK+   E    +D ++DV
Sbjct  217   FSVADLYPSIKFLEQASGLRPKLGKLHEKADGILERIVKEHRNKMNRSEEIQEDDDLVDV  276

Query  782   LLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVR  603
             LL+L + G+L+ P++ DNIK +I+DMF AGSETS+TT  WAMSEM+KNPR+L KAQ EVR
Sbjct  277   LLELQEHGDLEFPLSDDNIKTVILDMFSAGSETSSTTVEWAMSEMLKNPRILEKAQNEVR  336

Query  602   EVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKV  423
             +V+K K  ++E+ + +L YL +++KETLR HPP PLI  RE R    I  GY IP+KTKV
Sbjct  337   QVYKNKGTVDETSIHELKYLNSIIKETLRLHPPLPLIP-RESRARVEI-IGYDIPIKTKV  394

Query  422   MVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTI  243
             +VNA+A+  DP+ W EPE F PERF DN + + G+ F+++PFG+GRRICPG++F   N  
Sbjct  395   LVNAWAIGRDPKNWTEPENFCPERFLDNAISYKGTDFEFIPFGSGRRICPGISFALPNIE  454

Query  242   SPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              PLA LLY+FDWKL  G+  E LDMTE  GL + RK D
Sbjct  455   LPLAQLLYHFDWKLGNGMKNEDLDMTEGYGLTIRRKQD  492



>ref|XP_007154033.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
 gb|ESW26027.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
Length=511

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 340/489 (70%), Gaps = 12/489 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVY--TQWKKQR------RGKMPPGPRKLPIIGNLLHIT-GPVLPHRALR  1410
             S  +F  FL+L++  T+  K +        K+PPGP KLP+IGNL  +     LPH  L+
Sbjct  6     SLLVFAPFLLLLFWFTRIYKNKITVKSVVHKLPPGPWKLPVIGNLHQLARADTLPHHTLQ  65

Query  1409  DLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVL  1230
              L+ KYG LM LQ+GEISAV+VSSPDMAKE ++THDL F  R + L   IL Y ++DI  
Sbjct  66    SLSHKYGPLMHLQLGEISAVIVSSPDMAKEIMKTHDLNFVQRPQLLCPKILAYGSTDIAF  125

Query  1229  GPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR--SSAGRPFNVSERIFL  1056
              PYG+YWRQMRKIC  ELL+ + V SFS IR +E+ +L+  ++  + AG   NVSE +F 
Sbjct  126   APYGEYWRQMRKICTLELLSAKRVHSFSFIREEEVAKLIRSIQLCACAGSQVNVSENVFS  185

Query  1055  FTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKT  876
             F S+++ R AFG+  +   + +   K  + L G FD AD+FPS KA+H L   K+++   
Sbjct  186   FLSTLVSRTAFGKKSEKGNELLCLLKKGAELAGGFDLADLFPSLKAVHFLTRMKTKLENM  245

Query  875   HRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             H++ D I+ESII++H++K  +G  E+ ++DVLL++  S  L+VP+T +NIKA+I D+FGA
Sbjct  246   HKELDKILESIISEHQSKHRNGDAEENLVDVLLRVQQSATLEVPLTINNIKAVIWDIFGA  305

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS T   W MSE++KNPRV+ KAQ E+RE F+GK+ + ES+V +L YLK V+KETLR
Sbjct  306   GTDTSATVLEWGMSELLKNPRVMKKAQVEIREAFRGKKRIGESEVYELSYLKLVIKETLR  365

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP PL+  RECR+   I GGY IP KTKV++NA+AL  DP++W + ++FIPERF+  G
Sbjct  366   LHPPVPLLLPRECRDSCKI-GGYDIPRKTKVIINAWALGRDPKHWYDAQKFIPERFDGTG  424

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
              DF G++F+Y+PFGAGRRICPG+  G AN   PLA LLY+FDWKLP G+  + LDMTE  
Sbjct  425   FDFKGNNFEYIPFGAGRRICPGILLGLANVELPLAALLYHFDWKLPNGMKPQDLDMTEAF  484

Query  155   GLAVARKND  129
             G  V RKN+
Sbjct  485   GATVGRKNN  493



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   466 bits (1198),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 241/490 (49%), Positives = 334/490 (68%), Gaps = 20/490 (4%)
 Frame = -2

Query  1559  FALFVSFLVLVYTQWKKQRRGK----------MPPGPRKLPIIGNLLHITGPVLPHRALR  1410
             F +  +FL+ +Y     +R GK          +PPGP KLPIIGN+  + G  LPH +LR
Sbjct  8     FPILCTFLLFIYLL---KRLGKPSRTTHPAPNLPPGPWKLPIIGNMHQLVGS-LPHHSLR  63

Query  1409  DLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVL  1230
             +LA+K+G LM LQ+GE+SA+VVSS +MAKE ++THD+ F+ R   LA SI+ Y+ +DI  
Sbjct  64    NLAKKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIVSYDCTDIAF  123

Query  1229  GPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFT  1050
              PYGDYWRQ+RKI I ELL+ + V+SF S+R +E+  L+  + S  G   N++E IF  T
Sbjct  124   APYGDYWRQIRKISILELLSAKRVQSFRSVREEEVLNLVRSISSQEGVSINLTESIFSLT  183

Query  1049  SSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHR  870
              SII RAAFG+    +E F    +  +   G F  AD+FPS K LH + G + ++ K H+
Sbjct  184   FSIISRAAFGKKCKDQEAFSVTLEKFAGSGGGFTIADVFPSIKLLHVVSGIRHKLEKIHK  243

Query  869   KTDSIIESIINDHRNKLESGTGEDC-----IIDVLLKLMDSGNLQVPITHDNIKAIIIDM  705
             K D+I+E+IIN+H+ + E+    +      ++DVLLK+   G+L+ P+T DNIKAI++D+
Sbjct  244   KLDTILENIINEHKARSEASEISEAEVDEDLVDVLLKVQKQGDLEFPLTTDNIKAILLDL  303

Query  704   FGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKE  525
             F AGSETS+T   WAM+EM+KNP V+AKAQAEVR++F  K   +E+ + +L +LK V+KE
Sbjct  304   FIAGSETSSTAVEWAMAEMLKNPGVMAKAQAEVRDIFSRKGNADETMIHELKFLKLVIKE  363

Query  524   TLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfE  345
             TLR HPP PL+  RE RE   IN GY IPVKT+V++NA+A+A DP++W + E F PERF 
Sbjct  364   TLRLHPPVPLLIPRESRESCEIN-GYEIPVKTRVIINAWAVARDPEHWNDAESFNPERFL  422

Query  344   DNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMT  165
             D+ +D+ G++F+Y+PFGAGRR+CPG+ FG AN    LA LLY FDWKLP G   E LDMT
Sbjct  423   DSSIDYQGTNFEYIPFGAGRRMCPGILFGMANVEIALAQLLYYFDWKLPNGTQHEELDMT  482

Query  164   EMLGLAVARK  135
             E    ++ RK
Sbjct  483   EDFRTSLRRK  492



>dbj|BAM68809.1| putative CYP71AV1 ortholog [Artemisia afra]
Length=495

 Score =   465 bits (1196),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 229/474 (48%), Positives = 330/474 (70%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + F V  +    K  +  +P  P +LPIIG++ H+ G + PHR + DLARKYG LM LQ+
Sbjct  21    ILFFVYKFATRSKSTKNSLPE-PWRLPIIGHMHHLIGTI-PHRGVMDLARKYGSLMHLQL  78

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ+RK+C
Sbjct  79    GEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLC  138

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               ELL+ + V+SF S+R +E   L+ ++++S +GRPFN+SE +F   ++I+ RAAFG+  
Sbjct  139   TLELLSIKKVKSFQSLREEECWNLVQEIKASGSGRPFNLSENVFKLIATILSRAAFGKGI  198

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D++I +++ +H
Sbjct  199   KDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHQKLDNLINNLVAEH  258

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                  + T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  WA+SE
Sbjct  259   TVTTSNKTNE-TLLDVLLRLKDSA--EFPLTSDNVKAIILDMFGAGTDTSSATIEWAISE  315

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K QAE+R+   GKE + E D+++L YL  V+KETLR HPP PL+  RECR+
Sbjct  316   LIKCPRAMEKVQAELRKALNGKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQ  375

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++Y+PFGA
Sbjct  376   PVNL-AGYNIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSATVMGAEYEYLPFGA  434

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA++LY+F+WKLP G + + +DMTE  G  V RK +
Sbjct  435   GRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQIDMTESFGATVQRKTE  488



>ref|XP_003535173.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=500

 Score =   464 bits (1195),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 330/488 (68%), Gaps = 11/488 (2%)
 Frame = -2

Query  1562  SFALFVS-FLVLVYTQ--WKKQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             S+ L +  F VL +    +K     K+PPGP+KLPIIGNL  +     LPH ALRDLA+K
Sbjct  5     SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEISAVV SSP MAKE ++THD++F  R   + G ++ Y    I   PYGD
Sbjct  65    YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             +WRQ RK+C TELL+ + V+SF+SIR DE  + +  +R SAG P N++ RIF    + I 
Sbjct  125   HWRQTRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  1034  RAAFGEVFDGREQF-IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
             R AFG ++  +++F +   + I    G FD AD+FPS   L+ L G  + + K H++ D 
Sbjct  185   RVAFGGIYKDQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  857   IIESIINDH--RNKLESGTG---EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             ++E+II +H  +NK+    G   ED     LL++     L + +T +NIKA+I+D+F AG
Sbjct  245   VLENIIREHQEKNKIAKEDGAELEDQDFIDLLRIQQDDTLDIQMTTNNIKALILDIFAAG  304

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             ++TS +T  WAM+EMM+NPRV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R 
Sbjct  305   TDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVIKETFRV  364

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HPPTPL+  REC + T+I+ GY IP KTKVMVNAYA+  D QYW + +RF+PERFE + +
Sbjct  365   HPPTPLLLPRECSQPTIID-GYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERFEGSSI  423

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G++F Y+PFG GRRICPG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  G
Sbjct  424   DFKGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHFG  483

Query  152   LAVARKND  129
             LA+ RKN+
Sbjct  484   LAIGRKNE  491



>gb|AJD25166.1| cytochrome P450 CYP71D413 [Salvia miltiorrhiza]
Length=511

 Score =   465 bits (1196),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 242/494 (49%), Positives = 338/494 (68%), Gaps = 12/494 (2%)
 Frame = -2

Query  1577  MENLISFAL-FVSFLVLVYTQWKKQRRGKMPPGPRKLP----IIGNLLHITGPVLPHRAL  1413
             ME  I FA  F++FL     + +K+ +          P    +IG+L HI GP+  H  L
Sbjct  1     METAIQFAFSFIAFLSSWIIEGRKEVKPPDRRRLPPGPPRLPVIGHLHHIIGPLPHHYPL  60

Query  1412  RDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIV  1233
             R+LA KYG LM L+ GE++A++VSS ++A++ L+THD A A R +++A  I+ YN SDIV
Sbjct  61    RNLASKYGPLMHLKFGEVTAIIVSSAEVAEKVLKTHDPACADRPKSVATQIMWYNYSDIV  120

Query  1232  LGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLF  1053
               PYGDYWRQMRKICI ELL+ + VRSF  IR DE   L+  ++S+ G PF+++E+IFLF
Sbjct  121   FSPYGDYWRQMRKICILELLSAKNVRSFEYIRKDEASLLIESIQSTRGAPFDLTEKIFLF  180

Query  1052  TSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTH  873
              +S+ CRAAFG     R   I+  K    L G FD AD+FPS K    L  N+ E+LK  
Sbjct  181   MNSMTCRAAFGNASMDRAAAIKLIKKAICLAGHFDLADLFPSIKLFDLLTWNRFELLKLR  240

Query  872   RKTDSIIESIINDHRNKLES---GTGE---DCIIDVLLKLMDSGNLQVPITHDNIKAIII  711
             RK D I++ +I++H   L S   G GE   + ++DVLL+L  SG L++ IT+D+IK++I 
Sbjct  241   RKLDKILDDVIDEHERNLASTKMGYGELGTEDLVDVLLRLKGSGELELSITNDSIKSVIF  300

Query  710   DMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVV  531
             DMF AG+E+S+TT  WAM+E+M+NPRV+AKA+ E+R+ F+G+E ++ES++  L YLK V+
Sbjct  301   DMFAAGTESSSTTVDWAMAELMRNPRVMAKARDEIRQAFRGRETIKESEIRTLKYLKMVI  360

Query  530   KETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiper  351
              ETLR HPP  +I  R CREE +   GY IP+   V+VN +++  DP+YW + E F PER
Sbjct  361   NETLRLHPPVSIIP-RACREEELEIDGYHIPLNANVIVNIWSIGRDPKYWHDAESFEPER  419

Query  350   fEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLD  171
             FE+N +DF GSHF+Y+PFG+G+RICPG+AFG AN    LA LLY+FDW+LP GV+ + LD
Sbjct  420   FEENPIDFLGSHFEYIPFGSGKRICPGMAFGVANVEFVLAQLLYHFDWELPLGVSRDDLD  479

Query  170   MTEMLGLAVARKND  129
             M E  G+AV+RK++
Sbjct  480   MAEAAGIAVSRKSN  493



>emb|CDP20312.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   463 bits (1191),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 241/472 (51%), Positives = 327/472 (69%), Gaps = 51/472 (11%)
 Frame = -2

Query  1520  QWKKQRRG-KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVV  1344
             +WK+ +   K+PP P KLP+IGN+ H+ G   PH ALR LAR++G LM LQ+GEIS++VV
Sbjct  23    EWKRSKAAQKLPPSPLKLPVIGNMHHLVGSP-PHHALRKLARQHGALMHLQLGEISSIVV  81

Query  1343  SSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPR  1164
             SSP +AKE ++THDLAFA RAE L   IL+YN+SDI   PYGDYWRQMRKIC  ELL+ +
Sbjct  82    SSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCPYGDYWRQMRKICTLELLSAK  141

Query  1163  LVRSFSSIRHDEIHRLLADVRS--SAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI  990
              VRSF SIR DE   L+A V++  +AG   N+SE+++ +TSS+I                
Sbjct  142   NVRSFGSIRQDEASHLVASVQALATAGELINISEKLYSYTSSMI----------------  185

Query  989   QQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH-----RN  825
                                     LHPL   KS+++K H K D ++ +II+ H     R 
Sbjct  186   ------------------------LHPLLSAKSQLVKIHLKMDKLLGNIIDQHIDNLART  221

Query  824   KLESG-TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEM  648
              + +G +G + +IDVLL++ +SG+LQ PIT++NIKAI+ID+F AG+ETS+TT  WAMSEM
Sbjct  222   NMATGESGNEDLIDVLLRVKESGDLQFPITNNNIKAIVIDVFSAGTETSSTTVEWAMSEM  281

Query  647   MKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREE  468
             ++NP V+AKAQ+E+R  FKGK+ +EE+D+++L YL+ V+KETLR HPP PL+  RE   E
Sbjct  282   VRNPNVMAKAQSEIRTAFKGKKKIEETDIQELKYLRLVIKETLRLHPPGPLLVPRE-CRE  340

Query  467   TVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAG  288
                  GYTIPVKT+V++NA+A+  DP YW +PE F PERF+ N VDF G+HF+Y+PFGAG
Sbjct  341   ECEIEGYTIPVKTRVLINAWAIGRDPDYWNDPESFKPERFKSNPVDFTGTHFEYLPFGAG  400

Query  287   RRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             RR+CPG++FG AN   PLA LLY+FDWKLP+G+    LDM+E +G+  +RK+
Sbjct  401   RRMCPGISFGLANVHLPLALLLYHFDWKLPDGLDPCDLDMSETVGITASRKD  452



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   464 bits (1194),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 237/489 (48%), Positives = 335/489 (69%), Gaps = 10/489 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWK-KQRRGKMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARK  1395
             +I F++F+    L    +K K    K+PP PRKLP+IGNL  +     LPH  L+ L++K
Sbjct  9     IIPFSIFILLHWLATKYYKPKTIFYKLPPSPRKLPLIGNLHQLAFAGKLPHHGLQKLSQK  68

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+GEI+AVVVSS ++AKE ++THD+ FA R +  +  IL Y   DIV  PYGD
Sbjct  69    YGPLMHLQLGEINAVVVSSSNLAKEVMKTHDVVFANRPKLPSLKILAYGFKDIVFSPYGD  128

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWRQMRKIC+ E+L+ + V+SFS IR DE  + +  ++S AG   N++ RIF   +SII 
Sbjct  129   YWRQMRKICVLEILSAKRVQSFSYIREDETKKFIESIKSFAGSKINLTTRIFSVINSIIL  188

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAA G+  + +E+F+   +    ++   +  D+FPS K +H L G K  + K H++ D I
Sbjct  189   RAALGDKSEDQEEFVSLIRKAVAVSSGLELIDLFPSMKLIHVLTGMKKNVEKIHKRVDKI  248

Query  854   IESIINDHRNKLESGT-------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             +++++  H+ K   G         ++ ++DVLL++  SG+L V +T +NIKA+I D+F A
Sbjct  249   LDNVVRKHQEKRARGNEGNKSEIEKEDLVDVLLRVQQSGSLDVQLTINNIKAVIWDVFVA  308

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G++TS+TT  WAMSEMMKNPRV  KAQAE+R+ F GKE++ E+DVE+L YLK V+KETLR
Sbjct  309   GTDTSSTTIEWAMSEMMKNPRVREKAQAELRQAFNGKELIYETDVEKLSYLKLVIKETLR  368

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP+PL+  R   E T I+ GY IP  T V +NA+A+  DP+YW + ERFIPERF+D+ 
Sbjct  369   LHPPSPLLVPRLSTELTKID-GYDIPKNTTVFINAWAIGRDPKYWNDAERFIPERFDDSL  427

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             +DF G++F+Y+PFGAGRR+CPG+ FG A+ I PLA LLY+F+W+LP  + ++ LDM E  
Sbjct  428   IDFKGNNFEYIPFGAGRRMCPGMTFGLASVIFPLALLLYHFNWELPNQMKSQDLDMIEDF  487

Query  155   GLAVARKND  129
             GL V RKN+
Sbjct  488   GLTVGRKNE  496



>gb|AHN62855.1| germacrene A oxidase [Tanacetum parthenium]
Length=488

 Score =   463 bits (1192),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 329/474 (69%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + F V  +    K  +  +P  P +LPIIG++ H+ G + PHR + DLARKYG LM LQ+
Sbjct  14    ILFFVYKFATRSKSTKNSLPE-PWRLPIIGHMHHLIGTI-PHRGVMDLARKYGSLMHLQL  71

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ+RK+C
Sbjct  72    GEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLC  131

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               ELL+ + V+SF S+R +E   L+ ++++S +GRP N+SE IF   ++I+ RAAFG+  
Sbjct  132   TLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRAAFGKGI  191

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D++I +++ +H
Sbjct  192   KDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHQKLDNLINNLVAEH  251

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
               K  S T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  WA+SE
Sbjct  252   TVKTSSKTNE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATIEWAISE  308

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K Q E+R+   GKE + E D+++L YL  V+KETLR HPP PL+  RECR+
Sbjct  309   LIKCPRAMEKVQVELRKALNGKERIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQ  368

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++Y+PFGA
Sbjct  369   PVNL-AGYDIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSTTVMGAEYEYLPFGA  427

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA++LY+F+WKLP G + + +DMTE  G  V RK +
Sbjct  428   GRRMCPGAALGLANVQLPLANILYHFNWKLPNGASYDQIDMTESFGATVQRKTE  481



>dbj|BAM68815.1| cytochrome P450 monooxygenase CYP71AV2 [Artemisia maritima]
Length=495

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 328/474 (69%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + F V  +    K  +  +P  P +LPIIG++ H+ G + PHR + DLARKYG LM LQ+
Sbjct  21    ILFFVYKFATRSKSNKNSLPE-PWRLPIIGHMHHLIGTI-PHRGVMDLARKYGSLMHLQL  78

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ+RK+C
Sbjct  79    GEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLC  138

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               ELL+ + V+SF S+R +E   L+ +++++ +GRP N+SE IF   ++I+ RAAFG+  
Sbjct  139   TLELLSVKKVKSFQSLREEECWNLVQEIKAAGSGRPVNLSENIFKLIATILSRAAFGKGI  198

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               + +F +  K+I   TG FD AD+FPS K LH L G ++ +   H K D++I +++ +H
Sbjct  199   KDQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEH  258

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                  S T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  WA+SE
Sbjct  259   TVNTSSKTNE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATIEWAISE  315

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K QAE+R+  KGKE + E D+++L YL  V+KETLR HPP PL+  RECR+
Sbjct  316   LIKCPRAMEKVQAELRKALKGKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQ  375

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++Y+PFGA
Sbjct  376   PVNL-AGYNIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSTTVMGAEYEYLPFGA  434

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA++LY+F+WKLP G + + +DMTE  G  V RK +
Sbjct  435   GRRMCPGSALGLANVQLPLANILYHFNWKLPNGASYDQIDMTESFGATVQRKTE  488



>ref|XP_010655870.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
 emb|CBI39021.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   464 bits (1193),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/493 (50%), Positives = 336/493 (68%), Gaps = 15/493 (3%)
 Frame = -2

Query  1577  MENLISFALFVS--FLVLVYTQWKKQR----RGKMPPGPRKLPIIGNLLHITGPVLPHRA  1416
             M+ L S  LF S  FL ++Y   K+ R      K+PPGP KLP+IGN+  +    LPH +
Sbjct  1     MDVLFSSILFASLLFLYMLYKIGKRWRGNISSQKLPPGPWKLPLIGNMHQLIDGSLPHHS  60

Query  1415  LRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDI  1236
             L  LA++YG LMSLQ+GEIS +++SSP+MAK+ L+THD+ FA RA  LA + + Y+++DI
Sbjct  61    LSRLAKQYGPLMSLQLGEISTLIISSPEMAKQILKTHDINFAQRASFLATNTVSYHSTDI  120

Query  1235  VLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFL  1056
             V  PYGDYWRQ+RKIC+ ELL  + V+SF  IR +E+  L+  + S +  P N+++++  
Sbjct  121   VFSPYGDYWRQLRKICVVELLTSKRVKSFQLIREEELSNLITTLASCSRLPINLTDKLSS  180

Query  1055  FTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKT  876
              T +II RAAFGE    ++ FI   K+   L      ADM+PS K L  + G + +I K 
Sbjct  181   CTFAIIARAAFGEKCKEQDAFISVLKETLELVSGPCVADMYPSVKWLDLISGMRHKIEKV  240

Query  875   HRKTDSIIESIINDHRNKL--ESG--TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIID  708
              ++TD I+++I+++HR K+  E+G   GE+ ++DVLLKL   G+L+ P+T +NIKA+I+D
Sbjct  241   FKRTDRILQNIVDEHREKMKTEAGKLQGEEDLVDVLLKLQQHGDLEFPLTDNNIKAVILD  300

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             +F  G ET++ +  WAMSEM+KNPRV+ KAQAEVR VF GK   +    E+L +LK VVK
Sbjct  301   IFAGGGETTSISVEWAMSEMLKNPRVMDKAQAEVRRVFDGKGNAD----EELKFLKVVVK  356

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR HPP PL+  RECRE   IN GY IP KT ++VNA+A+  D  +W E ERF PERF
Sbjct  357   ETLRLHPPFPLLIPRECREMCEIN-GYEIPKKTLIIVNAWAIGRDSDHWVEAERFYPERF  415

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
              D+ +D+ G+ F Y+PFGAGRR+CPG+ F        LAHLLYNFDWKLP G+ A+ LDM
Sbjct  416   LDSSIDYKGTDFGYIPFGAGRRMCPGILFSLPIIELSLAHLLYNFDWKLPNGMKADDLDM  475

Query  167   TEMLGLAVARKND  129
             TE LG+AV RK D
Sbjct  476   TEALGIAVRRKQD  488



>dbj|BAM68810.1| putative CYP71AV1 ortholog [Artemisia absinthium]
Length=495

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/480 (48%), Positives = 331/480 (69%), Gaps = 8/480 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             I+ A  + F+    T+ K  +     P P +LPIIG++ H+ G + PHR + DLARKYG 
Sbjct  16    IALATILFFIYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIGTI-PHRGVMDLARKYGS  72

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWR
Sbjct  73    LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  132

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRA  1029
             Q+RK+C  ELL+ + V+SF S+R +E   L+ ++++S +GRP N+SE IF   ++I+ RA
Sbjct  133   QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRA  192

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG+    +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H K D++I 
Sbjct  193   AFGKGIKDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLIN  252

Query  848   SIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
             +++ +H     S T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T 
Sbjct  253   NLVAEHTVNTSSKTNE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATV  309

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WA+SE++K PR + K QAE+R+   GKE + E D+++L YL  V+KETLR HPP PL+ 
Sbjct  310   EWAISELIKCPRAMEKVQAELRKALNGKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVM  369

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
              RECR+   +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++
Sbjct  370   PRECRQPVNL-AGYNIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSTTVMGAEYE  428

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             Y+PFGAGRR+CPG A G AN   PLA++LY+F+WKLP G + + +DMTE  G  V RK +
Sbjct  429   YLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASYDQIDMTESFGATVQRKTE  488



>ref|XP_003529194.2| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=517

 Score =   463 bits (1192),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 242/493 (49%), Positives = 329/493 (67%), Gaps = 10/493 (2%)
 Frame = -2

Query  1583  NIMENLISFALFVSFLVLVYTQWKK-QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRD  1407
             N++  ++SF+LF+   + +    KK +    +PPGP KLPIIGN+ H+     PHR LRD
Sbjct  7     NMLAVIMSFSLFIIVALKIGRNLKKTESSPNIPPGPWKLPIIGNIHHLVT-CTPHRKLRD  65

Query  1406  LARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLG  1227
             LA+ YG LM LQ+GE+  ++VSSP+ AKE ++THD+ FA+R + LA  IL Y +++IV  
Sbjct  66    LAKTYGPLMHLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFS  125

Query  1226  PYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTS  1047
             PYG+YWRQ+RKIC  ELL  R V SF  IR +E   L+  + S  G P N++E +FL   
Sbjct  126   PYGNYWRQLRKICTVELLTQRRVNSFKQIREEEFTNLVKMIDSHKGSPINLTEAVFLSIY  185

Query  1046  SIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRK  867
             SII RAAFG     +E+FI   K+   +   F+  D+FPS K L  + G + ++ + H K
Sbjct  186   SIISRAAFGTKCKDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHGK  245

Query  866   TDSIIESIINDHRN-----KLESGTGEDCIIDVLLKLMDSG--NLQVPITHDNIKAIIID  708
             TD I++ IIN+HR      K + G  E+ ++DVLLK  D    N  + +T +NIKAII+D
Sbjct  246   TDRILKEIINEHREAKSKAKEDQGEAEEDLVDVLLKFQDGDDRNQDISLTINNIKAIILD  305

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             +F AG ETS TT  WAM+E++K+PRV+ KAQ EVRE+F  K  ++E  + +L YLK+VVK
Sbjct  306   VFAAGGETSATTINWAMAEIIKDPRVMKKAQVEVREIFNMKGRVDEICINELKYLKSVVK  365

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR HPP PL+  REC +   IN GY IPVK+KV VNA+A+  DP+YW EPERF PERF
Sbjct  366   ETLRLHPPAPLLIPRECGQTCEIN-GYHIPVKSKVFVNAWAIGRDPKYWTEPERFYPERF  424

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
              D+ +D+ G++F++ PFG+GRRICPG+  G  N    LA LLY+F WKLP G+ +E LDM
Sbjct  425   IDSSIDYKGNNFEFTPFGSGRRICPGITLGSVNVELALAFLLYHFHWKLPNGMKSEELDM  484

Query  167   TEMLGLAVARKND  129
             TE  G +V RK D
Sbjct  485   TEKFGASVRRKED  497



>gb|AGO03789.1| germacrene A oxidase [Tanacetum cinerariifolium]
Length=488

 Score =   462 bits (1189),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 230/474 (49%), Positives = 328/474 (69%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + F V  +    K  +  +P  P +LPIIG++ H+ G + PHR + DLARKYG LM LQ+
Sbjct  14    ILFFVYKFATRSKSTKNSLPE-PWRLPIIGHMHHLIGTI-PHRGVMDLARKYGSLMHLQL  71

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ+RK+C
Sbjct  72    GEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLC  131

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               ELL+ + V+SF S+R +E   L+ ++++S +GRP N+SE IF   ++I+ RAAFG+  
Sbjct  132   TLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRAAFGKGI  191

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H K D++I +++ +H
Sbjct  192   RDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHTKLDNLINNLVAEH  251

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
               K  S T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  WA+SE
Sbjct  252   TVKTSSKTNE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATIEWAISE  308

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K Q E+R+   GKE + E D+++L YL  V+KETLR HPP PL+  RECR+
Sbjct  309   LIKCPRAMEKVQVELRKALNGKERIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQ  368

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++Y+PFGA
Sbjct  369   PVNL-AGYDIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSTTVMGAEYEYLPFGA  427

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA++LY+F+WKLP G + + +DMTE  G  V RK +
Sbjct  428   GRRMCPGAALGLANVQLPLANILYHFNWKLPNGASYDQIDMTESFGATVQRKTE  481



>sp|D5J9U8.1|GAO_LACSA RecName: Full=Germacrene A oxidase; Short=LsGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Lactuca sativa]
 gb|ADF32078.1| germacrene A oxidase [Lactuca sativa]
Length=488

