BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78805_g1_i1 len=1153 path=[1:0-1152]

Length=1153
                                                                      Score     E

ref|XP_009619036.1|  PREDICTED: short-chain dehydrogenase reducta...    400   3e-135   
ref|XP_006351912.1|  PREDICTED: short-chain dehydrogenase reducta...    399   1e-134   
ref|XP_009797691.1|  PREDICTED: short-chain dehydrogenase reducta...    398   2e-134   
ref|XP_010312930.1|  PREDICTED: short-chain dehydrogenase reducta...    392   4e-132   
ref|XP_002521887.1|  short chain alcohol dehydrogenase, putative        390   1e-131   Ricinus communis
ref|XP_006448042.1|  hypothetical protein CICLE_v10016207mg             389   4e-131   
gb|KDO58626.1|  hypothetical protein CISIN_1g023708mg                   385   1e-129   
ref|XP_011025007.1|  PREDICTED: short-chain dehydrogenase reducta...    383   1e-128   
ref|XP_002312493.2|  alcohol dehydrogenase family protein               381   5e-128   Populus trichocarpa [western balsam poplar]
emb|CAN63288.1|  hypothetical protein VITISV_025196                     380   3e-127   Vitis vinifera
ref|XP_010651009.1|  PREDICTED: tropinone reductase-like 2              381   4e-127   
ref|XP_008221371.1|  PREDICTED: short-chain dehydrogenase reducta...    377   5e-126   
ref|XP_009351621.1|  PREDICTED: short-chain dehydrogenase reducta...    375   3e-125   
ref|XP_008340534.1|  PREDICTED: tropinone reductase-like 1              375   4e-125   
gb|KDP38202.1|  hypothetical protein JCGZ_04845                         373   1e-124   
gb|AGW52137.1|  ATA                                                     371   3e-124   
ref|XP_010111069.1|  Momilactone A synthase                             369   6e-123   
ref|XP_006492273.1|  PREDICTED: short-chain dehydrogenase reducta...    368   8e-123   
ref|XP_011088821.1|  PREDICTED: short-chain dehydrogenase reducta...    359   4e-119   
ref|XP_010270813.1|  PREDICTED: short-chain dehydrogenase reducta...    356   3e-118   
ref|XP_008389129.1|  PREDICTED: short-chain dehydrogenase reducta...    355   9e-118   
emb|CDP15179.1|  unnamed protein product                                354   3e-117   
ref|XP_004298637.1|  PREDICTED: short-chain dehydrogenase reducta...    342   2e-112   
ref|XP_007045394.1|  Alcohol dehydrogenase                              342   2e-112   
gb|AES89687.2|  enoyl-(acyl carrier) reductase                          340   1e-111   
gb|EYU26811.1|  hypothetical protein MIMGU_mgv1a026922mg                337   6e-111   
ref|XP_010669466.1|  PREDICTED: short-chain dehydrogenase reducta...    334   2e-109   
ref|XP_004491766.1|  PREDICTED: short-chain dehydrogenase reducta...    334   3e-109   
ref|XP_007139354.1|  hypothetical protein PHAVU_008G022500g             332   2e-108   
ref|XP_003607490.1|  Sex determination protein                          330   1e-107   
gb|AAB42054.1|  STA1-12                                                 328   3e-107   Silene latifolia subsp. alba [white campion]
ref|XP_009106575.1|  PREDICTED: short-chain dehydrogenase reducta...    322   6e-105   
ref|XP_009106566.1|  PREDICTED: short-chain dehydrogenase reducta...    321   2e-104   
ref|XP_010425804.1|  PREDICTED: short-chain dehydrogenase reducta...    318   4e-103   
ref|XP_010557798.1|  PREDICTED: short-chain dehydrogenase reducta...    316   1e-102   
ref|XP_006293541.1|  hypothetical protein CARUB_v10025571mg             316   2e-102   
ref|XP_002875592.1|  alcohol dehydrogenase                              315   4e-102   
ref|XP_010503023.1|  PREDICTED: short-chain dehydrogenase reducta...    315   6e-102   
ref|XP_006602985.1|  PREDICTED: short-chain dehydrogenase reducta...    313   4e-101   
ref|XP_006378426.1|  hypothetical protein POPTR_0010s11020g             308   4e-100   
ref|XP_006419137.1|  hypothetical protein EUTSA_v10003119mg             309   1e-99    
gb|AAB42053.1|  STA1-2                                                  309   2e-99    Silene latifolia subsp. alba [white campion]
gb|AAM63311.1|  alcohol dehydrogenase (ATA1)                            305   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189882.1|  protein TAPETUM 1                                     304   6e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AAC49835.1|  alcohol dehydrogenase                                   303   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855591.1|  hypothetical protein AMTR_s00044p00056720          298   3e-95    
gb|KHN13792.1|  Sex determination protein tasselseed-2                  291   7e-93    
gb|EPS59713.1|  hypothetical protein M569_15092                         281   6e-89    
ref|XP_004491767.1|  PREDICTED: short-chain dehydrogenase reducta...    264   2e-82    
ref|XP_007223520.1|  hypothetical protein PRUPE_ppa011965mg             255   9e-80    
ref|XP_002515215.1|  short chain alcohol dehydrogenase, putative        231   2e-69    Ricinus communis
ref|XP_002963807.1|  hypothetical protein SELMODRAFT_79955              226   3e-67    
ref|XP_010264500.1|  PREDICTED: short-chain dehydrogenase reducta...    224   6e-67    
ref|XP_010264499.1|  PREDICTED: short-chain dehydrogenase reducta...    224   9e-67    
ref|XP_010264497.1|  PREDICTED: short-chain dehydrogenase reducta...    224   1e-66    
ref|XP_006841570.1|  hypothetical protein AMTR_s00003p00190670          223   2e-66    
ref|XP_010264496.1|  PREDICTED: short-chain dehydrogenase reducta...    224   2e-66    
ref|XP_006444577.1|  hypothetical protein CICLE_v10021745mg             223   2e-66    
gb|ABK24197.1|  unknown                                                 223   4e-66    Picea sitchensis
ref|XP_004289431.1|  PREDICTED: short-chain dehydrogenase reducta...    224   5e-66    
ref|XP_010256990.1|  PREDICTED: short-chain dehydrogenase reducta...    223   5e-66    
ref|XP_011077500.1|  PREDICTED: short-chain dehydrogenase reducta...    222   1e-65    
ref|XP_008461398.1|  PREDICTED: short-chain dehydrogenase reducta...    220   3e-65    
ref|XP_010038318.1|  PREDICTED: short-chain dehydrogenase reducta...    220   3e-65    
gb|KHN33244.1|  Sex determination protein tasselseed-2                  221   3e-65    
ref|XP_003522142.1|  PREDICTED: short-chain dehydrogenase reducta...    221   4e-65    
ref|XP_004492523.1|  PREDICTED: short-chain dehydrogenase reducta...    221   4e-65    
ref|XP_010102621.1|  Sex determination protein tasselseed-2             221   5e-65    
ref|XP_008370219.1|  PREDICTED: short-chain dehydrogenase reducta...    220   8e-65    
ref|XP_006828171.1|  hypothetical protein AMTR_s00023p00118310          220   9e-65    
ref|XP_008798880.1|  PREDICTED: secoisolariciresinol dehydrogenas...    219   1e-64    
ref|XP_008812964.1|  PREDICTED: short-chain dehydrogenase reducta...    218   1e-64    
ref|XP_009373111.1|  PREDICTED: short-chain dehydrogenase reducta...    219   2e-64    
ref|XP_008461393.1|  PREDICTED: short-chain dehydrogenase reducta...    218   2e-64    
gb|ABR18410.1|  unknown                                                 218   3e-64    Picea sitchensis
ref|XP_003624486.1|  Sex determination protein tasselseed-2             218   3e-64    
ref|XP_003623493.1|  Sex determination protein tasselseed-2             218   5e-64    
ref|XP_010679442.1|  PREDICTED: short-chain dehydrogenase reducta...    216   7e-64    
ref|XP_007205611.1|  hypothetical protein PRUPE_ppa009084mg             218   9e-64    
ref|XP_002323034.2|  short-chain dehydrogenase/reductase family p...    217   9e-64    Populus trichocarpa [western balsam poplar]
ref|XP_004493066.1|  PREDICTED: short-chain dehydrogenase reducta...    218   1e-63    
gb|AHH81853.1|  short-chain alcohol dehydrogenase                       216   2e-63    
gb|ABK21151.1|  unknown                                                 216   2e-63    Picea sitchensis
gb|ABK26187.1|  unknown                                                 216   2e-63    Picea sitchensis
ref|XP_004302582.1|  PREDICTED: short-chain dehydrogenase reducta...    216   2e-63    
ref|XP_009378033.1|  PREDICTED: secoisolariciresinol dehydrogenas...    216   3e-63    
ref|XP_008246119.1|  PREDICTED: secoisolariciresinol dehydrogenas...    214   3e-63    
ref|XP_008450017.1|  PREDICTED: momilactone A synthase-like             215   4e-63    
ref|XP_010112720.1|  Sex determination protein tasselseed-2             216   4e-63    
gb|AFK46966.1|  unknown                                                 214   4e-63    
gb|AER92598.1|  putative short-chain alcohol dehydrogenase              216   5e-63    
gb|ABK26305.1|  unknown                                                 215   5e-63    Picea sitchensis
ref|XP_003552289.1|  PREDICTED: short-chain dehydrogenase reducta...    215   5e-63    
ref|XP_009378032.1|  PREDICTED: secoisolariciresinol dehydrogenas...    215   5e-63    
ref|XP_002308240.1|  short-chain dehydrogenase/reductase family p...    215   6e-63    Populus trichocarpa [western balsam poplar]
ref|XP_010412483.1|  PREDICTED: short-chain dehydrogenase reducta...    214   6e-63    
ref|XP_008231034.1|  PREDICTED: zerumbone synthase-like isoform X1      215   6e-63    
ref|XP_004981155.1|  PREDICTED: short-chain dehydrogenase reducta...    214   7e-63    
emb|CDP06416.1|  unnamed protein product                                215   8e-63    
ref|XP_002321531.2|  hypothetical protein POPTR_0015s07670g             214   8e-63    Populus trichocarpa [western balsam poplar]
ref|XP_010243159.1|  PREDICTED: short-chain dehydrogenase reducta...    213   9e-63    
ref|XP_008388874.1|  PREDICTED: short-chain dehydrogenase reducta...    215   9e-63    
gb|AHH81852.1|  short-chain alcohol dehydrogenase                       214   9e-63    
ref|XP_002463346.1|  hypothetical protein SORBIDRAFT_02g042140          214   1e-62    Sorghum bicolor [broomcorn]
ref|XP_004493067.1|  PREDICTED: short-chain dehydrogenase reducta...    215   1e-62    
ref|XP_008782768.1|  PREDICTED: sex determination protein tassels...    213   1e-62    
ref|NP_189570.3|  short-chain dehydrogenase reductase 4                 214   1e-62    Arabidopsis thaliana [mouse-ear cress]
emb|CDX78027.1|  BnaA09g32220D                                          214   1e-62    
ref|XP_008244807.1|  PREDICTED: short-chain dehydrogenase reducta...    214   1e-62    
ref|XP_007026536.1|  NAD(P)-binding Rossmann-fold superfamily pro...    214   1e-62    
emb|CDY50919.1|  BnaC03g72480D                                          213   2e-62    
ref|XP_009133799.1|  PREDICTED: short-chain dehydrogenase reducta...    213   2e-62    
gb|KDO61663.1|  hypothetical protein CISIN_1g041914mg                   213   2e-62    
ref|XP_006384780.1|  alcohol dehydroge family protein                   213   2e-62    
ref|XP_008811702.1|  PREDICTED: momilactone A synthase-like             214   2e-62    
ref|XP_002267041.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    213   2e-62    Vitis vinifera
ref|XP_006388114.1|  alcohol dehydroge family protein                   213   2e-62    
gb|KHN40676.1|  Sex determination protein tasselseed-2                  213   2e-62    
ref|XP_002967778.1|  hypothetical protein SELMODRAFT_88869              213   2e-62    
ref|XP_008379054.1|  PREDICTED: short-chain dehydrogenase reducta...    214   2e-62    
ref|XP_011019045.1|  PREDICTED: short-chain dehydrogenase reducta...    214   3e-62    
ref|XP_011028706.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    212   3e-62    
ref|XP_008231035.1|  PREDICTED: zerumbone synthase-like isoform X2      213   3e-62    
ref|XP_009115857.1|  PREDICTED: short-chain dehydrogenase reducta...    213   3e-62    
ref|XP_003534665.1|  PREDICTED: short-chain dehydrogenase reducta...    213   3e-62    
ref|XP_008665711.1|  PREDICTED: short-chain dehydrogenase reducta...    212   3e-62    
ref|XP_004151171.1|  PREDICTED: short-chain dehydrogenase reducta...    213   3e-62    
ref|NP_001118737.1|  short-chain dehydrogenase reductase 4              212   3e-62    Arabidopsis thaliana [mouse-ear cress]
emb|CDX73704.1|  BnaC08g22990D                                          213   3e-62    
ref|XP_007134614.1|  hypothetical protein PHAVU_010G061700g             213   3e-62    
ref|XP_004136143.1|  PREDICTED: short-chain dehydrogenase reducta...    212   4e-62    
ref|XP_011032578.1|  PREDICTED: short-chain dehydrogenase reducta...    213   4e-62    
ref|XP_010507925.1|  PREDICTED: short-chain dehydrogenase reducta...    211   4e-62    
ref|XP_007026535.1|  NAD(P)-binding Rossmann-fold superfamily pro...    213   5e-62    
ref|XP_002533789.1|  short chain alcohol dehydrogenase, putative        213   5e-62    Ricinus communis
ref|XP_010921066.1|  PREDICTED: LOW QUALITY PROTEIN: sex determin...    213   5e-62    
ref|XP_009133800.1|  PREDICTED: short-chain dehydrogenase reducta...    211   6e-62    
ref|XP_009133801.1|  PREDICTED: short-chain dehydrogenase reducta...    211   6e-62    
ref|XP_011006659.1|  PREDICTED: momilactone A synthase-like             211   7e-62    
ref|XP_011006635.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   8e-62    
ref|XP_011079747.1|  PREDICTED: zerumbone synthase isoform X2           211   8e-62    
ref|XP_006450496.1|  hypothetical protein CICLE_v10009218mg             211   8e-62    
ref|XP_006838732.1|  hypothetical protein AMTR_s00002p00253880          211   8e-62    
emb|CDY29039.1|  BnaC07g32450D                                          212   8e-62    
dbj|BAB01821.1|  alcohol dehydrogenase-like protein                     212   9e-62    Arabidopsis thaliana [mouse-ear cress]
gb|KHN29548.1|  Sex determination protein tasselseed-2                  213   9e-62    
ref|XP_007037208.1|  NAD(P)-binding Rossmann-fold superfamily pro...    211   1e-61    
ref|NP_190736.1|  short-chain dehydrogenase reductase 2a                212   1e-61    Arabidopsis thaliana [mouse-ear cress]
gb|KDP22808.1|  hypothetical protein JCGZ_00395                         212   1e-61    
ref|XP_009621472.1|  PREDICTED: zerumbone synthase-like                 212   1e-61    
ref|XP_006366370.1|  PREDICTED: zerumbone synthase-like isoform X2      211   1e-61    
ref|XP_010937967.1|  PREDICTED: sex determination protein tassels...    212   1e-61    
emb|CDY34214.1|  BnaA02g28260D                                          212   1e-61    
ref|XP_011043649.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   1e-61    
ref|XP_007162946.1|  hypothetical protein PHAVU_001G193500g             211   1e-61    
emb|CAN73475.1|  hypothetical protein VITISV_042532                     210   2e-61    Vitis vinifera
ref|XP_010039348.1|  PREDICTED: short-chain dehydrogenase reducta...    211   2e-61    
ref|XP_008362092.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   2e-61    
ref|XP_010683578.1|  PREDICTED: short-chain dehydrogenase reducta...    211   2e-61    
emb|CDX83342.1|  BnaA03g21640D                                          210   2e-61    
ref|XP_008362091.1|  PREDICTED: secoisolariciresinol dehydrogenas...    211   2e-61    
ref|XP_003520764.1|  PREDICTED: short-chain dehydrogenase reducta...    210   2e-61    
ref|XP_002265892.1|  PREDICTED: short-chain dehydrogenase reducta...    211   2e-61    Vitis vinifera
ref|XP_002877816.1|  short-chain dehydrogenase/reductase family p...    211   2e-61    
ref|XP_010914852.1|  PREDICTED: short-chain dehydrogenase reducta...    210   2e-61    
ref|XP_006366369.1|  PREDICTED: zerumbone synthase-like isoform X1      211   2e-61    
ref|XP_011079746.1|  PREDICTED: zerumbone synthase isoform X1           211   2e-61    
ref|XP_002512852.1|  short chain alcohol dehydrogenase, putative        211   2e-61    Ricinus communis
ref|XP_004158218.1|  PREDICTED: LOW QUALITY PROTEIN: short-chain ...    210   2e-61    
ref|XP_010096039.1|  Sex determination protein tasselseed-2             211   3e-61    
ref|XP_010652542.1|  PREDICTED: short-chain dehydrogenase reducta...    211   3e-61    
ref|XP_007221495.1|  hypothetical protein PRUPE_ppa009931mg             210   3e-61    
ref|XP_007140172.1|  hypothetical protein PHAVU_008G089900g             211   3e-61    
ref|XP_009136629.1|  PREDICTED: short-chain dehydrogenase reducta...    211   3e-61    
ref|XP_010523897.1|  PREDICTED: short-chain dehydrogenase reducta...    209   3e-61    
ref|XP_011022234.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   3e-61    
gb|KDP28314.1|  hypothetical protein JCGZ_14085                         209   3e-61    
ref|XP_010244665.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   3e-61    
ref|XP_009773745.1|  PREDICTED: short-chain dehydrogenase reducta...    209   4e-61    
ref|XP_009118132.1|  PREDICTED: short-chain dehydrogenase reducta...    209   4e-61    
ref|XP_004247470.1|  PREDICTED: zerumbone synthase                      210   4e-61    
ref|XP_003540813.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   4e-61    
gb|AGY49282.1|  short chain alcohol dehydrogenase/reductase             209   4e-61    
gb|KHN21176.1|  Momilactone A synthase                                  209   5e-61    
ref|XP_010518405.1|  PREDICTED: short-chain dehydrogenase reducta...    209   5e-61    
ref|XP_007051232.1|  NAD(P)-binding Rossmann-fold superfamily pro...    209   5e-61    
ref|XP_002272838.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   5e-61    Vitis vinifera
ref|XP_003553613.1|  PREDICTED: secoisolariciresinol dehydrogenase      209   5e-61    
ref|XP_008809990.1|  PREDICTED: sex determination protein tassels...    210   5e-61    
ref|XP_003626026.1|  Momilactone A synthase                             209   5e-61    
ref|XP_007027903.1|  Short chain alcohol dehydrogenase, putative        209   6e-61    
ref|XP_002323405.1|  putative short-chain alcohol dehydrogenase f...    209   6e-61    Populus trichocarpa [western balsam poplar]
ref|XP_006367066.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    209   6e-61    
ref|XP_008238188.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    209   7e-61    
ref|XP_002272206.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   7e-61    Vitis vinifera
ref|XP_010244664.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   8e-61    
ref|XP_002272942.2|  PREDICTED: short-chain dehydrogenase reducta...    208   8e-61    Vitis vinifera
ref|XP_009615792.1|  PREDICTED: short-chain dehydrogenase reducta...    208   8e-61    
ref|XP_007215764.1|  hypothetical protein PRUPE_ppa009553mg             209   8e-61    
ref|XP_008442351.1|  PREDICTED: short-chain dehydrogenase reducta...    209   9e-61    
ref|XP_006294086.1|  hypothetical protein CARUB_v10023080mg             215   1e-60    
ref|XP_002971756.1|  hypothetical protein SELMODRAFT_96102              208   1e-60    
gb|ABK24336.1|  unknown                                                 209   1e-60    Picea sitchensis
ref|XP_008780581.1|  PREDICTED: short-chain dehydrogenase reducta...    208   1e-60    
ref|XP_006855389.1|  hypothetical protein AMTR_s00057p00137740          209   1e-60    
ref|XP_010244663.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   1e-60    
ref|XP_002321085.2|  short-chain dehydrogenase/reductase family p...    209   1e-60    Populus trichocarpa [western balsam poplar]
ref|XP_010244662.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   1e-60    
ref|XP_007206370.1|  hypothetical protein PRUPE_ppa017863mg             208   1e-60    
emb|CDP19818.1|  unnamed protein product                                208   2e-60    
gb|ACN40791.1|  unknown                                                 209   2e-60    Picea sitchensis
emb|CBI18081.3|  unnamed protein product                                208   2e-60    
ref|XP_009771385.1|  PREDICTED: short-chain dehydrogenase reducta...    209   2e-60    
ref|XP_010244661.1|  PREDICTED: secoisolariciresinol dehydrogenas...    209   2e-60    
ref|XP_009771386.1|  PREDICTED: short-chain dehydrogenase reducta...    208   2e-60    
ref|XP_010691689.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   2e-60    
ref|XP_002309406.1|  putative short-chain alcohol dehydrogenase f...    207   2e-60    Populus trichocarpa [western balsam poplar]
ref|XP_011006647.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   2e-60    
ref|XP_010239603.1|  PREDICTED: short-chain dehydrogenase reducta...    207   3e-60    
ref|NP_566097.1|  short-chain dehydrogenase reductase 5                 207   3e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367070.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    207   3e-60    
ref|XP_006492460.1|  PREDICTED: short-chain dehydrogenase reducta...    207   3e-60    
ref|XP_011040603.1|  PREDICTED: short-chain dehydrogenase reducta...    207   3e-60    
ref|XP_010422493.1|  PREDICTED: zerumbone synthase-like                 208   3e-60    
ref|XP_001762586.1|  predicted protein                                  207   3e-60    
ref|XP_002320953.2|  hypothetical protein POPTR_0014s11070g             207   3e-60    Populus trichocarpa [western balsam poplar]
ref|XP_010249204.1|  PREDICTED: momilactone A synthase-like isofo...    208   3e-60    
ref|XP_004136145.1|  PREDICTED: short-chain dehydrogenase reducta...    207   3e-60    
ref|XP_006291556.1|  hypothetical protein CARUB_v10017712mg             208   4e-60    
ref|XP_009383702.1|  PREDICTED: short-chain dehydrogenase reducta...    207   4e-60    
ref|XP_006292209.1|  hypothetical protein CARUB_v10018415mg             208   4e-60    
ref|XP_004290718.1|  PREDICTED: zerumbone synthase-like                 207   4e-60    
ref|XP_010685947.1|  PREDICTED: sex determination protein tassels...    208   4e-60    
gb|KDP34634.1|  hypothetical protein JCGZ_11952                         207   4e-60    
gb|KDO86849.1|  hypothetical protein CISIN_1g046931mg                   206   4e-60    
ref|XP_011006108.1|  PREDICTED: secoisolariciresinol dehydrogenas...    207   4e-60    
gb|KGN45049.1|  hypothetical protein Csa_7G414460                       206   4e-60    
ref|XP_010249205.1|  PREDICTED: momilactone A synthase-like isofo...    207   4e-60    
ref|XP_006444587.1|  hypothetical protein CICLE_v10023411mg             207   4e-60    
ref|XP_011093172.1|  PREDICTED: short-chain dehydrogenase reducta...    206   5e-60    
emb|CDY37786.1|  BnaC04g00390D                                          206   5e-60    
ref|XP_010691680.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   5e-60    
ref|XP_006397907.1|  hypothetical protein EUTSA_v10001593mg             206   6e-60    
ref|XP_006429516.1|  hypothetical protein CICLE_v10012298mg             207   6e-60    