 Score =   462 bits (1188),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 234/480 (49%), Positives = 330/480 (69%), Gaps = 8/480 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             I+ A  V FL  + T+ K  +  K  P   +LPIIG++ H+ G  +PHR + DLARK+G 
Sbjct  9     IALATIVFFLYKLATRPKSTK--KQLPEASRLPIIGHMHHLIG-TMPHRGVMDLARKHGS  65

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWR
Sbjct  66    LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPYGEYWR  125

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRA  1029
             Q+RK+C  ELL+ + V+SF SIR +E   L+ +V+ S +G+P N+SE IF   ++I+ RA
Sbjct  126   QLRKLCTLELLSVKKVKSFQSIREEECWNLVKEVKESGSGKPINLSESIFTMIATILSRA  185

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG+    + +F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D++I 
Sbjct  186   AFGKGIKDQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLIN  245

Query  848   SIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
             +I+ +H     S   E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T 
Sbjct  246   NIVAEHHVSTSSKANE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATV  302

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WA+SE+++ PR + K QAE+R+   GKE ++E D++ L YL  V++ETLR HPP PL+ 
Sbjct  303   EWAISELIRCPRAMEKVQAELRQALNGKEKIQEEDIQDLAYLNLVIRETLRLHPPLPLVM  362

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
              RECRE   +  GY I  KTK++VN +A+  DP+YW++ E FIPERFE+N  +  G+ ++
Sbjct  363   PRECREPVNL-AGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIMGADYE  421

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             Y+PFGAGRR+CPG A G AN   PLA++LY+F+WKLP G + + LDMTE  G  V RK +
Sbjct  422   YLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGATVQRKTE  481



>gb|KHN42024.1| Cytochrome P450 71D8 [Glycine soja]
Length=459

 Score =   461 bits (1185),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 225/448 (50%), Positives = 321/448 (72%), Gaps = 9/448 (2%)
 Frame = -2

Query  1451  LHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETL  1272
             L   GP LPHRALR+LA KYG LM LQ+GEISAVVVSSP+MAKE  +THD+AF  R + +
Sbjct  4     LAAAGP-LPHRALRELAHKYGPLMHLQLGEISAVVVSSPNMAKEITKTHDVAFVQRPQII  62

Query  1271  AGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSA  1092
             +  IL Y   D+V  PYGDYWRQMRK+ ++ELL+ + V+SFS IR DE  +L+  +R+S 
Sbjct  63    SAQILSYGGLDVVFAPYGDYWRQMRKVFVSELLSAKRVQSFSFIREDEAAKLIDSIRASE  122

Query  1091  GRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALH  912
             G P N++ +IF   S+ + RAA G     +++F+   + +    G F+ AD+FPS K +H
Sbjct  123   GSPINLTRKIFSLVSASVSRAAIGNKSKDQDEFMYWVQKVIGSVGGFELADLFPSMKFIH  182

Query  911   PLFGNKSEILKTHRKTDSIIESIINDH-RNKLESGTG------EDCIIDVLLKLMDSGNL  753
              + G K+++ K   + D ++E+I+ +H   ++ +  G      ++ ++DVL+++  +  L
Sbjct  183   FITGTKAKLEKLLNRVDRVLENIVREHLERQIRAKEGRILVDEDEDLVDVLIRVQQADTL  242

Query  752   QVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLE  573
              + +T  ++KA+I+D+F  G +TS +T  WAM+EMMKNPRV  KAQAE+R+ F+ K+++ 
Sbjct  243   DIKMTTRHVKALILDVFAGGIDTSASTLEWAMTEMMKNPRVREKAQAELRQAFREKKIIH  302

Query  572   ESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATD  393
             ESD+EQL YLK V+KETLR HPPTPL+  REC EET+I  GY IPVKTKVM+N +A+  D
Sbjct  303   ESDIEQLTYLKLVIKETLRLHPPTPLLIPRECSEETII-AGYEIPVKTKVMINVWAICRD  361

Query  392   PQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNF  213
             P+YW + ERF+PERFED+ +DF G++F+Y+PFGAGRRICPG++FG A+ + PLA LL  F
Sbjct  362   PKYWTDAERFVPERFEDSSIDFKGNNFEYLPFGAGRRICPGISFGLASIMLPLAQLLLYF  421

Query  212   DWKLPEGVTAETLDMTEMLGLAVARKND  129
             +W+LP G+  E++DMTE  GLA+ RKND
Sbjct  422   NWELPNGMKPESIDMTERFGLAIGRKND  449



>sp|D5JBW9.1|GAO_SAUCO RecName: Full=Germacrene A oxidase; Short=SlGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Saussurea costus]
 gb|ADF43081.1| germacrene A oxidase [Saussurea costus]
Length=488

 Score =   462 bits (1188),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 232/482 (48%), Positives = 335/482 (70%), Gaps = 10/482 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRR----GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             +SF   ++   +V+  +K   R     K+ P P +LPIIG++ H+ G  +PHR + DLAR
Sbjct  3     LSFTTSIAVATIVFVLFKLATRPKSNKKLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLAR  61

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             KYG LM LQ+GE+S +VVSSP  AKE L THD+ FA R ETL G I+ Y+N+DIVL PYG
Sbjct  62    KYGSLMHLQLGEVSTIVVSSPKWAKEILTTHDITFANRPETLTGEIIAYHNTDIVLAPYG  121

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSI  1041
             +YWRQ+RK+C  ELL+ + V+SF S+R +E   L+ +V+ S +GRP ++SE IF   ++I
Sbjct  122   EYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQEVKESGSGRPVDLSENIFKMIATI  181

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
             + RAAFG+    +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D
Sbjct  182   LSRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLD  241

Query  860   SIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETS  681
             ++I +I+ +H     S + E  ++DV+L+L DS  ++ P+T DN+KAII+DMFGAG++TS
Sbjct  242   NLINNIVAEHPGNNSSKSNE-TLLDVMLRLKDS--VEFPLTADNVKAIILDMFGAGTDTS  298

Query  680   TTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPT  501
             + T  WA+SE+++ PR + K QAE+R+  KGK+ ++E D++ L YL  V+KETLR HPP 
Sbjct  299   SATVEWAISELIRCPRAMEKVQAELRQALKGKDKVKEEDIQDLSYLDLVIKETLRLHPPL  358

Query  500   PLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNG  321
             PL+  RECR+   +  GY I  KTK++VN +A+  DP+YW++ E FIPERFE++ +   G
Sbjct  359   PLVMPRECRQPVNL-AGYDIANKTKLIVNVFAINRDPEYWKDAESFIPERFENSPITVMG  417

Query  320   SHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVA  141
             + ++Y+PFGAGRR+CPG A G AN   PLA++LY+F+WKLP G + + LDMTE  G  V 
Sbjct  418   AEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGATVQ  477

Query  140   RK  135
             RK
Sbjct  478   RK  479



>gb|ABG49366.1| P450 monooxygenase [Artemisia annua]
Length=488

 Score =   462 bits (1188),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 229/474 (48%), Positives = 328/474 (69%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + F V  +    K  +  +P  P +LPIIG++ H+ G + PHR + DLARKYG LM LQ+
Sbjct  14    ILFFVYKFATRSKSNKNSLPE-PWRLPIIGHMHHLIGTI-PHRGVMDLARKYGSLMHLQL  71

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ+RK+C
Sbjct  72    GEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLC  131

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               ELL+ + V+SF S+R +E   L+ +++++ +GRP N+SE IF   ++I+ RAAFG+  
Sbjct  132   TLELLSVKKVKSFQSLREEECWNLVQEIKAAGSGRPVNLSENIFKLIATILSRAAFGKGI  191

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H K D++I +++ +H
Sbjct  192   KDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEH  251

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                  S T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  WA+SE
Sbjct  252   TVNTSSKTNE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATIEWAISE  308

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K QAE+R+  KGKE + E D+++L YL  V+KETLR HPP PL+  RECR+
Sbjct  309   LIKCPRAMEKVQAELRKALKGKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQ  368

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++Y+PFGA
Sbjct  369   PVNL-AGYNIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSTTVMGAEYEYLPFGA  427

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA++LY+F+WKLP G + + +DM E  G  V RK +
Sbjct  428   GRRMCPGSALGLANVQLPLANILYHFNWKLPNGASYDQIDMAESFGATVQRKTE  481



>gb|EYU31465.1| hypothetical protein MIMGU_mgv1a004885mg [Erythranthe guttata]
Length=506

 Score =   462 bits (1189),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 335/486 (69%), Gaps = 8/486 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKK----QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             NLIS  +F S + LV    KK     +  K+PP P +LP+IG+L HI G  L H ALR +
Sbjct  10    NLISLLIFPSLIFLVMKALKKPNTPTKNEKLPPSPPELPVIGHLHHIVGRGLAHHALRRV  69

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A KYG ++ L++G++S V++SS + AK+ L+  D   A R E++A  I+ Y+ +D+   P
Sbjct  70    AEKYGPVLHLKLGQVSTVLISSAEAAKQVLKDQDPGCAGRPESIALKIMWYDYTDLAFSP  129

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRS-SAGRPFNVSERIFLFTS  1047
             Y +YWRQMR+IC+ ELL+ + V+SF SIR DE+  L+  ++    G P N++E++F   S
Sbjct  130   YNEYWRQMRRICVVELLSAKNVKSFGSIRQDEVSILIKSIKKLCGGEPINLTEKVFGMIS  189

Query  1046  SIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRK  867
             SI CRA FGEV   R+  +   K+   + G F   D+FPSWK L+ L  + +++ +  RK
Sbjct  190   SITCRAVFGEVLKDRDSLVYLMKEGLSMAGGFQLVDLFPSWKLLNILSWSNNKLWRMRRK  249

Query  866   TDSIIESIINDHR-NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
              D ++++++ +HR NK     GED I+DVL+++  +G LQ PIT+DNIKA+I DMF AG+
Sbjct  250   VDLVLDALLEEHRLNKSGEFGGED-IVDVLIRVQRNGELQFPITNDNIKAVIFDMFSAGT  308

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             E+S++   WAM+E+M+NPRV+ K Q EVRE  KGK+ +++SDVE L YLK VVKETLR H
Sbjct  309   ESSSSAIDWAMAELMRNPRVMEKVQREVREGLKGKKRVDDSDVEGLKYLKLVVKETLRLH  368

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
             PP PL+  R CREE V   GY+IP+ ++VM++ +A+  DP YW++PE F PERFE++ +D
Sbjct  369   PPIPLLP-RACREEGVKVNGYSIPINSRVMISIWAMGRDPLYWDDPETFQPERFENSCID  427

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             F G+ F+Y+PFGAGRRICPG+ FG A+   PLA +LY+F+W LP G++ + +DMTE  G+
Sbjct  428   FTGNSFEYLPFGAGRRICPGMNFGLASVELPLAQILYHFNWTLPTGISFDHVDMTEQEGI  487

Query  149   AVARKN  132
              V+RKN
Sbjct  488   TVSRKN  493



>ref|XP_004512033.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=510

 Score =   462 bits (1189),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 324/463 (70%), Gaps = 9/463 (2%)
 Frame = -2

Query  1493  MPPGPRKLPIIGNLLHITG-PVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             +PPGP KLP IGNL  I     LPHRA + LA KYG +M L++G+ISAVV++SP +AKE 
Sbjct  36    LPPGPTKLPFIGNLHQIASLGSLPHRAFQQLAHKYGPIMHLKLGQISAVVITSPKLAKEI  95

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             L+THD+ FA R    +  I+ Y + DI   PYGDY+RQMRKIC+ ELL+ + V+SFS IR
Sbjct  96    LKTHDITFANRPNLESAHIMTYGSIDIAFSPYGDYYRQMRKICMLELLSAKRVQSFSYIR  155

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE ++ +  ++SS G   N++ RIF   SS + R+AFG+  + +++F+   +      G
Sbjct  156   EDETNKFIELIKSSEGSEVNLTNRIFSLVSSTVSRSAFGDKTEDQDEFVSVIRKAIESVG  215

Query  956   SFDFADMFPSWK-ALHPLFGNKSEILKTHRKTDSIIESIINDH-----RNKLE-SGTGED  798
               + AD+FPS+K  +H L GNKS++ K H++ D I+E I++ H     R KL+ S   ++
Sbjct  216   GLEPADLFPSFKYIIHVLTGNKSKLEKMHKQADKILEIIVSKHQEKQRRKKLDGSDEEQE  275

Query  797   CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKA  618
              ++DVLL++  SG L +PIT  NIKA+I D F AG++T+T+T  WAM+E+MKNPRV+ K 
Sbjct  276   DLVDVLLRVQQSGTLDIPITTSNIKAVIFDAFAAGTDTTTSTITWAMAELMKNPRVMEKL  335

Query  617   QAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             Q+E+R+  KGKE++ E DV+ LPYLK V+KETLR H PTPL+  RE  + T I GGY IP
Sbjct  336   QSELRDACKGKEIITEVDVQDLPYLKLVIKETLRLHSPTPLLLPRESTQLTNI-GGYDIP  394

Query  437   VKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFG  258
              KTKVMVN +A+A DP YW + E FIPERF+ N +D+ G+HF+Y+PFGAGRRICPG++FG
Sbjct  395   KKTKVMVNVWAMARDPYYWNDAEMFIPERFDSNSIDYKGNHFEYLPFGAGRRICPGMSFG  454

Query  257   FANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              A  + PLA L Y+FDWKLP  +  + LDMTE  GLA+ RK D
Sbjct  455   IAGIMLPLALLFYHFDWKLPNQMKPQDLDMTEHYGLAIGRKID  497



>ref|XP_007033123.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY04049.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   462 bits (1188),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 241/487 (49%), Positives = 330/487 (68%), Gaps = 10/487 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             L++F LFV  +V V   WK K  + ++PPGPRKLP+IGN+ H     LPH  LRDLA+K+
Sbjct  12    LLTF-LFVFMVVKVLKGWKAKNPQARLPPGPRKLPLIGNM-HQLISSLPHHTLRDLAKKH  69

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GE+  +V+SSP+ AKE L+ H   FA R   LA  I+ Y++++IV  PYG Y
Sbjct  70    GPLMHLQLGEVPTIVISSPETAKEVLKDHATIFAQRPYLLASKIMSYDSTNIVFSPYGKY  129

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             WRQ+RKI   ELL+P  V SF  IR +E+  L+  +    G P N+S +IF  T  I  R
Sbjct  130   WRQLRKISTMELLSPSRVLSFRFIREEEVSALIKTISLIEGSPVNLSVKIFSMTYGITSR  189

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             AAFG+    +E+FI+   +   L G F  ADM+PS + L  + G + ++ K    +D I+
Sbjct  190   AAFGKKSKDQEEFIRIMMETIKLAGGFCLADMYPSNELLKLISGVRLKLEKLQLASDRIL  249

Query  851   ESIINDHRNKL----ESGT--GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             E I+N+H+ K     E+G   GE+ ++DVLLKL  S +L++P+T+D IKAII+D+  AG 
Sbjct  250   EDIVNEHKEKTNRTSETGNQQGEEDLLDVLLKLQQSSDLEIPLTNDKIKAIILDILVAGG  309

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             +TS+TT  WAMSEM+KNPRV+ +AQAEVR+VF  K  ++E+ + +L +L+++VKETLR H
Sbjct  310   DTSSTTMEWAMSEMLKNPRVMKQAQAEVRQVFDRKGNVDEAGIHELKFLRSIVKETLRLH  369

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
             P  PL+  REC E  VI+ GY I  K+KV+VNA+A+  D +YW++ E F PERF D+ +D
Sbjct  370   PAAPLLVPRECDENCVIS-GYDILAKSKVIVNAWAIGRDSRYWKDAENFNPERFLDSPID  428

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             F G+HF+Y+PFGAGRRICPG++F   N   PLA LLY+FDWKLP G   E LDMTE  G+
Sbjct  429   FRGTHFEYIPFGAGRRICPGISFALPNIELPLAQLLYHFDWKLPNGSNCEDLDMTECFGI  488

Query  149   AVARKND  129
              V RKND
Sbjct  489   TVRRKND  495



>gb|KHN48844.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   461 bits (1187),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 233/469 (50%), Positives = 326/469 (70%), Gaps = 14/469 (3%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             K+PPGP+KLPIIGNL  +     LPH ALRDLA+KYG LM LQ+GEISAVV SSP MAKE
Sbjct  31    KLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKKYGPLMHLQLGEISAVVASSPKMAKE  90

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              ++THD++F  R   + G ++ Y    I   PYGD+WRQMRK+C TELL+ + V+SF+SI
Sbjct  91    IVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASI  150

Query  1139  RHDEIHRLLADVRSS----AGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFI-QQTKD  975
             R DE  + +  +R+S    AG P N++ +IF    + I R AFG ++  +++F+    + 
Sbjct  151   REDEAAKFIDSIRNSIREAAGSPINLTSQIFSLICASISRVAFGGIYKEQDEFVVSLIRK  210

Query  974   ISVLTGSFDFADM-FPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH--RNKLESGTG  804
             I    G FD AD+ FPS   L+ + G  +++ K H++ D ++E+II +H  + K+    G
Sbjct  211   IVESGGGFDLADVVFPSIPFLYFITGKMAKLKKLHKQVDKVLENIIREHQEKKKIAKEDG  270

Query  803   EDC----IIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNP  636
              +      ID+LLK+     + + +T +NIKA+I+D+F AG++TS +T  WAM+EMM+NP
Sbjct  271   AEVEDQDFIDLLLKIQQDDTMDIEMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNP  330

Query  635   RVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVIN  456
             RV  KAQAE+R+ F+ KE++ ESD+EQL YLK V+KET R HPPTPL+  REC + T+I+
Sbjct  331   RVREKAQAELRQTFREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIID  390

Query  455   GGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRIC  276
              GY IP KTKVMVNAYA+  DP+YW + ERF+PERFED+ +DF G++F Y+PFG GRRIC
Sbjct  391   -GYEIPTKTKVMVNAYAICKDPKYWTDAERFVPERFEDSSIDFKGNNFNYLPFGGGRRIC  449

Query  275   PGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             PG+  G A+ + PLA LLY+F+W+LP  +  E ++M E  GLA+ RKN+
Sbjct  450   PGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNE  498



>gb|KEH25835.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   461 bits (1185),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 246/485 (51%), Positives = 330/485 (68%), Gaps = 12/485 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHIT--GPVLPHRALRDLARKYG  1389
             SF   + FL  +Y    K R  K+PPGP KLP+IGNL  I   G +L H  +RDL+ KYG
Sbjct  12    SFIFLLIFLAKIYKHKIKVRSHKLPPGPWKLPLIGNLHQIAFAGKLL-HHTIRDLSHKYG  70

Query  1388  GLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYW  1209
              LM LQ+GEISAVVVSSP++ KE +RTHDL+F  R   LA +I+ Y + DI++  YGDYW
Sbjct  71    PLMHLQLGEISAVVVSSPNLTKEIMRTHDLSFVERPRFLAPNIITYESKDILMSSYGDYW  130

Query  1208  RQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGR-PFNVSERIFLFTSSIICR  1032
             RQMRKIC +ELL+ + V+SFSSIR D + +++  + S++ + P ++S+ I    SS I R
Sbjct  131   RQMRKICTSELLSAKRVQSFSSIREDGVEKMIQFIHSTSCQDPLDLSKMISSLVSSFISR  190

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             A FG+     ++ +   K    +   FD +D+FPS+K +H + G K  +    +K D I 
Sbjct  191   ATFGKKSKYEDELLCLLKQSMEMVNYFDVSDVFPSFKPIHFISGMKPRLKNFQKKLDMIF  250

Query  851   ESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTT  672
             E IIN H++      GE+ I+DVLL++  SG+L +PITHDN+KA+I DMF   S++S  T
Sbjct  251   EKIINAHQSN-HDLQGEN-IVDVLLRIQQSGSLNIPITHDNVKAVIWDMFAGASDSSAIT  308

Query  671   SMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLI  492
               WAMSE+MKNPRV  KAQAE+REV KGK+ + ESD+ +L YLK+V+KETLR HPP  ++
Sbjct  309   IDWAMSELMKNPRVRMKAQAEIREVCKGKKRIYESDLHELSYLKSVIKETLRLHPPGAIL  368

Query  491   ATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN-GVDF---N  324
              TRECRE   I GGY IP+KT +++NA+A+  DP +W + E+FIPERF DN G DF   N
Sbjct  369   -TRECREACNI-GGYEIPIKTNLILNAWAIGRDPNHWSDAEKFIPERFHDNTGFDFNKVN  426

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
              + FQY+PFG GRR+CPG+ FG AN   PLA LLY+FDWK+P  + AE  DMTE  G  V
Sbjct  427   DNSFQYIPFGGGRRMCPGVLFGLANIELPLAALLYHFDWKIPNEMKAEDFDMTEEYGATV  486

Query  143   ARKND  129
             +RKN+
Sbjct  487   SRKNN  491



>ref|XP_003550472.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=559

 Score =   462 bits (1190),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 240/467 (51%), Positives = 324/467 (69%), Gaps = 11/467 (2%)
 Frame = -2

Query  1517  WKKQRRGKMPPGPRKLPIIGNLLHITGPV-LPHRALRDLARKYGGLMSLQIGEISAVVVS  1341
             +K++   K+PPGP KLPIIGNLL +     LPH A+R+LA+KYG LM LQ+GEISAV+VS
Sbjct  78    YKQKSLHKLPPGPWKLPIIGNLLQLAAASSLPHHAIRELAKKYGPLMHLQLGEISAVIVS  137

Query  1340  SPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRL  1161
             SP+MAKE ++THDLAFA R + LA  I+ Y + DI   PYGDYWRQMRKIC  ELL+ + 
Sbjct  138   SPNMAKEIMKTHDLAFAQRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKK  197

Query  1160  VRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQT  981
             V+SFS+IR  EI +L+  ++SSAG P N++  I  F S+ + R  FG + D  E+F+  T
Sbjct  198   VQSFSNIREQEIAKLIEKIQSSAGAPINLTSMINSFISTFVSRTTFGNITDDHEEFLLIT  257

Query  980   KDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGE  801
             ++   +   FD ADMFPS+K +H + G K+++ K H+K D I++ II +  N+   G GE
Sbjct  258   REAIEVADGFDLADMFPSFKPMHLITGLKAKMDKMHKKVDKILDKIIKE--NQANKGMGE  315

Query  800   ---DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
                + +++VLL++  SGNL  PIT +NIKA+I D+F AG++TS     WAMSEMM+NPRV
Sbjct  316   EKNENLVEVLLRVQHSGNLDTPITTNNIKAVIWDIFAAGTDTSAKVIDWAMSEMMRNPRV  375

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
               KAQAE+R    GKE + ES++ +L YLK V+KET+R HPP PL+  REC E   I+ G
Sbjct  376   REKAQAEMR----GKETIHESNLGELSYLKAVIKETMRLHPPLPLLLPRECIEACRID-G  430

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             Y +P KTKV+VNA+A+  DP+ W + + FIPERF    +DF G  F+Y+PFGAGRR+CPG
Sbjct  431   YDLPTKTKVIVNAWAIGRDPENWHDADSFIPERFHGASIDFKGIDFEYIPFGAGRRMCPG  490

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++FG AN    LA LLY+F+W+L +G   E  DM E  G  V RKN+
Sbjct  491   ISFGIANVEFALAKLLYHFNWELQQGTKPEEFDMDESFGAVVGRKNN  537



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   460 bits (1184),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 239/487 (49%), Positives = 338/487 (69%), Gaps = 11/487 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQ---WKKQR-RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             +FA+ ++FL+ V      WKK + + K+PPGPRKLP IGNL H     LPH   ++L+ K
Sbjct  7     NFAMLIAFLLFVAIALKLWKKSKIQYKLPPGPRKLPFIGNL-HQLSSSLPHHTFKNLSNK  65

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG +M LQ+GE+SAV+VSSP +AKE L+THDL FA R + L+  IL  N+  +   PYG 
Sbjct  66    YGPMMHLQLGEVSAVIVSSPQVAKEVLKTHDLIFANRPQLLSVQILSNNSPTLSFSPYGA  125

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGR-PFNVSERIFLFTSSII  1038
              WRQ+RK+C+ ELL+ + V+SF SIR +E+  L+  +     + P ++SE IF  T++I 
Sbjct  126   NWRQLRKVCVLELLSAKRVQSFESIREEEVDNLIEAISLIQPQVPIDISEMIFSMTNNIT  185

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
              RAAFG+    +++FI+  K I+ L+G FD  D+FPS K  H L G K  + K H+K D 
Sbjct  186   ARAAFGKKCKHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVKPALEKVHQKVDK  245

Query  857   IIESIINDHR-NKLESGTG---EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             I E II +H+ NK +  +    ++ ++DVLL++ +SG+L++PI+ + +K++I++MF  G+
Sbjct  246   IFEDIIQEHKENKRDMSSNMLYKEDLVDVLLRVQESGDLEIPISRNTLKSVILEMFIGGT  305

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             +TS+T   WA+SEMMKNP+V+ KAQAEVREVFKGK  + ES++++L Y+K V+KETLR H
Sbjct  306   DTSSTVLEWAISEMMKNPQVMEKAQAEVREVFKGKSKITESEIQKLDYIKMVIKETLRMH  365

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
             PP PL+  RE  E+  I GGY IP KTKV++NA+A+   PQ+WE  E F PERF+D  +D
Sbjct  366   PPLPLLLPREAIEKCEI-GGYDIPAKTKVIINAWAIGRHPQHWENAECFEPERFQDLDLD  424

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             F G++ +Y+PFG GRR+CPG  FG AN   PLA LL++FDW+LP+G+ A  LDMTE  G 
Sbjct  425   FVGTNLEYIPFGGGRRMCPGSLFGIANVELPLAKLLFHFDWELPDGIEASDLDMTETFGA  484

Query  149   AVARKND  129
              V RKND
Sbjct  485   TVGRKND  491



>gb|AGC29947.1| CYP71BE30 [Sinopodophyllum hexandrum]
Length=498

 Score =   460 bits (1183),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 316/465 (68%), Gaps = 5/465 (1%)
 Frame = -2

Query  1514  KKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSP  1335
             KK +R ++PPGP KLP+IG+L H+    LPH  LRDLA+K+G LM LQ+G++S VVV+SP
Sbjct  21    KKGKRSQLPPGPWKLPLIGSLHHLLVG-LPHHTLRDLAKKHGSLMHLQLGQVSTVVVTSP  79

Query  1334  DMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVR  1155
              +AKE  +THD+ F  R    A SI+ Y   DIVL PYG++WRQMRKI   E+ + + V+
Sbjct  80    RIAKEMFKTHDIMFLDRPFMFAPSIVTYGAKDIVLAPYGEFWRQMRKISTLEVFSAKRVQ  139

Query  1154  SFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKD  975
             SF S+R DE+  L+  + S  G  FN+++RIF F + +  R AFG     +E F+     
Sbjct  140   SFQSVREDEVSMLIESISSMNGSVFNLTKRIFSFMNDLTARVAFGNKCKDQEAFVSMMDQ  199

Query  974   ISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH---RNKLESGTG  804
             +  ++G F  AD++PS + ++ + G KSE+   H+KTD I+E+II +H    N       
Sbjct  200   VIKVSGGFGVADLYPSLEIINVISGLKSEMEGIHQKTDEILENIIKEHMQRNNNPNKDVN  259

Query  803   EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLA  624
             E+ I+DVLL+L    NL   +T DNIKA++ D+F  GSETS+T   WA+ E+MK+P  + 
Sbjct  260   EEDIVDVLLRLQKDANLGFQLTSDNIKAVLFDIFSGGSETSSTVMDWAICELMKSPTSME  319

Query  623   KAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYT  444
             K Q EVR+V  GK  + E+D+ +L YLK+V+KETLR HPP PL+  RECRE   ++ GY 
Sbjct  320   KVQREVRQVLNGKTNIIETDIHELKYLKSVIKETLRLHPPFPLLIPRECRERCEVD-GYE  378

Query  443   IPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLA  264
             IPV TK++VNA+A+  DPQ+W++ E+F+PERF++  VD+ G+HFQY+PFGAGRRICPG++
Sbjct  379   IPVGTKIIVNAWAIGRDPQHWKDAEKFVPERFDEGSVDYKGAHFQYIPFGAGRRICPGIS  438

Query  263   FGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              G AN    LA LLY+FDWKLP GV  + LDM E  GLAV R+ D
Sbjct  439   LGVANIELALAQLLYHFDWKLPNGVGTDELDMAEAFGLAVRRRKD  483



>sp|D5JBW8.1|GAO_CICIN RecName: Full=Germacrene A oxidase; Short=CiGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Cichorium intybus]
 gb|ADF43080.1| germacrene A oxidase [Cichorium intybus]
Length=488

 Score =   459 bits (1181),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 231/479 (48%), Positives = 327/479 (68%), Gaps = 6/479 (1%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGL  1383
             S AL    L+L     + +   K  P   +LPIIG++ H+ G  +PHR + +LARK+G L
Sbjct  8     SIALATIVLILYKLATRPKSNKKRLPEASRLPIIGHMHHLIG-TMPHRGVMELARKHGSL  66

Query  1382  MSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQ  1203
             M LQ+GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ
Sbjct  67    MHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQ  126

Query  1202  MRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAA  1026
             +RK+C  ELL+ + V+SF SIR +E   L+ +V+ S +G+P ++SE IF   ++I+ RAA
Sbjct  127   LRKLCTLELLSVKKVKSFQSIREEECWNLVKEVKESGSGKPISLSESIFKMIATILSRAA  186

Query  1025  FGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIES  846
             FG+    + +F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D++I +
Sbjct  187   FGKGIKDQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDTLINN  246

Query  845   IINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSM  666
             I+ +H     S   E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  
Sbjct  247   IVAEHHVSTSSKANE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATVE  303

Query  665   WAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIAT  486
             WA+SE+++ PR + K QAE+R+   GKE + E D++ LPYL  V++ETLR HPP PL+  
Sbjct  304   WAISELIRCPRAMEKVQAELRQALNGKEQIHEEDIQDLPYLNLVIRETLRLHPPLPLVMP  363

Query  485   RECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQY  306
             RECRE   +  GY I  KTK++VN +A+  DP+YW++ E FIPERFE+N  +  G+ ++Y
Sbjct  364   RECREPVNL-AGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIMGADYEY  422

Query  305   VPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +PFGAGRR+CPG A G AN   PLA++LY+F+WKLP G + + LDMTE  G  V RK +
Sbjct  423   LPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGATVQRKTE  481



>emb|CDP17903.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   459 bits (1181),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 238/463 (51%), Positives = 317/463 (68%), Gaps = 33/463 (7%)
 Frame = -2

Query  1499  GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             GK+PPGPRKLP+IGN+ ++ G  LPH  LRDLA+KYG L+ LQ+GE+S VVVSS +MAKE
Sbjct  37    GKLPPGPRKLPLIGNIHNLFGG-LPHIVLRDLAKKYGPLLHLQLGEVSTVVVSSAEMAKE  95

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              L THD  F  R + LA +I+ Y+  D++  PYGD+WRQ+RKICITELL+ + VRSFS I
Sbjct  96    VLVTHDPVFTNRPDRLAINIMWYDKQDMIFTPYGDHWRQLRKICITELLSNKNVRSFSYI  155

Query  1139  RHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLT  960
             R DEI +L+  +RSS G   NV+E  F + + + CRAAFG +    E  I+  K+  VL 
Sbjct  156   RKDEIMKLMESIRSSQGLSVNVTEMFFRYATYMTCRAAFGTISKDTETMIKCLKEAMVLA  215

Query  959   GSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESG------TGED  798
               FD AD+FPS K L  + G K ++LK H K D I++ +IN H+   +SG      +GE+
Sbjct  216   AGFDAADVFPSLKILPLISGLKRKLLKMHDKMDEILDDVINQHKLNHKSGKMGNAVSGEE  275

Query  797   CIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKA  618
              +IDVLL+L +SGNLQ+PIT  NIK ++ D+F AG++TS+ TS WAMSE+MK+PRV+AKA
Sbjct  276   DLIDVLLRLQESGNLQMPITDRNIKGVLFDIFTAGTDTSSVTSEWAMSELMKHPRVMAKA  335

Query  617   QAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             QAEVR+V KGKE +EE D+++                   L+  RE +       GY IP
Sbjct  336   QAEVRQVCKGKETIEEDDIQK-------------------LVENREVK-------GYMIP  369

Query  437   VKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFG  258
              K+ V+VNAYA+A DP+YW++PE F PERF+   VD+ GS FQ++PFG GRR+CPG+ FG
Sbjct  370   NKSHVLVNAYAIARDPEYWDDPEMFKPERFDQKSVDYTGSDFQFLPFGTGRRMCPGVTFG  429

Query  257   FANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
              AN   PLAHLL++FDW LP G+    LDM E  GL++ RKN+
Sbjct  430   VANIELPLAHLLFHFDWSLPNGMKPNDLDMDEAAGLSINRKNN  472



>gb|KDP39287.1| hypothetical protein JCGZ_01044 [Jatropha curcas]
Length=510

 Score =   459 bits (1181),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 230/483 (48%), Positives = 326/483 (67%), Gaps = 11/483 (2%)
 Frame = -2

Query  1550  FVSFLVLVYTQWKKQRRG---KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLM  1380
             F+ FL +V   WK  ++     +PPGP KLP+IG++ H++G +LPH  LR+LA +YG LM
Sbjct  14    FLVFLFMVLRLWKNSKKNSAPNLPPGPWKLPVIGSMHHLSGSLLPHVRLRNLANEYGPLM  73

Query  1379  SLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQM  1200
              L++GE++ +VVSSP+ AK  ++THD  FA R   LA +I+ YN++D+   PYGDYWRQM
Sbjct  74    HLKLGEVTNIVVSSPETAKAIMKTHDHIFAQRPFLLAANIMAYNSTDLAFAPYGDYWRQM  133

Query  1199  RKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFG  1020
             RKIC  E+L+ + V SF  IR +E+ + + D+ S AG   N S      T +II R A G
Sbjct  134   RKICTQEILSAKRVLSFGLIREEEVSKFIRDLSSRAGSTVNFSRMFNSVTYNIIQRVAIG  193

Query  1019  EVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESII  840
             +++ G E  I   K +    G F  +D++PS K LH +   K ++L+ H++TD + ++II
Sbjct  194   KLWKGEEIVIPAFKKLIEAAGGFSLSDLYPSIKLLHKISTTKFKLLRAHKETDKLFQNII  253

Query  839   NDHR----NKLESGTG--EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETST  678
             ++HR    ++ +SG    E+ IIDVLL+      L+ PIT DNIKA+I+D+   G++TS 
Sbjct  254   DEHRARKASRAKSGAKNEEEDIIDVLLQAQSEEELEYPITDDNIKAVIMDVLSGGTDTSA  313

Query  677   TTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTP  498
             TT +WAMSE++KNP V+ + Q EVR+VF  K  ++E  + +L YLK VVKET+R H PT 
Sbjct  314   TTVVWAMSELLKNPDVMKRVQTEVRQVFSKKGYVDEESIGELHYLKAVVKETMRLH-PTG  372

Query  497   LIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGS  318
              + TRECRE+ VIN GY IP K+++++NA+AL  DP YW E ERF P+RF ++ +D+ G 
Sbjct  373   AVLTRECREDCVIN-GYDIPYKSRIIINAWALGRDPDYWPEAERFNPDRFLNSSIDYKGK  431

Query  317   HFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVAR  138
             HF+++PFGAGRRICPG+ FG +N   PLA LLY+FDWKLP G+  E LDM E  G+AV R
Sbjct  432   HFEFLPFGAGRRICPGILFGISNVQFPLARLLYHFDWKLPNGMRPEDLDMNEKYGIAVRR  491

Query  137   KND  129
              ND
Sbjct  492   AND  494



>gb|KEH25843.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   458 bits (1179),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 245/485 (51%), Positives = 334/485 (69%), Gaps = 12/485 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNL--LHITGPVLPHRALRDLARKYG  1389
             SF  F+ FL  +Y Q  K R  K+PPGP KLP+IGNL  L + G  LPH  L DL+ KYG
Sbjct  12    SFIFFLLFLAKIYKQKIKMRSHKLPPGPWKLPLIGNLHQLALAGK-LPHHTLGDLSHKYG  70

Query  1388  GLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYW  1209
              LM LQ+GEIS VVVSSP++ KE ++THDL+F  R + LA +IL Y + DI+   YGDYW
Sbjct  71    PLMHLQLGEISTVVVSSPNLTKEIMKTHDLSFVQRPQFLAPNILTYESKDIIFASYGDYW  130

Query  1208  RQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGR-PFNVSERIFLFTSSIICR  1032
             RQMRKIC +ELL+ + V+SFSSIR D + +++  + SS+ + P ++++ +    SS + R
Sbjct  131   RQMRKICTSELLSAKRVQSFSSIREDGVEKMIQFIHSSSCQDPLDLTKMVSSLVSSFVSR  190

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
             A FG+     +  +   K    +   FD AD+FPS+K +H + G K ++    +K D I+
Sbjct  191   ATFGKKSKYEDDLLCLLKQAMEMASGFDVADLFPSFKPIHLITGIKPKLENLQKKLDMIL  250

Query  851   ESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTT  672
             ESIIN+H++   +  GE+ ++DVLL++    +L++PIT DN+KA+I DMFG GS+TS  T
Sbjct  251   ESIINEHQSN-PALQGEN-LVDVLLRIQQRSSLEIPITQDNVKAVIWDMFGGGSDTSAIT  308

Query  671   SMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLI  492
               WAMSE+MKNPRV+ KAQAE+RE  KGK+ + ESD+ +L YLK V+KETLR HPP  L+
Sbjct  309   IEWAMSELMKNPRVMKKAQAEIREAVKGKKRIYESDLHKLGYLKLVIKETLRLHPPATLL  368

Query  491   ATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN-GVDF---N  324
               RECRE   I GGY IP+KT +++NA+A+  DP++W + E+FIPERF D+ G DF   N
Sbjct  369   -MRECREACNI-GGYEIPLKTNLILNAWAIGRDPEHWSDAEKFIPERFHDSTGFDFNKVN  426

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
              + FQY PFG GRR+CPG+ FG AN   PLA LLY+FDWK+P  +  E LDMTE+ G  V
Sbjct  427   DNSFQYFPFGGGRRMCPGILFGLANIELPLAALLYHFDWKIPNEMKEEDLDMTEVFGATV  486

Query  143   ARKND  129
             +RKN+
Sbjct  487   SRKNN  491



>ref|XP_006421138.1| hypothetical protein CICLE_v10004785mg [Citrus clementina]
 gb|ESR34378.1| hypothetical protein CICLE_v10004785mg [Citrus clementina]
Length=509

 Score =   458 bits (1179),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 232/467 (50%), Positives = 316/467 (68%), Gaps = 9/467 (2%)
 Frame = -2

Query  1511  KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPD  1332
             K R   +PPGP KLP+IGNL  + G  LPH  LRDL +KYG LM LQ+G++ A++VSSP+
Sbjct  32    KNRVSNLPPGPWKLPVIGNLHQLAG-FLPHHRLRDLTKKYGPLMLLQLGQVPAIIVSSPE  90

Query  1331  MAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRS  1152
             +AKE ++THD+ FA+R       IL YN  D++  PYGD W+Q+RKIC++ELL+ + V+S
Sbjct  91    VAKEVMKTHDVIFASRPHFPPAQILSYNYRDVIFSPYGDSWKQLRKICVSELLSAKRVQS  150

Query  1151  FSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDI  972
             F SIR  E+  L+  + S AG   N++E+++     I  RAAFG     +E F     +I
Sbjct  151   FQSIREAEVSDLINWISSKAGSVINLTEKVYSLMYGITSRAAFGNRSRDQEAFASVIGEI  210

Query  971   SVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES------G  810
             + +   F+ ADMFPS   L  L GNKS + + H++ D I+++IIN+H+ + E+      G
Sbjct  211   TKVMSGFNIADMFPSVGFLQWLTGNKSRVERLHQEADRIVKNIINEHKKRKETLKICKIG  270

Query  809   TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
               ED ++D+LLK+   G+L   +T D+IKA+I D+F AGSETS TT  WAM EMM+NPRV
Sbjct  271   DDED-LVDILLKIQGRGDLDSSLTTDHIKAVIFDIFAAGSETSATTVDWAMCEMMRNPRV  329

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
             + KAQAEVREVF     + E+ ++++ + K  VKETLR HP  PL+  REC E   IN G
Sbjct  330   MKKAQAEVREVFHRTGKVNETSIDEMKFFKLFVKETLRLHPVAPLLLPRECGERCQIN-G  388

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             + IPVKTKV VNA+A+  DP+YW EP  FIPERF D+ +D+ G++F+++PFGAGRRICPG
Sbjct  389   FDIPVKTKVFVNAWAIGRDPKYWTEPASFIPERFLDHSIDYKGTNFEFIPFGAGRRICPG  448

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++FG A+   PLA LLY+FDWKLP G+  E LDMTE     V RK D
Sbjct  449   ISFGLASVELPLAMLLYHFDWKLPNGMKHEDLDMTEAFATTVRRKQD  495



>dbj|BAM68811.1| putative CYP71AV1 ortholog [Artemisia abrotanum]
Length=495

 Score =   457 bits (1177),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/474 (48%), Positives = 325/474 (69%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + F V  +    K  +  +P  P +LPIIG++ H+ G + PHR + DLARKYG LM LQ+
Sbjct  21    ILFFVYKFATRSKSNKNSLPE-PWRLPIIGHMHHLIGTI-PHRGVMDLARKYGYLMHLQL  78

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWRQ+RK+C
Sbjct  79    GEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLC  138

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               ELL+ + V+SF S+R +E   L+ + +++ +GRP N+SE IF   + I+ RAAFG+  
Sbjct  139   TLELLSVKKVKSFRSLREEECWNLVQEFKAAGSGRPVNLSENIFKLIARILSRAAFGKGI  198

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H K D++I +++ +H
Sbjct  199   KDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEH  258

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                    T E  ++DVLL+L DS   + P+T DN+KAII+DMFGAG++TS+ T  WA+SE
Sbjct  259   TVNTSDKTNE-TLLDVLLRLKDSA--EFPLTADNVKAIILDMFGAGTDTSSATIEWAISE  315

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K QAE+R+  KGKE + E D+++L YL  V+KETLR HPP PL+  RECR+
Sbjct  316   LIKCPRAMEKVQAELRKALKGKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQ  375

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KTK++VN +A+  DP+YW++ E FIPERFE++     G+ ++Y+PFGA
Sbjct  376   PVNL-AGYNIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSSTTVMGAEYEYLPFGA  434

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA+LLY+F+WKLP G + + +DM E  G  V RK +
Sbjct  435   GRRMCPGSALGLANVQLPLANLLYHFNWKLPNGASYDQIDMAESFGATVQRKTE  488



>gb|AHK60843.1| CYP71D2 [Catharanthus roseus]
Length=507

 Score =   458 bits (1178),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 240/473 (51%), Positives = 327/473 (69%), Gaps = 11/473 (2%)
 Frame = -2

Query  1526  YTQWKKQRRGK--MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISA  1353
             Y + K +R  K  +PPGP KLPI+GNL ++     PH   RDL+RKYG LM +++GE + 
Sbjct  25    YGRRKSKRTXKINLPPGPWKLPILGNLHNMMMGSSPHHIFRDLSRKYGDLMLIKLGEFNT  84

Query  1352  VVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELL  1173
             +V SSP MAKE L+THDL+F  R    A  IL Y+NS +V   YGD WRQMRKI + ELL
Sbjct  85    IVASSPRMAKEVLKTHDLSFLNRPIIQATKILCYDNSALVFSQYGDSWRQMRKIFVLELL  144

Query  1172  NPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF  993
             + + VRSF  IR DE  RL++ ++ S G+  ++SE+I L+T+S++ RAAFG+V D    F
Sbjct  145   STKRVRSFQPIRQDEGSRLVSLIKESVGKSIDLSEKIKLYTTSMVARAAFGKVNDAGVTF  204

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
             ++   + + +   FD ADMFPS+K L+  F ++S +LK H KTD I+E +I++H    + 
Sbjct  205   LKLVTEAAEVAEGFDPADMFPSYKFLNVFFNSRSNLLKIHGKTDMILEEMIDEHIKSHQM  264

Query  812   G------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
             G       GE+ +ID+LL + DSG+L +    +N+KA+I DMF AG+ETS+ T  WAM+E
Sbjct  265   GKKANGENGEEDVIDILLSIKDSGDLGISHWMNNVKALIFDMFSAGTETSSATVEWAMTE  324

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             +MKNP V+ KAQ EVR+ FKGK+ ++ESD+E+L YLK VVKE LR HP  PL+  RECRE
Sbjct  325   LMKNPSVMRKAQDEVRQAFKGKKTIDESDLEELKYLKLVVKEVLRLHPFAPLLVPRECRE  384

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                I+ GY IPVKT+V VN +A+  D +YW++PE FIPERFEDN +DF G++F+Y+PFG 
Sbjct  385   ACQID-GYDIPVKTRVFVNVWAIGRDEKYWKDPESFIPERFEDNSLDFTGNNFEYLPFGC  443

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
             GRRICPG+ FG AN    LA LLY+F+WKLP GV    +DM E  GL  ++K+
Sbjct  444   GRRICPGMTFGLANVHLVLALLLYHFNWKLPPGVN--DIDMAERPGLGASKKH  494



>gb|ADA70806.1| cytochrome P450 CYP71D177 [Scoparia dulcis]
Length=504

 Score =   457 bits (1175),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 335/488 (69%), Gaps = 12/488 (2%)
 Frame = -2

Query  1577  MEN-LISFALFVS---FLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALR  1410
             MEN L+  AL +      VL+      ++   +PP P  LP+IG+L H+ G  LPHRAL+
Sbjct  1     MENRLVVAALLLVPTVIFVLINALKNSKKYKNLPPCPPSLPVIGHLHHL-GTELPHRALQ  59

Query  1409  DLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVL  1230
              +A+KYG LM L++G + A+VVSS + AKE L+  D   A R E++   I+ Y+  DI+ 
Sbjct  60    KMAKKYGPLMHLRLGNVLAIVVSSREGAKELLKNKDPLCADRPESIGSQIMWYDYRDIIF  119

Query  1229  GPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFT  1050
              PY DYWRQMRKIC+ ELL+ + VRSFSSIR DE  +++  +R+S+G+P N +E I  FT
Sbjct  120   SPYNDYWRQMRKICMIELLSTKNVRSFSSIRQDEALQMVESIRASSGKPVNFTETILAFT  179

Query  1049  SSIICRAAFGEVF--DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKT  876
              +I CR AFG+V   + R    +  K  + +   ++ AD+FP   AL     NK +++K 
Sbjct  180   CAITCRTAFGKVMKPEDRHTLSELLKKAAAMAAGYELADLFP---ALSLFSVNKYKLMKM  236

Query  875   HRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
              R+ DSI+++I+ +H  K     G + I+DVLL+L  +G+LQ PI  DNIKA+I D+F A
Sbjct  237   RRQMDSILDAIVKEHEFKQRGEFGGEDIVDVLLRLKQTGDLQFPIERDNIKAVIFDVFSA  296

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             GSETS+TT  WAM+E+M+NPRV+AK QAE+R+ FKGK+ ++ESD++ L YLK V+KETLR
Sbjct  297   GSETSSTTVDWAMAELMQNPRVMAKVQAELRDAFKGKKTIDESDIQSLTYLKLVIKETLR  356

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HPP P++  R  REE+ +N GYTIP K K++VN +A+  DP YW EPE F PERFE   
Sbjct  357   LHPPFPML-LRGTREESQLN-GYTIPYKAKIIVNNWAMGRDPAYWHEPESFQPERFESIS  414

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
              DF G++F+++PFGAG+RICPGL FG AN   PLA LLY+F+W  P+G+TA+ +D+TE  
Sbjct  415   TDFLGNNFEFLPFGAGKRICPGLHFGLANVELPLAQLLYHFNWNFPQGMTAKDIDLTETE  474

Query  155   GLAVARKN  132
             GL+++RKN
Sbjct  475   GLSLSRKN  482



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   457 bits (1175),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 233/488 (48%), Positives = 331/488 (68%), Gaps = 12/488 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWK---KQRRGK---MPPGPRKLPIIGNLLHITGPVLPHRALRDLA  1401
              F++F+SFLV +    K   +  RGK   +PPGPRKLP+IGNL  + G  LPH  LRD+A
Sbjct  7     QFSIFLSFLVFLVIAIKLISESMRGKGANLPPGPRKLPLIGNLHQLMGS-LPHHTLRDMA  65

Query  1400  RKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPY  1221
              +YG +M L+ GE+  V+VSS + AKE ++THDL FA R + L   I+ YN++ I   PY
Sbjct  66    NEYGPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPY  125

Query  1220  GDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR-SSAGRPFNVSERIFLFTSS  1044
             GD+WRQ+RKIC+ ELLN + V+SF S+R +E+  L+  +  + AG   N+S+ IF  T++
Sbjct  126   GDHWRQLRKICVAELLNVKRVQSFESLRQEEVKDLIKTISLNPAGTTINLSQMIFTLTNN  185

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             II RAAFG   + +++FI   + I  L G FD  D FPS K LHPL G K+ + K H + 
Sbjct  186   IIARAAFGRKLENQDEFIATLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQI  245

Query  863   DSIIESIINDHRNKLESGTG---EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             D I+ES++ +H+   +       ++ ++DVLL++ +SG+L+VPIT D IKA+I++ F AG
Sbjct  246   DKILESVLQEHKAARKLAINREDKEDLVDVLLRVQESGDLEVPITTDTIKAVILETFIAG  305

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             ++TS+T   WAM+E+MKNP+V+ +AQAEVR+ FKGK M+ E +V+QL YL+ V+KETLR 
Sbjct  306   TDTSSTALEWAMAELMKNPQVMEQAQAEVRQAFKGKSMITEFEVQQLDYLRLVIKETLRL  365

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             H P PL+  R  R+   + GGY I   T++MVNA+A+  DP+YWE  E F PER  ++ +
Sbjct  366   HAPVPLLVPRVARQRCEL-GGYEIQANTRLMVNAWAICRDPKYWENAECFEPERHRNSTL  424

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G++F+++PFGAGRR CPG+ FG +N   PLA LL +FDWKLP G+    LDMTE  G
Sbjct  425   DFKGNNFEFIPFGAGRRACPGILFGISNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFG  484

Query  152   LAVARKND  129
               V +K +
Sbjct  485   ETVRKKTN  492



>ref|XP_009345818.1| PREDICTED: cytochrome P450 71D9-like [Pyrus x bretschneideri]
Length=508

 Score =   456 bits (1174),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 238/491 (48%), Positives = 328/491 (67%), Gaps = 15/491 (3%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGK-------MPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             SF +  +FL+ +    K  R G        +PPGP KLP IGNL  + G  LPH  LRDL
Sbjct  7     SFPIMFAFLLFIIMVLKIGRSGNTNNYASNLPPGPWKLPFIGNLHQLIG-CLPHHGLRDL  65

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A KYG LM L++GE+S +VVSS + AKE ++THD+ FA+R + LA  IL Y +++I   P
Sbjct  66    AEKYGPLMHLRLGEVSTIVVSSAEFAKEVMKTHDVIFASRPQILATRILSYGSTNIAFAP  125

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             YGDYWRQ+RKIC  ELL+ + V+S+  +R +E+ +L+  +   +G   N+++ I+  T S
Sbjct  126   YGDYWRQLRKICTLELLSTKRVQSYRPVREEEVLKLIKSIALQSGSAVNLTQEIYSLTYS  185

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             I  RAA G+     E+FI   ++   + G F  AD++PS   LH + G + ++ + H++ 
Sbjct  186   ITSRAASGKKTRDHEKFIFVAEEAGKVAGGFALADLYPSVSLLHLVSGIRPKLERLHKQA  245

Query  863   DSIIESIINDHRNKLES-----GTGEDCIIDVLLKLMDSGN-LQVPITHDNIKAIIIDMF  702
             D I+E+IIN+H+  LE+     G   + ++ VLLK  + G  L+  +T +NIKA+I D+F
Sbjct  246   DRIMENIINEHQKDLETTKNVEGESVEDLVHVLLKFHEHGGALEFSLTTNNIKAVIFDVF  305

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
              AGSE S TT  WA+SEMMKNPRV+ KAQ EVREVF  K   +E+ + ++ YL TV+KET
Sbjct  306   SAGSERSATTVDWAISEMMKNPRVMKKAQREVREVFNRKGKADETSIGEMKYLNTVIKET  365

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HP  PL+  REC E+  I GGY IP K+KV+VNA+A+  DP+YW EPERF PERF D
Sbjct  366   LRLHPSVPLLLPRECGEKCEI-GGYGIPGKSKVIVNAWAIGRDPKYWTEPERFKPERFLD  424

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             + +D+ G++F+Y+PFGAGRRICPG+ +G AN   PLA LLY+FDWKLP+G   E LDMTE
Sbjct  425   SSIDYKGTNFEYIPFGAGRRICPGILYGLANVELPLALLLYHFDWKLPDGTKHEDLDMTE  484

Query  161   MLGLAVARKND  129
               G+AV RK D
Sbjct  485   TFGIAVRRKQD  495



>gb|AIA09035.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   456 bits (1172),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 228/480 (48%), Positives = 333/480 (69%), Gaps = 7/480 (1%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGK-MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             L +  +  S L +++    + +  K + P P +LPIIG++ H+ G  +PHR + DL+RKY
Sbjct  3     LTTSIVVASILFILFKLATRPKSNKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLSRKY  61

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GE+S +VVSSP  AKE L T+D+  A R ETL G I+ Y+N+DIVL PYG+Y
Sbjct  62    GSLMHLQLGEVSTIVVSSPKWAKEILTTYDITLANRPETLTGEIIAYHNTDIVLAPYGEY  121

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIIC  1035
             WRQ+RK+C  ELL+ + V+SF S+R +E   L+ +V++S +GRP ++SE IF   ++I+ 
Sbjct  122   WRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQEVKASGSGRPVDLSENIFKMIATILS  181

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAAFG+    +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D++
Sbjct  182   RAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNL  241

Query  854   IESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTT  675
             I +I+ +H     S + E  ++DVLL+L DS   + P+T DN+KA+I+DMFGAG++TS+ 
Sbjct  242   INNIVAEHPGNTSSKSNE-TLLDVLLRLKDSP--EFPLTADNVKAVILDMFGAGTDTSSA  298

Query  674   TSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPL  495
             T  WA+SE+++ PR + K QAE+R+  KGK+ ++E D++ L YL  V+KETLR HPP PL
Sbjct  299   TVEWAISELIRCPRAMEKVQAELRQALKGKDKIKEEDIQDLSYLDLVIKETLRLHPPLPL  358

Query  494   IATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSH  315
             +  RECR+   +  GY I  KTK++VN +A+  DP+YW++ E FIPERFE++  +  G+ 
Sbjct  359   VMPRECRQPVNL-AGYNIADKTKLIVNVFAINRDPEYWKDAESFIPERFENSPTNVMGAE  417

Query  314   FQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             ++Y+PFGAGRR+CPG A G AN + PLA +LY+F+WKLP G + E LDMTE  G  V RK
Sbjct  418   YEYLPFGAGRRMCPGAALGLANVLLPLATILYHFNWKLPNGASHEQLDMTESFGATVQRK  477



>gb|AIA09036.1| germacrene A oxidase [Cynara cardunculus var. altilis]
 gb|AIA09037.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   456 bits (1172),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 228/480 (48%), Positives = 334/480 (70%), Gaps = 7/480 (1%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGK-MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             L +  +  S L +++    + +  K + P P +LPIIG++ H+ G  +PHR + DL+RKY
Sbjct  3     LTTSIVVASILFILFKLATRPKSNKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLSRKY  61

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+GE+S +VVSSP  AKE L T+D+  A R ETL G I+ Y+N+DIVL PYG+Y
Sbjct  62    GSLMHLQLGEVSTIVVSSPKWAKEILTTYDITLANRPETLTGEIIAYHNTDIVLAPYGEY  121

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIIC  1035
             WRQ+RK+C  ELL+ + V+SF S+R +E   L+ +V++S +GRP ++SE IF   ++I+ 
Sbjct  122   WRQLRKLCTLELLSVKKVKSFQSLREEECWDLVQEVKASGSGRPVDLSENIFKMIATILS  181

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAAFG+    +++F +  K+I   TG FD AD+FPS K LH L G ++ +   H+K D++
Sbjct  182   RAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNL  241

Query  854   IESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTT  675
             I +I+++H     S + E  ++DVLL+L DS   + P+T DN+KA+I+DMFGAG++TS+ 
Sbjct  242   INNIVSEHPGNTSSKSNE-TLLDVLLRLKDSP--EFPLTADNVKAVILDMFGAGTDTSSA  298

Query  674   TSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPL  495
             T  WA+SE+++ PR + K QAE+R+  KGK+ ++E D++ L YL  V+KETLR HPP PL
Sbjct  299   TVEWAISELIRCPRAMEKVQAELRQALKGKDKIKEEDIQDLSYLDLVIKETLRLHPPLPL  358

Query  494   IATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSH  315
             +  RECR+   +  GY I  KTK++VN +A+  DP+YW++ E FIPERFE++  +  G+ 
Sbjct  359   VMPRECRQPVNL-AGYNIADKTKLIVNVFAINRDPEYWKDAESFIPERFENSPTNVMGAE  417

Query  314   FQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             ++Y+PFGAGRR+CPG A G AN + PLA +LY+F+WKLP G + E LDMTE  G  V RK
Sbjct  418   YEYLPFGAGRRMCPGAALGLANVLLPLATILYHFNWKLPNGASHEQLDMTESFGATVQRK  477



>ref|XP_007033124.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY04050.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   456 bits (1173),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 239/467 (51%), Positives = 326/467 (70%), Gaps = 8/467 (2%)
 Frame = -2

Query  1511  KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPD  1332
             K    K+PPGPRKLP+IGN+  + G  LPH  LRDLA+K+G LM LQ+G++  +V+SSP 
Sbjct  31    KNPEAKLPPGPRKLPLIGNMHQLIG-SLPHHTLRDLAKKHGPLMHLQLGDVPTIVISSPA  89

Query  1331  MAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRS  1152
             +AKE L+ H   FA R   LA  I+ Y++++IV  PYG+YWRQ+RKI   ELL+P  V+S
Sbjct  90    IAKEVLKDHATIFAQRPYLLASKIMSYDSTNIVFSPYGNYWRQLRKISTMELLSPSRVQS  149

Query  1151  FSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDI  972
             F  IR +E+  L+  +    G P N+SE+IF  T  I  RAAFG+   G+E+FI+   + 
Sbjct  150   FRFIREEEVSALIKTISLIEGSPVNLSEKIFSMTYGITSRAAFGKKSKGQEEFIRIMTEA  209