ref|XP_007032007.1|  NAD(P)-binding Rossmann-fold superfamily pro...    207   6e-60    
gb|KHN21177.1|  Momilactone A synthase                                  208   7e-60    
ref|XP_006384778.1|  hypothetical protein POPTR_0004s21020g             207   8e-60    
dbj|BAD30315.1|  putative sex determination protein tasselseed 2        207   8e-60    Oryza sativa Japonica Group [Japonica rice]
gb|KFK34412.1|  hypothetical protein AALP_AA5G141400                    207   8e-60    
ref|XP_010911608.1|  PREDICTED: short-chain dehydrogenase reducta...    206   8e-60    
ref|XP_010503863.1|  PREDICTED: short-chain dehydrogenase reducta...    207   8e-60    
ref|XP_004236185.1|  PREDICTED: short-chain dehydrogenase reducta...    206   9e-60    
gb|KCW64304.1|  hypothetical protein EUGRSUZ_G01939                     206   9e-60    
ref|XP_001753333.1|  predicted protein                                  207   9e-60    
ref|XP_009374964.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   1e-59    
ref|NP_001060559.1|  Os07g0664400                                       207   1e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455976.1|  PREDICTED: zerumbone synthase-like                 207   1e-59    
ref|XP_010250550.1|  PREDICTED: zerumbone synthase-like                 207   1e-59    
ref|XP_011098962.1|  PREDICTED: short-chain dehydrogenase reducta...    207   1e-59    
ref|XP_008810893.1|  PREDICTED: short-chain dehydrogenase reducta...    206   1e-59    
gb|KFK33598.1|  hypothetical protein AALP_AA5G034700                    206   1e-59    
emb|CDP03557.1|  unnamed protein product                                209   1e-59    
gb|KCW47495.1|  hypothetical protein EUGRSUZ_K01263                     206   1e-59    
ref|XP_010038156.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   1e-59    
gb|KDO35956.1|  hypothetical protein CISIN_1g046809mg                   205   1e-59    
ref|XP_004143649.1|  PREDICTED: zerumbone synthase-like                 206   1e-59    
gb|KDP26161.1|  hypothetical protein JCGZ_22863                         205   1e-59    
ref|XP_009587781.1|  PREDICTED: short-chain dehydrogenase reducta...    206   1e-59    
ref|XP_010430745.1|  PREDICTED: zerumbone synthase-like                 206   1e-59    
ref|XP_004169130.1|  PREDICTED: short-chain dehydrogenase reducta...    205   2e-59    
dbj|BAC10108.1|  putative sex determination protein tasselseed 2        207   2e-59    Oryza sativa Japonica Group [Japonica rice]
emb|CDO96909.1|  unnamed protein product                                205   2e-59    
ref|XP_002882109.1|  predicted protein                                  205   2e-59    
ref|XP_006481701.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   2e-59    
ref|XP_010514340.1|  PREDICTED: momilactone A synthase-like             206   2e-59    
ref|XP_009129481.1|  PREDICTED: zerumbone synthase                      206   2e-59    
ref|XP_010038158.1|  PREDICTED: secoisolariciresinol dehydrogenas...    206   2e-59    
ref|XP_002463347.1|  hypothetical protein SORBIDRAFT_02g042150          206   2e-59    Sorghum bicolor [broomcorn]
ref|XP_009387234.1|  PREDICTED: momilactone A synthase-like             205   2e-59    
ref|NP_566798.1|  NAD(P)-binding Rossmann-fold superfamily protein      206   2e-59    
ref|XP_008234980.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   2e-59    
gb|EAZ05052.1|  hypothetical protein OsI_27241                          206   2e-59    
ref|XP_010104810.1|  Momilactone A synthase                             205   2e-59    
ref|XP_002275647.1|  PREDICTED: secoisolariciresinol dehydrogenase      206   2e-59    
ref|XP_006468881.1|  PREDICTED: short-chain dehydrogenase reducta...    206   2e-59    
ref|XP_010035975.1|  PREDICTED: short-chain dehydrogenase reducta...    206   2e-59    
ref|XP_002463586.1|  hypothetical protein SORBIDRAFT_01g002510          204   3e-59    
gb|KDP36171.1|  hypothetical protein JCGZ_08815                         205   3e-59    
ref|XP_010068639.1|  PREDICTED: momilactone A synthase-like             207   3e-59    
ref|XP_009142566.1|  PREDICTED: short-chain dehydrogenase reducta...    204   3e-59    
ref|XP_008230130.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   3e-59    
ref|XP_008234979.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   3e-59    
ref|XP_004137687.1|  PREDICTED: short-chain dehydrogenase reducta...    206   3e-59    
gb|ABK23507.1|  unknown                                                 206   3e-59    
ref|XP_003521608.1|  PREDICTED: short-chain dehydrogenase reducta...    204   3e-59    
ref|XP_009776783.1|  PREDICTED: short-chain dehydrogenase reducta...    206   3e-59    
ref|XP_003554454.1|  PREDICTED: secoisolariciresinol dehydrogenas...    205   3e-59    
ref|XP_006446950.1|  hypothetical protein CICLE_v10016101mg             205   4e-59    
ref|NP_189311.2|  Rossmann-fold NAD(P)-binding domain-containing ...    205   4e-59    
gb|ABK22745.1|  unknown                                                 205   4e-59    
ref|NP_001060558.2|  Os07g0664300                                       205   4e-59    
ref|XP_010229744.1|  PREDICTED: short-chain dehydrogenase reducta...    207   4e-59    
ref|XP_011041828.1|  PREDICTED: short-chain dehydrogenase reducta...    205   4e-59    
ref|XP_002271524.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    204   4e-59    
ref|XP_004494319.1|  PREDICTED: zerumbone synthase-like                 205   4e-59    
ref|XP_010651860.1|  PREDICTED: secoisolariciresinol dehydrogenas...    204   5e-59    
ref|XP_002530512.1|  short chain alcohol dehydrogenase, putative        204   5e-59    
ref|XP_006431968.1|  hypothetical protein CICLE_v10003833mg             204   5e-59    
ref|XP_008810894.1|  PREDICTED: short-chain dehydrogenase reducta...    204   5e-59    
ref|XP_006396543.1|  hypothetical protein EUTSA_v10028841mg             205   5e-59    
ref|XP_007200395.1|  hypothetical protein PRUPE_ppa008509mg             206   5e-59    
gb|KEH39093.1|  short-chain dehydrogenase/reductase                     204   6e-59    
gb|ABK26167.1|  unknown                                                 204   6e-59    
gb|ACJ84543.1|  unknown                                                 203   6e-59    
gb|KDO36906.1|  hypothetical protein CISIN_1g040531mg                   204   6e-59    
gb|AAK97686.1|  AT3g26770/MDJ14_21                                      205   7e-59    
emb|CDP06870.1|  unnamed protein product                                203   7e-59    
emb|CDP06868.1|  unnamed protein product                                204   7e-59    
ref|XP_009142565.1|  PREDICTED: short-chain dehydrogenase reducta...    204   7e-59    
ref|XP_002875338.1|  short-chain dehydrogenase/reductase family p...    204   7e-59    
ref|XP_007206815.1|  hypothetical protein PRUPE_ppa025923mg             204   7e-59    
ref|XP_009117309.1|  PREDICTED: short-chain dehydrogenase reducta...    203   8e-59    
emb|CAN62844.1|  hypothetical protein VITISV_021186                     205   8e-59    
gb|ACU22941.1|  unknown                                                 203   8e-59    
ref|XP_009363143.1|  PREDICTED: short-chain dehydrogenase reducta...    203   8e-59    
ref|XP_004136701.1|  PREDICTED: momilactone A synthase-like             204   9e-59    
ref|XP_010506736.1|  PREDICTED: short-chain dehydrogenase reducta...    203   9e-59    
ref|XP_006468252.1|  PREDICTED: short-chain dehydrogenase reducta...    204   9e-59    
ref|XP_004494228.1|  PREDICTED: momilactone A synthase-like             203   9e-59    
emb|CDY49448.1|  BnaA09g42190D                                          203   9e-59    
ref|XP_009367175.1|  PREDICTED: short-chain dehydrogenase reducta...    203   9e-59    
ref|XP_009340878.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   1e-58    
ref|XP_007209470.1|  hypothetical protein PRUPE_ppa009958mg             203   1e-58    
ref|XP_007027886.1|  NAD(P)-binding Rossmann-fold superfamily pro...    203   1e-58    
ref|XP_009340877.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   1e-58    
ref|XP_011024778.1|  PREDICTED: zerumbone synthase-like isoform X1      204   1e-58    
ref|XP_008467261.1|  PREDICTED: secoisolariciresinol dehydrogenase      204   1e-58    
ref|XP_004494457.1|  PREDICTED: short-chain dehydrogenase reducta...    203   1e-58    
ref|XP_008229660.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   1e-58    
gb|ACU22781.1|  unknown                                                 203   1e-58    
ref|XP_009117310.1|  PREDICTED: short-chain dehydrogenase reducta...    202   1e-58    
dbj|BAC10103.1|  putative sex determination protein tasselseed 2        205   1e-58    
ref|XP_008368953.1|  PREDICTED: secoisolariciresinol dehydrogenase      204   1e-58    
ref|XP_010523896.1|  PREDICTED: short-chain dehydrogenase reducta...    202   1e-58    
ref|XP_009340879.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   2e-58    
dbj|BAA89230.1|  wts2L                                                  202   2e-58    
ref|XP_002325666.2|  hypothetical protein POPTR_0019s14650g             203   2e-58    
emb|CAC93667.1|  3-beta-hydroxysteroiddehydrogenase                     202   2e-58    
ref|XP_010921846.1|  PREDICTED: momilactone A synthase-like             204   2e-58    
ref|XP_004494456.1|  PREDICTED: short-chain dehydrogenase reducta...    203   2e-58    
ref|XP_010651861.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   2e-58    
ref|XP_008348630.1|  PREDICTED: short-chain dehydrogenase reducta...    202   2e-58    
ref|XP_011079498.1|  PREDICTED: LOW QUALITY PROTEIN: short-chain ...    202   2e-58    
ref|XP_010038159.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   2e-58    
ref|XP_010104811.1|  Momilactone A synthase                             202   2e-58    
ref|XP_010425400.1|  PREDICTED: momilactone A synthase-like             204   2e-58    
ref|XP_002322126.1|  hypothetical protein POPTR_0015s07660g             202   2e-58    
ref|XP_010682977.1|  PREDICTED: tropinone reductase-like 1              203   2e-58    
ref|XP_010914698.1|  PREDICTED: short-chain dehydrogenase reducta...    202   2e-58    
ref|XP_010038162.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   2e-58    
gb|EYU26737.1|  hypothetical protein MIMGU_mgv1a011831mg                202   2e-58    
ref|XP_007163050.1|  hypothetical protein PHAVU_001G201800g             203   2e-58    
ref|XP_010038160.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   2e-58    
gb|KFK30916.1|  hypothetical protein AALP_AA6G042300                    203   2e-58    
ref|XP_010038161.1|  PREDICTED: secoisolariciresinol dehydrogenas...    203   3e-58    
gb|EYU46864.1|  hypothetical protein MIMGU_mgv1a012139mg                202   3e-58    
gb|AAK83036.1|AF286651_1  TASSELSEED2-like protein                      202   3e-58    
ref|XP_002874879.1|  predicted protein                                  203   3e-58    
ref|XP_010522658.1|  PREDICTED: momilactone A synthase                  203   3e-58    
emb|CDP11313.1|  unnamed protein product                                198   3e-58    
ref|XP_007162945.1|  hypothetical protein PHAVU_001G193400g             202   3e-58    
gb|KDP36172.1|  hypothetical protein JCGZ_08816                         202   3e-58    
ref|XP_010911617.1|  PREDICTED: short-chain dehydrogenase reducta...    202   3e-58    
gb|AEZ01592.1|  3-beta-hydroxysteroid dehydrogenase 2                   201   4e-58    
ref|XP_006339460.1|  PREDICTED: short-chain dehydrogenase reducta...    201   4e-58    
ref|NP_189571.1|  short-chain dehydrogenase reductase 5                 201   4e-58    
ref|XP_006288323.1|  hypothetical protein CARUB_v10001569mg             202   4e-58    
ref|XP_010999596.1|  PREDICTED: xanthoxin dehydrogenase isoform X2      202   4e-58    
emb|CDP06872.1|  unnamed protein product                                204   4e-58    
ref|XP_006479859.1|  PREDICTED: short-chain dehydrogenase reducta...    202   4e-58    
gb|AAV68714.1|  3-beta hydroxysteroid dehydrogenase                     201   4e-58    
ref|XP_004139501.1|  PREDICTED: zerumbone synthase-like                 201   4e-58    
gb|KDP21551.1|  hypothetical protein JCGZ_22022                         202   4e-58    
ref|XP_002882108.1|  short-chain dehydrogenase/reductase family p...    201   4e-58    
ref|XP_006841568.1|  hypothetical protein AMTR_s00003p00187750          202   4e-58    
ref|XP_010101928.1|  Momilactone A synthase                             202   4e-58    
gb|EYU46651.1|  hypothetical protein MIMGU_mgv1a011658mg                201   5e-58    
gb|KFK37464.1|  hypothetical protein AALP_AA4G260500                    201   5e-58    
ref|XP_010246807.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   5e-58    
gb|KHG29158.1|  Sex determination tasselseed-2                          202   6e-58    
gb|AAD14442.1|  putative alcohol dehydrogenase                          201   6e-58    
ref|XP_010425399.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   7e-58    
ref|XP_010514339.1|  PREDICTED: secoisolariciresinol dehydrogenas...    202   7e-58    
ref|XP_010514640.1|  PREDICTED: short-chain dehydrogenase reducta...    201   7e-58    
ref|XP_009129483.1|  PREDICTED: zerumbone synthase-like                 202   7e-58    
ref|XP_006430117.1|  hypothetical protein CICLE_v10012261mg             201   8e-58    
ref|XP_007161632.1|  hypothetical protein PHAVU_001G085600g             202   8e-58    
ref|XP_004169912.1|  PREDICTED: short-chain dehydrogenase reducta...    201   8e-58    
ref|XP_002277487.2|  PREDICTED: short-chain dehydrogenase reducta...    201   8e-58    
ref|XP_004229837.1|  PREDICTED: short-chain dehydrogenase reducta...    200   8e-58    
emb|CDY28527.1|  BnaC02g36330D                                          201   8e-58    
ref|XP_010262932.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   9e-58    
ref|XP_004252598.1|  PREDICTED: secoisolariciresinol dehydrogenas...    201   9e-58    
gb|EMS65102.1|  Sex determination protein tasselseed-2                  202   9e-58    
gb|ACN40590.1|  unknown                                                 201   9e-58    
gb|AAV68713.1|  3-beta hydroxysteroid dehydrogenase                     200   1e-57    
ref|XP_002513332.1|  short chain alcohol dehydrogenase, putative        201   1e-57    
ref|XP_010094675.1|  Sex determination protein tasselseed-2             203   1e-57    
ref|XP_010045570.1|  PREDICTED: short-chain dehydrogenase reducta...    200   1e-57    
ref|XP_010028817.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    200   1e-57    
ref|XP_003618831.1|  Short-chain alcohol dehydrogenase                  200   1e-57    
ref|XP_006854737.1|  hypothetical protein AMTR_s00030p00244080          201   1e-57    
sp|Q94KL7.1|SILD_FORIN  RecName: Full=Secoisolariciresinol dehydr...    201   1e-57    
ref|XP_006291573.1|  hypothetical protein CARUB_v10017726mg             201   1e-57    
ref|XP_007027881.1|  Short chain alcohol dehydrogenase                  201   1e-57    
ref|XP_009387285.1|  PREDICTED: momilactone A synthase-like             200   1e-57    
ref|XP_009369359.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    200   1e-57    
ref|XP_008227805.1|  PREDICTED: short-chain dehydrogenase reducta...    200   1e-57    
emb|CDY70698.1|  BnaCnng69400D                                          201   1e-57    
ref|NP_567251.2|  NAD(P)-binding Rossmann-fold superfamily protein      202   1e-57    
ref|XP_002272549.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   1e-57    
ref|XP_008381460.1|  PREDICTED: short-chain dehydrogenase reducta...    200   1e-57    
ref|XP_011028713.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    201   1e-57    
ref|XP_009793983.1|  PREDICTED: short-chain dehydrogenase reducta...    200   1e-57    
ref|XP_006444212.1|  hypothetical protein CICLE_v10021400mg             201   1e-57    
ref|NP_001239862.1|  uncharacterized protein LOC100794412               200   2e-57    
ref|XP_010037141.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    200   2e-57    
ref|XP_010239159.1|  PREDICTED: short-chain dehydrogenase reducta...    201   2e-57    
gb|AAK83035.1|AF286650_1  CTA                                           200   2e-57    
ref|XP_007136712.1|  hypothetical protein PHAVU_009G067700g             200   2e-57    
gb|AAV68715.1|  3-beta hydroxysteroid dehydrogenase                     199   2e-57    
gb|KFK33597.1|  hypothetical protein AALP_AA5G034600                    208   2e-57    
ref|XP_010425726.1|  PREDICTED: short-chain dehydrogenase reducta...    199   2e-57    
ref|XP_010425727.1|  PREDICTED: short-chain dehydrogenase reducta...    199   2e-57    
ref|XP_004301169.1|  PREDICTED: short-chain dehydrogenase reducta...    199   2e-57    
ref|XP_006577897.1|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    200   2e-57    
gb|AIY27794.1|  3-beta-hydroxysteroid dehydrogenase                     199   2e-57    
emb|CDY48972.1|  BnaA02g28240D                                          202   2e-57    
gb|AAW31719.1|  3-beta-hydroxysteroid dehydrogenase                     199   2e-57    
ref|XP_008227892.1|  PREDICTED: short-chain dehydrogenase reducta...    199   2e-57    
ref|XP_007132475.1|  hypothetical protein PHAVU_011G097200g             199   2e-57    
ref|XP_008229671.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   2e-57    
ref|XP_002511516.1|  short chain alcohol dehydrogenase, putative        199   2e-57    
gb|AFK37606.1|  unknown                                                 199   3e-57    
ref|XP_010917565.1|  PREDICTED: momilactone A synthase-like isofo...    199   3e-57    
ref|XP_003523493.2|  PREDICTED: (-)-isopiperitenol/(-)-carveol de...    200   3e-57    
ref|XP_011043648.1|  PREDICTED: secoisolariciresinol dehydrogenas...    200   3e-57    
ref|XP_010262933.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   3e-57    
ref|XP_006430116.1|  hypothetical protein CICLE_v10012261mg             201   3e-57    
gb|KEH24360.1|  short-chain dehydrogenase/reductase                     200   3e-57    
gb|AEX31543.1|  putative 3beta-hydroxysteroid dehydrgenase              199   3e-57    
ref|XP_002323404.1|  alcohol dehydroge family protein                   199   3e-57    
ref|XP_006294813.1|  hypothetical protein CARUB_v10023880mg             199   3e-57    
gb|KHG18175.1|  hypothetical protein F383_00912                         199   3e-57    
ref|XP_010506739.1|  PREDICTED: short-chain dehydrogenase reducta...    199   3e-57    
gb|ABK22004.1|  unknown                                                 199   4e-57    
ref|XP_008461399.1|  PREDICTED: short-chain dehydrogenase reducta...    199   4e-57    
ref|XP_007050766.1|  NAD(P)-binding Rossmann-fold superfamily pro...    200   4e-57    
ref|XP_010049792.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   4e-57    
gb|ABK94192.1|  unknown                                                 200   4e-57    
ref|XP_006359043.1|  PREDICTED: xanthoxin dehydrogenase-like            199   4e-57    
ref|XP_010104809.1|  Momilactone A synthase                             199   4e-57    
ref|XP_009620564.1|  PREDICTED: short-chain dehydrogenase reducta...    198   5e-57    
gb|AHH81851.1|  short-chain alcohol dehydrogenase                       199   5e-57    
gb|KDP41845.1|  hypothetical protein JCGZ_26863                         199   5e-57    
gb|KHN11533.1|  Momilactone A synthase                                  199   5e-57    
ref|XP_010312311.1|  PREDICTED: short-chain dehydrogenase reducta...    200   5e-57    
ref|XP_006844487.1|  hypothetical protein AMTR_s00016p00114910          205   5e-57    
ref|XP_006854740.1|  hypothetical protein AMTR_s00030p00244570          199   5e-57    
ref|XP_006395525.1|  hypothetical protein EUTSA_v10004680mg             199   5e-57    
ref|XP_011033624.1|  PREDICTED: zerumbone synthase isoform X2           199   6e-57    
ref|XP_010911600.1|  PREDICTED: short-chain dehydrogenase reducta...    198   6e-57    
ref|XP_010059365.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   6e-57    
ref|NP_182235.1|  short-chain dehydrogenase reductase 3                 198   6e-57    
gb|KDP36095.1|  hypothetical protein JCGZ_08739                         199   6e-57    
ref|XP_004249651.1|  PREDICTED: short-chain dehydrogenase reducta...    200   6e-57    
gb|AAR88581.1|  putative hydroxysteroiddehydrogenase                    199   6e-57    
ref|XP_009411944.1|  PREDICTED: momilactone A synthase-like             199   6e-57    
ref|XP_004506207.1|  PREDICTED: momilactone A synthase-like             198   6e-57    
ref|XP_010684754.1|  PREDICTED: zerumbone synthase                      199   6e-57    
ref|XP_006416957.1|  hypothetical protein EUTSA_v10008526mg             198   7e-57    
ref|XP_011033623.1|  PREDICTED: zerumbone synthase isoform X1           199   7e-57    
ref|NP_001051806.2|  Os03g0833100                                       198   7e-57    
ref|XP_006360738.1|  PREDICTED: secoisolariciresinol dehydrogenas...    199   7e-57    
gb|ADK56099.1|  alcohol dehydrogenase                                   198   8e-57    
ref|XP_006354114.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   8e-57    
ref|XP_008462605.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   8e-57    
ref|XP_009122095.1|  PREDICTED: zerumbone synthase isoform X2           199   8e-57    
ref|XP_007050765.1|  NAD(P)-binding Rossmann-fold superfamily pro...    201   8e-57    
emb|CBI28276.3|  unnamed protein product                                200   9e-57    
ref|XP_008443590.1|  PREDICTED: tropinone reductase-like 1              198   1e-56    
ref|XP_003554568.1|  PREDICTED: short-chain dehydrogenase reducta...    198   1e-56    
gb|KGN48288.1|  hypothetical protein Csa_6G454360                       198   1e-56    
ref|XP_010999595.1|  PREDICTED: xanthoxin dehydrogenase isoform X1      199   1e-56    
ref|XP_010556323.1|  PREDICTED: sex determination protein tassels...    199   1e-56    
ref|XP_002308449.1|  hypothetical protein POPTR_0006s22330g             198   1e-56    
ref|XP_010507109.1|  PREDICTED: short-chain dehydrogenase reducta...    200   1e-56    
gb|ABK25445.1|  unknown                                                 198   1e-56    
ref|XP_010683811.1|  PREDICTED: tropinone reductase-like 1              198   1e-56    
ref|XP_006361612.1|  PREDICTED: secoisolariciresinol dehydrogenas...    198   1e-56    



>ref|XP_009619036.1| PREDICTED: short-chain dehydrogenase reductase 2a [Nicotiana 
tomentosiformis]
Length=286

 Score =   400 bits (1028),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/288 (73%), Positives = 242/288 (84%), Gaps = 2/288 (1%)
 Frame = +1

Query  25   FEMDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
              MD   +T +++  +L  KR  L GKVAVITGGARGIGA TA++ A NG  V+IADILD
Sbjct  1    MNMDHNGETEDTSVSLLSPKR--LRGKVAVITGGARGIGAATARVFAENGAHVVIADILD  58

Query  205  ELGAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKM  384
            E+GA LA+SI GRYVHCDVSKE +VESAVK A+EW+G+LDIMFNNAGIAG GGSI  +KM
Sbjct  59   EVGASLADSIEGRYVHCDVSKEEEVESAVKQAVEWKGRLDIMFNNAGIAGFGGSITNIKM  118

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            +++ +LLAINLNGVVHG+KHAAR MIAG  GGTIICSSSSAAIMGGLASH Y++SK AIL
Sbjct  119  DKMMTLLAINLNGVVHGVKHAARTMIAGKHGGTIICSSSSAAIMGGLASHSYTMSKEAIL  178

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllr  744
            GL RS ACELG +GIRVNC+SPHGVPSEMLVS YR  LG  ++  +EV  IVGERGSLL 
Sbjct  179  GLSRSTACELGVYGIRVNCISPHGVPSEMLVSEYRKFLGNMELRPDEVSSIVGERGSLLH  238

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            GRGG +EDVAQAVLFLAS++SGF+TGHNL++DGGYTSA SQMSFIYQE
Sbjct  239  GRGGTLEDVAQAVLFLASDESGFITGHNLVIDGGYTSACSQMSFIYQE  286



>ref|XP_006351912.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Solanum 
tuberosum]
Length=285

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 211/287 (74%), Positives = 246/287 (86%), Gaps = 3/287 (1%)
 Frame = +1

Query  31   MD-RTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDE  207
            MD   ++T ++  Q+L  +R  L GKVAVITGGARGIGA TA++ A NG  V+IADIL+E
Sbjct  1    MDHNNSETKDTLVQILSPQR--LRGKVAVITGGARGIGAATARVFAENGAHVVIADILNE  58

Query  208  LGAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKME  387
            +G  LAESIGGRYV CDVSKE +VESAVK+A+EW+G+LDIMFNNAGIAG GGSI  +KM+
Sbjct  59   VGTSLAESIGGRYVRCDVSKEEEVESAVKVAVEWKGRLDIMFNNAGIAGFGGSITNIKMD  118

Query  388  QLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILG  567
            Q+ +LLAINL+GVVHGIKHAAR MIAG +GGTIICSSSSAAIMGGLASH Y++SK AILG
Sbjct  119  QMMTLLAINLHGVVHGIKHAARTMIAGKRGGTIICSSSSAAIMGGLASHSYTMSKEAILG  178

Query  568  LVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrg  747
            L RS ACELG HGIRVNC+SPHGVPSEMLVS ++  LG T++   EVG IVGERGSLLRG
Sbjct  179  LARSTACELGVHGIRVNCISPHGVPSEMLVSEFQKFLGNTELRPNEVGSIVGERGSLLRG  238

Query  748  rggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            RGGR+EDVAQAVLFLAS++SGFVTGHNL++DGGYTSA SQMSFIY +
Sbjct  239  RGGRLEDVAQAVLFLASDESGFVTGHNLVIDGGYTSAFSQMSFIYND  285



>ref|XP_009797691.1| PREDICTED: short-chain dehydrogenase reductase 3b isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797692.1| PREDICTED: short-chain dehydrogenase reductase 3b isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797693.1| PREDICTED: short-chain dehydrogenase reductase 3b isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797694.1| PREDICTED: short-chain dehydrogenase reductase 3b isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797695.1| PREDICTED: short-chain dehydrogenase reductase 3b isoform X2 
[Nicotiana sylvestris]
Length=286

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/288 (73%), Positives = 243/288 (84%), Gaps = 2/288 (1%)
 Frame = +1

Query  25   FEMDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
              MD   +T +++  +L  KR  L GKVAVITGGARGIGA TA++ A NG  V+IADILD
Sbjct  1    MNMDHNGETVDTSVSLLSPKR--LRGKVAVITGGARGIGAATARVFAENGAHVVIADILD  58

Query  205  ELGAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKM  384
            E+GA LA+SI GRYVHCDVSKE +VESAVK A+EW+G+LDIMFNNAGIAG GGSI  +KM
Sbjct  59   EVGASLADSIEGRYVHCDVSKEEEVESAVKQAVEWKGRLDIMFNNAGIAGFGGSITNIKM  118

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            +++ +LLAINLNGVVHG+KHAAR MIAG  GGTIICSSSSAAIMGGLASH Y++SK AIL
Sbjct  119  DKMMTLLAINLNGVVHGVKHAARTMIAGKHGGTIICSSSSAAIMGGLASHSYTMSKEAIL  178

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllr  744
            GL RS ACELG +GIRVNC+SPHGVPSEMLV+ YR  LG  ++  +EV  IVGERGSLL 
Sbjct  179  GLARSTACELGVYGIRVNCISPHGVPSEMLVNEYRKFLGNMELRPDEVSSIVGERGSLLH  238

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            GRGGRMEDVAQAVLFLAS++SGF+TGHNL++DGGYTSA SQMSFIYQ+
Sbjct  239  GRGGRMEDVAQAVLFLASDESGFITGHNLVIDGGYTSACSQMSFIYQD  286



>ref|XP_010312930.1| PREDICTED: short-chain dehydrogenase reductase 2a [Solanum lycopersicum]
Length=283

 Score =   392 bits (1007),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 206/282 (73%), Positives = 238/282 (84%), Gaps = 0/282 (0%)
 Frame = +1

Query  43   TKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPL  222
            T   E T  +   K   L GKVAVITGGARGIGA TA++ A NG  V+IADIL+E+G  L
Sbjct  2    TIERERTKNLNSLKCVRLRGKVAVITGGARGIGAATARVFAENGAHVVIADILNEVGTSL  61

Query  223  AESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASL  402
            AESIGGRY+ CDVSKE +VESAVK+A+EW+G+LDIMFNNAGIAG GGSI  ++M+Q+ +L
Sbjct  62   AESIGGRYIQCDVSKEEEVESAVKVAVEWKGRLDIMFNNAGIAGFGGSITNIRMDQMMTL  121

Query  403  LAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSA  582
            LAINL+GVVHGIKHAAR MIAG +GGTIICSSSSAAIMGGLASH Y++SK AILGL RS 
Sbjct  122  LAINLHGVVHGIKHAARTMIAGKRGGTIICSSSSAAIMGGLASHSYTMSKEAILGLARST  181

Query  583  ACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrM  762
            ACELG HGIRVNC+SPHGVPSEMLVS ++  LG T++   EV  IVGERGSLLRGRGGR+
Sbjct  182  ACELGVHGIRVNCISPHGVPSEMLVSEFQKFLGNTELRPNEVSLIVGERGSLLRGRGGRL  241

Query  763  EDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            EDVAQAVLFLAS++SGFVTGHNL++DGGYTSA SQMSFIY +
Sbjct  242  EDVAQAVLFLASDESGFVTGHNLVIDGGYTSAFSQMSFIYND  283



>ref|XP_002521887.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF40523.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=282

 Score =   390 bits (1003),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 198/273 (73%), Positives = 230/273 (84%), Gaps = 2/273 (1%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRY  246
            Q L +KR  L GKVAV+TGGARGIGA TAK  A NG +V++ADILD+LG PLA+SIGGRY
Sbjct  12   QRLSTKR--LRGKVAVVTGGARGIGAATAKRFAENGANVVVADILDDLGHPLADSIGGRY  69

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGV  426
            +HCDV+ EADVESA+ LAL W+GKLDIMFNNAGIAGP GSI  + MEQ+  L ++N+NG 
Sbjct  70   IHCDVANEADVESAINLALAWKGKLDIMFNNAGIAGPDGSITNLDMEQVKYLFSVNVNGT  129

Query  427  VHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHG  606
            +HGIKHAA+AMI G  GG IICSSSSAAIMGGL SHPY+ SK AI+GL++S ACELG HG
Sbjct  130  LHGIKHAAKAMIKGQNGGCIICSSSSAAIMGGLGSHPYTSSKEAIVGLMKSTACELGVHG  189

Query  607  IRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVL  786
            IRVNC+SPHGVPSEMLV AYR ILGK D+ +EEV KIVGERGSLLRGR   +EDVAQA L
Sbjct  190  IRVNCISPHGVPSEMLVGAYRRILGKADMNSEEVSKIVGERGSLLRGRCATVEDVAQAAL  249

Query  787  FLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            FLASE+SGF+T HNL++DGGYTSA + M+FIYQ
Sbjct  250  FLASEESGFITAHNLVIDGGYTSANNNMNFIYQ  282



>ref|XP_006448042.1| hypothetical protein CICLE_v10016207mg [Citrus clementina]
 gb|ESR61282.1| hypothetical protein CICLE_v10016207mg [Citrus clementina]
Length=278

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 195/271 (72%), Positives = 230/271 (85%), Gaps = 2/271 (1%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVH  252
            L SKR  L GKVA+ITGGARGIGA TAKL A NG  ++IADILDELGA LA++IGGRY+H
Sbjct  10   LSSKR--LMGKVALITGGARGIGAATAKLFAENGAHIVIADILDELGAALADTIGGRYIH  67

Query  253  CDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVH  432
            CDV+KE DVESAV+LA+ W+G+LDIMFNNAGI+G GGSI  + ME +  LL++NLNG++H
Sbjct  68   CDVTKEEDVESAVRLAVSWKGRLDIMFNNAGISGSGGSITSLNMEDVKFLLSVNLNGILH  127

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            GIKHAA+AMI G + G+IIC+SSSAAIMGGLASH YSLSK AI+GL RS ACELG+HGIR
Sbjct  128  GIKHAAKAMIEGQRKGSIICTSSSAAIMGGLASHAYSLSKEAIIGLARSTACELGKHGIR  187

Query  613  VNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFL  792
            VNC+SPHGVPSEMLV+AYR  LGK D+  EEV K+VGE GSLLRGR   +EDVAQA LFL
Sbjct  188  VNCISPHGVPSEMLVNAYRKYLGKADMKPEEVSKMVGESGSLLRGRSASIEDVAQAALFL  247

Query  793  ASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            ASE++GF+T HNL++DGGYT+  S MSFIYQ
Sbjct  248  ASEEAGFITAHNLVIDGGYTTGTSSMSFIYQ  278



>gb|KDO58626.1| hypothetical protein CISIN_1g023708mg [Citrus sinensis]
Length=278

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 194/271 (72%), Positives = 228/271 (84%), Gaps = 2/271 (1%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVH  252
            L SKR  L GKVAVITGGARGIGA TAKL A NG  ++IADILDELGA LA +IGGRY+H
Sbjct  10   LSSKR--LTGKVAVITGGARGIGAATAKLFAENGAHIVIADILDELGAALASTIGGRYIH  67

Query  253  CDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVH  432
            CDV+KE DVESAV+LA+ W+G+LDIMFNNAGI+G GGSI  + ME +  LL++NLNG++H
Sbjct  68   CDVTKEEDVESAVRLAVSWKGQLDIMFNNAGISGSGGSITSLNMEDVKFLLSVNLNGILH  127

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            GIKHAA+AMI G + G+IIC+SSSAAIMGGLASH YSLSK AI+GL RS ACELG+HGIR
Sbjct  128  GIKHAAKAMIEGQRKGSIICTSSSAAIMGGLASHAYSLSKEAIIGLARSTACELGKHGIR  187

Query  613  VNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFL  792
            VNC+SPHGVPSEMLV+AYR  LGK D+  EEV K+V + GSLLRGR   +EDVAQA LFL
Sbjct  188  VNCISPHGVPSEMLVNAYRKYLGKADMKPEEVCKMVRDSGSLLRGRSASIEDVAQAALFL  247

Query  793  ASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            ASE++GF+T HNL++DGGYT+  S MSFIYQ
Sbjct  248  ASEEAGFITAHNLVIDGGYTTGTSSMSFIYQ  278



>ref|XP_011025007.1| PREDICTED: short-chain dehydrogenase reductase 2a [Populus euphratica]
Length=284

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 198/273 (73%), Positives = 226/273 (83%), Gaps = 2/273 (1%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRY  246
            Q   SKR  L GKVAVITGGARGIGA TAK+ A NG  VIIADILD LG  LA+SIGGRY
Sbjct  14   QRTTSKR--LMGKVAVITGGARGIGAATAKVFAENGASVIIADILDNLGTSLADSIGGRY  71

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGV  426
            +HCDV  EADVESA+ LAL W+GKLDIMFNNAGI+G  GSI  + MEQ+  LL++N+NG+
Sbjct  72   IHCDVVNEADVESAINLALAWKGKLDIMFNNAGISGTEGSITNIDMEQVKYLLSVNVNGI  131

Query  427  VHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHG  606
            +HGIKHAAR MI G KGG IIC SSSAAIMGGL SHPYSLSK AI+GL+RS ACELG HG
Sbjct  132  LHGIKHAARVMIKGQKGGCIICMSSSAAIMGGLGSHPYSLSKEAIIGLMRSTACELGVHG  191

Query  607  IRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVL  786
            IRVNC+SPHGVPSEMLV AYR +LGK  +  EEV KIVGERGSLL+GR   +EDVAQAV+
Sbjct  192  IRVNCISPHGVPSEMLVGAYRKVLGKKYMTPEEVSKIVGERGSLLKGRSPSLEDVAQAVM  251

Query  787  FLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            FLASE++G++T HNL++DGG+TSA S MSFIYQ
Sbjct  252  FLASEEAGYITAHNLVVDGGFTSASSNMSFIYQ  284



>ref|XP_002312493.2| alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE89860.2| alcohol dehydrogenase family protein [Populus trichocarpa]
Length=263

 Score =   381 bits (978),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/262 (74%), Positives = 222/262 (85%), Gaps = 0/262 (0%)
 Frame = +1

Query  100  GKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEADV  279
            GKVAVITGGARGIGA TAK+ A NG  VIIADILD+LG  LA+SIGGRY+HCDV  EADV
Sbjct  2    GKVAVITGGARGIGAATAKVFAENGASVIIADILDDLGTSLADSIGGRYIHCDVVNEADV  61

Query  280  ESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAM  459
            ESA+ LAL W+GKLDIMFNNAGI+G  GSI  + MEQ+  LL++N+NG++HGIKHAAR M
Sbjct  62   ESAINLALAWKGKLDIMFNNAGISGTEGSITNLDMEQVNYLLSVNVNGILHGIKHAARVM  121

Query  460  IAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
            I G KGG IIC SSSAAIMGGL SHPYSLSK AI+GL+RS ACELG HGIRVNC+SPHGV
Sbjct  122  IKGQKGGCIICMSSSAAIMGGLGSHPYSLSKEAIIGLMRSTACELGVHGIRVNCISPHGV  181

Query  640  PSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVT  819
             SEMLV AYR +LGK D+  EEV KIVGERGSLL+GR   +EDVAQAV+FLASE++G++T
Sbjct  182  ASEMLVGAYRKVLGKKDMTPEEVSKIVGERGSLLKGRSPSLEDVAQAVMFLASEEAGYIT  241

Query  820  GHNLILDGGYTSAVSQMSFIYQ  885
             HNL++DGG+TSA S MSFIYQ
Sbjct  242  AHNLVIDGGFTSASSNMSFIYQ  263



>emb|CAN63288.1| hypothetical protein VITISV_025196 [Vitis vinifera]
Length=285

 Score =   380 bits (975),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 198/276 (72%), Positives = 232/276 (84%), Gaps = 1/276 (0%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG  240
             DQ   S++  L GKVA+ITGGARGIGA TAKL A +G  VIIAD+LD LG  LA+SIGG
Sbjct  9    NDQQKLSEKRLL-GKVAIITGGARGIGAATAKLFARHGAHVIIADVLDHLGFTLADSIGG  67

Query  241  RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLN  420
            RY+HCDV+KE D+ESAV+LAL W+G+LDIMFNNAGI G  GS+  + M ++ +LLA+N+N
Sbjct  68   RYIHCDVAKEDDMESAVQLALTWKGQLDIMFNNAGIGGLDGSVTNIDMTKMKALLAVNVN  127

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            G +HGIKHAARAMI G KGG IIC+SSSAAIMGGLASH Y+LSK AI+GL+RS ACELG 
Sbjct  128  GNIHGIKHAARAMIRGRKGGCIICTSSSAAIMGGLASHGYTLSKEAIVGLMRSTACELGV  187

Query  601  HGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            HGIRVNC+SPHGVP+EMLVS YR ILGK DV  EEV +IVG+RGSLLRGRGG +ED+AQA
Sbjct  188  HGIRVNCISPHGVPTEMLVSGYRKILGKADVTPEEVSRIVGKRGSLLRGRGGSVEDIAQA  247

Query  781  VLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
             LFLASED+GF+T HNL+LDGG+TSA S MSFIYQE
Sbjct  248  ALFLASEDAGFITAHNLVLDGGFTSACSDMSFIYQE  283



>ref|XP_010651009.1| PREDICTED: tropinone reductase-like 2 [Vitis vinifera]
Length=332

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 236/287 (82%), Gaps = 3/287 (1%)
 Frame = +1

Query  28   EMDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDE  207
            EM+     H   DQ   S++  L GKVA+ITGGARGIGA TAKL A +G  VIIAD+LD 
Sbjct  47   EMELEPPLHN--DQQKLSEKRLL-GKVAIITGGARGIGAATAKLFARHGAHVIIADVLDH  103

Query  208  LGAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKME  387
            LG  LA+SIGGRY+HCDV+KE D+ESAV+LAL W+G+LDIMFNNAGI G  GS+  + M 
Sbjct  104  LGFTLADSIGGRYIHCDVAKEDDMESAVQLALTWKGQLDIMFNNAGIGGLDGSVTNIDMT  163

Query  388  QLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILG  567
            ++ +LLA+N+NG +HGIKHAARAMI G KGG IIC+SSSAAIMGGLASH Y+LSK AI+G
Sbjct  164  KMKALLAVNVNGNIHGIKHAARAMIRGRKGGCIICTSSSAAIMGGLASHGYTLSKEAIVG  223

Query  568  LVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrg  747
            L+RS ACELG HGIRVNC+SPHGVP+EMLVS YR ILGK DV  EEV +IVG+RGSLLRG
Sbjct  224  LMRSTACELGVHGIRVNCISPHGVPTEMLVSGYRKILGKADVTPEEVSRIVGKRGSLLRG  283

Query  748  rggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            RGG +ED+AQA LFLASED+GF+T HNL+LDGG+TSA S MSFIYQE
Sbjct  284  RGGSVEDIAQAALFLASEDAGFITAHNLVLDGGFTSACSDMSFIYQE  330



>ref|XP_008221371.1| PREDICTED: short-chain dehydrogenase reductase 2a [Prunus mume]
Length=287