Query  971   SVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLE--SGTG--  804
               L+G F  AD++PS K L  + G + ++ K  R +D I+E I+N+H+ K    S TG  
Sbjct  210   IKLSGGFCLADLYPSNKLLKLISGVRLKLEKLQRASDRILEDIVNEHKEKTNRTSETGNQ  269

Query  803   --EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
               ED ++DVLLKL  S +L++P+T+D IKAII+D+ GAGSETS+TT  WAMSEM++NPRV
Sbjct  270   QEEDDLLDVLLKLQQSSDLEIPLTNDKIKAIILDILGAGSETSSTTMEWAMSEMLRNPRV  329

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
             + +AQAEVR+VF  K  L+E+ + +L +L+++VKETLR HP  PL+  REC E  VI+ G
Sbjct  330   MKQAQAEVRQVFDRKGNLDEAGIHELKFLRSIVKETLRLHPAAPLLVPRECDENCVIS-G  388

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             Y I  K+KV+VNA+A+  D +YW++ E+F PERF D+ +DF G+HF+Y+PFGAGRRICPG
Sbjct  389   YDILAKSKVIVNAWAIGRDSRYWKDAEKFNPERFLDSPIDFRGTHFEYIPFGAGRRICPG  448

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++F   N   PLA LLY+FDWKLP G   E LDMTE  G+ V RKND
Sbjct  449   ISFALPNIELPLAQLLYHFDWKLPNGSNCEDLDMTECFGITVRRKND  495



>ref|XP_003615865.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98823.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   455 bits (1170),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 222/477 (47%), Positives = 324/477 (68%), Gaps = 3/477 (1%)
 Frame = -2

Query  1553  LFVSFLVLVYTQWKKQRRG-KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMS  1377
             LF+  L+ +  +W        +PPGP  LPIIGN+  +    LPH+  ++LA  YG LM 
Sbjct  17    LFLFVLLKIVKKWSCNNSSINLPPGPWTLPIIGNMHQLISNSLPHQCFKNLADTYGPLMH  76

Query  1376  LQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMR  1197
             L++GE+S ++VSSP MAKE ++THDL F  R   L  +I  YN  DI+  PYG++WRQ+R
Sbjct  77    LKLGEVSYLIVSSPSMAKEIMKTHDLNFCDRPNLLLSTIFSYNAIDIIFSPYGEHWRQLR  136

Query  1196  KICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGE  1017
             KIC+ +LL+ + V+SF  IR +E+  L+  + +S G   N+S +IFL TS I  RAAFG+
Sbjct  137   KICVLQLLSAKRVQSFRYIREEEVSNLVKSISASEGSIVNLSHKIFLMTSGITTRAAFGK  196

Query  1016  VFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIIN  837
                 +E F    K+I+ L G F  AD++PS K    +   K+++ K H++ D I++ II 
Sbjct  197   RSKHQEAFKSAIKEIASLLGEFCIADVYPSVKMFQWVSRAKTKVEKLHKEIDMILQDIIV  256

Query  836   DHRNKLESGTGEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWA  660
             DH+N  +  + ++ ++D LLK+  ++ +   P+T +N+KAII+DMFGAG+ETS+   +W 
Sbjct  257   DHKNIHKEESKDEDLVDTLLKIQQENDHSHNPLTDNNMKAIILDMFGAGTETSSGAVLWG  316

Query  659   MSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRE  480
             +SEM+KNP+++ KAQAEVR+VF  K  ++E+++ QL YLK++++ETLR HP  PL+  RE
Sbjct  317   ISEMVKNPKIMEKAQAEVRKVFDKKGYVDETELHQLIYLKSIIRETLRLHPSVPLLVPRE  376

Query  479   CREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVP  300
              RE   IN GY IP KT+V +N +A+  D +YW E E F PERF ++ +DF G++F+Y+P
Sbjct  377   SRERCQIN-GYEIPAKTRVAINVWAIGRDERYWAEAESFKPERFLNSTIDFKGTNFEYIP  435

Query  299   FGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             FGAGRR+CPG+AFG +N   PLA LLY+FDWKLP G+  E LDMTE  G+A+ RK+D
Sbjct  436   FGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELDMTESFGMAIGRKHD  492



>ref|XP_010644548.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   455 bits (1170),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 240/491 (49%), Positives = 328/491 (67%), Gaps = 18/491 (4%)
 Frame = -2

Query  1559  FALFVSFLVLVY--TQWKKQRRG-----KMPPGPRKLPIIGNLLHITGPVLPHRALRDLA  1401
             F +  +FL+ +Y   +  K  R      K+PPGP KLPIIGN+  + G  LPHR+LR LA
Sbjct  8     FPILCTFLLFIYLLKRLGKPSRTNHPAPKLPPGPWKLPIIGNMHQLVGS-LPHRSLRSLA  66

Query  1400  RKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPY  1221
             +K+G LM LQ+GE+SA+VVSS +MAKE ++THD+ F+ R   LA SI+ Y+ +DI   PY
Sbjct  67    KKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIVSYDCTDIAFAPY  126

Query  1220  GDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSI  1041
             G YWRQ+RKI + ELL+ + V+SF S+R +E+  L+  V    G   N+++ IF  T SI
Sbjct  127   GGYWRQIRKISVLELLSAKRVQSFRSVREEEVLNLVRSVSLQEGVLINLTKSIFSLTFSI  186

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
             I R AFG+    +E F       +   G F  AD+FPS K LH + G + ++ K H+K D
Sbjct  187   ISRTAFGKKCKDQEAFSVTLDKFADSAGGFTIADVFPSIKLLHVVSGMRRKLEKVHKKLD  246

Query  860   SIIESIINDHRNKLESGTGEDCIID-------VLLKLMDSGNLQVPITHDNIKAIIIDMF  702
              I+ +IIN+H+ +  S   E C  +       VLLK+   G+L+ P+T DNIKA+++D+F
Sbjct  247   RILGNIINEHKAR--SAAKETCEAEVDDDLVDVLLKVQKQGDLEFPLTMDNIKAVLLDLF  304

Query  701   GAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKET  522
              AG+ETS+T   WAM+EM+KNPRV+AKAQAEVR++F  K   +E+ V +L +LK V+KET
Sbjct  305   VAGTETSSTAVEWAMAEMLKNPRVMAKAQAEVRDIFSRKGNADETVVRELKFLKLVIKET  364

Query  521   LRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED  342
             LR HPP PL+  RE RE   IN GY IPVKT+V++NA+A+A DP+YW + E F PERF D
Sbjct  365   LRLHPPVPLLIPRESRERCAIN-GYEIPVKTRVIINAWAIARDPKYWTDAESFNPERFLD  423

Query  341   NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTE  162
             + +D+ G++F+Y+PFGAGRR+CPG+ FG AN    LA LLY+FDWKLP G   E LDMTE
Sbjct  424   SSIDYQGTNFEYIPFGAGRRMCPGILFGMANVELALAQLLYHFDWKLPNGARHEELDMTE  483

Query  161   MLGLAVARKND  129
                 +  RK D
Sbjct  484   GFRTSTKRKQD  494



>ref|XP_006345633.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   454 bits (1168),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 228/457 (50%), Positives = 316/457 (69%), Gaps = 6/457 (1%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+ PGP KLPIIGNLL +    LPH +L +LA K+G LM L++G++SA+V+SSP +AKE 
Sbjct  36    KLAPGPWKLPIIGNLLQMGS--LPHISLANLATKHGPLMHLKLGQLSAIVISSPQLAKEM  93

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             ++THDL FA R +     I+ Y+  DI   PYGDYW+Q+RKIC+ ELL+ + + SF  + 
Sbjct  94    MKTHDLTFANRPQLSVAKIMFYDCQDIAFSPYGDYWKQIRKICVMELLSTKNITSFFPMM  153

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE + L+  +++ + RP N+SE+++L TS+IICRA+ G     +E  I   K ++   G
Sbjct  154   VDETYLLVNSIKAMSERPINISEKMYLLTSAIICRASIGRTCKDQESVIMLMKQVASFAG  213

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK--LESGTGEDCIIDV  783
              F+  D+FPS K LH + G   ++L+ HRK D ++E IIN+H  +       GED ++DV
Sbjct  214   VFNVVDLFPSLKILHFISGTNRKLLQLHRKVDPVLERIINEHETEQLATEHVGED-LVDV  272

Query  782   LLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVR  603
             LL+L ++   Q+PIT +NIKAII+DMF AGS TS+T   WAMSE++KNP ++ KAQAEVR
Sbjct  273   LLRLQNNNEFQIPITRNNIKAIILDMFVAGSATSSTVLEWAMSELLKNPSMMEKAQAEVR  332

Query  602   EVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKV  423
             E F GK  ++++D+++L YLK V+KETLR HPP PL   RE R++  IN GYTIP KT  
Sbjct  333   EAFNGKTTIDQTDLKKLKYLKMVIKETLRFHPPGPLSIPRESRQQCHIN-GYTIPNKTIG  391

Query  422   MVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTI  243
             +VN +AL  D +YWEE E+F PERF +N +D +G+HFQ++PFGAGRRICPG+ F  A+  
Sbjct  392   IVNMWALGRDSEYWEEAEKFEPERFNENPLDVSGNHFQFIPFGAGRRICPGINFSMASME  451

Query  242   SPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
               LA LL +FDWKL  GV+ + LDMT   G   +RKN
Sbjct  452   LCLAQLLCHFDWKLVNGVSPQQLDMTVNFGNVASRKN  488



>ref|XP_006452556.1| hypothetical protein CICLE_v10008047mg [Citrus clementina]
 ref|XP_006474920.1| PREDICTED: cytochrome P450 71D11-like isoform X1 [Citrus sinensis]
 gb|ESR65796.1| hypothetical protein CICLE_v10008047mg [Citrus clementina]
Length=510

 Score =   454 bits (1168),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 232/460 (50%), Positives = 316/460 (69%), Gaps = 9/460 (2%)
 Frame = -2

Query  1490  PPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLR  1311
             PPGP KLP+IGNL  + G  LPH  LRDL++KYG LM LQ+GE+  ++VSSP++AKE ++
Sbjct  40    PPGPWKLPVIGNLYQLAGS-LPHHGLRDLSKKYGPLMLLQLGEVPTIIVSSPEVAKEVMK  98

Query  1310  THDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHD  1131
             THD+ FA+R    A  IL YN  DI+   YGD W+Q+RKIC++ELL+ + V+SF SIR  
Sbjct  99    THDVVFASRPHFPAAQILSYNYRDIIFSSYGDSWKQLRKICVSELLSAKRVQSFQSIREA  158

Query  1130  EIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSF  951
             E+  L+  + S AG   N+++ +      I  RAAFG     +E F+   ++ + +   F
Sbjct  159   EVSDLINWISSKAGSVINLTQNVHSLMYGITSRAAFGNRSRDQEAFVAVIEETTKVISGF  218

Query  950   DFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK------LESGTGEDCII  789
             + AD+FPS   L  L GNKS++   H++   I+E+IIN+H+ +       ++G  ED ++
Sbjct  219   NIADVFPSIGLLQWLTGNKSQVETLHQEGVRIVENIINEHKKRKATLKNCKTGDDED-LV  277

Query  788   DVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAE  609
             DVLLK+   G+L   +T D+IKA+I D+F AGSETS TT  WAM EMMKNPRV+ KAQAE
Sbjct  278   DVLLKIQGHGDLDSFLTTDHIKAVISDIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAE  337

Query  608   VREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKT  429
             VREVF     + E+ ++++ +LK VVKETLR HP  PL+  REC +   IN G+ IPVK 
Sbjct  338   VREVFHRTGKVNETSIDEMKFLKLVVKETLRLHPAAPLLIPRECGQRCQIN-GFDIPVKA  396

Query  428   KVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFAN  249
             +V+VNA+A+  DP+YW EPE FIPERF D+ VD+ G++F+Y+PFGAGRRICPG++FG A+
Sbjct  397   RVIVNAWAIGRDPEYWTEPESFIPERFLDHSVDYKGTNFEYIPFGAGRRICPGMSFGLAS  456

Query  248   TISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
                PLA LLY+FDWKLP G+  E LDMTE  G+ V RK D
Sbjct  457   VELPLAMLLYHFDWKLPNGIKHEDLDMTEAFGVTVRRKQD  496



>gb|KDP29297.1| hypothetical protein JCGZ_19400 [Jatropha curcas]
Length=546

 Score =   455 bits (1170),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 234/462 (51%), Positives = 327/462 (71%), Gaps = 9/462 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             ++PPGP KLP+IGNL ++ G   PH AL +LA++YG LM LQ+GEISA+VVS+P +A+  
Sbjct  61    RLPPGPIKLPLIGNLHNLAG-AQPHHALTELAKEYGPLMHLQLGEISAIVVSNPRIAQVI  119

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             ++THDL FA R E LA  I+ Y   DI     G+YW+QM++I + ELL P+ V+SF+S+R
Sbjct  120   MKTHDLVFADRPEILAAKIITYGGQDIAFSKLGEYWKQMKRISLMELLGPKTVQSFASLR  179

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              +E+ +L+  +  S G+P N +E+IF  T+ I C+AAFG+    ++  I  TK+ + + G
Sbjct  180   ENEVEKLIQSIHLSKGKPINFTEKIFHLTNVITCKAAFGDECKDQDVVIALTKEATTIAG  239

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGEDCI-----  792
              F  AD+FPS + L  + G K ++ K   +   +  +II++H+ KL +  G D +     
Sbjct  240   GFGIADVFPSMEFLQAITGVKGKLEKLRDELGDVFGNIIDEHKQKLMNRDGSDDVESEKE  299

Query  791   --IDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKA  618
               +DVLLKL  SG  Q P+T++++KA+++D+F AG++TS+TT  WAMSEMMKNPR+L KA
Sbjct  300   DLVDVLLKLQGSGRFQCPVTNNSLKAVVLDLFTAGTDTSSTTVEWAMSEMMKNPRILKKA  359

Query  617   QAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIP  438
             Q EVRE FKGK+++ E DV+QL YL  V+KETLR HPP PL+  RE RE   I+ GY IP
Sbjct  360   QEEVREAFKGKKIICEEDVKQLKYLPLVIKETLRLHPPAPLLLPRESREACEID-GYEIP  418

Query  437   VKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFG  258
             +++KV+VNAYA+  DP+ W EP+ F PERF ++ VDF G +F+++PFGAGRRICPG+AFG
Sbjct  419   MRSKVIVNAYAIGRDPEAWPEPDNFKPERFINSSVDFKGMNFEFIPFGAGRRICPGIAFG  478

Query  257   FANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
              AN   PLA +LY+FDWKLPEG+T+E LDMTE  G  V RKN
Sbjct  479   LANIELPLARILYHFDWKLPEGITSENLDMTEAFGATVGRKN  520



>sp|D5JBX0.1|GAO_HELAN RecName: Full=Germacrene A oxidase; Short=HaGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Helianthus annuus]
 gb|ADF43082.1| germacrene A oxidase [Helianthus annuus]
Length=488

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/480 (48%), Positives = 329/480 (69%), Gaps = 8/480 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             I+ A  V FL  + T+     + ++P  P +LPIIG++ H+ G  +PHR + DLARKYG 
Sbjct  9     IALATIVFFLYKLLTR-PTSSKNRLPE-PWRLPIIGHMHHLIG-TMPHRGVMDLARKYGS  65

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GE+SA+VVSSP  AKE L T+D+ FA R ETL G I+ Y+N+DIVL PYG+YWR
Sbjct  66    LMHLQLGEVSAIVVSSPKWAKEILTTYDIPFANRPETLTGEIIAYHNTDIVLAPYGEYWR  125

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRA  1029
             Q+RK+C  ELL+ + V+SF S+R +E   L+ ++++S +G PFN+SE IF   ++++ RA
Sbjct  126   QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGTPFNLSEGIFKVIATVLSRA  185

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG+    ++QF +  K+I   TG FD AD+FPS K LH L G +  +   H K DS+I 
Sbjct  186   AFGKGIKDQKQFTEIVKEILRETGGFDVADIFPSKKFLHHLSGKRGRLTSIHNKLDSLIN  245

Query  848   SIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTS  669
             +++ +H     S   E  ++DVLL+L +S   + P+T DN+KAII+DMFGAG++TS+ T 
Sbjct  246   NLVAEHTVSKSSKVNE-TLLDVLLRLKNSE--EFPLTADNVKAIILDMFGAGTDTSSATV  302

Query  668   MWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIA  489
              WA+SE+++ PR + K QAE+R+   GKE ++E +++ LPYL  V++ETLR HPP PL+ 
Sbjct  303   EWAISELIRCPRAMEKVQAELRQALNGKERIKEEEIQDLPYLNLVIRETLRLHPPLPLVM  362

Query  488   TRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQ  309
              RECR+   +  GY +  KTK++VN +A+  DP+YW++ E F PERFE++     G+ ++
Sbjct  363   PRECRQAMNL-AGYDVANKTKLIVNVFAINRDPEYWKDAESFNPERFENSNTTIMGADYE  421

Query  308   YVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             Y+PFGAGRR+CPG A G AN   PLA++LY F WKLP G + + LDMTE  G  V RK +
Sbjct  422   YLPFGAGRRMCPGSALGLANVQLPLANILYYFKWKLPNGASHDQLDMTESFGATVQRKTE  481



>ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39613.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 326/482 (68%), Gaps = 10/482 (2%)
 Frame = -2

Query  1550  FVSFLVLVYTQWKKQRRGK----MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGL  1383
             F+ F+ +V+  WKK +       +PPGP KLP+IG++ H+ G   PH  L+DLA+KYG L
Sbjct  14    FLLFIFMVFRIWKKSKTNHPAPHLPPGPWKLPLIGSMHHLVGS-QPHHRLKDLAKKYGPL  72

Query  1382  MSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQ  1203
             M LQ+GE++ +V+SSP++AKE ++THD+ FA R   LA S+  YN +DI   PYGDYWRQ
Sbjct  73    MHLQLGELTNIVISSPEIAKEVMKTHDVVFAQRPHLLAASVTSYNYTDIAFAPYGDYWRQ  132

Query  1202  MRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAF  1023
             MRK+C  ELL  + V+SF SIR +E+ RL+  + SSAG P N S      T SII RA+F
Sbjct  133   MRKLCTLELLTAKRVQSFRSIREEEVSRLMRSLSSSAGSPINFSRMFNSLTYSIISRASF  192

Query  1022  GEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESI  843
             G+++ G E FI   K + V  G F  AD++PS K LH + G    + + H   D+I ++I
Sbjct  193   GKIWKGEEIFIPIVKKLIVAAGGFTLADVYPSVKLLHWISGMAPRLKRIHHIVDNIFQNI  252

Query  842   INDHRNKLESGT----GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTT  675
             I+DHR K  +      GE  ++DVLL      +L VPIT+DNIK II+D F AGSETS+T
Sbjct  253   IDDHRTKRAAANSSVEGEGDLVDVLLNFQAQEDLAVPITNDNIKGIILDTFVAGSETSST  312

Query  674   TSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPL  495
             T+ WAMSE++KNPRV+ KAQ EVR VF  +  + E  + +L YLK V+ ETLR HPP PL
Sbjct  313   TAEWAMSELLKNPRVMEKAQEEVRRVFGEEGNVHEGRLHELNYLKWVINETLRLHPPIPL  372

Query  494   IATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSH  315
             +  RECRE  VIN GY IPVK+KV+VN +A+  DP  W + E+F PERF+D  +D+ G+H
Sbjct  373   LLPRECRESCVIN-GYDIPVKSKVIVNVWAIGRDPNCWMDAEKFYPERFQDCPIDYKGTH  431

Query  314   FQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARK  135
             F+++PFGAGRR+CPG+ FG  N   PLA LLY+FDWKLP GV  ET DMTE  G  V RK
Sbjct  432   FEFLPFGAGRRMCPGILFGIINVEFPLAQLLYHFDWKLPTGVKPETFDMTEDFGAVVKRK  491

Query  134   ND  129
             +D
Sbjct  492   SD  493



>ref|XP_006493509.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
Length=509

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/467 (49%), Positives = 313/467 (67%), Gaps = 9/467 (2%)
 Frame = -2

Query  1511  KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPD  1332
             K R   +PPGP KLP+IGNL  + G  LPH  LRDL +KYG LM LQ+G++ A++VSSP+
Sbjct  32    KNRVSNLPPGPWKLPVIGNLHQLAG-FLPHHRLRDLTKKYGPLMLLQLGQVPAIIVSSPE  90

Query  1331  MAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRS  1152
             +AKE ++THD+ FA+R       I+ YN  DI+  PYGD W+Q+RKIC++ELL+ + V+S
Sbjct  91    VAKEVMKTHDVIFASRPHFPPAQIISYNYRDIIFSPYGDSWKQLRKICVSELLSAKRVQS  150

Query  1151  FSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDI  972
             F SIR  E+  L+  + S AG   N++E+++     I  RAAFG      E F     +I
Sbjct  151   FQSIREAEVSDLIDWISSKAGSVINLTEKVYSLMYGITSRAAFGNRSRDEEAFASVIAEI  210

Query  971   SVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES------G  810
             + +   F+ ADMFPS   L  L GNKS + + H++ D I+++IIN+H+ +  +      G
Sbjct  211   TKVMSGFNIADMFPSVGFLQWLTGNKSRVERLHQEADRIVKNIINEHKKRKATLKISKIG  270

Query  809   TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRV  630
               ED ++DVLLK+   G+L   +T D+IKA+I D+F AGSETS TT  WAM EMM+NPRV
Sbjct  271   DDED-LVDVLLKIQGRGDLDSFLTTDHIKAVIFDIFAAGSETSATTVDWAMCEMMRNPRV  329

Query  629   LAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGG  450
             + KAQAEVREVF     + E+ ++++ + K  VKETLR HP  PL+  REC E   IN G
Sbjct  330   MKKAQAEVREVFHRTGKVNETSIDEMKFFKLFVKETLRLHPVAPLLLPRECGERCQIN-G  388

Query  449   YTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPG  270
             + IPVK KV VNA+A+  DP+YW EP  FIPERF D+ +D+ G++F+++PFGAGRRICPG
Sbjct  389   FDIPVKAKVFVNAWAIGRDPKYWTEPASFIPERFLDHSIDYKGTNFEFIPFGAGRRICPG  448

Query  269   LAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             ++FG A+   PLA LLY+FDWKLP G+  E LDMTE     V RK D
Sbjct  449   MSFGLASVELPLAMLLYHFDWKLPNGMKHEDLDMTEAFATTVRRKQD  495



>gb|ABO32531.1| cytochrome P450-dependent monooxygenase-like protein [Ammi majus]
Length=514

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 236/487 (48%), Positives = 328/487 (67%), Gaps = 11/487 (2%)
 Frame = -2

Query  1562  SFALFVSFLVL-VYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGG  1386
             S  L ++FL+  +  + K+Q +  +PPG  KLP+ GNL  + G + PHR LR LA K+G 
Sbjct  11    SSLLVITFLLFHIVKKSKQQSKSNLPPGLWKLPVFGNLFQVAGKI-PHRGLRKLADKFGP  69

Query  1385  LMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWR  1206
             LM LQ+GEISA+V+S P +AKE LRTHDLAFA R   L G+I+L N  DIVL  YGDYWR
Sbjct  70    LMHLQLGEISAIVISDPRVAKEVLRTHDLAFADRPVVLLGNIILANCRDIVLALYGDYWR  129

Query  1205  QMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPF-NVSERIFLFTSSIICRA  1029
             QMRKIC  ELL+   VRSF SIR DE  +L+  ++ S+G    +VS ++    +++ CRA
Sbjct  130   QMRKICTLELLSANKVRSFRSIREDETWKLIQSIKLSSGSSLVDVSHKVSALANAVTCRA  189

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
               G+    +++ I+  ++I+ L   F  AD+FPS   L  L G K  + K  +K D I +
Sbjct  190   TIGQACKYQDELIELVEEIAYLGSGFFLADLFPSIFFLPTLSGMKPALKKIRKKLDVIFD  249

Query  848   SIINDHRNKL-------ESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             +II +H +KL       E    E+ ++DVLL++ DS  L+ PI+  +I+ +++DM  AG+
Sbjct  250   NIIKEHNDKLSRRKKGSEIDAEEEDLVDVLLRINDSQRLEFPISSGDIQGLVLDMLTAGT  309

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             +TS+    WAMSE+M+NP+V+ K Q+EVREV KGKE +EE+D++ + YLK VVKETLR H
Sbjct  310   DTSSAVLEWAMSELMRNPKVMKKVQSEVREVVKGKEKIEEADIQNMSYLKLVVKETLRLH  369

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
              P PL+  RECR+E  IN GYTIPV TKVMVN +A+A DP+ W++ E FIPERFE++ VD
Sbjct  370   APVPLLLPRECRKECEIN-GYTIPVGTKVMVNVWAIARDPECWDDAESFIPERFENSSVD  428

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             + G++F+++PFGAGRR+C G++FG A    PLA LL++FDWKLP  +  E LDM E    
Sbjct  429   YIGANFEFLPFGAGRRMCAGISFGIATVELPLAQLLHSFDWKLPNEMKPEDLDMDETNAA  488

Query  149   AVARKND  129
                RKN+
Sbjct  489   TCKRKNN  495



>sp|Q9XHE6.1|C71DF_MENPI RecName: Full=Cytochrome P450 71D15; AltName: Full=(-)-(4S)-Limonene-3-hydroxylase; 
AltName: Full=Cytochrome P450 isoform 
PM2 [Mentha x piperita]
 gb|AAD44152.1| cytochrome p450 isoform PM2 [Mentha x piperita]
 gb|ABW86882.1| limonene hydroxylase [Mentha x piperita]
Length=498

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/477 (49%), Positives = 327/477 (69%), Gaps = 5/477 (1%)
 Frame = -2

Query  1553  LFVSFLV-LVYTQWKKQR-RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLM  1380
             L V++ + L+  QW+K + +GK PPGP KLP+IG+L H+    LP  AL  +A++YG + 
Sbjct  13    LVVTYTISLLINQWRKPKPQGKFPPGPPKLPLIGHL-HLLWGKLPQHALASVAKEYGPVA  71

Query  1379  SLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQM  1200
              +Q+GE+ +VV+SS +  KE ++  D A A R E++   I+ Y+N DI+  PY ++WRQM
Sbjct  72    HVQLGEVFSVVLSSREATKEAMKLVDPACANRFESIGTRIMWYDNEDIIFSPYSEHWRQM  131

Query  1199  RKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFG  1020
             RKIC++ELL+ R VRSF  IR DE+ RLL  +RSSAG   +++ERI   T SIICRAAFG
Sbjct  132   RKICVSELLSSRNVRSFGFIRQDEVSRLLRHLRSSAGAAVDMTERIETLTCSIICRAAFG  191

Query  1019  EVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESII  840
              V     + +   KD   +   F+ ADMFPS K L+ L  NKS++ +  R+ D+I+E+I+
Sbjct  192   SVIRDNAELVGLVKDALSMASGFELADMFPSSKLLNLLCWNKSKLWRMRRRVDTILEAIV  251

Query  839   NDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWA  660
             ++H+ K     G + IIDVL ++     ++VPIT ++IKA I D F AG+ETS+TT++W 
Sbjct  252   DEHKFKKSGEFGGEDIIDVLFRMQKDTQIKVPITTNSIKAFIFDTFSAGTETSSTTTLWV  311

Query  659   MSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRE  480
             ++E+M+NP V+AKAQAEVR   K K   +  DV++L Y+K+VVKET+R HPP PLI  R 
Sbjct  312   LAELMRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIP-RS  370

Query  479   CREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVP  300
             CREE V+N GYTIP K ++M+N +++  +P YWE+P+ F PERF+    DF G+ F++VP
Sbjct  371   CREECVVN-GYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSKDFMGNDFEFVP  429

Query  299   FGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             FGAGRRICPGL FG AN   PLA LLY+FDWKL EG+    +DM+E  GL    KN+
Sbjct  430   FGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGILKNN  486



>gb|AED99871.1| cytochrome P450 [Panax notoginseng]
Length=507

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 242/490 (49%), Positives = 328/490 (67%), Gaps = 15/490 (3%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHI--TGPVLPHRALRDLARK  1395
             +IS  +F  FL   +   K+ +   +PPGP KLPIIGNLL +    P+  HR L +LA+K
Sbjct  11    IISLIIFSLFL---FKLLKRSKPXNLPPGPTKLPIIGNLLQLARVDPIX-HRGLLELAQK  66

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM LQ+G+ISA+VVS+P +AKE L+THDL+ A R + L G I+L N+ DIVL PYGD
Sbjct  67    YGPLMHLQLGKISAIVVSTPRVAKEXLKTHDLSCADRPDMLLGRIMLKNSRDIVLAPYGD  126

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWRQMRKI  +ELL+   VRSF +IR +E  +L+  VRSS G P N S ++    +++IC
Sbjct  127   YWRQMRKISTSELLSANKVRSFRNIREEESWQLVESVRSSLGSPVNFSTQVTGMANAVIC  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAA G+    +++ I+  +DI+     F  AD+FPS K L  + G + ++ K  RK D I
Sbjct  187   RAAIGKKCAYQDELIEVVEDIAYWGSGFFMADLFPSLKFLEYVTGMRPKLQKMRRKLDHI  246

Query  854   IESIINDHRNKLES-------GTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
              E+II +H  K+ S          E+ +IDVLL++ +S +L +PIT  +I+ I +DMF A
Sbjct  247   FENIIQEHMEKMASKKEGKVNDNEEEDLIDVLLRIXESQSLDIPITSKDIQGITLDMFTA  306