 Score =   377 bits (967),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 195/286 (68%), Positives = 232/286 (81%), Gaps = 1/286 (0%)
 Frame = +1

Query  31   MDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDEL  210
            MD +   H+  +      +  +N KVAVITGGARGIGA TAKL A +G  V+IADILD+L
Sbjct  1    MDPSIPMHDEEEAHRLPPKRLVN-KVAVITGGARGIGAATAKLFADHGAHVVIADILDDL  59

Query  211  GAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQ  390
            GA LA+SIGGRY+HCDV+KEAD+ESA++LAL W+G+LDIMFNNAG+ GP GSI  + ME 
Sbjct  60   GATLADSIGGRYIHCDVAKEADIESAIELALNWKGRLDIMFNNAGVPGPSGSITSLDMEN  119

Query  391  LASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGL  570
            +  LL++N+ GV+HGIK+AA AMI G  GG+I+C+SSSAAIMGGL  H Y+LSK AI GL
Sbjct  120  VKQLLSVNVFGVIHGIKYAAAAMIKGRIGGSILCTSSSAAIMGGLGGHAYTLSKEAINGL  179

Query  571  VRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgr  750
            VRSAACELG HGIRVNC+SPHGVPSEMLVSAYR  LGK D+ AE+V KIVGERGSLLRGR
Sbjct  180  VRSAACELGVHGIRVNCISPHGVPSEMLVSAYREHLGKMDMKAEDVSKIVGERGSLLRGR  239

Query  751  ggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
               +EDVA+A LF+ASED+GF+T HNL+LDGGYTSA S MSFIYQ 
Sbjct  240  CPTVEDVAEAALFVASEDAGFITAHNLVLDGGYTSACSTMSFIYQN  285



>ref|XP_009351621.1| PREDICTED: short-chain dehydrogenase reductase 2a [Pyrus x bretschneideri]
Length=287

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 193/273 (71%), Positives = 229/273 (84%), Gaps = 0/273 (0%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYV  249
             +CS    L  KVAV+TGGARGIGA TAKL A +G  V++ADILDELGA LA+SIGGRY+
Sbjct  9    FMCSGLVRLANKVAVVTGGARGIGAATAKLFAQHGAHVVVADILDELGATLADSIGGRYI  68

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDVSKEADVESAV+LAL+W+G+LDIM NNAG+ GP GSI  + M+Q+  LL++N+ G V
Sbjct  69   HCDVSKEADVESAVELALKWKGRLDIMINNAGVPGPPGSITSLDMKQVMHLLSVNVLGAV  128

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
            HGIK+AA AMI GG+GG+IIC+SSSA IMGGL  H Y+LSK+AI GL RSAACELG HGI
Sbjct  129  HGIKYAAAAMINGGRGGSIICTSSSAGIMGGLGGHAYTLSKAAINGLARSAACELGVHGI  188

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVN +SPHGVPSEMLV +YR  LGK D+ AE+VG+IVGERGSLLRGR   +EDVA+A LF
Sbjct  189  RVNNISPHGVPSEMLVDSYRWHLGKMDMTAEDVGRIVGERGSLLRGRWATVEDVAEAALF  248

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            +AS+D+GF+TGHNL+LDGGYTSAVS MSFIYQ 
Sbjct  249  MASKDAGFITGHNLVLDGGYTSAVSTMSFIYQN  281



>ref|XP_008340534.1| PREDICTED: tropinone reductase-like 1 [Malus domestica]
Length=318

 Score =   375 bits (964),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 197/288 (68%), Positives = 235/288 (82%), Gaps = 3/288 (1%)
 Frame = +1

Query  28   EMDRTTKTHESTD-QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
             M+ +   H+  + Q   SKR  L  KVAV+TGGARGIGA TAKLLA +G  V++ADILD
Sbjct  27   NMEPSIPMHDEDEAQRPPSKR--LANKVAVVTGGARGIGAATAKLLAQHGAHVVVADILD  84

Query  205  ELGAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKM  384
            ELGA LA+SIGGRY+HCDVSKEADVESAV+LAL+W+G+LDIM NNAG+ GP GSI  + M
Sbjct  85   ELGATLADSIGGRYIHCDVSKEADVESAVELALKWKGRLDIMINNAGVPGPPGSITTLDM  144

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            +Q+  LL++N+ G VHGIK+AA AMI G +GG+IIC+SSSA IMGGL  H Y+LSK+AI 
Sbjct  145  KQVMHLLSVNVLGAVHGIKYAAAAMINGRRGGSIICTSSSAGIMGGLGGHAYTLSKAAIN  204

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllr  744
            GL RSAACELG HGIRVN +SPHGVPSEMLV +YR  LGK D+ AE+VG+IVGERGS LR
Sbjct  205  GLARSAACELGVHGIRVNNISPHGVPSEMLVDSYRWHLGKMDMTAEDVGRIVGERGSSLR  264

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            GR   +EDVA+A LF+ASED+GF+TGHNL+LDGGYTSAVS MSFIYQ 
Sbjct  265  GRWATVEDVAEAALFMASEDAGFITGHNLVLDGGYTSAVSTMSFIYQN  312



>gb|KDP38202.1| hypothetical protein JCGZ_04845 [Jatropha curcas]
Length=282

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 227/285 (80%), Gaps = 3/285 (1%)
 Frame = +1

Query  31   MDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDEL  210
            M+     HE   Q   +KR  L GKVAVITGGARGIGA TAK  A NG  V+IADILDEL
Sbjct  1    METQIHMHEDV-QGQSTKR--LRGKVAVITGGARGIGAATAKTFAENGASVVIADILDEL  57

Query  211  GAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQ  390
            G  LA+SIGG+Y+HC+V  EADVE+A+ LAL W+GK+DIMFNNAGIAGPGGSI  + M+Q
Sbjct  58   GGSLADSIGGKYIHCNVVNEADVEAAINLALAWKGKIDIMFNNAGIAGPGGSITNLDMQQ  117

Query  391  LASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGL  570
            + +L ++N+ G+ HGIKHAA AMI     G IIC+SSSAAIMGGL SHPY+ SK AILGL
Sbjct  118  VKNLFSVNVGGIFHGIKHAAAAMIKARTEGCIICTSSSAAIMGGLGSHPYTSSKEAILGL  177

Query  571  VRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgr  750
            ++S+ACELG +GIRVNC+SPHGVPS+MLV+AYR ILGK D+  EEV KIVGE GSLLRG+
Sbjct  178  MKSSACELGVYGIRVNCISPHGVPSDMLVNAYRRILGKEDMQPEEVSKIVGESGSLLRGK  237

Query  751  ggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
               +EDVAQA LFLASE+S F+T HNL++DGGYTSA S MSFIYQ
Sbjct  238  CASVEDVAQAALFLASEESRFITAHNLVIDGGYTSANSNMSFIYQ  282



>gb|AGW52137.1| ATA [Populus tomentosa]
Length=263

 Score =   371 bits (953),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 189/262 (72%), Positives = 220/262 (84%), Gaps = 0/262 (0%)
 Frame = +1

Query  100  GKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEADV  279
            GKVAVITGGARGIGA TAK+ A NG  V IADIL +LG  LA+SIGGRY+HCDV  +ADV
Sbjct  2    GKVAVITGGARGIGAATAKVFAENGASVNIADILADLGTSLADSIGGRYIHCDVVNQADV  61

Query  280  ESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAM  459
            ESA+ LAL W+GKLDIMFNNAGI+G  GSI  + MEQ+  LL++N+NG++HGIKHAAR M
Sbjct  62   ESAINLALAWKGKLDIMFNNAGISGTEGSITNLDMEQVNYLLSVNVNGILHGIKHAARVM  121

Query  460  IAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
            I G KGG IIC SSSAAIMGGL SHPYSL+K AI+GL+RS ACELG HGIRVNC+SPHGV
Sbjct  122  ITGQKGGCIICMSSSAAIMGGLGSHPYSLAKEAIIGLMRSTACELGVHGIRVNCISPHGV  181

Query  640  PSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVT  819
             SEMLV AYR +LGK D+   EV KIVGERGSLL+GR   +EDVAQAVLFLASE++G++T
Sbjct  182  ASEMLVGAYRKVLGKKDMTPVEVSKIVGERGSLLKGRSPSLEDVAQAVLFLASEEAGYIT  241

Query  820  GHNLILDGGYTSAVSQMSFIYQ  885
             HNL++DGG+TSA S+MSFIYQ
Sbjct  242  AHNLVIDGGFTSASSKMSFIYQ  263



>ref|XP_010111069.1| Momilactone A synthase [Morus notabilis]
 gb|EXC29931.1| Momilactone A synthase [Morus notabilis]
Length=285

 Score =   369 bits (947),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 195/287 (68%), Positives = 237/287 (83%), Gaps = 4/287 (1%)
 Frame = +1

Query  31   MDRTTKTHESTD-QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDE  207
            MD    ++++ + Q +  KR  L GK+AVITGGARGIGA TAK+ A NG  VIIADILD+
Sbjct  1    MDPAANSYKTDEAQKVSEKR--LAGKIAVITGGARGIGAATAKVFAQNGAHVIIADILDD  58

Query  208  LGAPLAESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKM  384
            LGA LA+SIGGRY+HCDV+KE+DVESAV+LAL+W+G+LDIMFNNAGI+GP GGSI  + M
Sbjct  59   LGATLADSIGGRYIHCDVTKESDVESAVELALKWKGQLDIMFNNAGISGPTGGSITSLDM  118

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            +++ +LL++N+ G++HG K+A+RAMI G   G+IIC+SSSA IMGGL SH Y+LSK AI 
Sbjct  119  DKVKNLLSVNVLGILHGTKYASRAMIKGKNKGSIICTSSSAGIMGGLGSHGYTLSKEAIN  178

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllr  744
            GLVRS ACELG HGIRVN +SPHGVP+EMLV A+R  +GK D+ AEEVGKIVGERGSLLR
Sbjct  179  GLVRSVACELGVHGIRVNSISPHGVPTEMLVGAFRKFVGKVDIKAEEVGKIVGERGSLLR  238

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            GRGG  +DVA A LFLAS+DS FVT HNL++DGGYTSA S MSFIYQ
Sbjct  239  GRGGTADDVAMAALFLASDDSAFVTAHNLVVDGGYTSADSNMSFIYQ  285



>ref|XP_006492273.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Citrus 
sinensis]
Length=278

 Score =   368 bits (945),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 196/271 (72%), Positives = 230/271 (85%), Gaps = 2/271 (1%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVH  252
            L SKR  L GKVA+ITGGARGIGA TAKL A NG  ++IADILDELGA LA++IGGRY+H
Sbjct  10   LSSKR--LMGKVALITGGARGIGAATAKLFAENGAHIVIADILDELGAALADTIGGRYIH  67

Query  253  CDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVH  432
            CDV+KE DVESAV+LA+ W+G+LDIMFNNAGI+G GGSI  + ME +  LL++NLNG++H
Sbjct  68   CDVTKEEDVESAVRLAVSWKGQLDIMFNNAGISGSGGSITSLNMEDVKFLLSVNLNGILH  127

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            GIKHAA+AMI G + G+IICSSSSAAIMGGLASH YSLSK AI+GL RS ACELG+HGIR
Sbjct  128  GIKHAAKAMIEGQRKGSIICSSSSAAIMGGLASHAYSLSKEAIIGLARSTACELGKHGIR  187

Query  613  VNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFL  792
            VNC+SPHGVPSEMLV+AYR  LGK D+  EEV K+VGE GSLLRGR   +EDVAQA LFL
Sbjct  188  VNCISPHGVPSEMLVNAYRKYLGKADMKPEEVSKMVGESGSLLRGRSASIEDVAQAALFL  247

Query  793  ASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            ASE++GF+T HNL++DGGYT+  S MSFIYQ
Sbjct  248  ASEEAGFITAHNLVIDGGYTTGTSSMSFIYQ  278



>ref|XP_011088821.1| PREDICTED: short-chain dehydrogenase reductase 3b [Sesamum indicum]
Length=299

 Score =   359 bits (922),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 201/269 (75%), Positives = 232/269 (86%), Gaps = 0/269 (0%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCD  258
            S  + L GKVAVITGGARGIGA TA++ A NG  VIIADILDE GA LA+SIGGRYVHCD
Sbjct  30   SASTRLLGKVAVITGGARGIGAATAQVFAENGAHVIIADILDEPGAKLADSIGGRYVHCD  89

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            VS E DVE AV+LA++W+G+LDIMFNNAG+ GPGGSI  +KME L +L+A+NLNG+VHGI
Sbjct  90   VSVEHDVERAVQLAIDWKGRLDIMFNNAGVPGPGGSITNLKMEHLMALVAVNLNGIVHGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAARAMI G   G+IICSSSSAAIMGGLASH Y+LSK AILGL RS ACELG HGIRVN
Sbjct  150  KHAARAMIKGKNSGSIICSSSSAAIMGGLASHSYTLSKEAILGLARSTACELGVHGIRVN  209

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            CVSPHGVP+E+L+SAYR +LG  D+  E+V KIVGERGSLLRGRGGR+EDVA+AVLFLAS
Sbjct  210  CVSPHGVPTEILMSAYRKVLGNPDLQPEDVSKIVGERGSLLRGRGGRLEDVAEAVLFLAS  269

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            +D+GF+TGHNLI+DGGYT A +Q+S IYQ
Sbjct  270  DDAGFITGHNLIIDGGYTCANNQLSVIYQ  298



>ref|XP_010270813.1| PREDICTED: short-chain dehydrogenase reductase 2a [Nelumbo nucifera]
Length=275

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/277 (66%), Positives = 226/277 (82%), Gaps = 3/277 (1%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E    M  SKR  L GKVA++TGG+RGIGA TAKL A +G  VIIADILDELG  +A+SI
Sbjct  2    EQNGHMHKSKR--LKGKVAIVTGGSRGIGAATAKLFAQSGAHVIIADILDELGMGVADSI  59

Query  235  GGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAIN  414
            GG+Y+HCDV+ E+DVESAV+LA+ W+G+LDIM NNAGI G  GSI ++ M++L  ++++N
Sbjct  60   GGQYIHCDVTSESDVESAVQLAVAWKGRLDIMVNNAGITGADGSIVKLDMDKLKEVVSVN  119

Query  415  LNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACEL  594
            +NG+VHGIKHAARAMI   +G  IIC SSSAA+MGGLASH YSLSK AILGL RS ACEL
Sbjct  120  INGMVHGIKHAARAMIKARRG-CIICISSSAALMGGLASHGYSLSKEAILGLARSTACEL  178

Query  595  GQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            G +GIRVNC+SPHGVPSEMLV  +R +LGK D+ AEEVGK++GERGSLL GR G  ED+A
Sbjct  179  GAYGIRVNCISPHGVPSEMLVDGFRRVLGKVDIGAEEVGKVIGERGSLLLGRSGSTEDIA  238

Query  775  QAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            QA LFLAS+D+G++TGHNL++DGG+TS  S MSF+Y 
Sbjct  239  QAALFLASDDAGYITGHNLVVDGGFTSGYSFMSFLYN  275



>ref|XP_008389129.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Malus 
domestica]
 ref|XP_008350826.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Malus 
domestica]
Length=287

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 194/276 (70%), Positives = 228/276 (83%), Gaps = 0/276 (0%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYV  249
             +C     L  KVAVITGGARGIGA  AKL A NG  VI+ADILD++GA LA+SIGGRY+
Sbjct  9    FICFSFVRLANKVAVITGGARGIGAAAAKLFARNGAHVIVADILDDIGATLADSIGGRYI  68

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDVSKEADVESAV+LAL+W+G++DIMFNNAG+ GP GSI+ + MEQ+  LL+IN+ GVV
Sbjct  69   HCDVSKEADVESAVELALKWKGRIDIMFNNAGVPGPSGSISSLDMEQVKDLLSINVLGVV  128

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
            HGIK+AA AMI G +GG+IIC+SSSA IMGGL  H Y+LSK A+ GL +SAACELG HGI
Sbjct  129  HGIKYAAAAMIKGRRGGSIICTSSSAGIMGGLGGHAYTLSKEALNGLAKSAACELGVHGI  188

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVN +SPHGVPSEMLV AYRM LGK D+ AE+V +IVGERGSLLRGR   +EDVA+A LF
Sbjct  189  RVNNISPHGVPSEMLVDAYRMHLGKMDMTAEDVSRIVGERGSLLRGRCATVEDVAEAALF  248

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE*RK  897
            +ASED+GF+TGHNL+LDGGYTSA S MSFIYQ   K
Sbjct  249  MASEDAGFITGHNLVLDGGYTSACSTMSFIYQNSNK  284



>emb|CDP15179.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 197/273 (72%), Positives = 232/273 (85%), Gaps = 2/273 (1%)
 Frame = +1

Query  64   DQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR  243
            D+   SKR  L GKVA+ITG ARGIG  TAKL A NG  V+IADILDELG+ LA+SIGGR
Sbjct  7    DRQSPSKR--LEGKVALITGSARGIGGATAKLFAKNGAYVVIADILDELGSKLADSIGGR  64

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNG  423
            Y+HCDVSKE DVESAV+ AL W+GKLDIMFNNAG+ GPGGSI+ + ME + +LL+INL G
Sbjct  65   YIHCDVSKEEDVESAVEFALAWKGKLDIMFNNAGVGGPGGSISSLNMEDVRALLSINLFG  124

Query  424  VVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQH  603
            ++HGIKHA+RAMIAG  GG+IICSSSSAAIMGGLA+H Y+ SK+AILGL ++ ACELG +
Sbjct  125  IIHGIKHASRAMIAGKNGGSIICSSSSAAIMGGLAAHAYTASKTAILGLAKTTACELGAY  184

Query  604  GIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAV  783
            GIRVNC+SPHGV SEML+SAYR  LG+ D+ AE+V KIVGERGSLLRGRGG MEDVA+AV
Sbjct  185  GIRVNCISPHGVASEMLLSAYRTCLGRDDLQAEDVTKIVGERGSLLRGRGGSMEDVAKAV  244

Query  784  LFLASEDSGFVTGHNLILDGGYTSAVSQMSFIY  882
            LFLAS++SGF+T HNL++DGGYTSA S MS IY
Sbjct  245  LFLASDESGFITAHNLVIDGGYTSACSHMSPIY  277



>ref|XP_004298637.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Fragaria 
vesca subsp. vesca]
Length=280

 Score =   342 bits (877),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 222/272 (82%), Gaps = 2/272 (1%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYV  249
            +L SK+  L  KVAVITGGARGIGA  A L A NG  V+IADILD+LGA LAESI GRYV
Sbjct  6    LLPSKK--LVNKVAVITGGARGIGAAAATLFAQNGAHVVIADILDDLGAALAESIEGRYV  63

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDVSKEADVESA++LAL W+G+LDIMFNNAGI+GP GSI  + M ++  LL++N+ G +
Sbjct  64   HCDVSKEADVESAIELALRWKGQLDIMFNNAGISGPSGSITSLDMGKVQQLLSVNIFGYL  123

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
            HGIK+AA AMI     G+IIC+SSSAAIMGGL  H Y+LSK AI GLVRSAACELG HGI
Sbjct  124  HGIKYAAAAMIKTRTNGSIICTSSSAAIMGGLGGHAYTLSKEAINGLVRSAACELGVHGI  183

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVN +SPHGVP+E+LV+AYR +L K D+ AE+V KIVGE GSLLRGR   ++DVA+A LF
Sbjct  184  RVNSISPHGVPTEILVTAYRELLRKEDMQAEDVSKIVGETGSLLRGRCATVKDVAEAALF  243

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            LASEDSGF+T HNL+LDGGYTSA S +SFIYQ
Sbjct  244  LASEDSGFITAHNLVLDGGYTSATSTLSFIYQ  275



>ref|XP_007045394.1| Alcohol dehydrogenase [Theobroma cacao]
 gb|EOY01226.1| Alcohol dehydrogenase [Theobroma cacao]
Length=281

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/273 (69%), Positives = 225/273 (82%), Gaps = 3/273 (1%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRY  246
            Q L +KR  L GKVAVITGGARGIGA  AKL A NG  V+IADILDELGA LAESIG RY
Sbjct  12   QNLSAKR--LIGKVAVITGGARGIGAAAAKLFAENGAYVVIADILDELGAMLAESIGARY  69

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGV  426
            +HCDV+KE DVESA++LAL W+G+LDI+F+NAGI GP GSI  + MEQ+  L++INL G 
Sbjct  70   IHCDVAKEDDVESAIQLALTWKGQLDILFSNAGIGGPAGSITSIDMEQVKHLISINLLGN  129

Query  427  VHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHG  606
            VHGIKHAARAM+     G+IIC+SSSA +MGGLASH YSLSK+AI+GL+R+AACELG HG
Sbjct  130  VHGIKHAARAMLKHRTKGSIICTSSSAGVMGGLASHIYSLSKAAIIGLMRTAACELGVHG  189

Query  607  IRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVL  786
            IRVNC+SPH VPS++LVSAYR+ LG  +   E+V K+VGE GSLLRGR   +EDVAQA L
Sbjct  190  IRVNCISPHAVPSDLLVSAYRIFLGN-ETRPEQVSKLVGETGSLLRGRAATVEDVAQAAL  248

Query  787  FLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            FLASED+GF+T HNL+LDGG+TS+ + +SFIYQ
Sbjct  249  FLASEDAGFITAHNLVLDGGFTSSCNTLSFIYQ  281



>gb|AES89687.2| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=285

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 220/275 (80%), Gaps = 4/275 (1%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRY  246
            Q L  KR  L GKVAVITGGARGIGA TAKL A NG  VIIAD+LDE G  +AESI G Y
Sbjct  12   QNLAPKR--LLGKVAVITGGARGIGAATAKLFAENGAHVIIADVLDEEGTKVAESIDGLY  69

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNG  423
            +HCDVSKE+D+ESA+ L++ W+G+LDIMFNNAGIAG  G SI  + ME+L  LL+INL G
Sbjct  70   IHCDVSKESDIESAINLSISWKGQLDIMFNNAGIAGYEGRSITTLDMEKLTHLLSINLFG  129

Query  424  VVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQH  603
             +HGIKHAA+AMI G KGG+IIC+SS+AA +GG ASH Y++SKSA+ GL+RSAACELG H
Sbjct  130  TIHGIKHAAKAMIKGKKGGSIICTSSAAATIGGFASHGYTMSKSAMDGLMRSAACELGVH  189

Query  604  GIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAV  783
             IRVNCVSPHGVPSEML++A+R   G+ D+ +E++ + +G   SLL+GRG   +DVAQA 
Sbjct  190  LIRVNCVSPHGVPSEMLLNAFR-CYGEVDMTSEQLSEFIGMNASLLKGRGATTDDVAQAA  248

Query  784  LFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            LFLAS++SGFVT HNL +DGG TSA S MSFIYQ+
Sbjct  249  LFLASDESGFVTAHNLSVDGGITSANSVMSFIYQD  283



>gb|EYU26811.1| hypothetical protein MIMGU_mgv1a026922mg, partial [Erythranthe 
guttata]
Length=262

 Score =   337 bits (865),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 184/261 (70%), Positives = 218/261 (84%), Gaps = 0/261 (0%)
 Frame = +1

Query  103  KVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEADVE  282
            KVAVITGGARGIGA TAK  A NG  V+IADILDE G+ LA+ I GRY HCDVS E DVE
Sbjct  1    KVAVITGGARGIGAATAKAFAQNGAHVVIADILDEPGSRLADIINGRYTHCDVSIEGDVE  60

Query  283  SAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAMI  462
             A++LAL+W+G+LDIMFNNAG+AGP GSI  +++ +L SLLA+NL+GVVHGIKHAARAMI
Sbjct  61   RAIQLALDWKGRLDIMFNNAGVAGPDGSITNLEIGRLTSLLAVNLHGVVHGIKHAARAMI  120

Query  463  AGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGVP  642
                 G+IICSSSSAAIMGGLASH Y++SK AILGL R+ ACELG+HGIRVNCVSPHGV 
Sbjct  121  DKKTAGSIICSSSSAAIMGGLASHAYTMSKEAILGLARTTACELGEHGIRVNCVSPHGVA  180

Query  643  SEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVTG  822
            SEMLV AY+  LG  D+  E+V K+V E GSLL+GRG  +EDVAQ VLFLAS++SGF+TG
Sbjct  181  SEMLVGAYKRFLGNPDLKTEDVSKMVSETGSLLKGRGPTVEDVAQGVLFLASDESGFITG  240

Query  823  HNLILDGGYTSAVSQMSFIYQ  885
            HNL++DGG+T+A +QMSFIYQ
Sbjct  241  HNLVIDGGFTAASNQMSFIYQ  261



>ref|XP_010669466.1| PREDICTED: short-chain dehydrogenase reductase 3b [Beta vulgaris 
subsp. vulgaris]
Length=281

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/276 (64%), Positives = 222/276 (80%), Gaps = 2/276 (1%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG  240
            +D +  S+   L GKVA+ITGGARGIGA T KL A NG  V++AD+LDELG  LA SIGG
Sbjct  3    SDGIKRSEEQRLKGKVAIITGGARGIGAATVKLFASNGAYVVVADVLDELGVNLANSIGG  62

Query  241  RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLN  420
            RY+HCDVSKEAD+ESAVKLAL W+G+LDI+FNNAG +G  GSI  + M ++  ++A+NL 
Sbjct  63   RYIHCDVSKEADLESAVKLALAWKGRLDIIFNNAGTSGADGSITNVNMNEVNKIIAVNLF  122

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            GVVHGIKHAARAMI G +GG+IICSSSSAAIMGGLASH Y++SK AI  L++SAACELGQ
Sbjct  123  GVVHGIKHAARAMIEGQQGGSIICSSSSAAIMGGLASHAYTMSKGAIQSLIKSAACELGQ  182

Query  601  HGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            HGIRVNC+SPHGVP+EML+S YR  LG  D+ AEE+ KI  +  SLL G+GG  +DVA A
Sbjct  183  HGIRVNCISPHGVPTEMLISGYRRFLG--DIEAEEISKISAKSCSLLSGKGGTTQDVAAA  240

Query  781  VLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
             LFLA++++GF+TGHNL++DGG+T A + M  +YQ+
Sbjct  241  ALFLATDEAGFITGHNLVIDGGFTEASTNMIHMYQD  276



>ref|XP_004491766.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Cicer arietinum]
Length=285

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/263 (65%), Positives = 215/263 (82%), Gaps = 2/263 (1%)
 Frame = +1

Query  103  KVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEADVE  282
            KVAVITGGARGIGA TAKL A NG  VIIAD+LD+ G  +AE IGG Y+HCDVSKE+D+E
Sbjct  22   KVAVITGGARGIGAATAKLFAENGAHVIIADVLDDEGTKVAELIGGLYIHCDVSKESDIE  81

Query  283  SAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAM  459
            SA+ L++ W+G LDIMFNNAGIAG  G SI  + ME+L+ LL+INL G +HGIKHA++AM
Sbjct  82   SAINLSISWKGHLDIMFNNAGIAGYEGRSITTIDMEKLSHLLSINLFGTIHGIKHASKAM  141

Query  460  IAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
            I G KGG+IIC+SS+A+IMGG ASH Y++SK+A+ GL+RS ACELG H IRVNC+SPHGV
Sbjct  142  IKGKKGGSIICTSSTASIMGGYASHAYTMSKAAMDGLMRSCACELGVHLIRVNCISPHGV  201

Query  640  PSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVT  819
            PSEML++A++   GK D+  EE+ + +G++ SLL+GRG  +EDV+QA LFLAS++SGF+T
Sbjct  202  PSEMLLNAFK-CFGKVDITCEELSEFIGKKASLLKGRGATIEDVSQAALFLASDESGFIT  260

Query  820  GHNLILDGGYTSAVSQMSFIYQE  888
             HNL +DGG TSA S  SFIYQ+
Sbjct  261  AHNLFVDGGITSANSLNSFIYQD  283



>ref|XP_007139354.1| hypothetical protein PHAVU_008G022500g [Phaseolus vulgaris]
 gb|ESW11348.1| hypothetical protein PHAVU_008G022500g [Phaseolus vulgaris]
Length=292

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 170/266 (64%), Positives = 213/266 (80%), Gaps = 2/266 (1%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            L  KVAV+TGGARGIGA  AKL A NG  V+IAD+LD+LGA +AESIGGRY+HCDVSKE 
Sbjct  19   LADKVAVVTGGARGIGATAAKLFAENGAHVVIADVLDDLGANVAESIGGRYIHCDVSKED  78

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIKHAA  450
            DVESA+ LA+ W+G LDIM +NAGI GP G SI  + MEQ+  L +INL+G VHGIKHAA
Sbjct  79   DVESAINLAVSWKGHLDIMLSNAGIGGPEGRSITTIDMEQVRHLFSINLHGTVHGIKHAA  138

Query  451  RAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSP  630
            RAMI G +GG+IIC+SS AA+MGGLA H Y+++K+AI GLVRSAACELG+H IRVNC+SP
Sbjct  139  RAMIKGQRGGSIICTSSVAAVMGGLALHGYTMTKAAIDGLVRSAACELGEHLIRVNCISP  198

Query  631  HGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSG  810
            HG+PS+ML++A++      D+  E + + +G R SLL+GRG  +EDVA A LFLAS++SG
Sbjct  199  HGIPSQMLITAFKR-FANVDITPECLNEYIGTRASLLKGRGATIEDVAHAALFLASDESG  257

Query  811  FVTGHNLILDGGYTSAVSQMSFIYQE  888
            F+T HNL +DGGYTSA S+M ++YQ 
Sbjct  258  FITAHNLRVDGGYTSADSRMCYMYQH  283



>ref|XP_003607490.1| Sex determination protein [Medicago truncatula]
Length=298

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 181/288 (63%), Positives = 220/288 (76%), Gaps = 17/288 (6%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRY  246
            Q L  KR  L GKVAVITGGARGIGA TAKL A NG  VIIAD+LDE G  +AESI G Y
Sbjct  12   QNLAPKR--LLGKVAVITGGARGIGAATAKLFAENGAHVIIADVLDEEGTKVAESIDGLY  69

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGI-------------AG-PGGSIAEMKM  384
            +HCDVSKE+D+ESA+ L++ W+G+LDIMFNNAGI             AG  G SI  + M
Sbjct  70   IHCDVSKESDIESAINLSISWKGQLDIMFNNAGIVHRIIGLVLTPVIAGYEGRSITTLDM  129

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            E+L  LL+INL G +HGIKHAA+AMI G KGG+IIC+SS+AA +GG ASH Y++SKSA+ 
Sbjct  130  EKLTHLLSINLFGTIHGIKHAAKAMIKGKKGGSIICTSSAAATIGGFASHGYTMSKSAMD  189

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllr  744
            GL+RSAACELG H IRVNCVSPHGVPSEML++A+R   G+ D+ +E++ + +G   SLL+
Sbjct  190  GLMRSAACELGVHLIRVNCVSPHGVPSEMLLNAFR-CYGEVDMTSEQLSEFIGMNASLLK  248

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            GRG   +DVAQA LFLAS++SGFVT HNL +DGG TSA S MSFIYQ+
Sbjct  249  GRGATTDDVAQAALFLASDESGFVTAHNLSVDGGITSANSVMSFIYQD  296



>gb|AAB42054.1| STA1-12 [Silene latifolia subsp. alba]
Length=281

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 163/265 (62%), Positives = 214/265 (81%), Gaps = 2/265 (1%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            L GKVA++TGGARGIGA  AKL A NG  V++AD+LDELG  LA SIGG +VHC+VSKEA
Sbjct  19   LKGKVAIVTGGARGIGAAIAKLFASNGAHVVVADVLDELGVGLANSIGGCFVHCNVSKEA  78

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            D+E+ VKLA+ W+G+LDI+ NNAG +G  GSI  + M+++  ++ +NL GVVHGIKHAAR
Sbjct  79   DLENTVKLAMAWKGRLDIIVNNAGTSGADGSIVNVNMDRVREIVGVNLFGVVHGIKHAAR  138

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
            AMI G +GG+IIC+SSSAAIMGGLASH Y++SK AIL +++SAACELG+HGIRVNC+SPH
Sbjct  139  AMIEGKRGGSIICTSSSAAIMGGLASHAYTMSKGAILSVMKSAACELGEHGIRVNCISPH  198

Query  634  GVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGF  813
             VP+EML+S YR  +G  D+  EE+ K+   + SLL G+GG +ED+A   LFLAS+D+GF
Sbjct  199  AVPTEMLISGYRRFVG--DIGDEEIAKMCAAKASLLHGKGGSVEDIAAGALFLASDDAGF  256

Query  814  VTGHNLILDGGYTSAVSQMSFIYQE  888
            +TGHNL++DGGYT+A   M+ +Y++
Sbjct  257  ITGHNLVVDGGYTAANITMAHMYRD  281



>ref|XP_009106575.1| PREDICTED: short-chain dehydrogenase reductase 2a isoform X2 
[Brassica rapa]
Length=270

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 210/265 (79%), Gaps = 3/265 (1%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            LN KVA+ITGGARGIGA TA+L   NG  VI+ADILDE G  +AESIGG YVHCDVSKEA
Sbjct  8    LNNKVAIITGGARGIGAATARLFTENGAYVIVADILDEEGVRMAESIGGCYVHCDVSKEA  67

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            DVE+AV+LA+  +G+LD+MFNNAG+A   GSI EM ++ +  L+++N+NGV+ GIKHAA+
Sbjct  68   DVEAAVELAMRRKGRLDVMFNNAGMAVNEGSIMEMDIKMVNKLVSVNVNGVLLGIKHAAK  127

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
            AMI G  GG+IIC+SSS+ +MGGL  H Y+LSK AI GLV++ ACELG HGIRVN +SPH
Sbjct  128  AMIKG--GGSIICTSSSSGVMGGLGGHAYTLSKGAINGLVKTTACELGSHGIRVNSISPH  185

Query  634  GVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSG-  810
            GVP+E+LV+AYR  L    + A EV K V E+GSLL GR G +EDVAQA LFLASE+S  
Sbjct  186  GVPTEILVNAYRTYLHNDRIDAAEVTKTVAEKGSLLTGRAGTVEDVAQAALFLASEESSR  245

Query  811  FVTGHNLILDGGYTSAVSQMSFIYQ  885
            F+TGHNL++DGGYTSA + M +IY 
Sbjct  246  FITGHNLVIDGGYTSATTTMRYIYD  270



>ref|XP_009106566.1| PREDICTED: short-chain dehydrogenase reductase 2a isoform X1 
[Brassica rapa]
 emb|CDY18106.1| BnaA01g23670D [Brassica napus]
Length=271

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 170/265 (64%), Positives = 210/265 (79%), Gaps = 2/265 (1%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            LN KVA+ITGGARGIGA TA+L   NG  VI+ADILDE G  +AESIGG YVHCDVSKEA
Sbjct  8    LNNKVAIITGGARGIGAATARLFTENGAYVIVADILDEEGVRMAESIGGCYVHCDVSKEA  67

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            DVE+AV+LA+  +G+LD+MFNNAG+A   GSI EM ++ +  L+++N+NGV+ GIKHAA+
Sbjct  68   DVEAAVELAMRRKGRLDVMFNNAGMAVNEGSIMEMDIKMVNKLVSVNVNGVLLGIKHAAK  127

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
            AMI  G GG+IIC+SSS+ +MGGL  H Y+LSK AI GLV++ ACELG HGIRVN +SPH
Sbjct  128  AMIKVG-GGSIICTSSSSGVMGGLGGHAYTLSKGAINGLVKTTACELGSHGIRVNSISPH  186

Query  634  GVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSG-  810
            GVP+E+LV+AYR  L    + A EV K V E+GSLL GR G +EDVAQA LFLASE+S  
Sbjct  187  GVPTEILVNAYRTYLHNDRIDAAEVTKTVAEKGSLLTGRAGTVEDVAQAALFLASEESSR  246

Query  811  FVTGHNLILDGGYTSAVSQMSFIYQ  885
            F+TGHNL++DGGYTSA + M +IY 
Sbjct  247  FITGHNLVIDGGYTSATTTMRYIYD  271



>ref|XP_010425804.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Camelina sativa]
Length=276

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 210/274 (77%), Gaps = 7/274 (3%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCD  258
            +KR F   KVA+ITGGARGIGA TA+L   NG  VI+ADIL+  G  +AESIGG YVHCD
Sbjct  5    NKRLFE--KVAIITGGARGIGAATARLFTENGAYVIVADILENEGIHVAESIGGCYVHCD  62

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            VSKEADVE+AV+LA+  +G+LD+MFNNAG+    GSI EM ++    L+++N+NGV+HGI
Sbjct  63   VSKEADVEAAVELAMRRKGRLDVMFNNAGMTFNEGSIMEMDVDMANKLVSVNVNGVLHGI  122

Query  439  KHAARAMIA----GGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHG  606
            KHAA+AMI     GG GG+IIC+SSS+ +MGGL  H Y+LSK AI GLVR+ ACELG HG
Sbjct  123  KHAAKAMIKAVREGGGGGSIICTSSSSGVMGGLGGHAYTLSKGAINGLVRTTACELGSHG  182

Query  607  IRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVL  786
            IRVN +SPHGVP+++LV+AYR  L    +   EV  IV E+GSLL GR G +EDVAQA L
Sbjct  183  IRVNSISPHGVPTDILVNAYRKYLNNDKLDVAEVTDIVAEKGSLLTGRAGTVEDVAQAAL  242

Query  787  FLAS-EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            FLAS E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  243  FLASQESSGFITGHNLVVDGGYTSATSTMKFIYN  276



>ref|XP_010557798.1| PREDICTED: short-chain dehydrogenase reductase 2a [Tarenaya hassleriana]
Length=271

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 177/270 (66%), Positives = 216/270 (80%), Gaps = 4/270 (1%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCD  258
            SKR  L+ KVAVITGGARGIGA TAKL A NG  V++ADILDE G  +AESIGG YVHCD
Sbjct  5    SKR--LSNKVAVITGGARGIGAATAKLFAENGAYVVVADILDEEGKQVAESIGGMYVHCD  62

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            VS+E DVE AV++A+  + KLD+MFNNAGIA   GSI ++ ++++  L+++N+NGV+HG+
Sbjct  63   VSREEDVEMAVQVAMARKNKLDVMFNNAGIAIYEGSITDIDVDKVNHLVSVNVNGVLHGV  122

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAA+AMI GG GG+IIC+SSSA  MGGL  H Y+LSK AI GLVRS ACELG +GIRVN
Sbjct  123  KHAAKAMIKGGGGGSIICTSSSAGEMGGLGGHAYTLSKGAINGLVRSTACELGSYGIRVN  182

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
             +SPHGVP+E+LV AYR  LG  +V A EVG+IV E+GSLL GR G +EDVA A LFLAS
Sbjct  183  SISPHGVPTEILVKAYRKFLGH-EVDATEVGRIVAEKGSLLHGRWGTVEDVANAALFLAS  241

Query  799  E-DSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            + +SGFVTGHNL++DGGYTSA +   FIYQ
Sbjct  242  DRESGFVTGHNLVIDGGYTSATNACQFIYQ  271



>ref|XP_006293541.1| hypothetical protein CARUB_v10025571mg [Capsella rubella]
 gb|EOA26439.1| hypothetical protein CARUB_v10025571mg [Capsella rubella]
Length=272

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/273 (63%), Positives = 212/273 (78%), Gaps = 2/273 (1%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYV  249
            M+ SK+     KVA+ITGGARGIGA TA+L   NG  VI+ADIL+  G  +AESIGG YV
Sbjct  1    MVNSKKRLFQ-KVAIITGGARGIGAATARLFTENGAYVIVADILENEGIHVAESIGGCYV  59

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDVSKEADVE+ V+LA+  +G+LD+MFNNAG+    GSI EM ++ +  L+++N+NGV+
Sbjct  60   HCDVSKEADVEAVVELAMRRKGRLDVMFNNAGMTFNEGSIMEMDVDMVNKLVSVNVNGVL  119

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
            HGIKHAA+AMI GG GG+IIC+SSS+ +MGGL  H Y+LSK AI GLVR+ ACELG HGI
Sbjct  120  HGIKHAAKAMIKGGGGGSIICTSSSSGVMGGLGGHAYTLSKGAINGLVRTTACELGSHGI  179

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVN +SPHGVP+++LV+AYR  L    +  +EV  IV E+GSLL GR G +EDVAQA LF
Sbjct  180  RVNSISPHGVPTDILVNAYRKYLNNDKLDVDEVTDIVAEKGSLLTGRAGNVEDVAQAALF  239

Query  790  LAS-EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            LAS E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  240  LASQESSGFITGHNLVVDGGYTSATSTMRFIYN  272



>ref|XP_002875592.1| alcohol dehydrogenase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51851.1| alcohol dehydrogenase [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   315 bits (807),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 211/270 (78%), Gaps = 3/270 (1%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCD  258
            +KR F   KVA+ITGGARGIGA TA+L   NG  VI+ADIL+  G  +AESIGG YVHCD
Sbjct  5    NKRLFQ--KVAIITGGARGIGAATARLFTENGAYVIVADILENEGIHVAESIGGCYVHCD  62

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            VSKEADVE+AV+LA+  +G+LD+MFNNAG+    GSI EM ++ +  L+++N+NGV+HGI
Sbjct  63   VSKEADVEAAVELAMRRKGRLDVMFNNAGMTLNEGSIMEMDVDMVNKLVSVNVNGVLHGI  122

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAA+AMI GG GG+IIC+SSS+ +MGGL  H Y+LSK AI GLVR+ ACELG HGIRVN
Sbjct  123  KHAAKAMIKGGGGGSIICTSSSSGVMGGLGGHAYTLSKGAINGLVRTTACELGSHGIRVN  182

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
             +SPHGVP+++LV+AYR  L    +   EV  IV E+GSLL GR G +EDVAQA LFLAS
Sbjct  183  SISPHGVPTDILVNAYRKYLNNDKLDVAEVTDIVAEKGSLLTGRAGTVEDVAQAALFLAS  242

Query  799  -EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
             E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  243  QESSGFITGHNLVVDGGYTSATSTMRFIYN  272



>ref|XP_010503023.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Camelina 
sativa]
 ref|XP_010425805.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Camelina sativa]
Length=272

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 172/270 (64%), Positives = 210/270 (78%), Gaps = 3/270 (1%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCD  258
            +KR F   KVA+ITGGARGIGA TA+L   NG  VI+ADIL+  G  +AESIGG YVHCD
Sbjct  5    NKRLF--EKVAIITGGARGIGAATARLFTENGAYVIVADILENEGIHVAESIGGCYVHCD  62

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            VSKEADVE+AV+LA+  +G+LD+MFNNAG+    GSI EM ++    L+++N+NGV+HGI
Sbjct  63   VSKEADVEAAVELAMRRKGRLDVMFNNAGMTFNEGSIMEMDVDMANKLVSVNVNGVLHGI  122

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAA+AMI GG GG+IIC+SSS+ +MGGL  H Y+LSK AI GLVR+ ACELG HGIRVN
Sbjct  123  KHAAKAMIKGGGGGSIICTSSSSGVMGGLGGHAYTLSKGAINGLVRTTACELGSHGIRVN  182

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
             +SPHGVP+++LV+AYR  L    +   EV  IV E+GSLL GR G +EDVAQA LFLAS
Sbjct  183  SISPHGVPTDILVNAYRKYLNNDKLDVAEVTDIVAEKGSLLTGRAGTVEDVAQAALFLAS  242

Query  799  -EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
             E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  243  QESSGFITGHNLVVDGGYTSATSTMKFIYN  272



>ref|XP_006602985.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Glycine 
max]
Length=288

 Score =   313 bits (802),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/281 (63%), Positives = 224/281 (80%), Gaps = 6/281 (2%)
 Frame = +1