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G+++++ T  W MSE+M+NP  + KAQAEVREV KGK  + E+DV+ L YLK V+KETLR
Sbjct  307   GTDSTSATLQWMMSELMRNPEAMKKAQAEVREVLKGKTKIYEADVQGLTYLKLVIKETLR  366

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              H P PL+  RECR++  I+ GYTIPV TK+MVNA+A+A DP+ W   E F+PERFE   
Sbjct  367   LHAPVPLLVPRECRKQCEID-GYTIPVGTKIMVNAWAIARDPECWVHAESFMPERFESGS  425

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLP-EGVTAETLDMTEM  159
             VDF G++F+Y+PFGAGRRIC G+AF  A    P+A LLY FDWKLP + +  E LDM E 
Sbjct  426   VDFIGANFEYIPFGAGRRICAGIAFAAATLELPMAQLLYYFDWKLPNDRMKPEDLDMEET  485

Query  158   LGLAVARKND  129
              G    RKN+
Sbjct  486   NGATATRKNN  495



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   453 bits (1166),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 230/477 (48%), Positives = 323/477 (68%), Gaps = 11/477 (2%)
 Frame = -2

Query  1535  VLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEIS  1356
             + + ++ K+ +   +PPGPRKLP+IGNL  + G  LPH  LRD+A +YG +M L+ GE+ 
Sbjct  22    IKLMSESKRGKGSNLPPGPRKLPLIGNLHQLMGS-LPHHTLRDMANEYGPIMHLRFGEVP  80

Query  1355  AVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITEL  1176
              V+VSS + AKE ++THDL FA R + L   I+ YN++ I   PYGD+WRQ+RKIC+ EL
Sbjct  81    TVIVSSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAEL  140

Query  1175  LNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVFDGRE  999
             LN + V+SF SIR +E+  L+  + S+ +G   N+S+ IF  T++II RAAFG   + ++
Sbjct  141   LNVKRVQSFESIRQEEVEDLIKTISSNPSGTTINLSQMIFTLTNNIIARAAFGRKLENQD  200

Query  998   QFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHR---  828
             +FI   + I  L G FD  D FPS K LHPL G K+ + K H + D I+ES++ +H+   
Sbjct  201   EFIGTLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKAAR  260

Query  827   ----NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWA  660
                 N  +    ED ++DVLL++ +S +L VPIT D IKA+I++ F AG++TS+T   WA
Sbjct  261   KVTINHKDKMHKED-LVDVLLRVQESSDLDVPITTDTIKAVILETFIAGTDTSSTALEWA  319

Query  659   MSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRE  480
             M+E+MKNP V+ +AQAEVR+ FKGK M+ ES+V+QL YLK V+KETLR H P PL+  R 
Sbjct  320   MAELMKNPHVMEQAQAEVRKAFKGKSMMTESEVQQLDYLKLVIKETLRLHAPVPLLVPRV  379

Query  479   CREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVP  300
              RE   + GGY I   T++MVNA+A+  DP+YWE  E F PER  ++ +DF G++F+++P
Sbjct  380   ARERCEL-GGYEIQANTRLMVNAWAICRDPKYWENAECFEPERHRNSTLDFKGNNFEFIP  438

Query  299   FGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             FGAGRR CPG+ FG +N   PLA LL +FDWKLP G+    LDMTE  G  V +K +
Sbjct  439   FGAGRRACPGILFGISNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFGETVRKKTN  495



>gb|KDP39285.1| hypothetical protein JCGZ_01042 [Jatropha curcas]
Length=505

 Score =   452 bits (1164),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 223/468 (48%), Positives = 323/468 (69%), Gaps = 7/468 (1%)
 Frame = -2

Query  1517  WKKQR-RGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVS  1341
             W+K + +  +PPGP KLP+IG++ H+ GP L H  + +LARKYG +M LQ+G+++ + +S
Sbjct  26    WRKTKSKPNLPPGPWKLPLIGSMHHLAGPSLLHHRVTELARKYGPIMHLQLGQVTNIFIS  85

Query  1340  SPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRL  1161
             SP++A+E ++THDL FATR   +A  ++ YN +DI   PYGDYWRQ++KIC  ELL  + 
Sbjct  86    SPEIAREVMKTHDLIFATRPSLVAVQLVTYNFTDIAFAPYGDYWRQIKKICTMELLTAKR  145

Query  1160  VRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQT  981
             V+ F+ IR +E+ +++ D+ S+ G   N +  +   T  I+ R+  G++  G E FI+  
Sbjct  146   VQLFAPIRQEEVSKVITDITSNVGSTINFTNVLTSLTYKILSRSTIGKILKGEEGFIRAV  205

Query  980   KDISVLTGSFDFADMFPSWKALHPLFGN-KSEILKTHRKTDSIIESIINDHR-NKLESGT  807
              D++     F+ AD +PS K L  +FG+ K ++ + H++ D +++++I+D R  K ESG 
Sbjct  206   MDLTEEGAGFNLADFYPSIK-LFRMFGSLKHKLKRIHQQVDKMMQNVIDDRRATKRESGV  264

Query  806   G--EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPR  633
                E  I+DVLL++ + G+LQ+P+T DNIKA+I DMF AGS++S  T++W MSE++KNP 
Sbjct  265   DDEERDIVDVLLRIQEQGDLQLPLTDDNIKAVIFDMFSAGSDSSAATTIWTMSELLKNPS  324

Query  632   VLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVING  453
             V+ KAQAEVR+VFK K  ++E  +E+L YLK  VKETLR H P PL+  REC E  VI  
Sbjct  325   VMEKAQAEVRQVFKKKGQVDEEGMEELHYLKAAVKETLRLHAPGPLVVPRECTENCVI-A  383

Query  452   GYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICP  273
             GY IP K+++ VN++AL  DP+YW EPER+ PERF D  +D  G++F Y+PFG+GRR+CP
Sbjct  384   GYDIPAKSRINVNSWALGRDPEYWTEPERYSPERFLDGSIDHKGNNFTYLPFGSGRRLCP  443

Query  272   GLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             G+ FG  N    LA+LLY FDWKLP G+  E LDMTE+ G A  RKND
Sbjct  444   GILFGLTNIEFILANLLYYFDWKLPNGLQPEDLDMTEVFGSAARRKND  491



>emb|CDP07886.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   451 bits (1160),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 339/493 (69%), Gaps = 35/493 (7%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRG-----KMPPGPRKLPIIGNLLHITGPVLPHRALRD  1407
             N I+  L V+F+  +     KQR G     K+PP P KLP+IGNL H+ G   PH ALR+
Sbjct  6     NFIALFLLVAFISTLI----KQRNGSKAAQKLPPSPWKLPLIGNLHHLIGSP-PHHALRN  60

Query  1406  LARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLG  1227
             L++K+G LM  Q+GE+S++VVSS  +AKE L+THDL F  RAE LA  IL Y+  DI   
Sbjct  61    LSKKHGPLMHFQLGEVSSIVVSSSRLAKEVLKTHDLEFGNRAEFLATKILCYDYGDIASA  120

Query  1226  PYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTS  1047
             PYGDYWRQMRKI          ++  SSI+            + AG+  N+ E++  +TS
Sbjct  121   PYGDYWRQMRKIY-------EALKLMSSIK----------TLAGAGKIVNLKEKLASYTS  163

Query  1046  SIICRAAFGEVF-DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHR  870
             S++CRAAFG+V  D  + F+Q   +   L+ +F+ +D+FPS K LHPLF  K++++K H 
Sbjct  164   SMVCRAAFGKVSKDDHKAFLQLVMEALPLSSAFEISDLFPSLKILHPLFSAKTKLMKVHH  223

Query  869   KTDSIIESIINDH-----RNKLESG-TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIID  708
             K D I++ II+ H     R ++  G +G + + DVLL++ +SG+LQ PIT +N+KA++ D
Sbjct  224   KMDVILDKIIDQHIDNLARTRMAMGESGHEDLTDVLLRVKESGDLQFPITKNNVKAVLFD  283

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             MF  G+ETS+TT  WAMSE++KNP V+ K Q EVR+ F GK+ +EE++++QL YLK V+K
Sbjct  284   MFLGGTETSSTTLEWAMSELIKNPNVMTKVQNEVRKAFTGKKTIEENEIQQLQYLKLVIK  343

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR HPP PL   ++CRE+  I+ GY+IPVKT++ VN +A+A DP+YW++PE F PERF
Sbjct  344   ETLRLHPPAPLSVPKQCREQCEID-GYSIPVKTRLFVNTWAIARDPEYWDDPESFKPERF  402

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
             E++ +DF G+HF+ +PFG+GRRICPG++FG AN   PL  LLY+FDW+LP G++ + LDM
Sbjct  403   ENSSIDFTGNHFELLPFGSGRRICPGISFGIANVELPLTLLLYHFDWRLPNGLSPDDLDM  462

Query  167   TEMLGLAVARKND  129
              E +G+A  RKND
Sbjct  463   IESVGIATTRKND  475



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   452 bits (1162),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 223/502 (44%), Positives = 333/502 (66%), Gaps = 25/502 (5%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRRG---KMPPGPRKLPIIGNLLHITGPVLPHRALRDLA  1401
             N  + ALFV  ++L+  +W+K +      +PPGP  LPIIG+L H+T   LP R+ R+L+
Sbjct  8     NFTTLALFVPVILLLIRKWRKSKSDSVKNLPPGPTPLPIIGDLHHLTA--LPFRSFRELS  65

Query  1400  RKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPY  1221
             +KYG LM L++G++S +VVSSP++AK+ L+ HD +FA R  ++   I+ Y+ ++I   PY
Sbjct  66    KKYGPLMHLKLGQVSTIVVSSPEIAKQMLKEHDPSFADRPRSVGIEIMWYDYTNIAFSPY  125

Query  1220  GDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVR--SSAGRPFNVSERIFLFTS  1047
             G+YWRQMRKIC+ ELL+P+ VRSF+SIR DE+  L+  +R  +++G P N++++IF   S
Sbjct  126   GNYWRQMRKICVIELLSPKSVRSFASIRKDEVSGLVDSLRRCAASGEPINLTDKIFSLMS  185

Query  1046  SIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRK  867
             SI CRAAFG+V    E  I+  K+   +   F+ +D+FP  K ++ L   + ++LK  RK
Sbjct  186   SITCRAAFGKVSKDNEALIKLLKEGIEMASGFEISDLFPGSKIINALSKGRFKLLKMRRK  245

Query  866   TDSIIESIINDHRNKL------------ESGTGEDC---IIDVLLKLMDSGNLQVPITHD  732
              D I++SII++H+  L            + G G+D    ++DV L++ ++G L+ PI ++
Sbjct  246   LDEILDSIIDEHKANLAKMATENAESAVKRGNGDDGNEDLVDVFLRIQENGELEFPIGNN  305

Query  731   NIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQL  552
             NIKA++ DMF AG++TS+T   W M+E+M+NPRV+AKAQAEVRE FK  E ++E + + L
Sbjct  306   NIKAVLQDMFSAGTDTSSTAIEWTMTELMRNPRVMAKAQAEVREAFKETEPIDEGNTQHL  365

Query  551   PYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWee-  375
              YLK V+KE+LR HPP PL+  R  REETV+N GYTIP   KV+VN +A+  DP++WE  
Sbjct  366   KYLKMVIKESLRLHPPVPLLP-RASREETVVN-GYTIPANVKVLVNNWAIQRDPKHWENP  423

Query  374   perfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPE  195
                      + N  DF G  F+Y+PFG+G+R+CPG+ F  A+    LA LLY+F+WKLP+
Sbjct  424   DSFEPERFEKKNSRDFLGGDFEYLPFGSGKRMCPGITFSLASVELFLAQLLYSFNWKLPD  483

Query  194   GVTAETLDMTEMLGLAVARKND  129
             GV    +D+TE  G+   RK +
Sbjct  484   GVNPGNMDLTENPGITAQRKEN  505



>gb|AED99878.1| cytochrome P450 [Panax notoginseng]
Length=514

 Score =   451 bits (1161),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 234/493 (47%), Positives = 332/493 (67%), Gaps = 10/493 (2%)
 Frame = -2

Query  1583  NIMENLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHI--TGPVLPHRALR  1410
             +I+   ++  LF+  L+    +   Q   K+PPGP KLP+IGNL+ +  + P+ PHR L 
Sbjct  9     SIISTSLASILFLFLLINKLLKRSSQAAHKLPPGPWKLPLIGNLMQVAASNPI-PHRGLL  67

Query  1409  DLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVL  1230
             +L+RK+G LM LQ+G+I A+VVSSP +AKE L+THDLA A R + L G I+L N+ DIVL
Sbjct  68    ELSRKHGPLMHLQLGKIPAIVVSSPRVAKEVLKTHDLACADRPDMLLGKIMLANSRDIVL  127

Query  1229  GPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFT  1050
              PYGDYWRQMRKI  +ELL+   VRSF ++R +E  +L+  +RSS G P N S ++    
Sbjct  128   APYGDYWRQMRKISTSELLSANKVRSFRNVREEESWQLIDSIRSSLGSPINYSTKVTGMA  187

Query  1049  SSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHR  870
             ++IICRA  G+    +++ I+  +DI+     F  AD+FP  K L  + G + ++    R
Sbjct  188   NAIICRATIGKKCKYQDELIEVVEDIAYWGSGFFMADLFPKLKFLEYITGMRPKLEDMRR  247

Query  869   KTDSIIESIINDHRNKLESGTGEDC------IIDVLLKLMDSGNLQVPITHDNIKAIIID  708
             K D I   IIN+HR KL +   ++       +IDVLL++ +S  L+ PIT ++I+ I +D
Sbjct  248   KLDHIFGHIINEHREKLATXKEQNIHDADEDLIDVLLRINESQRLEFPITSNDIQGITLD  307

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             MF AG+++++ T  W MSE+M+NPRV+ KAQAEVR+  KGK ++ E+D++ L YLK VVK
Sbjct  308   MFTAGTDSTSATLQWIMSELMRNPRVMEKAQAEVRQALKGKTIIYEADIQGLGYLKLVVK  367

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR H P PL+  RECR++  I+ GYTIPV TKV+VNA+A+A DP++W + + FIPERF
Sbjct  368   ETLRLHAPVPLLVPRECRKQCEID-GYTIPVGTKVIVNAWAIARDPEHWVDADSFIPERF  426

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
             E+  +D+ G++F+Y+PFGAGRR+C G+AF  A    PLA LLY FDWKLP  +  E +DM
Sbjct  427   ENGSMDYIGTNFEYIPFGAGRRVCAGIAFAAATIELPLAQLLYYFDWKLPNDMKPEDVDM  486

Query  167   TEMLGLAVARKND  129
              E  G    RKN+
Sbjct  487   EESNGATATRKNN  499



>ref|XP_010061472.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=511

 Score =   451 bits (1161),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/487 (48%), Positives = 324/487 (67%), Gaps = 6/487 (1%)
 Frame = -2

Query  1577  MENLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             + +++SF +F+  L  +  +   +   K+PPGPRKLP+IGNL  + G   PHRALRDLA+
Sbjct  8     LPSVVSFCIFIFILRKLCHKSDVKGLPKLPPGPRKLPLIGNLHQLLGSP-PHRALRDLAK  66

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
             K+G LM LQ+GE+  V+VSS +MAKE ++THDL FATR   LA  ++ Y ++DI   PYG
Sbjct  67    KHGPLMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFATRPPLLASEVMSYGSTDIAFAPYG  126

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
             +YWRQ+RKIC  EL + + V+SF  IR +E   L+  V S+AG P N+++++F       
Sbjct  127   EYWRQLRKICTLELFSVKRVQSFRHIREEETSNLVKWVASNAGSPINLTQKLFSTNYGAT  186

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
               AAFG+ F  +E+FI    + + L   F+  D+FPS K LH +   K  + K HR+ D 
Sbjct  187   SIAAFGKKFKEQEEFISVVTEANKLAAGFEVGDVFPSSKWLHVISRMKPRLEKLHRQADH  246

Query  857   IIESII----NDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             ++ +II     +   + +  T  D +IDVLL+  D G  +  +T DNIKA+I+D+F AG 
Sbjct  247   MMNNIIRERREERAKRRDDETRHDDLIDVLLRFADPGGPEFSLTADNIKAVILDIFVAGG  306

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             ETS T   WA++EMMKNPR+L KAQAEVREVF  +   +E  + +L YLK V+KE+LR  
Sbjct  307   ETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADEMGLPELEYLKLVIKESLRMR  366

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
             P  PL+  REC E   IN GY IPVKTKV+VNA+A+  DP+YW+ PE F PERF+D+ VD
Sbjct  367   PSVPLLLPRECGERCEIN-GYEIPVKTKVVVNAWAIGRDPKYWDNPEVFYPERFKDSPVD  425

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             + G+ F+Y+PFGAGRR+CPG+ FG  N   PLA LLY+FDW+LPEG+  E LDM+E+LG 
Sbjct  426   YKGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAMLLYHFDWELPEGMKREELDMSELLGA  485

Query  149   AVARKND  129
                RK D
Sbjct  486   TQRRKRD  492



>ref|XP_003617704.1| Cytochrome P450 [Medicago truncatula]
 gb|AET00663.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   451 bits (1159),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/493 (47%), Positives = 329/493 (67%), Gaps = 5/493 (1%)
 Frame = -2

Query  1595  LDRSNIMENLISFALFVSFLVL--VYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLP  1425
             ++  N   N+I    F+  LVL  +  +W       K+PPGP KLP+IGNL  I    LP
Sbjct  1     MELQNPFSNIIFILSFLILLVLFKIVQRWSFNNSTTKLPPGPWKLPLIGNLHQIISRSLP  60

Query  1424  HRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNN  1245
             H   + LA KYG LM L++GE+  V+VSSP++AKE ++THDL F  R   L  +I  YN 
Sbjct  61    HHLFKILADKYGPLMHLKLGEVPYVIVSSPEIAKEIMKTHDLNFCDRPNLLLSNIYSYNA  120

Query  1244  SDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSER  1065
             +DI    YG++WRQ+RKIC+ ELL+ + V+SF SIR DE+  L+  + +S G   N++ +
Sbjct  121   TDIAFAAYGEHWRQLRKICVIELLSAKRVQSFRSIREDEVSNLVKSITASEGSVVNLTRK  180

Query  1064  IFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEI  885
             IF  T+ I  RAAFG+    ++ FI   + + VL G F+ AD++PS K L  +   K+++
Sbjct  181   IFSMTNGITARAAFGKRNRHQDVFIPALEKVVVLLGRFEIADLYPSIKLLQWMTREKTKM  240

Query  884   LKTHRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIID  708
              K H + D I + II+DHR+  +  + ++ ++DVLLK+  ++ + + P+T DN+K+II D
Sbjct  241   EKLHTEIDMIAQDIIDDHRSIHKEASNDEDLVDVLLKIQQENYHSEHPLTDDNMKSIIQD  300

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             MF AG+ETS+   +WAMSEM+KNP+V+ +AQ EV  VF  KE ++E+++ QL YLK+V+K
Sbjct  301   MFLAGTETSSQVLLWAMSEMVKNPKVMEEAQDEVSRVFDKKEYVDETELHQLIYLKSVIK  360

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR HP  PL+  RE RE   IN GY IP KT+VMVNA+A+  D +YW E E F PERF
Sbjct  361   ETLRLHPVAPLLVPRESRERCQIN-GYEIPAKTRVMVNAWAIGRDSRYWVEAESFKPERF  419

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
              ++ +DF G+ F+++PFGAGRR+CPG++F   N   PLA LLY+FDWKLP G++ + LDM
Sbjct  420   VNSPIDFKGTDFEFIPFGAGRRMCPGISFAIPNVELPLAKLLYHFDWKLPNGMSHQELDM  479

Query  167   TEMLGLAVARKND  129
             TE  G+ V RK+D
Sbjct  480   TEFFGITVGRKHD  492



>gb|ABR15423.1| (-)P450 limonene-3-hydroxylase [Mentha canadensis]
Length=498

 Score =   450 bits (1158),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/477 (49%), Positives = 326/477 (68%), Gaps = 5/477 (1%)
 Frame = -2

Query  1553  LFVSFLV-LVYTQWKK-QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLM  1380
             L V++ + L+  QW+K + + K PPGP KLP+IG+L H+    LP  AL  +A++YG + 
Sbjct  13    LVVTYAISLLINQWRKPEPQEKFPPGPPKLPLIGHL-HLLWGKLPQHALASVAKEYGPVA  71

Query  1379  SLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQM  1200
              +Q+GE+ +VV+SS +  KE ++  D A A R E++   I+ Y+N DI+  PY ++WRQM
Sbjct  72    HVQLGEVFSVVLSSREATKEAMKLVDPACANRFESIGTRIMWYDNEDIIFSPYSEHWRQM  131

Query  1199  RKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFG  1020
             RKIC++ELL+ R  RSF  IR DE+ RLL  +RSSAG   +++ERI   T SIICRAAFG
Sbjct  132   RKICVSELLSSRNGRSFGFIRQDEVSRLLRHLRSSAGAAVDMTERIETLTCSIICRAAFG  191

Query  1019  EVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESII  840
              V     + +   KD   +   F+ ADMFPS K L+ L  NKS++ +   + D+I+E+I+
Sbjct  192   SVIRDNAELVGLVKDALSMASGFELADMFPSSKLLNLLSWNKSKLWRMRGRVDTILEAIV  251

Query  839   NDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWA  660
             ++H+ K     G + IIDVL ++     ++VPIT ++IKA I D F AG+ETS+TT++W 
Sbjct  252   DEHKLKKSGEFGGEDIIDVLFRMQKDTQIKVPITTNSIKAFIFDTFSAGTETSSTTTLWV  311

Query  659   MSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRE  480
             ++E+M+NP V+AK QAEVR   KGK   +  DV++L Y+K+VVKET+R HPP PLI  R 
Sbjct  312   LAELMRNPAVMAKVQAEVRAALKGKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIP-RS  370

Query  479   CREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVP  300
             CREE V+N GYTIP K ++M+N +++  +P YWE+PE F PERF+D   DF G+ F++VP
Sbjct  371   CREECVVN-GYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDDVSKDFMGNDFEFVP  429

Query  299   FGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             FGAGRRICPGL FG AN   PLA LLY+FDWKL EG+    +DM+E  GL   RKN+
Sbjct  430   FGAGRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNN  486



>ref|XP_011082254.1| PREDICTED: premnaspirodiene oxygenase [Sesamum indicum]
Length=524

 Score =   451 bits (1161),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/485 (48%), Positives = 325/485 (67%), Gaps = 10/485 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLVLVYTQWKKQRR---GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLA  1401
             N    AL V  + L+  + +K  +    K+PPGP++LPIIG+L  I+   +P R+ RDLA
Sbjct  8     NFTILALLVPVIFLLLLKKRKNSKPSSAKLPPGPQELPIIGHLHLISS--VPFRSFRDLA  65

Query  1400  RKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPY  1221
             +KYG +M L+ GE+  +++SSP++AK+ L+  D  FA R   +A  I+ YN  DI   PY
Sbjct  66    KKYGPIMHLKFGEVPGIIISSPEIAKKVLKEQDPVFANRPPAIAMQIMGYNYKDIGFSPY  125

Query  1220  GDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSI  1041
             GDYWRQMRKICI ELL+ + VRSF SIR+DE+  L+  +++SAG+P N++++IF   +SI
Sbjct  126   GDYWRQMRKICIMELLSSKSVRSFGSIRNDEVSSLVKFIQASAGKPVNLTDKIFWMMNSI  185

Query  1040  ICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTD  861
              CRA+FG V    +  I+  +D   + G F+ AD+FPS K +  L   K  ++   RK D
Sbjct  186   TCRASFGTVCKDNDALIKLLRDGMQMAGGFEIADVFPSSKIVSALSWTKWRLVMMGRKLD  245

Query  860   SIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETS  681
              I++ IIN+H+  L+    E+ ++DV L+L +SG+L+ PI +DNIKAI+ D+F A +ETS
Sbjct  246   MILDDIINEHKVNLDKLAREN-LVDVFLRLKESGDLEFPIGNDNIKAILFDVFSAATETS  304

Query  680   TTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEM--LEESDVEQLPYLKTVVKETLRCHP  507
              T   W M+E+M+NP V+AKAQAEVR+VF G     + E +V +L YLK V++ETLR HP
Sbjct  305   ATAIDWIMTELMRNPGVMAKAQAEVRQVFNGSRTTSINEDNVRKLNYLKLVIRETLRLHP  364

Query  506   PTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDF  327
               P +  R  REE  IN GYTIP   KV+VN++ +  DP+YW  PE F PERFE+N +DF
Sbjct  365   SVPFLP-RASREECTIN-GYTIPANVKVLVNSWGMQRDPKYWTNPESFEPERFENNSMDF  422

Query  326   NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLA  147
              G  F+Y+PFG+GRR+CPG+ F  A+   PLA LLYNF+WKLPEGV  E LDM E  GL 
Sbjct  423   VGGDFEYLPFGSGRRMCPGITFALASIELPLAQLLYNFNWKLPEGVKPENLDMIENPGLT  482

Query  146   VARKN  132
              +RK+
Sbjct  483   ASRKS  487



>ref|XP_006452554.1| hypothetical protein CICLE_v10008073mg [Citrus clementina]
 ref|XP_006474924.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65794.1| hypothetical protein CICLE_v10008073mg [Citrus clementina]
Length=504

 Score =   450 bits (1157),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 233/466 (50%), Positives = 316/466 (68%), Gaps = 10/466 (2%)
 Frame = -2

Query  1508  QRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDM  1329
              R   +PPGP KLP+IGNL  + G  LPH  LRDL +K+G LM LQ+G++  ++VSSP++
Sbjct  34    NRISNLPPGPWKLPLIGNLHQLAGS-LPHHRLRDLTKKFGPLMLLQLGQVPTIIVSSPEV  92

Query  1328  AKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSF  1149
             AK+ ++THD+ FA+R    A  I+ YN   I+   YGD W+Q+RKIC++ELL+ + V+SF
Sbjct  93    AKDVMKTHDVVFASRPHFPAAQIMSYNYRGIIFSAYGDCWKQLRKICVSELLSTKRVQSF  152

Query  1148  SSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDIS  969
              SIR  E+  L+  + S AG   N++E+++     I  RAAFG     +E F+   ++ +
Sbjct  153   QSIREAEVSDLINWISSKAGLVINLTEKVYSLMYGITSRAAFGNRSRDQETFVSVIEETT  212

Query  968   VLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK------LESGT  807
              +   F+ ADMFPS   L  L GNKS++ K  ++ D I+E+IINDH+ +       ++G 
Sbjct  213   KVISGFNIADMFPSIGLLQRLTGNKSQVEKLLQEADRIVENIINDHKKRKATLKNCKTGD  272

Query  806   GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVL  627
              ED ++DVLLK+   G+L   +T DNIKA+I D+FGAGSETS TT  WAM EMMKNPRV+
Sbjct  273   DED-LVDVLLKIQGHGDLDSSLTTDNIKAVIFDIFGAGSETSATTVDWAMYEMMKNPRVM  331

Query  626   AKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGY  447
              KAQAEVREVF  K  ++E+ + ++ YLK VVKETLR HP  PLI  REC +   IN G+
Sbjct  332   KKAQAEVREVFNRKGKVDETGINEMKYLKLVVKETLRLHPSAPLI-LRECGDSCEIN-GF  389

Query  446   TIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGL  267
              IP K +V+VN++A   DP YW EPE FIPERF D+ VD+ G++F+Y+PFGAGRRICPG+
Sbjct  390   NIPAKARVIVNSWATGRDPMYWTEPESFIPERFIDHSVDYKGTNFEYIPFGAGRRICPGM  449

Query  266   AFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +FG A+    LA LLY+F+WKLP G+  E LDMTE  G  V RK D
Sbjct  450   SFGLASVELTLAMLLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQD  495



>emb|CDP18847.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   450 bits (1157),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 244/479 (51%), Positives = 319/479 (67%), Gaps = 37/479 (8%)
 Frame = -2

Query  1535  VLVYTQWKKQRRGKM--PPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGE  1362
             VL+   WKK+    M  PPGPRKLPIIGN+ ++ G  LPH  LRDLAR            
Sbjct  23    VLIVKIWKKRNTPIMNLPPGPRKLPIIGNMHNLFGG-LPHVVLRDLAR------------  69

Query  1361  ISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICIT  1182
                       MAKE L THD  FA R + LA  I+ Y+  D++  PYGD WRQMRKIC T
Sbjct  70    ----------MAKEVLVTHDPTFANRPDRLAVKIMWYDQQDMIFIPYGDKWRQMRKICTT  119

Query  1181  ELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGR  1002
             ELL+ + VRSFS IR DEI +L+  +RSS G   NV E  F++TS + CRAAFG +    
Sbjct  120   ELLSGKHVRSFSYIRKDEISKLIESIRSSQGAAINVGEIFFMYTSLMTCRAAFGRICKEY  179

Query  1001  EQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK  822
             E  I   K+   L   FD ADMFPS K L  + G + ++LK H K DSI++ +I+ H+  
Sbjct  180   ETMIAYVKEGIALAAGFDAADMFPSLKVLPLISGLRRKLLKMHYKIDSILDDVISQHKLN  239

Query  821   LESG------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWA  660
              +SG      TGE+ +IDVLL+  +SGN Q+PIT  +IKA++ D+F  G++T++ TS WA
Sbjct  240   HKSGKKSNAETGEEDLIDVLLREQESGNPQMPITSKDIKAVVFDIFTGGTDTASVTSEWA  299

Query  659   MSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLI--AT  486
             M+E+MK+PRV+AKAQAEVR+VFKGK+ +EE DV++L YLK VVKETLR HPP PLI  A+
Sbjct  300   MAELMKHPRVMAKAQAEVRQVFKGKKPIEEDDVQKLVYLKMVVKETLRLHPPIPLIPRAS  359

Query  485   RECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQY  306
             RE R+      G  IP K+++MVNA+A+  DP+YW++PE F+PERFE N +D+ G+H QY
Sbjct  360   RENRQVK----GCMIPNKSQIMVNAWAIGRDPEYWDDPEIFLPERFEQNSIDYTGTHCQY  415

Query  305   VPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +PFG GRR+CPG AFG  N   PLAHLLY+FDW+LP+ +    LDM E  G+ + RKN+
Sbjct  416   LPFGTGRRMCPGTAFGIVNVELPLAHLLYHFDWRLPDRMNVIDLDMDEAAGINIKRKNN  474



>ref|XP_007022417.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY13942.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   450 bits (1158),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 238/488 (49%), Positives = 333/488 (68%), Gaps = 11/488 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRR--GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             L+  +LFV F+VL   +  K      ++PPGPRKLP IGNL H     LPH  LRDLA+K
Sbjct  11    LLLTSLFV-FMVLKVLKRSKANNPPARLPPGPRKLPFIGNL-HQLISSLPHHTLRDLAKK  68

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             +G LM LQ+GE+ ++V+SSP++AKE L+ H   FA R   LA  I+ Y++  I+  PYG+
Sbjct  69    HGPLMHLQLGEVPSIVISSPEIAKEVLKDHATTFAQRPYLLASRIMSYDSVGIIFSPYGN  128

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YW+Q+RKI   ELL+P  V+SF  IR +E+  L+  +  + G P N+SE+IF  T  I  
Sbjct  129   YWKQLRKISTMELLSPSRVQSFQFIREEEVSALIKTISLNEGSPINLSEKIFSMTYGITS  188

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAAFG+   G+E+FI+   + +   G F  ADM+PS + L  + G + ++ K  R +D I
Sbjct  189   RAAFGKKSKGQEEFIRIITETTKRAGGFCLADMYPSNELLKLISGVRLKLEKLQRASDRI  248

Query  854   IESIINDHRNKLESGT------GEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             +E I+N+H+ K  S +      GE+ ++DVLLKL  S +L++P+T+D IKAII+D+  AG
Sbjct  249   LEDIVNEHKEKTNSTSEMGKQQGEEDLLDVLLKLKQSSDLEIPLTNDKIKAIILDILAAG  308

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             SETS+TT  WA+SEM+KNP+V+ +AQAEVR+VF  K  ++E+ + +L +L+ +VKETLR 
Sbjct  309   SETSSTTMEWALSEMLKNPKVMKQAQAEVRQVFDRKGNVDEAGIHELKFLRLIVKETLRL  368

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGV  333
             HP  PL+  REC E+ VI+ GY I  KTKV+VNA+A+  D +YW++ E+F P+RF D  +
Sbjct  369   HPAAPLLVPRECDEKCVIS-GYDILAKTKVIVNAWAIGRDSRYWKDAEKFNPDRFLDGSI  427

Query  332   DFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLG  153
             DF G++F+Y+PFGAGRRICPG++F   N   PLA LLY+FDW LP G   E LDMTE  G
Sbjct  428   DFRGTNFEYIPFGAGRRICPGISFALPNIELPLAQLLYHFDWMLPNGSKCEDLDMTECFG  487

Query  152   LAVARKND  129
             L+V RKND
Sbjct  488   LSVRRKND  495



>gb|KHN36161.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   447 bits (1151),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 315/441 (71%), Gaps = 9/441 (2%)
 Frame = -2

Query  1430  LPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLY  1251
             LPHR LRDLA KYG LM LQ+GEIS+VVVSSP+MAKE ++THDLAF  R + L   IL Y
Sbjct  5     LPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQILTY  64

Query  1250  NNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVS  1071
               +DIV  PYGDYWRQM+KIC++ELL+ + V+SFS IR DE  + +  +R S G P N++
Sbjct  65    GQNDIVFAPYGDYWRQMKKICVSELLSAKRVQSFSHIREDETSKFIESIRISEGSPINLT  124

Query  1070  ERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKS  891
              +I+   SS + R AFG+    +E+F+   + + +  G F+  D+FPS K LH + G K+
Sbjct  125   SKIYSLVSSSVSRVAFGDKSKDQEEFLCVLEKMILAGGGFEPDDLFPSMK-LHLINGRKA  183

Query  890   EILKTHRKTDSIIESIINDHRNKLESG-------TGEDCIIDVLLKLMDSGNLQVPITHD  732
             ++ K H + D I ++I+ +H+ K E           E+ ++DVLL++  S NL++ I+  
Sbjct  184   KLEKMHEQVDKIADNILREHQEKRERALREGKVDLEEEDLVDVLLRIQQSDNLEIKISTT  243

Query  731   NIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQL  552
             NIKA+I+D+F AG++TS +T  WAM+EMM+NPRV  KAQAEVR+ F+  +++ E+DV +L
Sbjct  244   NIKAVILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIIHETDVGKL  303

Query  551   PYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeep  372
              YLK V+KETLR H P+PL+  REC E T+I+ GY IPVKTKVM+N +A+  DPQYW + 
Sbjct  304   TYLKLVIKETLRLHAPSPLLVPRECSELTIID-GYEIPVKTKVMINVWAIGRDPQYWTDA  362

Query  371   erfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEG  192
             ERF+PERF+ + +DF G++F+Y+PFGAGRR+CPG+ FG AN + PLA LLY+F+W+LP  
Sbjct  363   ERFVPERFDGSSIDFKGNNFEYLPFGAGRRMCPGMTFGLANIMLPLALLLYHFNWELPNE  422

Query  191   VTAETLDMTEMLGLAVARKND  129
             +  E +DM+E  GL V RK++
Sbjct  423   MKPEDMDMSENFGLTVTRKSE  443



>gb|KDP26294.1| hypothetical protein JCGZ_22279 [Jatropha curcas]
Length=528

 Score =   450 bits (1158),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 322/458 (70%), Gaps = 6/458 (1%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+PPGP+KLP IGNL H  G  LPH  L+DLA +YG LM LQ+GE+ A+V+SS  MA+E 
Sbjct  46    KLPPGPKKLPFIGNL-HNLGGSLPHHVLKDLANQYGPLMHLQLGEVPAIVISSSKMAQEV  104

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             LRT D  FA R E LA  IL Y+++D+V    G+YW+QMRK C  ELL  + V+S + +R
Sbjct  105   LRTQDHVFAQRPELLASKILSYDSTDLVFA-KGEYWKQMRKFCFNELLGAKKVKSLAPLR  163

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              DE+  LL  +RS+ G P N++E+IF  TS I  RAAFG  ++ ++  I   ++   L G
Sbjct  164   EDEVSNLLESIRSAGGSPVNLTEKIFWMTSVIAVRAAFGNKWEDQKTIISIARESLSLAG  223

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGE---DCIID  786
              FD AD++P  + LH +   K  + K   K D +++ I+N+H+ KL SG  +   + ++D
Sbjct  224   GFDLADLYPEREFLHIITNMKPRLEKMRVKLDGVLDRIVNEHKEKLLSGQTQPDNEVLVD  283

Query  785   VLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEV  606
             VLL+  ++GNL+ P+T DN+KA+I DMF AG++TS+TT+ WA+SEM++NP+V+ KAQ EV
Sbjct  284   VLLRFQETGNLRCPVTIDNVKAVIWDMFVAGTDTSSTTTEWALSEMIRNPKVMKKAQEEV  343

Query  605   REVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTK  426
             R+  KGK  ++E D++ LPYLK V+KETLR HPP PL+  RE  +++ I  GY IP +TK
Sbjct  344   RQAAKGKTTIDEEDIQDLPYLKQVIKETLRLHPPVPLLLPRESNQDSEIE-GYYIPERTK  402

Query  425   VMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANT  246
             V+VNA+A+  DP YWE+PE FIPERF D+ +DF G++F Y+PFGAGRRICPG+ FG AN 
Sbjct  403   VIVNAWAIGRDPAYWEDPESFIPERFSDSSIDFKGNNFTYIPFGAGRRICPGMTFGLANV  462

Query  245   ISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKN  132
               PLA LLY+FD+KLP+G+  E LDMTE  G  V RKN
Sbjct  463   ELPLAKLLYHFDFKLPDGIRGEDLDMTEAFGATVGRKN  500



>ref|XP_007156882.1| hypothetical protein PHAVU_002G025100g [Phaseolus vulgaris]
 gb|ESW28876.1| hypothetical protein PHAVU_002G025100g [Phaseolus vulgaris]
Length=506

 Score =   449 bits (1154),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 221/474 (47%), Positives = 321/474 (68%), Gaps = 9/474 (2%)
 Frame = -2

Query  1526  YTQWKKQRRGKMPPGPRKLPIIGNLLHITGPV-LPHRALRDLARKYGGLMSLQIGEISAV  1350
             Y + K      +PPGP+KLP+IGNL  ++G   LPH A   LA KYG LM  Q+GE+S V
Sbjct  24    YYKLKPNGSHNLPPGPKKLPLIGNLHQLSGAASLPHHAFHKLAHKYGPLMHFQLGEMSTV  83

Query  1349  VVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLN  1170
             + SSP MAKE ++T+D+AF  R + L G IL Y   +IV  PYGD+WRQ++KIC+ ELL+
Sbjct  84    IASSPGMAKEIMKTNDIAFVQRPQFLFGDILSYGGKNIVFAPYGDHWRQLKKICVLELLS  143

Query  1169  PRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQF-  993
              + V+SFS IR DE  + +  +R SAG P N++ +I+   S+ + RAAFG     +++F 
Sbjct  144   AKRVKSFSFIREDETAKFIDSIRKSAGSPINLTAKIYSLVSASVFRAAFGGKNKDQDEFV  203

Query  992   IQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLES  813
             +   + +      FDF D FPS K +H + G ++++ +  ++ D ++++++ +H  K + 
Sbjct  204   VPLMRKVIEAAAGFDFVDFFPSLKFIHFITGKRAKLEELQKQVDDVLDNVVKEHEEKRKE  263

Query  812   G------TGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
                      ++  +DVLL++  +  L + +T   IKA+I+D+F AGS+TS +   W ++E
Sbjct  264   AKEDGVEVEDEDFVDVLLRIQQNDTLDIKMTTIQIKALILDVFVAGSDTSASVLEWVVAE  323

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             +MK+PRV+ KAQ+E+RE F+GKE + ESD+++L YLK V+KETLR HPP PL+  REC +
Sbjct  324   IMKSPRVMEKAQSEIREAFRGKETIHESDLDELNYLKLVIKETLRLHPPVPLLIPRECTK  383

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
              T I GGY IP KTKVM+NA+AL  DP+YW + ERFIPERFE N VDF G++F+YVPFGA
Sbjct  384   LTNI-GGYEIPKKTKVMINAWALGRDPEYWSDAERFIPERFEGNSVDFRGNNFEYVPFGA  442

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG+ FG A+ + PLA LLY+F+W+LP  +  E +DM E  GL V R+N+
Sbjct  443   GRRMCPGMTFGLASIMLPLALLLYHFNWELPNKMKPEDMDMVEHFGLVVGRENE  496



>ref|XP_007020557.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY12082.1| Cytochrome P450, putative [Theobroma cacao]
Length=505

 Score =   449 bits (1154),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 229/485 (47%), Positives = 331/485 (68%), Gaps = 8/485 (2%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKY  1392
             L++  LF+S +  V    K K+   ++PPGP KLP IGN+ H  G  LPH  LR+LA K+
Sbjct  11    LLTTLLFLSMIARVGKALKDKKPSQRLPPGPWKLPFIGNI-HQLGGSLPHCTLRNLALKH  69

Query  1391  GGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDY  1212
             G LM LQ+G +S VV+SSP+ A+E +R +D+ FA+R   LA  I+ Y+ ++IV  PYG Y
Sbjct  70    GPLMHLQLGAVSTVVLSSPEFAEEAMRKNDVTFASRPYQLAPGIISYDCTNIVFSPYGSY  129

Query  1211  WRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICR  1032
             W+Q+RKIC+ ELL+ + V+SF  +R + +  L+  + SS   P N+S++IF  T S   +
Sbjct  130   WKQLRKICVMELLSSQRVKSFKRVREEMVSSLIKTMSSSQSSPINLSQKIFSLTYSTTAK  189

Query  1031  AAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSII  852
              AFG    G+E F+    +++ L      AD++PS KAL  + G ++++ K HR+ D I+
Sbjct  190   VAFGSKCKGQETFVSVITEVNKLATGLTLADLYPSVKALQMISGIRTKLEKLHREADGIL  249

Query  851   ESIINDH--RNKLESGTG--EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             E++I +H  R + E+G+G  E  I+D+LL L + GNL  P++ +NIK++I+D+F AGSET
Sbjct  250   ENVIAEHKERPRKENGSGGDEKDIVDMLLDLQEHGNLDFPLSANNIKSVILDIFAAGSET  309

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPP  504
             S+T   WAMSE++KNP  + KA+AEVR+VFKGK  ++E    +L +LK+V+KETLR H P
Sbjct  310   SSTIVEWAMSELLKNPGSMEKAKAEVRDVFKGKGYVDEESFHELKFLKSVIKETLRLHNP  369

Query  503   TPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFN  324
              PLI  RECRE   + GGY IP KTKV++N++A+  DP++W EP++F PE F ++ +DF 
Sbjct  370   VPLIP-RECRENCKL-GGYEIPAKTKVLINSWAITRDPRHWSEPDKFNPENFLNSSLDFK  427

Query  323   GSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAV  144
             G+ FQY+PFGAGRRICPG++F  AN    LA  LY+FDWKLP G+  E LDMT+  GL +
Sbjct  428   GTDFQYIPFGAGRRICPGISFAHANIEMQLAQFLYHFDWKLPNGMKHEELDMTDAPGLTI  487

Query  143   ARKND  129
              RK+D
Sbjct  488   RRKHD  492



>ref|XP_011097779.1| PREDICTED: cytochrome P450 71D11-like [Sesamum indicum]
Length=510

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 234/495 (47%), Positives = 329/495 (66%), Gaps = 18/495 (4%)
 Frame = -2

Query  1571  NLISFALFVSFLVLV--------YTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRA  1416
             +L SF++ VSF +L+        +++ K     K PPGPRKLP+IGNL    G   PHR 
Sbjct  4     DLSSFSILVSFFILLITLLRATSHSRTKMNPEPKFPPGPRKLPLIGNLYLFAGFRPPHRT  63

Query  1415  LRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDI  1236
             + DLA +YG +M L++GE++ VVVSS + AK+ L+THDL FA R   L   I+ Y N+DI
Sbjct  64    ISDLASRYGPVMHLKLGEVNTVVVSSAEAAKDVLKTHDLNFAYRPSLLVTEIICYGNTDI  123

Query  1235  VLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFL  1056
                PYGDYWRQ+RKIC  ELL+ + V+SF  IR +E   L   + S + +  N++ER+ L
Sbjct  124   AFAPYGDYWRQLRKICTLELLSVKRVQSFRHIREEESFNLCRWIGSQSEQLINLTERVNL  183

Query  1055  FTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKT  876
              TS ++ RA+ G+    +  FI   +    +      AD++PS K L  + G ++ + + 
Sbjct  184   TTSDVVARASLGKKTKEKAAFISVIRKAIEMAAGLHVADVYPSIKLLSRVTGMRARVERL  243

Query  875   HRKTDSIIESIINDHR------NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAII  714
             H+++D I+E+IINDHR      N  ES   ED +IDVLLK  DSG+ ++ +T DN+K+++
Sbjct  244   HKESDRILENIINDHRATNAATNSNESKKHED-LIDVLLKFHDSGD-ELHLTIDNLKSVL  301

Query  713   IDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTV  534
              DMF AGSETS++T  WAM+EM+K+PR+L KAQ EVR+VF  K  ++E  + +L YLK V
Sbjct  302   QDMFSAGSETSSSTIDWAMAEMLKHPRILKKAQDEVRQVFDKKGYIDEVYIHELKYLKCV  361

Query  533   VKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfipe  354
             +KE+LR HPP PL+  REC E+  I+ GY IP KT+VMVNA+AL  DP+YW+E E F PE
Sbjct  362   IKESLRMHPPIPLLLPRECHEQCEID-GYEIPAKTRVMVNAWALGRDPKYWKEAESFKPE  420

Query  353   rfED-NGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAET  177
             R+ D + VD+ G++F+Y+PFGAGRR+CPG++FG AN   PLA LLY+FDW LP G+  E 
Sbjct  421   RYLDIDSVDYKGNNFEYIPFGAGRRMCPGISFGLANVELPLAMLLYHFDWLLPGGMKPEK  480

Query  176   LDMTEMLGLAVARKN  132
             ++MTE  G+   R N
Sbjct  481   VEMTETFGITTRRTN  495



>ref|XP_004506687.1| PREDICTED: cytochrome P450 71D11-like [Cicer arietinum]
Length=509

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 239/492 (49%), Positives = 321/492 (65%), Gaps = 17/492 (3%)
 Frame = -2

Query  1559  FALFVSFLV------LVYTQWKKQ--RRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             F LF  FL       L+   +KK       +PP P KLPIIGN+LH+     P R LRDL
Sbjct  6     FTLFTIFLFMIIALKLIRNHYKKSDSTSTNLPPSPWKLPIIGNILHLVTSN-PPRKLRDL  64

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A++YG LM LQ+GEI  +VVSS ++AKE L+THD+ FA+R   +A  I  YN++DI   P
Sbjct  65    AKRYGPLMHLQLGEIFFIVVSSAEVAKEVLKTHDITFASRPHLMATDIASYNSTDIAFSP  124

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             YGDYWRQ+RKIC  ELL+ R V+S   IR  E++ LL  + S+ G  FN+S+ +  F  +
Sbjct  125   YGDYWRQLRKICAIELLSVRRVKSLWPIREKEMNSLLKKIASNEGSQFNLSQAVISFMYT  184

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
                +AAFG+ +   E+FI   K +  L G F   D+FPS   LH L G K ++ K  +  
Sbjct  185   FTSKAAFGKKYAEEEEFISVAKQLIKLAGGFYIGDLFPSATWLHNLSGMKPKLEKLSQHV  244

Query  863   DSIIESIINDH------RNKLESGTGEDCIIDVLLKLMDSGN-LQVPITHDNIKAIIIDM  705
             D I+  IINDH      R K      E+ +IDVLLK  DS N L   +T DNIKAII+D+
Sbjct  245   DRILGHIINDHKEERSRRAKEGVAEAEEDLIDVLLKFEDSSNDLDFYLTSDNIKAIILDV  304

Query  704   FGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKE  525
             F AGSET+ TT  WAM+EM+KNPRVL  AQAEVR+    + M++E+ + +L YLK V+KE
Sbjct  305   FIAGSETAATTINWAMAEMIKNPRVLKIAQAEVRDKINRRGMIDETTLGELKYLKAVIKE  364

Query  524   TLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfE  345
             +LR HP  PL+  RECR+  VIN GY IPVK++V++NA+A+  DP+YW +P++F PERF 
Sbjct  365   SLRLHPSIPLLLPRECRQACVIN-GYHIPVKSRVIINAWAIGRDPKYWIDPDKFYPERFI  423

Query  344   DNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMT  165
             D+ +D+ G++F+Y+PFG GRRICPG+ +G AN    LA  LY+FDWKLP G+  E L++ 
Sbjct  424   DSSIDYKGTNFEYIPFGGGRRICPGMNYGIANVEQTLAMFLYHFDWKLPNGMKNEELELR  483

Query  164   EMLGLAVARKND  129
             E  G A++RK D
Sbjct  484   EEFGAAMSRKGD  495



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   448 bits (1153),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 235/484 (49%), Positives = 319/484 (66%), Gaps = 12/484 (2%)
 Frame = -2

Query  1550  FVSFLVLVYTQWKKQRRG----KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGL  1383
             FV   ++V    KK ++      +P GPRKLPIIGN+ H      PHR L DLA+KYG L
Sbjct  14    FVLLAIVVQKVGKKLKKTDSTFNLPKGPRKLPIIGNI-HNLLSSQPHRKLSDLAKKYGPL  72

Query  1382  MSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQ  1203
             M LQ+GE+S +V+SS + AKE ++THD+ FATR + LA  I+ YN++ I   PYGDYWRQ
Sbjct  73    MHLQLGEVSTIVISSAEFAKEVMKTHDIHFATRPKVLAIDIMSYNSTSISFSPYGDYWRQ  132

Query  1202  MRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAF  1023
              RKIC  ELL+ + V S+  IR +    L+  + S  G P N +E +     +I+ RAAF
Sbjct  133   ARKICTLELLSLKRVNSYQPIREEVFSNLIKSIASENGSPINFTEAVLSSIYTIVSRAAF  192

Query  1022  GEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESI  843
             G     +E+FI   K+   +   FD  D FPS K L  + G + +I K H++TD I+E+I
Sbjct  193   GNKCKDQEKFISVVKESVKIAAGFDLGDSFPSSKWLQYVTGLRPKIEKFHQQTDEILENI  252

Query  842   INDHR----NKLESGTGE--DCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETS  681
             I++H+     K++   GE  + ++D+LLK  D  +    +T DNIKAII+D+FG G ETS
Sbjct  253   IDEHKREKYTKVKGDQGEVAEDLVDILLKYEDGSDQDFSLTKDNIKAIILDIFGGGGETS  312

Query  680   TTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPT  501
              +T+ WAM EM++NPR++ KAQ EVR+V K K  ++E  + +L YLK+VVKETLR HP  
Sbjct  313   ASTTDWAMIEMIRNPRIMKKAQDEVRDVIKMKGRVDEKCINELSYLKSVVKETLRLHPSV  372

Query  500   PLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNG  321
             PL+  REC +   I+ GY IPVKTKV++NA+A+A DP YW EPE+F PERF DNG+D+ G
Sbjct  373   PLLLPRECGKACEIH-GYHIPVKTKVIINAWAIARDPNYWTEPEKFYPERFIDNGIDYKG  431

Query  320   SHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVA  141
             S+F+Y+PFG GRRICPG  FG  N    LA LLY+FDWKLP G+  + LDMTE  G+ + 
Sbjct  432   SNFEYIPFGGGRRICPGSTFGLRNVELALAMLLYHFDWKLPGGIKCDELDMTEQFGVTMR  491

Query  140   RKND  129
             RK+D
Sbjct  492   RKDD  495



>gb|AET00662.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 327/493 (66%), Gaps = 5/493 (1%)
 Frame = -2

Query  1595  LDRSNIMENLISFALFVSFLVL--VYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLP  1425
             ++  N   N+I    F+  LVL  +  +W       K+PPGP +LP+IGNL  I    LP
Sbjct  1     MELHNPFSNIIFMLSFLILLVLFKIVKRWSFNNSTTKLPPGPWELPLIGNLHQIISRSLP  60

Query  1424  HRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNN  1245
             H   + LA KYG LM L++GE+  ++VSSP++AKE ++THDL F+ R   L  +IL YN 
Sbjct  61    HHRFKILADKYGPLMHLKLGEVPYIIVSSPEIAKEIMKTHDLTFSDRPNLLLATILTYNA  120

Query  1244  SDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSER  1065
             +D++   YG+ WRQ+RKIC+ ELL+ + V+SF S R DE+  L   + +S G   N++ +
Sbjct  121   TDVIFSKYGERWRQLRKICVVELLSAKRVQSFRSTREDEVSNLATSITASEGSIVNLTHK  180

Query  1064  IFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEI  885
             IF  T  I  RAAFG+    ++ F    ++I  L G     D++PS K L  +   K+++
Sbjct  181   IFSMTYGITTRAAFGKRSKHQQSFKSAVEEIVSLLGGICIVDLYPSIKLLQCVSRAKAKM  240

Query  884   LKTHRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIID  708
              K H++ D I++ II+DH++  +  + E+ ++DVLLK+  ++ + Q P+T DNIK+II D
Sbjct  241   EKLHKEIDMILQDIIDDHKSIHKEDSNEEYLVDVLLKIQQENYHSQHPLTDDNIKSIIQD  300

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             +F AG+ETS+TT +WA+SEM+KNP+V+ +AQAEVR VF  K  ++E+++ QL YLK+V+K
Sbjct  301   IFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEVRRVFDRKGFVDETELHQLIYLKSVIK  360

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ET+R HP  PL+  RE RE   IN GY IP KT+VMVNA+A+  DP+YW + E F PERF
Sbjct  361   ETMRLHPTVPLLLPRESRERCQIN-GYEIPAKTRVMVNAWAIGRDPRYWVDAESFKPERF  419

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
              ++ +DF G+ F+Y+PFGAGRR+CPG+AF   N   PLA LLY+FDWKLP  +  E LDM
Sbjct  420   VNSPIDFKGTDFEYIPFGAGRRMCPGIAFALPNVELPLASLLYHFDWKLPNKMKNEELDM  479

Query  167   TEMLGLAVARKND  129
             TE  G+   RK++
Sbjct  480   TESFGITAGRKHN  492



>ref|XP_004516744.1| PREDICTED: cytochrome P450 71D10-like [Cicer arietinum]
Length=502

 Score =   448 bits (1152),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 236/490 (48%), Positives = 324/490 (66%), Gaps = 7/490 (1%)
 Frame = -2

Query  1583  NIMENLISFALFVSFLVL--VYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRAL  1413
             N   N+   A FV  L++  ++ +W  K     +PPGP  LP+IGN+  I    LPH   
Sbjct  5     NPFTNITFIASFVFILMIFKIFKRWSSKSSTTNLPPGPWTLPLIGNIYQIISNSLPHHCF  64

Query  1412  RDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIV  1233
             ++LA KYG LM L++GEIS V+VSSP+MAKE ++THD  F  R   L  SIL YN SDI 
Sbjct  65    KNLAEKYGPLMHLKLGEISHVIVSSPEMAKEVMKTHDFTFCDRPSLLLLSILTYNGSDIA  124

Query  1232  LGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLF  1053
                YG+ WRQ+RK+ + ELLN + V+SF SIR +E+  L+  +  S G   N+++ I+  
Sbjct  125   FSKYGEKWRQLRKMIVVELLNAKRVQSFRSIREEEVSDLVKSIYESEGSVVNLTKMIYSM  184

Query  1052  TSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKA-LHPLFGNKSEILKT  876
             T  I  RAAFG+    ++ FI   + I ++ G F  AD+FPS K  L  +   K++  K 
Sbjct  185   TYGITGRAAFGKKNQQQQVFISAFEKILIILGGFCIADLFPSIKILLERVSSTKTKFEKL  244

Query  875   HRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIIDMFG  699
              R+TD I++ IINDH+N  +    ED ++DVLLKL  ++ + + P+T DNIK++I D+F 
Sbjct  245   CRETDGILQDIINDHKNSDKEARDED-LVDVLLKLQQENKHSENPLTDDNIKSVIQDLFA  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AGSETS++T +W MSEM+KNP+V+ +AQAEVR V+  K  ++E+++ QL YLK+V+KETL
Sbjct  304   AGSETSSSTVLWGMSEMVKNPKVMEEAQAEVRRVYGSKGYVDETELNQLIYLKSVIKETL  363

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  RE RE+  IN GY IP KT V VN +A+  DP+YW E E F PERFE++
Sbjct  364   RLHPPIPLLVPRESREKCQIN-GYDIPAKTIVAVNVWAIGRDPRYWVEAESFKPERFENS  422

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              VDF G+ F+ +PFGAGRR+CPG+ F   N   PLA LLY+FDWKLP G+  E L+MTE 
Sbjct  423   LVDFRGTDFELLPFGAGRRVCPGIIFAIPNIELPLAQLLYHFDWKLPNGLKNEELNMTEQ  482

Query  158   LGLAVARKND  129
              G+ V RK+D
Sbjct  483   FGITVGRKHD  492



>ref|XP_006351653.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   447 bits (1151),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 235/486 (48%), Positives = 326/486 (67%), Gaps = 13/486 (3%)
 Frame = -2

Query  1556  ALFVSFLVLVYTQWKKQ--RRGKMPPGPRKLPIIGNLLHI----TGPVLPHRALRDLARK  1395
             ALF+   +LV T+W K+   + K+PPGP KLP IGNL H+    +  +LPHR L  LA K
Sbjct  9     ALFLVLPLLV-TKWYKECNSKKKLPPGPWKLPFIGNLHHLVDWQSSELLPHRTLAKLASK  67

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG LM +++GE  A+VVSSP M +E +R HDL F+ R   L G+ + Y+++D+    YGD
Sbjct  68    YGDLMHMKLGEREAIVVSSPQMVREVMRKHDLNFSNRPTLLVGTEMFYDHADMGFCNYGD  127

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSA---GRPFNVSERIFLFTSS  1044
             +WRQMRKICI ELL+ + ++SF     +EI  L+  ++SSA   G   N+++ + L+T+S
Sbjct  128   FWRQMRKICIQELLSHKNIQSFYPNMLNEITNLVTSIKSSASEGGSSINMTDTLSLYTNS  187

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             IIC+A+ G     +   I+  + ++   G FD AD+FPS K +H + G K ++ K H + 
Sbjct  188   IICKASVGRACKSQGSLIEIMRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEV  247

Query  863   DSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSET  684
             D ++E IIN+H  +  S T E+ I+DVLL+L  S +  +PIT DNIKAIIID+F  GS T
Sbjct  248   DVLLEEIINEHEFQ-NSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFSGGSTT  306