Query  61   TDQMLCSKRS---FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAES  231
            TDQ + +++S    L  KVAVITGGARGIGA  AKL A NG  V+IAD+LDELG  +A+S
Sbjct  7    TDQNIETQKSSTKRLADKVAVITGGARGIGAAAAKLFAENGAHVVIADVLDELGTTVAKS  66

Query  232  IGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLA  408
            IGG Y+HCDVSKE DVESA+ LAL W+G LDIM +NAGI GP G SI  ++M+++  L +
Sbjct  67   IGGHYIHCDVSKEDDVESAINLALSWKGHLDIMLSNAGIGGPEGRSITTLEMDRVRHLFS  126

Query  409  INLNGVVHGIKHAARAMIAG-GKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            INL G +HGIKHAARAMI G  KGG+IIC+SS+A+IMGGLA H Y+++K+AI GLVRSAA
Sbjct  127  INLYGTIHGIKHAARAMIKGNNKGGSIICTSSAASIMGGLALHGYTMTKAAIDGLVRSAA  186

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
            CELG+H IRVNC+SPHGVPSEML+SA R   G  D+  + V +++G R SLL+G+G  +E
Sbjct  187  CELGEHLIRVNCISPHGVPSEMLLSACRR-FGHDDITPQGVKEMIGSRASLLKGKGATIE  245

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            DVA A LFLAS++SGF+T HNL++DGG+TSA S+MS++YQ+
Sbjct  246  DVAHAALFLASDESGFITAHNLLIDGGHTSADSRMSYMYQD  286



>ref|XP_006378426.1| hypothetical protein POPTR_0010s11020g [Populus trichocarpa]
 gb|ERP56223.1| hypothetical protein POPTR_0010s11020g [Populus trichocarpa]
Length=229

 Score =   308 bits (789),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/261 (62%), Positives = 188/261 (72%), Gaps = 33/261 (13%)
 Frame = +1

Query  100  GKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEADV  279
            GKVAVITGGARGIGA TAK+ A NG  VIIADILDELG  LA+SIGGRY+H         
Sbjct  2    GKVAVITGGARGIGAATAKVFAENGASVIIADILDELGTSLADSIGGRYIH---------  52

Query  280  ESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAM  459
                     W  K+DIMFNNAGIAG  GSI  + ME++  LL +N+NG++HGIKHAAR M
Sbjct  53   ---------W--KIDIMFNNAGIAGTEGSITNIDMEKVKRLLCVNVNGILHGIKHAARVM  101

Query  460  IAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
            I G KG  IIC SSSAAIMGGL SHPYS+SK AI+GL+RS ACELG HGI VNC+SPHGV
Sbjct  102  IEGRKGWCIICMSSSAAIMGGLGSHPYSMSKEAIIGLMRSTACELGVHGILVNCISPHGV  161

Query  640  PSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVT  819
             SEMLV AYR ILGK D+  EE  K               +EDVAQ+VLFLASE++G++T
Sbjct  162  ASEMLVDAYRKILGKKDMKPEERKK-------------SDLEDVAQSVLFLASEEAGYIT  208

Query  820  GHNLILDGGYTSAVSQMSFIY  882
              NL++DGGYT+A S MSFIY
Sbjct  209  ARNLLVDGGYTAASSNMSFIY  229



>ref|XP_006419137.1| hypothetical protein EUTSA_v10003119mg [Eutrema salsugineum]
 gb|ESQ37573.1| hypothetical protein EUTSA_v10003119mg [Eutrema salsugineum]
Length=272

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/268 (63%), Positives = 209/268 (78%), Gaps = 1/268 (0%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVS  264
            +  LN KVA+ITGGARGIGA TA+L A NG  VI+ADIL++ G  +A+SIGG YVHCDVS
Sbjct  5    KKKLNEKVAIITGGARGIGAATARLFAENGAYVIVADILEKEGVHVADSIGGCYVHCDVS  64

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             EADV + V+LA+  RG+LD+MFNNAG+    GSI EM +  +  L+++N+NGVVHGIKH
Sbjct  65   NEADVAAVVELAMRRRGRLDVMFNNAGMTVNEGSIMEMDVGMVNKLVSVNVNGVVHGIKH  124

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AA+AMI GG GG+IIC+SSS+A+MGGL +H Y+LSK+AI GLVR+ ACELG HGIRVN V
Sbjct  125  AAKAMIKGGGGGSIICTSSSSAVMGGLGAHGYTLSKAAINGLVRTTACELGSHGIRVNSV  184

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS-E  801
            SPHGVP+++LV+AYR  L    V   EV  IV E+GSLL GR G +EDVAQA LFLAS E
Sbjct  185  SPHGVPTDILVNAYRKYLNNDKVDVAEVTDIVAEKGSLLNGRPGTVEDVAQAALFLASQE  244

Query  802  DSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
             SGF+TGHNL++DGGYTSA   +  +Y 
Sbjct  245  SSGFITGHNLVVDGGYTSATKTLRAMYN  272



>gb|AAB42053.1| STA1-2 [Silene latifolia subsp. alba]
 gb|AAB42055.1| STA1-18 [Silene latifolia subsp. alba]
Length=281

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 213/265 (80%), Gaps = 2/265 (1%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            L GKVA++TG ARGIGA  AKL A NG  V++AD+LDELG  LA SIGG +VHC+VSKEA
Sbjct  19   LKGKVAIVTGAARGIGAAIAKLFASNGAHVVVADVLDELGVGLANSIGGCFVHCNVSKEA  78

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            D+E+ VKLA+ W+G+LDI+ NNAG +G  GSI  + M+++  ++ +NL GVVHGIKHAAR
Sbjct  79   DLENTVKLAMAWKGRLDIIVNNAGTSGADGSIVNVNMDRVREIVGVNLFGVVHGIKHAAR  138

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
            AMI G +GG+IIC+SSSAAIMGGLASH Y++SK AIL +++SAACELG+HGIRVNC+SPH
Sbjct  139  AMIEGKRGGSIICTSSSAAIMGGLASHAYTMSKGAILSVMKSAACELGEHGIRVNCISPH  198

Query  634  GVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGF  813
             VP+EML+S YR  +G  D+  EE+ K+   + SLL G+GG +ED+A   LFLAS+D+GF
Sbjct  199  AVPTEMLISGYRRFVG--DIGDEEIAKMCAAKASLLHGKGGSVEDIAAGALFLASDDAGF  256

Query  814  VTGHNLILDGGYTSAVSQMSFIYQE  888
            +TGHNL++DGGYT+A   M+ +Y++
Sbjct  257  ITGHNLVVDGGYTAANITMAHMYRD  281



>gb|AAM63311.1| alcohol dehydrogenase (ATA1) [Arabidopsis thaliana]
Length=272

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 211/269 (78%), Gaps = 3/269 (1%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDV  261
            KR F   KVA+ITGGARGIGA TA+L   NG  VI+ADIL+  G  +AESIGG YVHCDV
Sbjct  6    KRLF--EKVAIITGGARGIGAATARLFTENGAYVIVADILENEGILVAESIGGCYVHCDV  63

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            SKEADVE+AV+LA+  +G+LD+MFNNAG++   GSI  M ++ +  L+++N+NGV+HGIK
Sbjct  64   SKEADVEAAVELAMRRKGRLDVMFNNAGMSLNEGSIMGMDVDMVNKLVSVNVNGVLHGIK  123

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAA+AMI GG+GG+IIC+SSS+ +MGGL  H Y+LSK AI G+VR+ ACELG HGIRVN 
Sbjct  124  HAAKAMIKGGRGGSIICTSSSSGLMGGLGGHAYTLSKGAINGVVRTTACELGSHGIRVNS  183

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS-  798
            +SPHGVP+++LV+AYR  L    +   EV  I+ E+GSLL GR G +EDVAQA LFLAS 
Sbjct  184  ISPHGVPTDILVNAYRKFLNNDKLNVAEVTDIIAEKGSLLTGRAGTVEDVAQAALFLASQ  243

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  244  ESSGFITGHNLVVDGGYTSATSTMRFIYN  272



>ref|NP_189882.1| protein TAPETUM 1 [Arabidopsis thaliana]
 emb|CAB86683.1| alcohol dehydrogenase (ATA1) [Arabidopsis thaliana]
 gb|ABK32159.1| At3g42960 [Arabidopsis thaliana]
 gb|AEE77761.1| protein TAPETUM 1 [Arabidopsis thaliana]
Length=272

 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 169/269 (63%), Positives = 211/269 (78%), Gaps = 3/269 (1%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDV  261
            KR F   KVA+ITGGARGIGA TA+L   NG  VI+ADIL+  G  +AESIGG YVHCDV
Sbjct  6    KRLF--EKVAIITGGARGIGAATARLFTENGAYVIVADILENEGILVAESIGGCYVHCDV  63

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            SKEADVE+AV+LA+  +G+LD+MFNNAG++   GSI  M ++ +  L+++N+NGV+HGIK
Sbjct  64   SKEADVEAAVELAMRRKGRLDVMFNNAGMSLNEGSIMGMDVDMVNKLVSVNVNGVLHGIK  123

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAA+AMI GG+GG+IIC+SSS+ +MGGL  H Y+LSK AI G+VR+ ACELG HGIRVN 
Sbjct  124  HAAKAMIKGGRGGSIICTSSSSGLMGGLGGHAYTLSKGAINGVVRTTACELGSHGIRVNS  183

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS-  798
            +SPHGVP+++LV+AYR  L    +   EV  I+ E+GSLL GR G +EDVAQA LFLAS 
Sbjct  184  ISPHGVPTDILVNAYRKFLNHDKLNVAEVTDIIAEKGSLLTGRAGTVEDVAQAALFLASQ  243

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  244  ESSGFITGHNLVVDGGYTSATSTMRFIYN  272



>gb|AAC49835.1| alcohol dehydrogenase [Arabidopsis thaliana]
Length=272

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/269 (62%), Positives = 209/269 (78%), Gaps = 3/269 (1%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDV  261
            KR F   KVA+ITGGARGIGA TA+L   NG  VI+ADILD  G  +AESIGG YVHCDV
Sbjct  6    KRLF--EKVAIITGGARGIGAATARLFTENGAYVIVADILDNEGILVAESIGGCYVHCDV  63

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            SKEADVE+AV+LA+  +G+LD+MFNNAG++   GSI  M ++ +  L+++N+NGV+HGIK
Sbjct  64   SKEADVEAAVELAMRRKGRLDVMFNNAGMSLNEGSIMGMDVDMVNKLVSVNVNGVLHGIK  123

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAA+AMI GG+GG+IIC+SSS+ +MGGL  H Y+LSK  I G+VR+  CELG HGIRVN 
Sbjct  124  HAAKAMIKGGRGGSIICTSSSSGLMGGLGGHAYTLSKGGINGVVRTTECELGSHGIRVNS  183

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS-  798
            +SPHGVP+++LV+AYR  L    +   EV  I+ E+GSLL GR G +EDVAQA LFLAS 
Sbjct  184  ISPHGVPTDILVNAYRKFLNNDKLNVAEVTDIIAEKGSLLTGRAGTVEDVAQAALFLASQ  243

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  244  ESSGFITGHNLVVDGGYTSATSTMRFIYN  272



>ref|XP_006855591.1| hypothetical protein AMTR_s00044p00056720 [Amborella trichopoda]
 gb|ERN17058.1| hypothetical protein AMTR_s00044p00056720 [Amborella trichopoda]
Length=276

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 169/272 (62%), Positives = 210/272 (77%), Gaps = 1/272 (0%)
 Frame = +1

Query  73   LC-SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYV  249
            LC SK + L GKVA+ITGGARGIGA  A+L A +G  V +ADILD+ G  L   IG RY+
Sbjct  5    LCNSKSNRLKGKVAIITGGARGIGAAAARLFALHGAHVTVADILDDEGPALCTKIGARYM  64

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDVS E+DV + V+  +   G LDIMFNNAGIAG  GSI  +  + + +LL++NL G V
Sbjct  65   HCDVSLESDVAATVRSTVAQHGCLDIMFNNAGIAGQLGSITHLNSKLMQNLLSVNLCGPV  124

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
            +GIKHAA+AMI G   G+I+C++SSAA+MGGL SH Y++SK A++G+VRSAACELG HGI
Sbjct  125  YGIKHAAQAMIKGRVQGSIVCTASSAALMGGLGSHAYTMSKEAVVGIVRSAACELGVHGI  184

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVNCVSPHGV S+MLV AYR ILG+ D+ AE V ++V E GSLL+GR    EDVA A LF
Sbjct  185  RVNCVSPHGVASDMLVGAYREILGREDLGAEAVDRVVAESGSLLKGRSATPEDVANAALF  244

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            LAS++SGFVTGHNL++DGG+TSA + MSFIYQ
Sbjct  245  LASDESGFVTGHNLVVDGGFTSACNTMSFIYQ  276



>gb|KHN13792.1| Sex determination protein tasselseed-2 [Glycine soja]
Length=277

 Score =   291 bits (746),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 170/281 (60%), Positives = 215/281 (77%), Gaps = 17/281 (6%)
 Frame = +1

Query  61   TDQMLCSKRS---FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAES  231
            TDQ + +++S    L  KVAVITGGARGIGA  AKL A NG  V+IAD           S
Sbjct  7    TDQNIETQKSSTKRLADKVAVITGGARGIGAAAAKLFAENGAHVVIAD-----------S  55

Query  232  IGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLA  408
            IGG Y+HCDVSKE DVESA+ LAL W+G LDIM +NAGI GP G SI  ++M+++  L +
Sbjct  56   IGGHYIHCDVSKEDDVESAINLALSWKGHLDIMLSNAGIGGPEGRSITTLEMDRVRHLFS  115

Query  409  INLNGVVHGIKHAARAMIAGG-KGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            INL G +HGIKHAARAMI G  KGG+IIC+SS+A+IMGGLA H Y+++K+AI GLVRSAA
Sbjct  116  INLYGTIHGIKHAARAMIKGNNKGGSIICTSSAASIMGGLALHGYTMTKAAIDGLVRSAA  175

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
            CELG+H IRVNC+SPHGVPSEML+SA R   G  D+  + V +++G R SLL+G+G  +E
Sbjct  176  CELGEHLIRVNCISPHGVPSEMLLSACRR-FGHDDITPQGVKEMIGSRASLLKGKGATIE  234

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFIYQE  888
            DVA A LFLAS++SGF+T HNL++DGG+TSA S+MS++YQ+
Sbjct  235  DVAHAALFLASDESGFITAHNLLIDGGHTSADSRMSYMYQD  275



>gb|EPS59713.1| hypothetical protein M569_15092, partial [Genlisea aurea]
Length=270

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 215/268 (80%), Gaps = 5/268 (2%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            L GKVAVITGGARGIGA  A+  A NG  V+IAD+LDE GA LAE IGGRYV CDVS+E 
Sbjct  3    LGGKVAVITGGARGIGAAAARAFAWNGAHVVIADVLDEEGAALAEEIGGRYVRCDVSEEG  62

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGG----SIAEMKMEQLASLLAINLNGVVHGIK  441
            DVE AV  A+ W+G+LD+MFNNAG+ G  G    SI  ++   L +LLA+NLNGVVHGIK
Sbjct  63   DVERAVGSAVSWKGRLDVMFNNAGVGGTAGGGRRSITGLETADLTALLAVNLNGVVHGIK  122

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAARAMI GG GG+I+CSSSSAAI+GGLASH Y++SK+AI  + R+AACELG +GIRVNC
Sbjct  123  HAARAMIGGGVGGSIVCSSSSAAIVGGLASHAYTMSKAAIAAVARTAACELGPYGIRVNC  182

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS-  798
            +SPHGVPSEML  A+R + G  ++ AE+VGKIVGERGSLLRGR   ++DVA A +FLAS 
Sbjct  183  ISPHGVPSEMLTEAFREVTGDRNLRAEDVGKIVGERGSLLRGRAATVDDVANAAVFLASD  242

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIY  882
            E++GF+TGHNL++DGG+T A S MSFIY
Sbjct  243  EEAGFITGHNLVVDGGFTIAASNMSFIY  270



>ref|XP_004491767.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Cicer arietinum]
Length=248

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 148/263 (56%), Positives = 185/263 (70%), Gaps = 39/263 (15%)
 Frame = +1

Query  103  KVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEADVE  282
            KVAVITGGARGIGA TAKL A NG  VIIAD+LD+                         
Sbjct  22   KVAVITGGARGIGAATAKLFAENGAHVIIADVLDDE------------------------  57

Query  283  SAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAM  459
                         DIMFNNAGIAG  G SI  + ME+L+ LL+INL G +HGIKHA++AM
Sbjct  58   -------------DIMFNNAGIAGYEGRSITTIDMEKLSHLLSINLFGTIHGIKHASKAM  104

Query  460  IAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
            I G KGG+IIC+SS+A+IMGG ASH Y++SK+A+ GL+RS ACELG H IRVNC+SPHGV
Sbjct  105  IKGKKGGSIICTSSTASIMGGYASHAYTMSKAAMDGLMRSCACELGVHLIRVNCISPHGV  164

Query  640  PSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVT  819
            PSEML++A++   GK D+  EE+ + +G++ SLL+GRG  +EDV+QA LFLAS++SGF+T
Sbjct  165  PSEMLLNAFK-CFGKVDITCEELSEFIGKKASLLKGRGATIEDVSQAALFLASDESGFIT  223

Query  820  GHNLILDGGYTSAVSQMSFIYQE  888
             HNL +DGG TSA S  SFIYQ+
Sbjct  224  AHNLFVDGGITSANSLNSFIYQD  246



>ref|XP_007223520.1| hypothetical protein PRUPE_ppa011965mg [Prunus persica]
 gb|EMJ24719.1| hypothetical protein PRUPE_ppa011965mg [Prunus persica]
Length=189

 Score =   255 bits (651),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +1

Query  328  MFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSA  507
            MFNNAG+ GP GSI  + ME +  LL++N+ GV+HGIK+AA AMI G  GG+I+C+SSSA
Sbjct  1    MFNNAGVPGPSGSITSLDMENVKHLLSVNVLGVIHGIKYAAAAMIKGRIGGSILCTSSSA  60

Query  508  AIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKT  687
            AIMGGL  H Y+LSK AI GLVRSAACELG HGIRVNC+SPHGVPSEMLVSAYR  LGK 
Sbjct  61   AIMGGLGGHAYTLSKEAINGLVRSAACELGVHGIRVNCISPHGVPSEMLVSAYREHLGKM  120

Query  688  DVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQ  867
            D+ AE+V KIVGERGSLLRGR   +EDVA+A LF+ASED+GF+T HNL+LDGGYTSA S 
Sbjct  121  DMTAEDVSKIVGERGSLLRGRCATVEDVAEAALFVASEDAGFITAHNLVLDGGYTSACST  180

Query  868  MSFIYQE  888
            MSFIYQ 
Sbjct  181  MSFIYQN  187



>ref|XP_002515215.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF47199.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=271

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 171/279 (61%), Gaps = 17/279 (6%)
 Frame = +1

Query  25   FEMDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
            F     +  HE T+ +L      L GKVA+ITG A GIG +  +L   NG  VI AD+ D
Sbjct  2    FLYQENSDNHEPTELIL------LGGKVALITGAASGIGEQAVRLFVENGAFVIAADVQD  55

Query  205  ELGAPLAESIG---GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAE  375
            +LG  + ES+G     Y HCDV  E  VE  V  A+E  GKLD++F+NAGI GP   I E
Sbjct  56   DLGQEVVESVGTDKATYRHCDVRDEKQVEETVNYAVEKYGKLDVLFSNAGILGPLTGILE  115

Query  376  MKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKS  555
            + +    + +A N+ GV   IKHAARAM+A    G+IIC++S A+ +GG   H Y++SK 
Sbjct  116  LDLSGFDNTMATNVRGVAATIKHAARAMVAKNIRGSIICTASVASSVGGTGPHAYTVSKH  175

Query  556  AILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgs  735
            AILGLVR+A CELG +GIRVNC+SP GV + +  +AY M   + +     +G + G    
Sbjct  176  AILGLVRTACCELGNYGIRVNCISPFGVATPLTCNAYNMKPSEVEANCSNLGNLKG----  231

Query  736  llrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYT  852
                   + ++VA+  LFLAS++S +++GHNL++DGGYT
Sbjct  232  ----IALKAKNVAETALFLASDESAYISGHNLVIDGGYT  266



>ref|XP_002963807.1| hypothetical protein SELMODRAFT_79955 [Selaginella moellendorffii]
 gb|EFJ35678.1| hypothetical protein SELMODRAFT_79955 [Selaginella moellendorffii]
Length=294

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 176/269 (65%), Gaps = 10/269 (4%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---  240
             L S++  L  KVAVITGGA GIGA TA+L A NG  ++IADI DE GA L   +GG   
Sbjct  8    FLSSRQELLRDKVAVITGGANGIGAATARLFASNGARLVIADIDDESGARLEAEVGGPAV  67

Query  241  -RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLA  408
             RYVHCDV  EAD+  AV+ A+   G+LD+M NNAG+     P  SI+ M+  +L  L A
Sbjct  68   CRYVHCDVGSEADIVRAVRTAVSEFGRLDVMHNNAGVLNGRHPSPSISSMEAAELDFLYA  127

Query  409  INLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAAC  588
            +N+ G   GIKHA+R MI     G+I+C++S +A++ GLA HPY+++K AILGLV++ A 
Sbjct  128  VNVRGAALGIKHASRVMIEQHVQGSILCTASVSAMVAGLALHPYTITKHAILGLVKTCAL  187

Query  589  ELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMED  768
            EL  +GIRVNC++P+GV +++L S  R  L   ++  E+     G        +    ED
Sbjct  188  ELAHYGIRVNCITPNGVLTDLLCSVGRH-LRHLEIRDEK--SCPGSENCEDLRKMLAPED  244

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYTS  855
            VA+A LFLAS+DS +++GH+L++DG +++
Sbjct  245  VAKAALFLASDDSKYISGHSLVIDGSFSA  273



>ref|XP_010264500.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X4 [Nelumbo nucifera]
Length=273