Query  683   STTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKE-MLEESDVEQLPYLKTVVKETLRCHP  507
             S +T  WA SE+MK P ++ KAQ EVREVFKGKE  ++++D+++L Y+K VVKET+R HP
Sbjct  307   SASTMEWAFSELMKKPEIMKKAQDEVREVFKGKETTIDQADIQKLKYIKMVVKETVRFHP  366

Query  506   PTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDF  327
               PL+A RE REE  IN GY IP  T  +VN +A++ DP+YW+ PE F PERF D+ +DF
Sbjct  367   LAPLLAPRESREECEIN-GYVIPKGTMALVNFWAISRDPKYWQNPEVFDPERFNDSHLDF  425

Query  326   NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLA  147
              G+HF++ PFG GRRICPGL+F  A     +A LLY+FDWKLP G+    LDMTE    A
Sbjct  426   IGAHFEFTPFGTGRRICPGLSFSMATVELSIALLLYHFDWKLPNGMNPHELDMTEKFSNA  485

Query  146   VARKND  129
             + RKN+
Sbjct  486   LERKNN  491



>dbj|BAM68812.1| cytochrome P450 monooxygenase CYP71AV10 [Artemisia campestris]
Length=495

 Score =   447 bits (1150),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 324/474 (68%), Gaps = 7/474 (1%)
 Frame = -2

Query  1547  VSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQI  1368
             + FLV  +    K  +  +P  P +LPIIG++ H+ G + PHR L DLARKYG LM LQ+
Sbjct  21    IFFLVYKFATDSKSTKNSLPE-PWRLPIIGHMHHLIGTI-PHRGLMDLARKYGSLMHLQL  78

Query  1367  GEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKIC  1188
             GE+S +VVSSP  AKE   T+D+ F  R ETL+G I+ Y+N+DIV  PYG+YWRQ+RK+C
Sbjct  79    GEVSTIVVSSPKWAKEIFTTYDITFPNRPETLSGEIVAYHNTDIVFAPYGEYWRQVRKLC  138

Query  1187  ITELLNPRLVRSFSSIRHDEIHRLLADVRSS-AGRPFNVSERIFLFTSSIICRAAFGEVF  1011
               +LL+ + V+S+ S+R +E   L+ ++++S +GRP N+SE IF+  ++I+CR+AFG+  
Sbjct  139   TLDLLSVKKVKSYQSLREEECWNLVQEIKASGSGRPVNLSENIFMLIATILCRSAFGKGI  198

Query  1010  DGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDH  831
               +++F +  K++   TG FD AD+FPS K LH L G ++ +   H+K D++I +I+ +H
Sbjct  199   KDQKEFTENMKEMLRQTGGFDVADIFPSKKFLHYLSGKRARLTSIHKKLDNLINNIVAEH  258

Query  830   RNKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSE  651
               K  S T E  ++DVLL++ DS   Q  +T DN+KAII+D+F  G+ +S  T  WA+SE
Sbjct  259   TVKTASKTKE-TLLDVLLRVKDSTEFQ--LTADNVKAIILDVFTGGTNSSAATIEWAISE  315

Query  650   MMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECRE  471
             ++K PR + K QAE+R+   GKE + E D+++L YL  V+KETLR HPP PLI  REC +
Sbjct  316   LIKCPRAMEKVQAELRKALNGKEKIHEEDIQELSYLNLVIKETLRLHPPLPLILRRECHQ  375

Query  470   ETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGA  291
                +  GY IP KT++M N +A+  DP++W++ E F+PERFE++     G+ ++Y+PFGA
Sbjct  376   PVNL-AGYNIPNKTRLMFNVFAINRDPEFWKDAETFLPERFENSSTTVMGAEYEYLPFGA  434

Query  290   GRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             GRR+CPG A G AN   PLA +LY+F+WKLP G + + ++MTE  GL V RK +
Sbjct  435   GRRMCPGAALGLANVQLPLASILYHFNWKLPNGASYDQINMTERYGLNVVRKAE  488



>ref|XP_007147597.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
 gb|ESW19591.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
Length=506

 Score =   447 bits (1150),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 236/460 (51%), Positives = 321/460 (70%), Gaps = 7/460 (2%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHIT-GPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKE  1320
             ++PPGP KLPIIGNL  +     LPHRAL +LA+KYG LM LQ+G+ISAV+VSSP +AKE
Sbjct  31    RLPPGPWKLPIIGNLHQLAVASTLPHRALGELAQKYGPLMHLQLGQISAVIVSSPSIAKE  90

Query  1319  FLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSI  1140
              ++THDLAFA R + LA  I+ Y + DI   PYGDYWRQMRK+C  ELL+ + V+SF  I
Sbjct  91    IMKTHDLAFAQRPKFLASDIMGYGSGDIAFAPYGDYWRQMRKLCTLELLSAKKVQSFFHI  150

Query  1139  RHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLT  960
             R +E+ +L+  ++SSAG P ++S R   F S+ + RA FG++ +  E+F+   K+   + 
Sbjct  151   REEEVAKLIKTIQSSAGEPIDLSSRFGSFISTFVSRATFGKINEDHEEFVLTVKEAIEVA  210

Query  959   GSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTGE---DCII  789
               FD AD FPS+K +H + G K+++ K H+K+D I+E II +  N+   G GE   + ++
Sbjct  211   DGFDLADAFPSFKPIHLITGLKAKLDKMHKKSDKILEKIIRE--NQANEGMGEENNENLV  268

Query  788   DVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAE  609
             +VLL+    GNL  PIT++NIKA+I D+F AG++TST    WAMSEMM+NPRV  KAQ E
Sbjct  269   EVLLRFQHRGNLDTPITNNNIKAVIWDIFSAGTDTSTKVLEWAMSEMMRNPRVREKAQYE  328

Query  608   VREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKT  429
             +R+ F  KE   ES++ +L YLK V++ETLR HPP PL+  REC E   I+ GY IP+KT
Sbjct  329   IRQKFSLKETTHESNLGELTYLKAVIRETLRLHPPLPLLLPRECIETCSID-GYDIPIKT  387

Query  428   KVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFAN  249
             KV+VNA+A+  D  +W + E FIPERF D  +DF G+ F+Y+PFGAGRR+CPG++FG AN
Sbjct  388   KVIVNAWAIGRDADHWHDSESFIPERFHDTCIDFKGTDFEYIPFGAGRRMCPGISFGIAN  447

Query  248   TISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
                 LA LLY+F+W+LPEG+    LDM E  G  V RKN+
Sbjct  448   VELALAKLLYHFNWELPEGMKPGELDMDEAFGAVVGRKNN  487



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   447 bits (1151),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 239/497 (48%), Positives = 333/497 (67%), Gaps = 27/497 (5%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQRR--GKMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             L+SF  F      +Y  ++K R    K+PP P KLP+IG+L HI    LPHR+ + L+ K
Sbjct  15    LLSFIFF-----FIYKGYRKSRNTTAKLPPSPWKLPLIGHLHHIGK--LPHRSFQKLSEK  67

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             +G LM + +GE++A+VVSSP +AK+ L+ HD  FA R  T+AG IL YN+S+I    YGD
Sbjct  68    HGPLMHVMLGEVTAIVVSSPALAKQVLKAHDPTFADRPVTIAGEILWYNSSNISFSQYGD  127

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWRQMRKICI ELL+ + V+SFSSIR+DE+ +L+  ++ S+    +++E+IF  TSSI C
Sbjct  128   YWRQMRKICILELLSAKNVKSFSSIRNDEVSQLIESIKISSST-VDLTEKIFGMTSSITC  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             RAAFG+V   ++Q I   K+   L   FD +D++PS K L  L  N+  ++K   K D I
Sbjct  187   RAAFGKVCKDKDQLIGMFKEGITLVSGFDVSDLYPSSKMLKALSCNRMRLMKMRLKLDLI  246

Query  854   IESIINDHRNKLES------------GTGE---DCIIDVLLKLMDSGNLQVPITHDNIKA  720
             ++ +I++HR  LE             G GE   + ++DVLL++ +SG L+ PI+ DNIKA
Sbjct  247   LDDVIDEHRRNLEKIVFADEENSERRGNGEFGNEDLVDVLLRVKESGELEFPISDDNIKA  306

Query  719   IIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLK  540
             +I D+F AG+ETS+TT  W M+E+++NPRV++K Q E+RE FK      ESDV++L YLK
Sbjct  307   VIYDIFAAGTETSSTTIDWIMAELIRNPRVMSKLQTEIRETFKDNPNFGESDVQKLKYLK  366

Query  539   TVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfi  360
              V+KE  R H P PLI  R  R +T I  GY IP+  KV+VNA+A+  DP  W +PERF 
Sbjct  367   LVIKEGFRLHAPIPLIP-RVSRADTEIE-GYVIPIGAKVLVNAWAMGRDPGLWSDPERFE  424

Query  359   perfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAE  180
             PERFE++  DF G+ F+Y+PFGAGRR+CPG+ FG A+   PLAHLLY+FDWKLP G+++ 
Sbjct  425   PERFENDPRDFTGNDFEYIPFGAGRRMCPGMTFGLASVELPLAHLLYSFDWKLPAGMSSG  484

Query  179   TLDMTEMLGLAVARKND  129
              LDMTE   +  AR+ +
Sbjct  485   DLDMTERPAITAARRQN  501



>ref|XP_011097781.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=505

 Score =   447 bits (1149),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 237/488 (49%), Positives = 317/488 (65%), Gaps = 14/488 (3%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRG----KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARK  1395
             SF L VS  VL+ T  +   +     K PPGPRKLP+IGNL        PH  LRDLA K
Sbjct  7     SFTLLVSLFVLLITLLRAATQSRTDVKCPPGPRKLPLIGNLHLFASFRPPHHTLRDLASK  66

Query  1394  YGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGD  1215
             YG +M L++GE+ AVVVSS + AK+ L+THD  FA R   L   IL Y N++I   PYGD
Sbjct  67    YGPVMHLKLGEVDAVVVSSAEAAKQVLKTHDANFAYRPSLLVTEILCYGNTNIAFAPYGD  126

Query  1214  YWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIIC  1035
             YWRQ+RKIC  ELL+ + V+SF  IR  E   L   + S  G   N++ERI L TS ++ 
Sbjct  127   YWRQLRKICTLELLSVKRVQSFRHIREGEFLNLCRWIASQTGALINLTERINLSTSDVVT  186

Query  1034  RAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSI  855
             +A  G+  + +  FI   K+ + L   F   D++PS K    + G K  + + H+++D I
Sbjct  187   QATLGKKTEEQAAFISVIKEATELAAGFHIGDVYPSIKLFSRVSGMKGRVERLHKESDRI  246

Query  854   IESIINDHR------NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAG  693
             +E+IINDHR      N  ES   +D +IDVLLK  DSG+ ++ +T DN+K+++ DMF AG
Sbjct  247   LENIINDHRATNAATNNNESKNHQD-LIDVLLKFHDSGD-ELHLTIDNLKSVLQDMFSAG  304

Query  692   SETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRC  513
             SETS+TT  WAM+EM+K+PR+L KAQ EVR+VF  K  ++E  + +L YLK V+KE LR 
Sbjct  305   SETSSTTIDWAMAEMLKHPRILKKAQDEVRQVFNKKGCVDEDYIHELKYLKCVIKECLRM  364

Query  512   HPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfED-NG  336
             HPP PL+  REC E   I+ GY IP +T+VMVNA+AL  DP+YW+E E F PER+ + N 
Sbjct  365   HPPIPLLLPRECHEGCAID-GYEIPARTRVMVNAWALGRDPRYWKEAESFKPERYLEINS  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
              D+ GS+F+Y+PFG GRRICPG++FG AN   PLA LLY+F+W LP+G+  E +DM E  
Sbjct  424   ADYKGSNFEYIPFGGGRRICPGMSFGLANVELPLAMLLYHFNWILPQGMKPERVDMMETF  483

Query  155   GLAVARKN  132
             G+   RKN
Sbjct  484   GVTARRKN  491



>gb|KCW68416.1| hypothetical protein EUGRSUZ_F02065 [Eucalyptus grandis]
Length=530

 Score =   447 bits (1151),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 232/460 (50%), Positives = 311/460 (68%), Gaps = 6/460 (1%)
 Frame = -2

Query  1496  KMPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEF  1317
             K+PPGPRKLP+IGNL  + G   PHRALRDLA+K+G LM LQ+GE+  V+VSS +MAKE 
Sbjct  54    KLPPGPRKLPLIGNLHQLLGSP-PHRALRDLAKKHGPLMHLQLGEVPHVIVSSAEMAKEV  112

Query  1316  LRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIR  1137
             ++THDL FATR   LA  ++ Y ++DI   PYG+YWRQ+RKIC  EL + + V+SF  IR
Sbjct  113   MKTHDLTFATRPPLLASEVMSYGSTDIAFAPYGEYWRQLRKICTLELFSVKRVQSFRHIR  172

Query  1136  HDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTG  957
              +E   L+  V S+AG P N+++++F         AAFG+ F  +E+FI    + + L  
Sbjct  173   EEETSNLVKWVASNAGSPINLTQKLFSTNYGATSIAAFGKKFKEQEEFISVVTEANKLAA  232

Query  956   SFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESII----NDHRNKLESGTGEDCII  789
              F+  D+FPS K LH +   K  + K HR+ D ++ +II     +   + +  T  D +I
Sbjct  233   GFEVGDVFPSSKWLHVISRMKPRLEKLHRQADHMMNNIIRERREERAKRRDDETRHDDLI  292

Query  788   DVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAE  609
             DVLL+  D G  +  +T DNIKA+I+D+F AG ETS T   WA++EMMKNPR+L KAQAE
Sbjct  293   DVLLRFADPGGPEFSLTADNIKAVILDIFVAGGETSATQVDWALAEMMKNPRILKKAQAE  352

Query  608   VREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKT  429
             VREVF  +   +E  + +L YLK V+KE+LR  P  PL+  REC E   IN GY IPVKT
Sbjct  353   VREVFDRRGKADEMGLPELEYLKLVIKESLRMRPSVPLLLPRECGERCEIN-GYEIPVKT  411

Query  428   KVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFAN  249
             KV+VNA+A+  DP+YW+ PE F PERF+D+ VD+ G+ F+Y+PFGAGRR+CPG+ FG  N
Sbjct  412   KVVVNAWAIGRDPKYWDNPEVFYPERFKDSPVDYKGTSFEYIPFGAGRRMCPGMNFGIVN  471

Query  248   TISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
                PLA LLY+FDW+LPEG+  E LDM+E+LG    RK D
Sbjct  472   VELPLAMLLYHFDWELPEGMKREELDMSELLGATQRRKRD  511



>ref|XP_006474921.1| PREDICTED: cytochrome P450 71D11-like isoform X2 [Citrus sinensis]
Length=507

 Score =   446 bits (1148),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 314/460 (68%), Gaps = 12/460 (3%)
 Frame = -2

Query  1490  PPGPRKLPIIGNLLHITGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLR  1311
             PPGP KLP+IGNL  + G  LPH  LRDL++KYG LM LQ+GE+  ++VSSP++AKE ++
Sbjct  40    PPGPWKLPVIGNLYQLAGS-LPHHGLRDLSKKYGPLMLLQLGEVPTIIVSSPEVAKEVMK  98

Query  1310  THDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHD  1131
             THD+ FA+R    A  IL YN  DI+   YGD W+Q+RKIC++ELL+ + V+SF SIR  
Sbjct  99    THDVVFASRPHFPAAQILSYNYRDIIFSSYGDSWKQLRKICVSELLSAKRVQSFQSIREA  158

Query  1130  EIHRLLADVRSSAGRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSF  951
             E+  L+  + S AG   N+++ +      I  RAAFG     +E F+   ++ + +   F
Sbjct  159   EVSDLINWISSKAGSVINLTQNVHSLMYGITSRAAFGNRSRDQEAFVAVIEETTKVISGF  218

Query  950   DFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNK------LESGTGEDCII  789
             + AD+FPS   L  L GNKS++   H++   I+E+IIN+H+ +       ++G  ED ++
Sbjct  219   NIADVFPSIGLLQWLTGNKSQVETLHQEGVRIVENIINEHKKRKATLKNCKTGDDED-LV  277

Query  788   DVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAE  609
             DVLLK+   G+L   +T D+IKA   D+F AGSETS TT  WAM EMMKNPRV+ KAQAE
Sbjct  278   DVLLKIQGHGDLDSFLTTDHIKA---DIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAE  334

Query  608   VREVFKGKEMLEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKT  429
             VREVF     + E+ ++++ +LK VVKETLR HP  PL+  REC +   IN G+ IPVK 
Sbjct  335   VREVFHRTGKVNETSIDEMKFLKLVVKETLRLHPAAPLLIPRECGQRCQIN-GFDIPVKA  393

Query  428   KVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFAN  249
             +V+VNA+A+  DP+YW EPE FIPERF D+ VD+ G++F+Y+PFGAGRRICPG++FG A+
Sbjct  394   RVIVNAWAIGRDPEYWTEPESFIPERFLDHSVDYKGTNFEYIPFGAGRRICPGMSFGLAS  453

Query  248   TISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
                PLA LLY+FDWKLP G+  E LDMTE  G+ V RK D
Sbjct  454   VELPLAMLLYHFDWKLPNGIKHEDLDMTEAFGVTVRRKQD  493



>ref|XP_007213458.1| hypothetical protein PRUPE_ppa024556mg [Prunus persica]
 gb|EMJ14657.1| hypothetical protein PRUPE_ppa024556mg [Prunus persica]
Length=507

 Score =   446 bits (1148),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 229/497 (46%), Positives = 331/497 (67%), Gaps = 17/497 (3%)
 Frame = -2

Query  1577  MENLISFALFVS---FLVLVYTQWKK-QRRG--KMPPGPRKLPIIGNLLHITGPVLPHRA  1416
             M  L SF +F++   FL++++  WKK Q +G  K+PPGP++LPIIGN+  + G  LPH A
Sbjct  1     MLQLPSFFVFLASLFFLLMLFKYWKKSQAKGLSKLPPGPKQLPIIGNVHQLIG-ALPHHA  59

Query  1415  LRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDI  1236
             + DL  K+G +M LQ+GEI AV++SSP+ AKE L+T +++FA R E  A  I+  ++S I
Sbjct  60    VTDLCNKHGPVMKLQLGEIFAVIISSPEAAKEVLKTSEISFAQRPEVCAVEIMAEDHSGI  119

Query  1235  VLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFL  1056
             V  PY +YWRQ+RKI + ELL+   VRSF SIR +E+  L+  + +S G   N+S++I+ 
Sbjct  120   VFAPYNEYWRQLRKISVMELLSANRVRSFRSIREEEVWNLVEFIAASEGHTINLSDKIYT  179

Query  1055  FTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKT  876
              ++ ++ RAAFG     + +FI   ++  +  G F+ AD++PS   L  + G K  ++K 
Sbjct  180   MSNDVVARAAFGNKCKYKHEFILLLEETMLFVGGFNIADLYPSLTFLRSMSGMKPALMKI  239

Query  875   HRKTDSIIESIINDHRNKLES--------GTGEDCIIDVLLKLMDSGNLQVPITHDNIKA  720
              +K D I++ I+++H+ K E+        G  E+ ++D  L   ++   +  +T D IKA
Sbjct  240   QKKIDEILQDIVSEHKMKREASRKGFGKIGVDEEDLVDTFLNYEEADKHEFHLTTDQIKA  299

Query  719   IIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLK  540
             +I+D+F AGSETS TT  WAMSE++KNPRV+ KAQ EVR+VFKGK  +EE DVE+L YLK
Sbjct  300   VIMDIFSAGSETSATTMEWAMSELLKNPRVMEKAQLEVRQVFKGKNKIEEEDVEKLHYLK  359

Query  539   TVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfi  360
              V+KET R HPP PLI  RE RE   I GGYTIP K K+++NAYA+  DP+ W +PE F 
Sbjct  360   LVMKETFRLHPPVPLIP-REARERCEI-GGYTIPAKAKILINAYAIGRDPKLWADPECFQ  417

Query  359   perfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAE  180
             PERF+ + +DF G++F+ +PFGAGRR+CPG++F  +     LA LLY+F+W LP G   E
Sbjct  418   PERFQGSSIDFKGNNFELLPFGAGRRMCPGISFATSKVELGLAQLLYHFNWNLPNGTKLE  477

Query  179   TLDMTEMLGLAVARKND  129
              LDM E  G+A  +KN+
Sbjct  478   ALDMAEKFGMAARKKNN  494



>ref|XP_010061471.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=503

 Score =   446 bits (1147),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 239/489 (49%), Positives = 325/489 (66%), Gaps = 13/489 (3%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQW--KKQRRG--KMPPGPRKLPIIGNLLHITG-PVLPHRALRDL  1404
             + +FA  VSF + +  +   K + +G  K+PPGPRKLP+IGNL  + G P+L  RALRDL
Sbjct  5     VFAFASIVSFCIFILRKLCDKSEMKGLPKLPPGPRKLPLIGNLHQLLGSPLL--RALRDL  62

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A+K+G LM LQ+GE+  V+VSS +MAKE ++THDL FA R   LA  ++ Y ++ I   P
Sbjct  63    AKKHGPLMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFAMRPPLLASEVMSYGSTSIAFAP  122

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             YG+YWRQ+RKI   ELL+ + V+SF  IR +E   L+  V S+AG P N+++++F     
Sbjct  123   YGEYWRQIRKISTLELLSAKRVQSFRHIREEETLNLVKWVASNAGSPINLTQKLFSTNYG  182

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
                 AAFG+ F  +E+FI      + L   F+  D FPS K LH +   K  + K HR+ 
Sbjct  183   ATSIAAFGKKFKEQEEFISVVTKANKLAAGFEVGDAFPSSKWLHVISRMKPRLEKLHRQA  242

Query  863   DSIIESIINDHR----NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             D ++ ++I + R     + +  T  D +IDVLL+  D G  +  +T DNIKA+I+D+F A
Sbjct  243   DRMMNNVIREKREERAKRRDDETRHDDLIDVLLRFADPGGPEFSLTTDNIKAVILDIFVA  302

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             G ETS T   WA++EMMKNPR+L KAQAEVREVF  +   +E+ + +L YLK V+KE LR
Sbjct  303   GGETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADETGLPELEYLKLVIKECLR  362

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
              HP  PL+  RECRE   IN GY IPVKTKV+VNA+A+  DP+YW+ PE F PERF+D+ 
Sbjct  363   MHPSIPLL-LRECRERFEIN-GYEIPVKTKVVVNAWAIGRDPKYWDNPEAFYPERFKDSP  420

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             VD+ G+ F+Y+PFGAGRR+CPG+ FG  N   PLA LLY+FDW+LPEG+  E LDM E+L
Sbjct  421   VDYKGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAMLLYHFDWELPEGMKREELDMGELL  480

Query  155   GLAVARKND  129
             G+   RK D
Sbjct  481   GVTQRRKRD  489



>ref|XP_003617705.1| Cytochrome P450 [Medicago truncatula]
 gb|AET00664.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/493 (47%), Positives = 324/493 (66%), Gaps = 5/493 (1%)
 Frame = -2

Query  1595  LDRSNIMENLISFALFVSFLVL--VYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLP  1425
             ++  N   N+I    F+  LVL  +  +W       K+PPGP KLP+IGNL  I    LP
Sbjct  1     MELQNPFSNIIFMLSFLILLVLFKIVQRWSFNNSTTKLPPGPWKLPLIGNLHQIISRSLP  60

Query  1424  HRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNN  1245
             H   + LA KYG LM L++GE+  V+VSSP+MAKE ++THDL F  R   L  +I  YN 
Sbjct  61    HHLFKKLAEKYGPLMHLKLGEVPYVIVSSPEMAKEVMKTHDLTFCDRPNLLLSTIWSYNA  120

Query  1244  SDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSER  1065
             ++IV   Y ++WRQ+RKIC+ ELL+ + V+SF SIR DE+  L+  + +S G   N++ +
Sbjct  121   TNIVFATYCEHWRQVRKICVIELLSAKRVQSFRSIREDEVTNLVKSITASEGSVVNLTRK  180

Query  1064  IFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEI  885
             IF  T+ I  RAAFG+    ++ FI   + + VL G F+ AD++PS K L  +   K+++
Sbjct  181   IFSMTNGITARAAFGKRNRNQDVFISAMEKVLVLLGGFEIADLYPSIKMLQCMSREKTKM  240

Query  884   LKTHRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKLMDSGNL-QVPITHDNIKAIIID  708
              K HR+ D I++ II+DHR+  +  + ++ ++DVLLK+       + P+T DN+K+II D
Sbjct  241   EKIHRELDMIMQDIIDDHRSIHKEASNDEDLVDVLLKIQQENYYSEHPLTDDNMKSIIQD  300

Query  707   MFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVK  528
             MF AG+ETS+   +WAMSEM+KNP+VL +AQ EVR VF  K  ++ES++ QL YLK+VVK
Sbjct  301   MFIAGTETSSEVLLWAMSEMVKNPKVLEEAQIEVRRVFDKKGYVDESELHQLIYLKSVVK  360

Query  527   ETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperf  348
             ETLR HP  PL+  RE  +   IN GY IP KT+VMVNA+A+  D +YW E E F PERF
Sbjct  361   ETLRLHPVAPLLIPRESMKPCQIN-GYEIPAKTRVMVNAWAIGRDSRYWVEAESFKPERF  419

Query  347   EDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDM  168
              ++ ++F G+ F+++PFGAGRR+CPG+AF   N   PLA LL +FDWKLP  +  E LDM
Sbjct  420   VNSTIEFKGTDFEFIPFGAGRRMCPGIAFALPNIELPLAQLLCHFDWKLPNKMKNEELDM  479

Query  167   TEMLGLAVARKND  129
             TE  G+ V RK+D
Sbjct  480   TESFGITVGRKHD  492



>ref|XP_003519623.2| PREDICTED: cytochrome P450 71D10-like [Glycine max]
Length=506

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 231/498 (46%), Positives = 320/498 (64%), Gaps = 19/498 (4%)
 Frame = -2

Query  1577  MENLISFALFVSFLVLVY-----TQWK---KQRRGKMPPGPRKLPIIGNLLHITGPVLPH  1422
             ME  IS +  + F +LV+       W+   K    K+PPGPRKLP+IGN+ H+    LPH
Sbjct  1     MELHISLSTILPFFILVFMLIINIVWRSKTKNSNSKLPPGPRKLPLIGNIHHLG--TLPH  58

Query  1421  RALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNS  1242
             R+L  LA +YG LM +Q+GE+S ++VSSP+MAKE ++THD+ FA R   LA  ++ Y + 
Sbjct  59    RSLARLANQYGPLMHMQLGELSCIMVSSPEMAKEVMKTHDIIFANRPYVLAADVITYGSK  118

Query  1241  DIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERI  1062
              +   P G YWRQMRKIC  ELL P+ V SF SIR  E+   + ++  S G P N+SE+I
Sbjct  119   GMTFSPQGTYWRQMRKICTMELLAPKRVDSFRSIREQELSIFVKEMSLSEGSPINLSEKI  178

Query  1061  FLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEIL  882
                   +I R AFG+    +E +I+  K ++     F  AD++PS   L  L G +  + 
Sbjct  179   SSLAYGLISRIAFGKKSKDQEAYIEFMKGVTDTVSGFSLADLYPSIGLLQVLTGIRPRVE  238

Query  881   KTHRKTDSIIESIINDHRNK-------LESGTGEDCIIDVLLKLMDSGNLQVPITHDNIK  723
             K  R  D II++I+ DHR+K       +    GED ++DVLL+L  +GNLQ P++   +K
Sbjct  239   KIRRGMDRIIDNIVRDHRDKNSDTQPVVGEENGED-LVDVLLRLQKNGNLQHPLSDTVVK  297

Query  722   AIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYL  543
             A I+D+F AGSET++TT  WAMSE++KNPR++ KAQ EVR VF  K  ++E+ + +L YL
Sbjct  298   ATIMDIFSAGSETTSTTMEWAMSELVKNPRMMEKAQIEVRRVFDPKGYVDETSIHELKYL  357

Query  542   KTVVKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperf  363
             ++V+KETLR H P PL+  REC E   IN GY IP K+KV+VNA+A+  DP YW E E+F
Sbjct  358   RSVIKETLRLHTPVPLLLPRECSERCEIN-GYEIPAKSKVIVNAWAIGRDPNYWIEAEKF  416

Query  362   iperfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTA  183
              PERF D  +D+ G  FQ++PFGAGRRICPG+  G  N    LA+LL++FDWK+  G + 
Sbjct  417   SPERFIDCSIDYKGGEFQFIPFGAGRRICPGINLGIVNVEFSLANLLFHFDWKMAPGNSP  476

Query  182   ETLDMTEMLGLAVARKND  129
             + LDMTE  GL++ RK D
Sbjct  477   QELDMTESFGLSLKRKQD  494



>ref|XP_008385924.1| PREDICTED: premnaspirodiene oxygenase-like [Malus domestica]
Length=506

 Score =   446 bits (1147),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 236/487 (48%), Positives = 331/487 (68%), Gaps = 11/487 (2%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQRRGK--MPPGPRKLPIIGNLLHITGPVLPHRALRDLARKYG  1389
             SF L  +FL+ +    K  +R K  +PPGP KLP IGNL  + G + PH  LRDLA+KYG
Sbjct  7     SFZLVATFLLFLIMILKIGKRAKINLPPGPWKLPFIGNLHQLVGSI-PHHGLRDLAKKYG  65

Query  1388  GLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYW  1209
              LM L++GE+S +VVSS + AKE ++THD+ FA+R   LA SIL Y +++I   PYGDYW
Sbjct  66    XLMHLKLGEVSTIVVSSAEFAKEVMKTHDVXFASRPHILANSILTYGDTNIGFAPYGDYW  125

Query  1208  RQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSIICRA  1029
             RQ+RKIC  ELL+ + V+SF S+R +E+  L+  +R  A  P N++E+I+ FT     RA
Sbjct  126   RQLRKICTLELLSMKRVQSFRSLREEEVFNLIKLIRLRAETPINITEQIYSFTYGFTSRA  185

Query  1028  AFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIE  849
             AFG     +++FI   K    + G FD AD+FPS   LH + G + ++ + H++ D I+E
Sbjct  186   AFGIKSKDQDKFIDIVKQAMKVAGGFDVADVFPSVSLLHLISGMRPKLERLHKEADRIME  245

Query  848   SIINDHRNKLESGTGEDC-----IIDVLLKLM-DSGNLQVPITHDNIKAIIIDMFGAGSE  687
             +II +H+  + +   +D      +IDVLLK   +   L+  +T DN+KAII++ FGAG E
Sbjct  246   NIIKEHKKDMATSKSQDVEAREDLIDVLLKFHEEESGLEFSLTADNVKAIILETFGAGGE  305

Query  686   TSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCHP  507
             T+ TT  WA+SEM+KNPR++ KAQAEVRE+F  K  ++E++++++ YL  V+KETLR HP
Sbjct  306   TAATTVNWAISEMIKNPRIMQKAQAEVREIFNXKXQVDETEIKEMMYLNLVIKETLRLHP  365

Query  506   PTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDF  327
             P PL+  RECRE   I+ GY IPVKTKV++NA+A+  DP YW  P+ F PERF D+ +D 
Sbjct  366   PFPLLLPRECRESCKID-GYEIPVKTKVVINAWAIGRDPNYWTNPDSFYPERFLDSSIDL  424

Query  326   NGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTA-ETLDMTEMLGL  150
              G +F+++PFGAGRR+CPG++FG A+   PLA LLY+FDWKL  G+   E LDMTE  G+
Sbjct  425   KGKNFEFIPFGAGRRMCPGMSFGLASVEFPLASLLYHFDWKLSXGMKHDEDLDMTEAFGV  484

Query  149   AVARKND  129
             +V RK D
Sbjct  485   SVRRKQD  491



>gb|KHG11859.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   446 bits (1147),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 323/487 (66%), Gaps = 8/487 (2%)
 Frame = -2

Query  1571  NLISFALFVSFLV--LVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVLPHRALRDLAR  1398
             N++   LF SF++  LV T   K+   ++PPGP KLP+IGN+  +    LPH  LR+LA 
Sbjct  13    NILLTILFFSFIITRLVKTLKAKKPSPRLPPGPWKLPLIGNIHQLVAVSLPHFTLRNLAL  72

Query  1397  KYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYG  1218
              +G LM LQ+GE+S VV+SSP+ A+E +R +D+ FA+R+  LA SI+ Y+ ++IV  PYG
Sbjct  73    NHGPLMHLQLGEVSTVVISSPEFAEEAMRKNDIIFASRSYQLAPSIISYDCTNIVFSPYG  132

Query  1217  DYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSSII  1038
              YWR + KIC+TELL+ + VRSF  +R + +  L+  + SS G P N+S++IF  T  I 
Sbjct  133   SYWRHLPKICVTELLSAQRVRSFRRVREEMVSNLIKTISSSQGSPINLSDQIFSLTYRIT  192

Query  1037  CRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDS  858
                AFG      E+F      ++ L+     AD FPS KA+  + G K ++ K H + D 
Sbjct  193   AAMAFGSKCSEEEKFKSIITKVAELSTGLTLADFFPSIKAVEVVSGIKPKLEKLHGEADR  252

Query  857   IIESIINDHRNKLESGTG----EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGS  690
             I+E+II++H+ +   G G    E  I+D+LL L   GNL  P++ +NIK++I+DMF AGS
Sbjct  253   ILENIISEHKERRVEGNGSGEDEKDIVDMLLNLQQHGNLDFPLSSNNIKSVILDMFAAGS  312

Query  689   ETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLRCH  510
             ETS+ +  WAMS+++KNP ++ KA AEVR+VF G   ++E+   +L +LK V+KETLR H
Sbjct  313   ETSSISVEWAMSQLLKNPSLMEKATAEVRQVFNGNGYVDEAQFGELKFLKLVIKETLRLH  372

Query  509   PPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVD  330
              P PLI  RECRE   + GGY IP  TKV++N++A+A D +YW EPE F PERF D+ +D
Sbjct  373   NPVPLIP-RECRENCKL-GGYDIPANTKVLINSWAIARDSRYWSEPESFNPERFLDSSLD  430

Query  329   FNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGL  150
             + G+ FQY+PFGAGRRICPG+ FG AN    LA L+Y+FDWKLP G+  E LDMT   GL
Sbjct  431   YKGTDFQYIPFGAGRRICPGITFGLANVEQQLAQLVYHFDWKLPNGMKCEDLDMTSGPGL  490

Query  149   AVARKND  129
              + RK+D
Sbjct  491   TIRRKHD  497



>gb|AGO03787.1| cytochrome P450 [Tanacetum cinerariifolium]
Length=498

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 228/488 (47%), Positives = 334/488 (68%), Gaps = 13/488 (3%)
 Frame = -2

Query  1568  LISFALFVSFLVLVYTQWKKQR-RGK----MPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
             ++ F + +  +VL Y    K+  RGK    +PPGP KLPIIGN+  + G + PHRA RDL
Sbjct  1     MVLFFIVLCLIVLSYFLLNKRSVRGKTSLNLPPGPSKLPIIGNIYQLAG-LPPHRAFRDL  59

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             ARK+G +M +Q+G+IS VV+SSP +AKE L+ HD+A A R  T    ++LY NSDI L P
Sbjct  60    ARKHGPIMHIQLGQISTVVISSPKLAKEALKIHDIALADRPVTFTSDLVLYGNSDIALAP  119

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             YG+YWRQM+KI   ELL+ + V+SF  IR  E+  L+  +R S+G+  N+ + I    ++
Sbjct  120   YGEYWRQMKKISSLELLSAKKVKSFGPIREQELDYLIDFLRLSSGKLVNLHQTITKSINN  179

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
             I+C A+FG+    + + ++    ++     F  AD+FP +K L+ + G +SE+LK +R  
Sbjct  180   IVCIASFGKNIKYQHELVEFLDMLARTNSGFYVADLFPKFKFLYFVSGMRSELLKLYRTL  239

Query  863   DSIIESIINDHR-----NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFG  699
             D + + I+ DH      +K + G  ED ++DVLL++ + G L+ PIT++NIKAI +D+F 
Sbjct  240   DKVFDDILKDHEQRRIIDKGDHGQEED-LLDVLLQVKNKGGLEFPITNNNIKAIFVDIFA  298

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
              G++TS+ T  WAM+EM+++PRV+ KAQ EVRE FKGK  ++E+D++ L YL +V+KETL
Sbjct  299   GGTDTSSNTIEWAMTEMIRHPRVMKKAQDEVREAFKGKTKIKETDIQCLTYLPSVIKETL  358

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R H P PL+  R CRE+  I GGY IPV TKV+VNA+A +TDP+YWE+ E F PERF+++
Sbjct  359   RLHVPLPLLIPRVCREQCKI-GGYDIPVNTKVIVNAFACSTDPEYWEDAETFKPERFDNS  417

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              VDF GS+++++PFG+GRR+CPG+ FG  +    LA +LY FDWKLP+G++   LDMTE+
Sbjct  418   SVDFTGSNYEFIPFGSGRRMCPGINFGLVSVKLFLAQMLYYFDWKLPDGLSPRKLDMTEI  477

Query  158   LGLAVARK  135
                 VA+K
Sbjct  478   ESSIVAKK  485



>ref|XP_004247352.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=502

 Score =   445 bits (1145),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 227/466 (49%), Positives = 318/466 (68%), Gaps = 10/466 (2%)
 Frame = -2

Query  1502  RGKMPPGPRKLPIIGNLLHI----TGPVLPHRALRDLARKYGGLMSLQIGEISAVVVSSP  1335
             + K+PPGP KLP+IGNL H+    +  +LPHR L  LA K+G LM +++GE  A+VVSSP
Sbjct  28    KKKLPPGPWKLPLIGNLHHLIDWQSSELLPHRTLAKLASKHGDLMHMKLGEREAIVVSSP  87

Query  1334  DMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGPYGDYWRQMRKICITELLNPRLVR  1155
              M +E +R HDL F+ R   L G+ + Y+++D+    YGD+WRQMRKICI ELL+ + ++
Sbjct  88    QMVREVMRKHDLIFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQELLSHKNIQ  147

Query  1154  SFSSIRHDEIHRLLADVRSSA---GRPFNVSERIFLFTSSIICRAAFGEVFDGREQFIQQ  984
             SF     +EI  L++ ++SSA   G   N++E + L+T+SIIC+A+ G     +   I+ 
Sbjct  148   SFYPNMMNEITNLVSCIKSSASEGGSSINMTETLSLYTNSIICKASVGRACKNQGSLIEI  207

Query  983   TKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKTDSIIESIINDHRNKLESGTG  804
              + ++   G FD AD+FPS K +H + G K ++ K H + D ++E IIN+H ++  S T 
Sbjct  208   MRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVVLEEIINEHESQ-NSETS  266

Query  803   EDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGAGSETSTTTSMWAMSEMMKNPRVLA  624
             E+ I+DVLL+L  S +  +PIT DNIKAIIID+F  GS TS +T  WA SE+MKNP ++ 
Sbjct  267   EEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFAGGSTTSASTMEWAFSELMKNPEIMK  326

Query  623   KAQAEVREVFKGKEM-LEESDVEQLPYLKTVVKETLRCHPPTPLIATRECREETVINGGY  447
             KAQ EVR+VFKGKE  ++++D+++L Y+K +VKET+R HP  PL+A RE REE  ING Y
Sbjct  327   KAQDEVRQVFKGKETTIDQADIQKLKYIKMIVKETVRFHPLAPLLAPRESREECEING-Y  385

Query  446   TIPVKTKVMVNAYALATDPQYWeeperfiperfEDNGVDFNGSHFQYVPFGAGRRICPGL  267
              IP  T  +VN +A++ DP YW+ PE F PERF D+ +DF G+HF++ PFG GRRICPGL
Sbjct  386   VIPKGTMALVNFWAISRDPNYWQNPEIFDPERFNDSHLDFIGAHFEFTPFGTGRRICPGL  445

Query  266   AFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEMLGLAVARKND  129
             +F  A     +A LLY+FDWKLP G+    LDMTE  G A+ RKN+
Sbjct  446   SFSMATVELSIALLLYHFDWKLPNGMNPHELDMTEKFGNALERKNN  491



>ref|XP_010064672.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=506

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 231/489 (47%), Positives = 322/489 (66%), Gaps = 12/489 (2%)
 Frame = -2

Query  1565  ISFALFVSFLVLVYTQWKKQRRG------KMPPGPRKLPIIGNLLHITGPVLPHRALRDL  1404
              +F + +SF + ++T  K  ++       K+PPGPRKLP+IGNL  + G    H AL +L
Sbjct  6     FAFPIVLSFFIFIFTAIKYSQKSDVKGLSKLPPGPRKLPVIGNLHQLLGSPA-HCALWEL  64

Query  1403  ARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLGP  1224
             A+ YG LM +Q GE+  VV+SS +MAKE ++THD+ FATR   LA  +L Y ++DI   P
Sbjct  65    AKIYGPLMHMQFGEVPHVVISSAEMAKEVMKTHDITFATRPRLLATEVLSYGSTDIAFAP  124

Query  1223  YGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTSS  1044
             Y +YWRQ+RKIC  ELL+ + V+SF  IR +EI  L+  V S+AG P N+++R+F     
Sbjct  125   YSEYWRQLRKICTLELLSAKRVQSFRHIREEEISNLVKWVASNAGSPINLTQRLFSTNYG  184

Query  1043  IICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRKT  864
                 AAFG+    +E+FI   K+   L   F+  D+FPS K LH + G K  + K  ++ 
Sbjct  185   ATSIAAFGKKVKEQEEFITIVKEAIRLAAGFEVGDVFPSLKWLHVITGMKPRLEKLRQQL  244

Query  863   DSIIESIINDHR----NKLESGTGEDCIIDVLLKLMDSGNLQVPITHDNIKAIIIDMFGA  696
             D I+ ++I +      N+    T  D ++DVLL+  D       +T DN+KA+++D+F A
Sbjct  245   DRIMNNLIREKEEERANRSSDETTLDGLVDVLLRFADPSGPDFFLTTDNVKAVLLDIFAA  304

Query  695   GSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETLR  516
             GSETS T   WA++EMMKNPR+L KAQAEVREVF  +   +E+ + +L YLK V+KE LR
Sbjct  305   GSETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADETGLPELEYLKLVIKECLR  364

Query  515   CHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDNG  336
               P  PL+  REC E   IN GY IPVKT+V+VNA+A+  DP+YW++PE F PERF+D+ 
Sbjct  365   LRPSIPLLLPRECTERCEIN-GYEIPVKTRVLVNAWAIGRDPKYWDDPESFYPERFKDSP  423

Query  335   VDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEML  156
             VD+ G+ F+Y+PFGAGRRICPG+ FG AN   PLA LLY+FDW+LPEG+ +E +DM+E L
Sbjct  424   VDYKGTSFEYIPFGAGRRICPGMNFGIANVELPLAMLLYHFDWELPEGMKSEEMDMSETL  483

Query  155   GLAVARKND  129
             G++  RK D
Sbjct  484   GVSQRRKRD  492



>ref|XP_003545101.1| PREDICTED: cytochrome P450 71D10-like [Glycine max]
 gb|KHN23857.1| Cytochrome P450 71D10 [Glycine soja]
Length=507

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 226/495 (46%), Positives = 320/495 (65%), Gaps = 15/495 (3%)
 Frame = -2

Query  1577  MENLISFALFVSFLVLVY----TQWK---KQRRGKMPPGPRKLPIIGNLLHITGPVLPHR  1419
             +E  IS ++ + F +LV+    T W+   K    K+PPGPRKLP+IG++ H+    LPHR
Sbjct  3     LELHISLSIILPFFLLVFILIITLWRSKTKNSNSKLPPGPRKLPLIGSIHHLG--TLPHR  60

Query  1418  ALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSD  1239
             +L  LA +YG LM +Q+GE+  +VVSSP+MAKE + THD+ FA R   LA  ++ Y +  
Sbjct  61    SLARLASQYGSLMHMQLGELYCIVVSSPEMAKEVMNTHDIIFANRPYVLAADVITYGSKG  120

Query  1238  IVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIF  1059
             +   P G Y RQMRKIC  ELL  + V+SF SIR  E+   + ++  S G P N+SE+I 
Sbjct  121   MTFSPQGTYLRQMRKICTMELLAQKRVQSFRSIREQELSIFVKEISLSEGSPINISEKIN  180

Query  1058  LFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILK  879
                  ++ R AFG+    ++ +I+  KD+      F  AD++PS   L  L G ++ + K
Sbjct  181   SLAYGLLSRIAFGKKSKDQQAYIEHMKDVIETVTGFSLADLYPSIGLLQVLTGIRTRVEK  240

Query  878   THRKTDSIIESIINDHRNKL--ESGTGEDC---IIDVLLKLMDSGNLQVPITHDNIKAII  714
              HR  D I+E+I+ DHR K       GED    ++DVLL+L  +G+LQ P++   +KA I
Sbjct  241   IHRGMDRILENIVRDHREKTLDTKAVGEDKGEDLVDVLLRLQKNGDLQHPLSDTVVKATI  300

Query  713   IDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTV  534
             +D+F AGS+TS+T  +W MSE++KNPRV+ K Q EVR VF GK  ++E+ + +L YL++V
Sbjct  301   LDIFSAGSDTSSTIMVWVMSELVKNPRVMEKVQIEVRRVFDGKGYVDETSIHELKYLRSV  360

Query  533   VKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfipe  354
             +KETLR HPP+P +  REC E   IN GY IP K+KV+VNA+A+  DP YW E E+F PE
Sbjct  361   IKETLRLHPPSPFLLPRECSERCEIN-GYEIPTKSKVIVNAWAIGRDPNYWVEAEKFSPE  419

Query  353   rfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETL  174
             RF D+ +D+ G  F+++PFGAGRRICPG+  G  N    LA+LL++FDW++ +G   E L
Sbjct  420   RFLDSPIDYKGGDFEFIPFGAGRRICPGINLGIVNVEFSLANLLFHFDWRMAQGNRPEEL  479

Query  173   DMTEMLGLAVARKND  129
             DMTE  GL+V RK D
Sbjct  480   DMTESFGLSVKRKQD  494



>ref|XP_004516745.1| PREDICTED: cytochrome P450 71D10-like [Cicer arietinum]
Length=502

 Score =   444 bits (1143),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/490 (48%), Positives = 323/490 (66%), Gaps = 7/490 (1%)
 Frame = -2

Query  1583  NIMENLISFALFVSFLVL--VYTQWK-KQRRGKMPPGPRKLPIIGNLLHITGPVLPHRAL  1413
             N   N+   A FV  L++  ++ +W  K     +PPGP  LP+IGN+  I    LPH   
Sbjct  5     NPFTNITFIASFVFLLMIFKIFKRWSSKNSTTNLPPGPWTLPLIGNIHQIISNSLPHHCF  64

Query  1412  RDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIV  1233
             ++LA KYG LM L++GEIS V+VSSP+MAKE ++THD  F  R   L  SIL YN SDI 
Sbjct  65    KNLAEKYGPLMHLKLGEISHVIVSSPEMAKEVMKTHDFTFCDRPSLLLLSILTYNGSDIA  124

Query  1232  LGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLF  1053
                YG+ WRQ+RK+ + ELLN + V+SF  IR +E+  L+  +  S G   N+++ I+  
Sbjct  125   FSKYGEKWRQLRKMIVVELLNAKRVQSFRPIREEEVSDLVKSIYESEGSVVNLTKMIYSM  184

Query  1052  TSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKA-LHPLFGNKSEILKT  876
             T  I  RAAFG+    ++ FI   + I ++ G F  AD+FPS K  L  +   K++  K 
Sbjct  185   TYGITGRAAFGKKNQQQQVFISAFEKILIILGGFCIADLFPSIKILLERVSSTKTKFEKL  244

Query  875   HRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKL-MDSGNLQVPITHDNIKAIIIDMFG  699
              R+TD I++ IINDH+N  +    ED ++DVLLKL  ++ + + P+T DNIK++I D+F 
Sbjct  245   CRETDGILQDIINDHKNSDKEARDED-LVDVLLKLQQENKHSENPLTDDNIKSVIQDLFA  303

Query  698   AGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKETL  519
             AGSETS++T +W MSEM+KNP+V+ +AQAEVR V+  K  ++E+++ QL YLK+V+KETL
Sbjct  304   AGSETSSSTVLWGMSEMVKNPKVMEEAQAEVRRVYGSKGYVDETELNQLIYLKSVIKETL  363

Query  518   RCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfEDN  339
             R HPP PL+  RE RE+  IN GY IP KT V VN +A+  DP+YW E E F PERFE++
Sbjct  364   RLHPPIPLLVPRESREKCQIN-GYDIPAKTIVAVNVWAIGRDPRYWVEAESFKPERFENS  422

Query  338   GVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLDMTEM  159
              VDF G+ F+ +PFGAGRR+CPG+ F   N   PLA LLY+FDWKLP G+  E L+MTE 
Sbjct  423   LVDFRGTDFELLPFGAGRRVCPGIIFAIPNIELPLAQLLYHFDWKLPNGLKNEELNMTEQ  482

Query  158   LGLAVARKND  129
              G+ V RK+D
Sbjct  483   FGITVGRKHD  492



>ref|XP_004516743.1| PREDICTED: cytochrome P450 71D10-like [Cicer arietinum]
Length=502

 Score =   444 bits (1142),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 230/494 (47%), Positives = 328/494 (66%), Gaps = 7/494 (1%)
 Frame = -2

Query  1595  LDRSNIMENLISFALFVSFLVL--VYTQWKKQRRG-KMPPGPRKLPIIGNLLHITGPVLP  1425
             ++  N   N+   A FV  L++  ++ +W        +PPGP  LP+IGN+  I    LP
Sbjct  1     MELHNPFSNITFLASFVFILMIFKIFKRWSSNNSTTNLPPGPWTLPLIGNIHQIISNSLP  60

Query  1424  HRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNN  1245
             H   + LA KYG LM L++GE+S ++V+SP+MA+E ++THDLAF  R   L  SIL YN 
Sbjct  61    HHCFKILAEKYGPLMHLKLGEVSHIIVTSPEMAREVMKTHDLAFCDRPSLLLPSILTYNG  120

Query  1244  SDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSER  1065
             S+I    YG+ WRQ+RK+ + EL+N + V+SF SIR +E+  L+  +  S G   N+++ 
Sbjct  121   SNIAFSKYGEKWRQLRKVIVVELVNAKRVQSFRSIREEEVSDLVKSIYESEGSVVNLTKM  180

Query  1064  IFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKA-LHPLFGNKSE  888
             I+  T  I  RAAFG+    ++ FI   + I ++ G F  AD+FPS K  L  +   K++
Sbjct  181   IYSMTYGITGRAAFGKKNQQQQVFISAFEKILIILGGFCIADLFPSIKILLERVSSTKTK  240

Query  887   ILKTHRKTDSIIESIINDHRNKLESGTGEDCIIDVLLKL-MDSGNLQVPITHDNIKAIII  711
               K  R+TD I++ IINDH+N  +    ED ++DVLLKL  ++ +L+ P+T DN+K++I 
Sbjct  241   FEKLCRETDGILQDIINDHKNSDKEARDED-LVDVLLKLQQENKHLENPLTDDNVKSVIQ  299

Query  710   DMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVV  531
             D+F AGSETS++T +W M EM+KNP+V+ +AQAEVR V+  K  ++E+++ QL YLK+V+
Sbjct  300   DLFVAGSETSSSTVLWGMFEMVKNPKVMEEAQAEVRRVYGSKGYVDETELNQLIYLKSVI  359

Query  530   KETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiper  351
             KETLR HPP PL+  RE RE+  IN GY IP KT V VN +A+  DP+YW E E F PER
Sbjct  360   KETLRLHPPVPLLIPRESREKCQIN-GYVIPAKTIVAVNVWAIGRDPRYWVEAECFKPER  418

Query  350   fEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETLD  171
             F+++ VDF G+ F+++PFGAGRR+CPG+ F   N   PLA LLY+FDWKLP G+  E LD
Sbjct  419   FDNSPVDFRGTDFEFLPFGAGRRVCPGIIFAIPNIELPLAQLLYHFDWKLPNGLKNEELD  478

Query  170   MTEMLGLAVARKND  129
             MTE  G++V RK+D
Sbjct  479   MTEQFGISVGRKHD  492



>ref|XP_011087047.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=498

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 234/495 (47%), Positives = 345/495 (70%), Gaps = 13/495 (3%)
 Frame = -2

Query  1607  LPSFLDRSNIMENLISFALFVSFLVLVYTQWKKQRRGKMPPGPRKLPIIGNLLHITGPVL  1428
             +PSFL        +IS  L V  L L+     +  R K+PPGP KLP+IG+L H++G   
Sbjct  5     IPSFL--------IISLILIVPLLNLIIRF--RISRPKLPPGPWKLPLIGSLHHLSGGSG  54

Query  1427  PHRALRDLARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYN  1248
             PH ALR+LARKYG +M LQ+GEISAVV+S+P +AKE L THDLAF++RA   + +I+ YN
Sbjct  55    PHYALRNLARKYGPIMHLQLGEISAVVISAPRVAKELLTTHDLAFSSRARLPSLAIITYN  114

Query  1247  NSDIVLGPYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAG-RPFNVS  1071
               D+V+ PYGDYW+QMR+IC +ELL+ + VRSFS+IR +E   L+  +RS     P +++
Sbjct  115   YQDMVMAPYGDYWKQMRRICFSELLSSKNVRSFSTIRDEEAVNLVESIRSHPSLMPMDLA  174

Query  1070  ERIFLFTSSIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKS  891
             +++  +T+ ++CRAAFG+   G+++F+    +    +G FD AD+FPS   L  + G ++
Sbjct  175   QKVLSYTNDVLCRAAFGKSRGGKDEFLPLIIEFGTSSGGFDVADLFPSITFLPAVTGLRT  234

Query  890   EILKTHRKTDSIIESIINDHRNKLESGT-GEDCIIDVLLKLMDSGNLQVPITHDNIKAII  714
             +++K H K D ++  II++H  +L  G   E+ I+DVLL+  + GNL+ PIT DNIKAI 
Sbjct  235   KLMKLHHKLDQVLNVIIDEHMERLRFGQHAEEDIVDVLLRFKEKGNLEFPITLDNIKAIT  294

Query  713   IDMFGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTV  534
             +DMF AG+ T+  T  +AM +M+K+  V+ KAQ+E+R VF+GKE + ESD+E++ YLK V
Sbjct  295   LDMFIAGTHTTAATVEFAMVQMIKHANVMEKAQSELRHVFRGKERILESDLEKVSYLKMV  354

Query  533   VKETLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfipe  354
             +KETLR +PP PL+  R+C++   +  GY IP KTKV++N  A+  DP+YW   E F PE
Sbjct  355   IKETLRLNPPVPLLLPRDCKDWQKVY-GYDIPPKTKVVLNVLAINRDPEYWVNAEAFEPE  413

Query  353   rfEDNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEGVTAETL  174
             RF ++ ++F G++F+++PFG GRR+CPG++FG A+    LA LLY+F+WKLP+G+  + L
Sbjct  414   RFAESSIEFIGTNFEFIPFGGGRRMCPGISFGLASVELLLAQLLYHFNWKLPDGLMPQDL  473

Query  173   DMTEMLGLAVARKND  129
             DMTE+LGLA   KN+
Sbjct  474   DMTEILGLAAKMKNN  488



>ref|XP_007213422.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
 gb|EMJ14621.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
Length=475

 Score =   442 bits (1137),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 230/471 (49%), Positives = 321/471 (68%), Gaps = 16/471 (3%)
 Frame = -2

Query  1562  SFALFVSFLVLVYTQWKKQR-RGK-------MPPGPRKLPIIGNLLHITGPVLPHRALRD  1407
             SF + ++FL+ +    K  + RGK       +PPGP KLP+IGNL  + G  LPH+ LRD
Sbjct  7     SFHVLLAFLLFMIMVLKIGKIRGKTKCSASNLPPGPWKLPVIGNLHQLAGS-LPHQRLRD  65

Query  1406  LARKYGGLMSLQIGEISAVVVSSPDMAKEFLRTHDLAFATRAETLAGSILLYNNSDIVLG  1227
             LA+KYG LM L++GE+S VVVSS + AKE ++THDL FA+R   LA  IL Y+ + IV  
Sbjct  66    LAKKYGPLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFASRPHVLAPRILSYDFTSIVFA  125

Query  1226  PYGDYWRQMRKICITELLNPRLVRSFSSIRHDEIHRLLADVRSSAGRPFNVSERIFLFTS  1047
             PYG+YWR++RKIC  ELL+ + VRS+  IR +E+ +L+  + S AG P N+++ I+  T 
Sbjct  126   PYGEYWRKLRKICTLELLSAKRVRSYRPIREEEVRKLIKLIASRAGSPINLTQEIYSSTF  185

Query  1046  SIICRAAFGEVFDGREQFIQQTKDISVLTGSFDFADMFPSWKALHPLFGNKSEILKTHRK  867
             +I  RAAFG+    +E+FI   K+++     F  AD+FPS   LH L G + +I + H++
Sbjct  186   TITSRAAFGKKNRDQEKFIYIVKEVAKAASGFALADVFPSVSLLHLLSGMRHKIERLHKE  245

Query  866   TDSIIESIINDHR-----NKLESGTGEDCIIDVLLKLMDSGN-LQVPITHDNIKAIIIDM  705
              D I+ +II +H+      K   G  E+ ++DVLLK  + GN  +  +T +NIKA+I D+
Sbjct  246   ADRIMGNIIKEHQRDMVTTKSSEGEAEEDLVDVLLKFHEHGNEREFSLTTENIKAVIFDI  305

Query  704   FGAGSETSTTTSMWAMSEMMKNPRVLAKAQAEVREVFKGKEMLEESDVEQLPYLKTVVKE  525
             F AGSETS+T   WA++EM+KNPRV+  AQ EVREVF  K  ++E+ + ++ YL  V+KE
Sbjct  306   FAAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVREVFNRKGQVDETCIREMKYLNLVIKE  365

Query  524   TLRCHPPTPLIATRECREETVINGGYTIPVKTKVMVNAYALATDPQYWeeperfiperfE  345
             TLR HPP PL+  REC E+  I+ G+ IPVK+KV+VNA+A+  DP YW EPE F P RF 
Sbjct  366   TLRLHPPGPLLVPRECGEKCEID-GHEIPVKSKVIVNAWAIGRDPNYWNEPESFNPNRFL  424

Query  344   DNGVDFNGSHFQYVPFGAGRRICPGLAFGFANTISPLAHLLYNFDWKLPEG  192
             DN +D+ G++F+Y+PFGAGRR+CPG++FG AN   PLA LLY+FDWKLP G
Sbjct  425   DNSIDYKGTNFEYIPFGAGRRMCPGVSFGLANVELPLALLLYHFDWKLPMG  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4554914126840