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/275 (45%), Positives = 179/275 (65%), Gaps = 15/275 (5%)
 Frame = +1

Query  91   FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVS  264
             L GKVA++TGGARGIG  T +L A +G  V+IAD+ DE+G  L+ S+     Y+HCDVS
Sbjct  1    MLEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDEIGIALSNSLAPCVTYIHCDVS  60

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHG  435
             E DVE+ +   + W G+LDI+FNNAG+ G      SI +   E+   ++ +N+ GV  G
Sbjct  61   LEEDVENLINSTVSWHGRLDILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALG  120

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +K+AAR M+  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRV
Sbjct  121  MKYAARVMVPRGSG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRV  179

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVM-----AEEVGKI---VGErgsllrgrggrMEDV  771
            NC+SP GV + ML++A+R    + D M      EEV K+   VG   +L        +D+
Sbjct  180  NCISPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRA-KDI  238

Query  772  AQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            A+A L+LAS++S +V+GHNL++DGG T++ + + F
Sbjct  239  AEAALYLASDESKYVSGHNLVVDGGVTTSRNCVGF  273



>ref|XP_010264499.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X3 [Nelumbo nucifera]
Length=280

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 182/282 (65%), Gaps = 15/282 (5%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--R  243
            M  S  + L GKVA++TGGARGIG  T +L A +G  V+IAD+ DE+G  L+ S+     
Sbjct  1    MASSPVTELEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDEIGIALSNSLAPCVT  60

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAIN  414
            Y+HCDVS E DVE+ +   + W G+LDI+FNNAG+ G      SI +   E+   ++ +N
Sbjct  61   YIHCDVSLEEDVENLINSTVSWHGRLDILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVN  120

Query  415  LNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACEL  594
            + GV  G+K+AAR M+  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACEL
Sbjct  121  VRGVALGMKYAARVMVPRGSG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACEL  179

Query  595  GQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVM-----AEEVGKI---VGErgsllrgr  750
            G++GIRVNC+SP GV + ML++A+R    + D M      EEV K+   VG   +L    
Sbjct  180  GRYGIRVNCISPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPT  239

Query  751  ggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
                +D+A+A L+LAS++S +V+GHNL++DGG T++ + + F
Sbjct  240  LRA-KDIAEAALYLASDESKYVSGHNLVVDGGVTTSRNCVGF  280



>ref|XP_010264497.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Nelumbo nucifera]
Length=291

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 179/274 (65%), Gaps = 15/274 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GKVA++TGGARGIG  T +L A +G  V+IAD+ DE+G  L+ S+     Y+HCDVS 
Sbjct  20   LEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDEIGIALSNSLAPCVTYIHCDVSL  79

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E DVE+ +   + W G+LDI+FNNAG+ G      SI +   E+   ++ +N+ GV  G+
Sbjct  80   EEDVENLINSTVSWHGRLDILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGM  139

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            K+AAR M+  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  140  KYAARVMVPRGSG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  198

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVM-----AEEVGKI---VGErgsllrgrggrMEDVA  774
            C+SP GV + ML++A+R    + D M      EEV K+   VG   +L        +D+A
Sbjct  199  CISPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRA-KDIA  257

Query  775  QAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            +A L+LAS++S +V+GHNL++DGG T++ + + F
Sbjct  258  EAALYLASDESKYVSGHNLVVDGGVTTSRNCVGF  291



>ref|XP_006841570.1| hypothetical protein AMTR_s00003p00190670 [Amborella trichopoda]
 gb|ERN03245.1| hypothetical protein AMTR_s00003p00190670 [Amborella trichopoda]
Length=260

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 165/256 (64%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITG A GIG   A+L   NG  V+IADI DELG  +A SIG     Y HCDV 
Sbjct  3    LEGKVAIITGAASGIGEAAARLFVENGARVVIADIQDELGIQVATSIGLEQCSYKHCDVR  62

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  +   V+ ALE  GK+D+MF+NAG+ G   SI +M  ++    L+INL G+   +KH
Sbjct  63   DENQIRETVRFALEKYGKVDVMFSNAGVLGHQTSILDMDAKEFDETLSINLRGMTLAVKH  122

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AA AM+  G  G+IIC++S +A +GG+A+H Y++SK A++GLVRSA+ +LG+HGIRVNC+
Sbjct  123  AACAMVEKGTCGSIICTASVSACIGGVAAHSYTISKHAVVGLVRSASSDLGRHGIRVNCI  182

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+G+ +  +  AY     + +        + G           + + +A+A LFLAS++
Sbjct  183  SPYGMATPSVCKAYNSTPDEIEADCNYRSTLKG--------VTLKPKQIAEAALFLASDE  234

Query  805  SGFVTGHNLILDGGYT  852
            S FV+GHNL++DGG+T
Sbjct  235  SSFVSGHNLVVDGGFT  250



>ref|XP_010264496.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Nelumbo nucifera]
Length=301

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 179/274 (65%), Gaps = 15/274 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GKVA++TGGARGIG  T +L A +G  V+IAD+ DE+G  L+ S+     Y+HCDVS 
Sbjct  30   LEGKVAIVTGGARGIGEATVRLFARHGAKVVIADVEDEIGIALSNSLAPCVTYIHCDVSL  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E DVE+ +   + W G+LDI+FNNAG+ G      SI +   E+   ++ +N+ GV  G+
Sbjct  90   EEDVENLINSTVSWHGRLDILFNNAGVLGNQSKHKSIIDFDAEEFDRVMRVNVRGVALGM  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            K+AAR M+  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  150  KYAARVMVPRGSG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  208

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVM-----AEEVGKI---VGErgsllrgrggrMEDVA  774
            C+SP GV + ML++A+R    + D M      EEV K+   VG   +L        +D+A
Sbjct  209  CISPFGVATSMLLNAWRRCDDEEDCMEIGGSCEEVEKMEEFVGSLANLKGPTLRA-KDIA  267

Query  775  QAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            +A L+LAS++S +V+GHNL++DGG T++ + + F
Sbjct  268  EAALYLASDESKYVSGHNLVVDGGVTTSRNCVGF  301



>ref|XP_006444577.1| hypothetical protein CICLE_v10021745mg [Citrus clementina]
 ref|XP_006492385.1| PREDICTED: short-chain dehydrogenase reductase 3b-like isoform 
X1 [Citrus sinensis]
 gb|ESR57817.1| hypothetical protein CICLE_v10021745mg [Citrus clementina]
 gb|KDO86858.1| hypothetical protein CISIN_1g024839mg [Citrus sinensis]
Length=262

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 167/265 (63%), Gaps = 15/265 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+I G A GIG  TAKL A +G  VIIADI DELG  +  SIG     Y HCDV 
Sbjct  6    LQGKVAIIMGAASGIGEATAKLFAEHGAFVIIADIQDELGNQVVSSIGPEKASYRHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V  A+E  G LDIM++NAG+AGP G+I ++ M Q    +A NL G V  +K+
Sbjct  66   DEKQVEETVAYAIEKYGSLDIMYSNAGVAGPVGTILDLDMAQFDRTIATNLAGSVMAVKY  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR M+A    G+IIC++S+A+ +GG   H Y++SK  +LGLVRSAA ELG+HGIRVNCV
Sbjct  126  AARVMVANKIRGSIICTTSTASTVGGSGPHAYTISKHGLLGLVRSAASELGKHGIRVNCV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV +         + G    +A   G ++            + + VA+A LFLAS++
Sbjct  186  SPFGVATPFSAGTINDVEGFVCKVANLKGIVL------------KAKHVAEAALFLASDE  233

Query  805  SGFVTGHNLILDGGYTSAVSQMSFI  879
            S +V+GH+L++DGG+T+  + MS +
Sbjct  234  SAYVSGHDLVVDGGFTAVTNVMSML  258



>gb|ABK24197.1| unknown [Picea sitchensis]
Length=289

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 174/259 (67%), Gaps = 9/259 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            LNG+VA+ITGGA GIG    +L   +G  VIIADI DE G  LAES+  R  YVHCDVSK
Sbjct  24   LNGRVAIITGGASGIGEAIVRLFTKHGAKVIIADIADEAGGKLAESLSPRGTYVHCDVSK  83

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHA  447
            E D+ +AV LA+E  G+LDIM+NNAGI   G S+AE  MEQ   ++ +N+ GV+ GIKHA
Sbjct  84   EQDMSAAVDLAMEKHGQLDIMYNNAGILAAGKSVAEYDMEQFDRVMRVNVRGVMLGIKHA  143

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MI   K G II ++S  +I+GGL  + Y+ SK A++GL ++ A ELG++GIRVN VS
Sbjct  144  ARVMIP-RKKGCIINTASVVSIVGGLTPYSYTASKHAVIGLTKNGAAELGKYGIRVNAVS  202

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGEr----gsllrgrggrMEDVAQAVLFLA  795
            P+G+ + + V  ++   G     A E+ K   +      + L G   ++EDVA+A L+LA
Sbjct  203  PYGLATALTVEYFKE--GDASSSASEIDKAAVDAFCDGVANLEGTILKVEDVAEAGLYLA  260

Query  796  SEDSGFVTGHNLILDGGYT  852
            S+++ +V+GHNL++DGG T
Sbjct  261  SDEAKYVSGHNLVVDGGIT  279



>ref|XP_004289431.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Fragaria 
vesca subsp. vesca]
Length=344

 Score =   224 bits (572),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 123/280 (44%), Positives = 172/280 (61%), Gaps = 15/280 (5%)
 Frame = +1

Query  34   DRTTKTHESTDQMLCSKRS----FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADIL  201
            +R+ K   S++  +C+  S     L GKVA+ITG A GIG E A+L A NG  V++ADI 
Sbjct  64   ERSLKGRISSNIFVCNTISNASTRLEGKVALITGAAGGIGEEAARLFAANGAFVVVADIQ  123

Query  202  DELGAPLAESIGGR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIA  372
            DELG  +  SI      Y HCDV  E  VE  V   LE  G LD++F+NAGI GP   I 
Sbjct  124  DELGLQVVASIASERVSYFHCDVRDENQVEQTVSYTLEKYGSLDVLFSNAGIMGPMTGIL  183

Query  373  EMKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSK  552
            ++ ++   + +  N+ GV   IKHAARAM+A    G+IIC+SS AA +GG A H Y+ SK
Sbjct  184  DLDIQGFDNAMITNVRGVATTIKHAARAMVARKLRGSIICTSSVAASLGGTAPHAYTTSK  243

Query  553  SAILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErg  732
            +A++GLVRSA  ELG +GIRVNC+SP GV + +  +AY +   + +  +  +  + G   
Sbjct  244  TALIGLVRSACSELGSYGIRVNCISPFGVATPLSCNAYNLAPNEVEANSSAIANLKGTVL  303

Query  733  sllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYT  852
                        VA+A LFLAS++SG+V+GHNL++DGG++
Sbjct  304  KA--------RHVAEAALFLASDESGYVSGHNLVIDGGFS  335



>ref|XP_010256990.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Nelumbo 
nucifera]
Length=304

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 174/276 (63%), Gaps = 15/276 (5%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RY  246
            L S    L GKVA++TGGARGIG  T +L A  G  V+IAD+ DELG  LA S+     Y
Sbjct  24   LSSTPRRLEGKVAIVTGGARGIGEATVRLFARQGAKVVIADVEDELGIVLARSLAPSVTY  83

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINL  417
            VHCDVS E DVE  +   +   G+LDI+FNNAG+ G      SI     ++   ++ +N+
Sbjct  84   VHCDVSLEEDVEKLINSTVSRHGRLDILFNNAGVLGNQSKHKSIINFDADEFDRVMRVNV  143

Query  418  NGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELG  597
             GV  G+KHAAR M+  G  G II ++S A ++GGL  H Y+ SK AI+GL ++ ACELG
Sbjct  144  RGVALGMKHAARVMVPRG-SGCIISTASVAGVLGGLGPHAYTASKHAIVGLTKNTACELG  202

Query  598  QHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVM-------AEEVGKI--VGErgsllrgr  750
            ++GIRVNC+SP GV + MLV+A+R      D M        EEVGK+       + L+  
Sbjct  203  RYGIRVNCISPFGVATSMLVNAWRRCNDVQDCMDIVGIPCEEEVGKMEEFVRSLANLKSA  262

Query  751  ggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
               ++D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  263  TLTVKDIAEAALYLASDESKYVSGHNLVVDGGITTS  298



>ref|XP_011077500.1| PREDICTED: short-chain dehydrogenase reductase 2a [Sesamum indicum]
Length=300

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 178/285 (62%), Gaps = 27/285 (9%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E+T   +  KR  L+GKVA++TGGARGIG  T +L A +G  VIIAD+ D LG  LA S+
Sbjct  20   ETTSSTISIKR--LDGKVAIVTGGARGIGEATVRLFAIHGAKVIIADVDDALGISLANSL  77

Query  235  GGR--YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLAS  399
                 YVHCDV+ E D+++ +   L   GKLDI+FNNAG+ G      SI +   ++   
Sbjct  78   SPHVAYVHCDVTSEEDIQTLINSTLSNYGKLDILFNNAGVLGNQSKHKSILDFDADEFDQ  137

Query  400  LLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRS  579
            ++ +N+ G   G+KHAARAMI     G II ++S A +MGGL  H Y+ SK AI+GL ++
Sbjct  138  VMRVNVRGTALGMKHAARAMIGARTAGCIISTASVAGVMGGLGPHSYTASKHAIVGLTKN  197

Query  580  AACELGQHGIRVNCVSPHGVPSEMLVSAYRM------------ILGKTDVMAEEVGKIVG  723
            AACELG++GIRVNC+SP GV + MLV+A+R+             + K +     +G + G
Sbjct  198  AACELGRYGIRVNCISPFGVATRMLVNAWRVDGEGEGEGVSEEEVEKMEEFVRGMGNLNG  257

Query  724  ErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            E            +D+A+A LFLAS++S +++GHNL++DGG T++
Sbjct  258  EALRA--------KDIAEAALFLASDESRYISGHNLVVDGGVTTS  294



>ref|XP_008461398.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Cucumis 
melo]
Length=262

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 167/262 (64%), Gaps = 11/262 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GKVA+ITG A GIGAETA+L AGNG  V++ DI DELG  +A SIG     + HCDV 
Sbjct  9    LHGKVALITGAASGIGAETARLFAGNGAFVVVVDIDDELGHKVAASIGIDQASFHHCDVR  68

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V   +E  G+LDI+F+NAGI G   SI E+ M    +++AIN+ GVV  IKH
Sbjct  69   DETQVEKIVSYTIEKHGRLDILFSNAGITGSLSSIRELDMSDFDNVMAINVRGVVSSIKH  128

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
              +AM+     G+IIC++S AA +GG+A   Y+ SK A+LG+VRS+  ELG +GIRVNCV
Sbjct  129  GGKAMVERNIRGSIICTTSVAATVGGMALMAYTCSKHAVLGVVRSSCAELGAYGIRVNCV  188

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + +   + +M   K + +      + G           +   +A+A LFLAS++
Sbjct  189  SPYGVATPLTCQSLKMEESKFEEIVSSKASLKG--------VVLKASHIAEAALFLASDE  240

Query  805  SGFVTGHNLILDGGYTSAVSQM  870
            S +++G NL++DGG+T+  S M
Sbjct  241  SVYISGQNLVVDGGFTAVRSVM  262



>ref|XP_010038318.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Eucalyptus 
grandis]
Length=262

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 166/257 (65%), Gaps = 11/257 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA++TG A GIG E A+L A +G  V+IADI DELG  +A+SIG     Y HCDV 
Sbjct  6    LEGKVALVTGAASGIGEEAARLFAEHGAFVVIADIQDELGQKVADSIGNHRASYHHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E+ VESAV   +    KLD++F+NAG+ GP   I ++ +    + +A N+ GV   IKH
Sbjct  66   DESQVESAVNYTVREHKKLDVLFSNAGVIGPLDGILDLDLAAFDATVATNVRGVAATIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+A G  G+I+C++S AA +GG   H Y++SK A++GLVR+A  ELG HGIRVNCV
Sbjct  126  AARAMVAAGTRGSIVCTASVAAAIGGAGPHAYTVSKHALVGLVRTACSELGAHGIRVNCV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P+GV + +   AY +   + +V +     + G           R   VA+A LFLAS++
Sbjct  186  APYGVATPLSCVAYGLTPEEVEVNSAAAANLKG--------VVLRARHVAEAALFLASDE  237

Query  805  SGFVTGHNLILDGGYTS  855
            S +++GHNL +DGG+T+
Sbjct  238  SEYISGHNLAVDGGFTA  254



>gb|KHN33244.1| Sex determination protein tasselseed-2 [Glycine soja]
Length=305

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 177/276 (64%), Gaps = 22/276 (8%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA++TGGARGIG  T ++ A NG  V+IAD+ D LG  LAE++     YVHCDVSK
Sbjct  25   LEGKVAIVTGGARGIGEATVRVFAKNGARVVIADVEDALGTMLAETLAPSATYVHCDVSK  84

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E +VE+ V+  +   G+LDIMFNNAG+ G      SI     E+   ++++N+ G+  GI
Sbjct  85   EEEVENLVRSTVSRYGQLDIMFNNAGVLGNQSKNKSIINFDPEEFDKVMSVNVKGMALGI  144

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  145  KHAARVMIPKGIG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  203

Query  619  CVSPHGVPSEMLVSAYR--------------MILGKTDVMAEEVGKIVGErgsllrgrgg  756
            C+SP GV + MLV+A++               I+       EEV K+ G    L   +G 
Sbjct  204  CISPFGVATNMLVNAWKSGGGDDEDDDQGDEGIINFGLPYQEEVEKMEGFVRGLANLQGA  263

Query  757  rM--EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +  +D+A+A L+LAS++S +V+GHNL++DGG TS+
Sbjct  264  TLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTSS  299



>ref|XP_003522142.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
1 [Glycine max]
Length=311

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 177/276 (64%), Gaps = 22/276 (8%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA++TGGARGIG  T ++ A NG  V+IAD+ D LG  LAE++     YVHCDVSK
Sbjct  31   LEGKVAIVTGGARGIGEATVRVFAKNGARVVIADVEDALGTMLAETLAPSATYVHCDVSK  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E +VE+ V+  +   G+LDIMFNNAG+ G      SI     E+   ++++N+ G+  GI
Sbjct  91   EEEVENLVRSTVSRYGQLDIMFNNAGVLGNQSKNKSIINFDPEEFDKVMSVNVKGMALGI  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  151  KHAARVMIPKGIG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  209

Query  619  CVSPHGVPSEMLVSAYR--------------MILGKTDVMAEEVGKIVGErgsllrgrgg  756
            C+SP GV + MLV+A++               I+       EEV K+ G    L   +G 
Sbjct  210  CISPFGVATNMLVNAWKSGGGDDDDDDQGDEGIINFGLPYQEEVEKMEGFVRGLANLQGA  269

Query  757  rM--EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +  +D+A+A L+LAS++S +V+GHNL++DGG TS+
Sbjct  270  TLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTSS  305



>ref|XP_004492523.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cicer 
arietinum]
Length=302

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 177/283 (63%), Gaps = 15/283 (5%)
 Frame = +1

Query  52   HESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAES  231
            H S           L GK+A++TGGARGIG  T ++   +G  V+I D+ DE+G  LA S
Sbjct  15   HSSDTTFSAPSSRRLEGKLAIVTGGARGIGEATVRIFVKHGAKVVIGDVEDEIGTKLANS  74

Query  232  IG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLA  396
            +     YVHCDVS E DVE+ V   L   GKLDIMFNNAG+ G      SI     ++  
Sbjct  75   LSPLATYVHCDVSVEKDVENLVTSTLFHYGKLDIMFNNAGVLGNQSKNKSIVNFDADEFD  134

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++++N+ GV  GIKHAA+AMI  G G  II SSS A +MGGL  H Y+ SK AI+GL +
Sbjct  135  RVMSVNVKGVALGIKHAAKAMIPQGFG-CIISSSSVAGVMGGLGPHAYTTSKHAIVGLTK  193

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTD-------VMAEEVGKI--VGEr  729
            + +CELG+ GIRVNC+SP GV + MLV+A+R    + D        + EEV K+      
Sbjct  194  NTSCELGRFGIRVNCISPFGVATSMLVNAWRKGDEEIDDDINFGLPLHEEVEKMEEFVRG  253

Query  730  gsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             + LRG   R +D+A+AVL+LAS++S +V+GHNL++DGG TS+
Sbjct  254  LANLRGATLRAQDIAEAVLYLASDESKYVSGHNLVVDGGITSS  296



>ref|XP_010102621.1| Sex determination protein tasselseed-2 [Morus notabilis]
 gb|EXC46007.1| Sex determination protein tasselseed-2 [Morus notabilis]
Length=307

 Score =   221 bits (562),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 186/285 (65%), Gaps = 18/285 (6%)
 Frame = +1

Query  52   HESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAES  231
             E  +  L  +R  L GKVA++TGGARGIG  TA+L A +G  V+IAD+ D+ G  LA++
Sbjct  19   REPENNPLSHRR--LEGKVAIVTGGARGIGEATARLFAKHGAKVVIADVEDKHGELLADT  76

Query  232  IGGR--YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLA  396
            +G    +VHCDVS E D+E+ ++  +   G++DI+FNNAG+ G      SI +   ++  
Sbjct  77   LGASVSFVHCDVSSEEDIENLIESTVSRYGQIDILFNNAGVLGSQSRHKSIIDFDADEFD  136

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ GV  G+KHAA+AMI  G GG II ++S A +MGGL  H Y+ SK AI+GL +
Sbjct  137  QVMRVNVRGVALGMKHAAKAMILRGGGGCIISTASVAGVMGGLGPHAYTASKHAIVGLTK  196

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTD---------VMAEEVGKI--VG  723
            +AACELG++GIRVNC+SP GV + MLV+A+R    + D            +EV K+    
Sbjct  197  NAACELGKYGIRVNCISPFGVATSMLVNAWRSCGEEDDDEESLNFGLPSEQEVEKMEEFV  256

Query  724  ErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
               + L+G   R +D+A+A L+LASE+S +V+GHNL++DGG T++
Sbjct  257  RGLANLKGPTLRAKDIAEAALYLASEESKYVSGHNLVVDGGITTS  301



>ref|XP_008370219.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Malus 
domestica]
Length=308

 Score =   220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 176/273 (64%), Gaps = 19/273 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L+GKVA++TGGARGIG  T KL A +G  V+IAD+ D +G  LA S+     YVHCDVS 
Sbjct  31   LDGKVAIVTGGARGIGEATVKLFARHGAKVVIADVEDAVGTALANSLSPSVTYVHCDVSL  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ ++  +   G+LDIMFNNAG+ G      SI    +++  S++ +N+ G   G+
Sbjct  91   EEDMENLIESTITRYGQLDIMFNNAGVLGNQSKHKSIMNFDVDEFDSVMRVNVRGAALGM  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+A G GG II ++S A + GGL  H Y+ SK AI+GL ++AACELG++GIRVN
Sbjct  151  KHAARVMVARGIGGCIISTASVAGVTGGLGPHGYTASKHAIVGLTKNAACELGRYGIRVN  210

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrM------------  762
            C+SP GV + MLV+A+RM  G  +  AEE   +V      +      +            
Sbjct  211  CISPFGVATSMLVNAWRMSGGDEE-DAEECMDLVMPCEQEVEKMEEFVRGLANLKGQTLR  269

Query  763  -EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  270  AKDIAEAALYLASDESKYVSGHNLVVDGGITTS  302



>ref|XP_006828171.1| hypothetical protein AMTR_s00023p00118310 [Amborella trichopoda]
 gb|ERM95587.1| hypothetical protein AMTR_s00023p00118310 [Amborella trichopoda]
Length=297

 Score =   220 bits (560),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 180/266 (68%), Gaps = 15/266 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI-GGRYVHCDVSKE  270
            L GKVAVITGGARGIG  TA+L + +G  V+IADI D  G  LA S+ G  YVHCDVS+E
Sbjct  30   LEGKVAVITGGARGIGEATARLFSRHGAKVVIADINDVSGEALAASLPGALYVHCDVSQE  89

Query  271  ADVESAVKLALEWRGKLDIMFNNAGIAGPGG----SIAEMKMEQLASLLAINLNGVVHGI  438
            +DV + +  AL   G+LDI+FNNAG+ G       SI E   ++   ++++N+ GV  G+
Sbjct  90   SDVCNLIDRALTRYGRLDILFNNAGVLGSQSQGRKSILEFDPDEFDRVMSVNVRGVALGM  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAARAM+  G  G II ++S A ++GGL  H Y+ SK AI+GL ++AACELG+HGIRVN
Sbjct  150  KHAARAMLPRG-CGCIISTASVAGVLGGLGPHSYTASKHAIVGLTKNAACELGKHGIRVN  208

Query  619  CVSPHGVPSEMLVSAYRM------ILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            C+SP GV + ML+ A+R        L   DV  E++ + V    + L+G   R +DVA+A
Sbjct  209  CISPFGVATSMLIDAWREGVEMEGCLRGDDV--EKMEEFV-RGLANLKGANLRAKDVAEA  265

Query  781  VLFLASEDSGFVTGHNLILDGGYTSA  858
             L+LAS++S +V+GHNL++DGG T+A
Sbjct  266  ALYLASDESKYVSGHNLVVDGGVTTA  291



>ref|XP_008798880.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Phoenix dactylifera]
Length=269

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 168/253 (66%), Gaps = 9/253 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            L GKVAVITGGA GIG  TA+L + +G  V++ADI DE G  + ++IG  +VHCDV+KE+
Sbjct  9    LEGKVAVITGGASGIGECTARLFSQHGAKVVVADIQDERGRSVCDTIGATFVHCDVTKES  68

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            DV+ A+  A+   GKLDIMFNNAGI   G  I +  +     ++ + + G   G KHAAR
Sbjct  69   DVQKAIDTAVTGHGKLDIMFNNAGIIDAGKPITDTALSDFHKVIDVIVTGAFLGTKHAAR  128

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
             M+  G+ G+II ++S A+++GG+ +H Y+ +K A+ GL RSAA ELG+ G+RVNCVSP+
Sbjct  129  VMVPAGR-GSIISTASVASVIGGVGTHAYTAAKHAVAGLTRSAAVELGRFGVRVNCVSPY  187

Query  634  GVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGF  813
             V + + V   R+      V  E + K      + L+G   + EDVA AVL+LAS++S +
Sbjct  188  AVATRLAVEFARI---DEKVFEEAMSKF-----ATLQGTLLKPEDVAMAVLYLASDESKY  239

Query  814  VTGHNLILDGGYT  852
            V+GHNL++DGGY+
Sbjct  240  VSGHNLMVDGGYS  252



>ref|XP_008812964.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Phoenix 
dactylifera]
Length=263

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 163/262 (62%), Gaps = 11/262 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITG A GIG   A+L A NG  V+IADI DELG  +A SI      + HCDV+
Sbjct  6    LEGKVAIITGAASGIGEAAARLFASNGATVVIADIQDELGTAVAASISPGKCSFKHCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V   L   G+LDIMF+NAG+ G    I +  M +L  ++A+N+ G    +KH
Sbjct  66   DEKQVEETVNHVLRTHGRLDIMFSNAGVLGTATPILDADMGELDRVMAVNVRGTAAAVKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            +ARAM+A G  G+IIC++S A+  GGLA   Y+ SK A+LGLVR+AA ELGQHGIRVNC+
Sbjct  126  SARAMVARGTRGSIICTASVASCRGGLAPAAYTASKHAVLGLVRAAAGELGQHGIRVNCL  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV + +      M L K + +   +  + G           +   VA+A LFLAS++
Sbjct  186  SPFGVATPLACGLNGMSLSKVEDLCCAMANLKG--------VVLKTSHVAEAALFLASDE  237

Query  805  SGFVTGHNLILDGGYTSAVSQM  870
            S F++GHNL++DGG T+  S +
Sbjct  238  SVFISGHNLVVDGGTTAVNSSL  259



>ref|XP_009373111.1| PREDICTED: short-chain dehydrogenase reductase 2a [Pyrus x bretschneideri]
Length=308

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 181/273 (66%), Gaps = 19/273 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L+GKVA++TGGARGIG  T KL A +G  V+IAD+ D +G  L+ S+     YVHCDVS 
Sbjct  31   LDGKVAIVTGGARGIGEATVKLFARHGAKVVIADVEDAVGTALSNSLSPSVTYVHCDVSL  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ ++  +   G+LDIMFNNAG+ G      SI    +++  S++ +N+ GV  G+
Sbjct  91   EEDMENLIESTITRYGQLDIMFNNAGVLGNQSKHKSIMNFDVDEFDSIMRVNVRGVALGM  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+A G GG II ++S A + GGL  H Y+ SK AI+GL ++AACELG++GIRVN
Sbjct  151  KHAARVMVARGIGGCIISTASVAGVTGGLGPHGYTASKHAIVGLTKNAACELGRYGIRVN  210

Query  619  CVSPHGVPSEMLVSAYRM-------------ILGKTDVMAEEVGKIVGErgsllrgrggr  759
            C+SP GV + MLV+A+RM              +   +   E++ + V    + L+G+  R
Sbjct  211  CISPFGVATSMLVNAWRMSGGDEEDEEECMDFVMPCEQEVEKMEEFV-RGLANLKGQTLR  269

Query  760  MEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  270  AKDIAEAALYLASDESKYVSGHNLVVDGGITTS  302



>ref|XP_008461393.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Cucumis 
melo]
Length=265

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 167/256 (65%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GKVA+ITGGA GIG +TA++ A NG  V+IADI DELG  +A  IG     + HCDV 
Sbjct  6    LHGKVALITGGASGIGEKTARVFAENGAIVVIADIQDELGEKIASEIGQNKASFHHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E DVE  VK  +E  G+LDI+F+NA + GP   I E+ ME+  + + IN+ GV   IKH
Sbjct  66   NEEDVEQTVKFTVEKHGRLDILFSNAAVMGPMAGILELNMEEFENTMRINVKGVTATIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR M+     G+IIC++S AA +GG+    Y+++K+A++G+V++A  ELG++GIRVN V
Sbjct  126  AAREMVKRKTRGSIICTASVAATLGGVGPFGYTVAKNAVVGVVKAACGELGKYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + M   +Y M + + +  +  +  + G               VA+AVLFLAS++
Sbjct  186  SPYGVATPMTCRSYNMSVEEAEESSSALANLKG--------IVLNCRHVAEAVLFLASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+GHNL +DGG+T
Sbjct  238  SVYVSGHNLAVDGGFT  253



>gb|ABR18410.1| unknown [Picea sitchensis]
Length=291

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 177/289 (61%), Gaps = 30/289 (10%)
 Frame = +1

Query  49   THESTDQM--------LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
            +HE  D+         + S +  LNGKVA+ITGGA GIG    +L   +G  VIIADI D
Sbjct  2    SHEEVDEFAACVGSLNIHSSQRRLNGKVAIITGGASGIGEAIVRLFTKHGAKVIIADIAD  61

Query  205  ELGAPLAESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEM  378
            E G  LAES+     Y+HCDVSKE D+ + V+LA+E  G+LDIM+NNAGI     S+AE 
Sbjct  62   EAGRKLAESLSPPAIYLHCDVSKEQDMSAVVELAMEKYGQLDIMYNNAGIGIADKSVAEY  121

Query  379  KMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSA  558
             MEQ   ++ +N+ GV+ GIKHAAR MI   K G II ++S A+I+GGL  + Y+ SK A
Sbjct  122  DMEQFDRVMKVNVRGVMLGIKHAARVMIP-QKKGCIISTASVASIVGGLTPYSYTASKHA  180

Query  559  ILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRM-----------ILGKTDVMAEE  705
            ++GL ++ A ELG++GIRVN VSP+G+ + + V  ++            +    D     
Sbjct  181  VIGLTKNGAAELGKYGIRVNAVSPYGLATALTVEYFKEGDASSSASEMDLKAAVDAFCSS  240

Query  706  VGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYT  852
            V  + G           ++EDVA+A L+LAS+++ +V+GHNL++DGG T
Sbjct  241  VANLEG--------TILKVEDVAEAGLYLASDEAKYVSGHNLVVDGGIT  281



>ref|XP_003624486.1| Sex determination protein tasselseed-2 [Medicago truncatula]
 gb|ABD32552.1| Short-chain dehydrogenase/reductase SDR [Medicago truncatula]
 gb|AES80704.1| short-chain dehydrogenase/reductase [Medicago truncatula]
 gb|AFK44649.1| unknown [Medicago truncatula]
Length=301

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/258 (48%), Positives = 170/258 (66%), Gaps = 8/258 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GK+A+ITG A G+G  TA     +G  VIIAD   +LG  +A+ +G   +YV CDV+ 
Sbjct  35   LEGKIAIITGSASGLGKATAHEFVQHGAQVIIADNDTQLGPKVAKELGHSAQYVECDVTV  94

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGP--GGSIAEMKMEQLASLLAINLNGVVHGIK  441
            EA VE AV  A+   GKLDIM+NNAGI GP    SI E+ +++   ++ IN+ GV+ GIK
Sbjct  95   EAQVEEAVNFAITNYGKLDIMYNNAGITGPVIPPSITELDLDEFEKVMRINVTGVIAGIK  154

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI  G G +IIC+SS + + GGL  HPY++SKS I G+V+S A EL   GIRVNC
Sbjct  155  HAARVMIPKGYG-SIICTSSISGLFGGLGPHPYTISKSTIPGVVKSVASELCGAGIRVNC  213

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            +SP  +P+ M  S Y++      V  E++G+IV    +L   +   + DVA+A L+LAS+
Sbjct  214  ISPTAIPTPM--SLYQIGKFIPGVTYEQIGEIVSGLSALKGAKCEDI-DVARAALYLASD  270

Query  802  DSGFVTGHNLILDGGYTS  855
            D+ F++G NLI+DGG+TS
Sbjct  271  DAKFISGQNLIVDGGFTS  288



>ref|XP_003623493.1| Sex determination protein tasselseed-2 [Medicago truncatula]
 gb|AES79711.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=302

 Score =   218 bits (555),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 173/269 (64%), Gaps = 15/269 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L GK+A++TGGARGIG  T ++   +G  V+I D+ DELG  LA S+     YVHCDVS 
Sbjct  29   LEGKIAIVTGGARGIGEATVRIFVKHGAKVVIGDVEDELGIMLANSLSPSAIYVHCDVSV  88

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E DVE+ V   +   GKLDIMFNNAG  G      SI     E+   ++ +N+ GV  G+
Sbjct  89   EKDVENLVTSTISHYGKLDIMFNNAGFLGNQSKNKSIVNFDTEEFDRVMNVNVKGVALGM  148

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAA+ MI  G G  I+ +SS A ++GGL  H Y+ SK AI+GL ++A+CELG++GIRVN
Sbjct  149  KHAAKVMIPRGNG-CIVSTSSVAGVLGGLGPHAYTASKHAIVGLTKNASCELGKYGIRVN  207

Query  619  CVSPHGVPSEMLVSAYRMILGKTD-------VMAEEVGKI--VGErgsllrgrggrMEDV  771
            C+SP GV + MLV+A+R    + D        + EEV K+         LRG   + +D+
Sbjct  208  CISPFGVATSMLVNAWRNGEDEVDEGINFGLPLIEEVEKMEEFVRGIGNLRGTTLKTQDI  267

Query  772  AQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            A+AVL+LAS++S +V+GHNL++DGG TS+
Sbjct  268  AEAVLYLASDESKYVSGHNLVVDGGITSS  296



>ref|XP_010679442.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Beta 
vulgaris subsp. vulgaris]
Length=264

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 164/263 (62%), Gaps = 13/263 (5%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---  243
            +C  R  L GKVA+ITG A GIG E AKL A NG  V+IADI DELG  +  SIG     
Sbjct  1    MCKSR--LEGKVALITGAASGIGEEAAKLFAENGAFVVIADIQDELGEQVVTSIGSNKAS  58

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNG  423
            Y HCDV  E  VE +V   L+  G LDI+F+NAG+ GP  SI ++ +  L + LA N+ G
Sbjct  59   YYHCDVRDEKQVEDSVNYTLQKHGTLDILFSNAGVMGPITSILDLDLALLDNTLATNVRG  118

Query  424  VVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQH  603
            V   IKH  RAM++    G+IIC++S AA +GG+  + Y+ SK A++GLVR+A  ELG H
Sbjct  119  VAATIKHVGRAMVSRKISGSIICTASVAACLGGVGPNAYTASKHAVVGLVRAACNELGAH  178

Query  604  GIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAV  783
            GIRVNC+SP GV + +  +AY M   + +  +  +  + G           +   +A+A 
Sbjct  179  GIRVNCISPFGVATPLPCNAYNMEPSQLEANSCSLANLKG--------IVLKARHIAEAA  230

Query  784  LFLASEDSGFVTGHNLILDGGYT  852
            LF AS++S F++GHNL++DGG+T
Sbjct  231  LFFASDESAFISGHNLVVDGGFT  253



>ref|XP_007205611.1| hypothetical protein PRUPE_ppa009084mg [Prunus persica]
 gb|EMJ06810.1| hypothetical protein PRUPE_ppa009084mg [Prunus persica]
Length=307

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 176/273 (64%), Gaps = 20/273 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L+GKVA++TGGARGIG  T +L A +G  VIIAD+ D +G  LA S+     +VHCDVS 
Sbjct  31   LDGKVAIVTGGARGIGEATVRLFARHGAKVIIADVEDAVGLTLANSLSPSVTFVHCDVSL  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ V+  +   G+LDIMFNNAGI G      SI +   ++   ++ +N+ G   G+
Sbjct  91   EEDIENLVESTISRYGQLDIMFNNAGILGNQSKHKSIMDFDTDEFDQVMRVNVRGAALGM  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+  G GG II +SS A + GGL  H Y+ SK AI+GL ++AACELG++GIRVN
Sbjct  151  KHAARVMVPRGNGGCIISTSSVAGVAGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVN  210

Query  619  CVSPHGVPSEMLVSAYR-----------MILGKTDVMAEEVGKIVGErgsllrgrggrM-  762
            C+SP GV + MLV+A+R           M LG      +EV K+      L   +G  + 
Sbjct  211  CISPFGVATSMLVNAWRTSGDDEEEEECMDLGMP--CEQEVEKMEDFVRGLANLKGQTLR  268

Query  763  -EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  269  AKDIAEAALYLASDESKYVSGHNLVVDGGITTS  301



>ref|XP_002323034.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEF04795.2| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 127/282 (45%), Positives = 179/282 (63%), Gaps = 15/282 (5%)
 Frame = +1

Query  52   HESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAES  231
             +ST+   CS    L G+VAV+TGGARGIG  T +L A +G  V+IAD+ D LG  LA S
Sbjct  20   EKSTENSPCSP-GRLEGRVAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGTLLANS  78

Query  232  IGGR--YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLA  396
            +     +VHCDVS E D+E+ +   +   GKLD++FNNAG+ G      SIA    E+  
Sbjct  79   LAPSVSFVHCDVSLEEDIENLINSTVSHYGKLDVLFNNAGVLGNQSKNKSIANFDAEEFD  138

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ GV  GIKHAAR MI  G G  II ++S A +MGGL  H Y+ SK AI+GL +
Sbjct  139  RVMQVNVRGVALGIKHAARVMIPRGVG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTK  197

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVM------AEEVGKIVGErgsl  738
            + ACELG++GIRVNC+SP GV + MLV+A+R    + D +       +EV K+      L
Sbjct  198  NTACELGRYGIRVNCISPFGVATSMLVNAWRSGDEEEDCLNFGLPCEKEVEKMEDFVRGL  257

Query  739  lrgrggrM--EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
               +G  +   D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  258  ANLKGPTLRARDIAEAALYLASDESKYVSGHNLVVDGGITTS  299



>ref|XP_004493066.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X1 [Cicer arietinum]
Length=332

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/262 (47%), Positives = 173/262 (66%), Gaps = 10/262 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCD  258
            RS L GKVA+ITG A G+G  TA     +G  VIIAD   +LG  +A+ +G   +YV CD
Sbjct  63   RSRLEGKVAIITGSASGLGKATAHEFVQHGAQVIIADTDTKLGPQVAKQLGPSAQYVECD  122

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGP--GGSIAEMKMEQLASLLAINLNGVVH  432
            V+ EA +E AV +A+   GKLDIM+NNAGI GP    SI E+ +++   ++ IN+ G++ 
Sbjct  123  VTVEAQIEEAVNVAITNYGKLDIMYNNAGITGPISPPSITELDLDEFDKVMRINVTGIIS  182

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            GIKHAAR MI  G G +IIC+SS + + GGL  HPY++SKS I G+V+S A EL   GIR
Sbjct  183  GIKHAARVMIPKGYG-SIICTSSISGLFGGLGPHPYTISKSTIPGVVKSVASELCGVGIR  241

Query  613  VNCVSPHGVPSEM-LVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            VNC+SP  +P+ M L    + + G T    E++ ++V   G L   +   + DVA+A L+
Sbjct  242  VNCISPAAIPTPMSLTQVGKFLPGFTQ---EQIAEVVSGLGVLKGAKCEDI-DVARAALY  297

Query  790  LASEDSGFVTGHNLILDGGYTS  855
            LAS+++ F++GHNLI+DGG+TS
Sbjct  298  LASDEAKFISGHNLIVDGGFTS  319



>gb|AHH81853.1| short-chain alcohol dehydrogenase [Perilla frutescens]
Length=277

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 172/270 (64%), Gaps = 13/270 (5%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GR  243
            L S    L GKVA+ITGGA GIG  TAKL + +G  V I D+ DELG  + + IG     
Sbjct  7    LSSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNST  66

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLN  420
            Y+HCDV+ E DV +AV   +   GKLDIMFNNAGIA  P   I + +      +LA+N+ 
Sbjct  67   YIHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVT  126

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            GV  G+KHAAR MI   +GG II ++S A+ MGG A+H Y+ SK A++GL R++A ELGQ
Sbjct  127  GVFQGMKHAARVMIPA-RGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSAIELGQ  185

Query  601  HGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            +GIRVNC+SP+ + S++     R  LG  D   EE+ +++ ++ +L        +D+A A
Sbjct  186  YGIRVNCMSPYALASDL----SRKYLGIED---EELERMMNDKANLKGTTLKA-DDIANA  237

Query  781  VLFLASEDSGFVTGHNLILDGGYTSAVSQM  870
             LFLAS+D+ +V+G NL +DGG+T   S M
Sbjct  238  ALFLASDDAKYVSGQNLFIDGGFTIFNSAM  267



>gb|ABK21151.1| unknown [Picea sitchensis]
Length=290

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 169/260 (65%), Gaps = 10/260 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            LNGKVA+ITGGA GIG    +L   +G  VIIADI DE G  LA S+     YVHCDVSK
Sbjct  24   LNGKVAIITGGASGIGEAIVRLFTKHGAKVIIADIADEAGRNLAGSLSPPATYVHCDVSK  83

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHA  447
            E DV +AV LA+E  G+LDIM+NNAGI   G S+AE  MEQ   ++ +N+ GV+ GIKHA
Sbjct  84   EQDVRAAVDLAMEKHGQLDIMYNNAGIIVAGKSVAEYDMEQFDRVMRVNVRGVMLGIKHA  143

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MI   K G II ++S A I+GG A + Y++SK A++GL ++ A ELG++GIRVN VS
Sbjct  144  ARVMIP-RKKGCIISTASIAGIVGGFAPYSYTVSKHAVIGLTKNGAAELGKYGIRVNAVS  202

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVG-----ErgsllrgrggrMEDVAQAVLFL  792
            P+G  + + V   +   G     A EV             + L G   ++ED+A+A L+L
Sbjct  203  PYGSATPLAVEYLKQ--GDASSSASEVDNKAAVEAFCSSVANLEGTIHKVEDIAEAGLYL  260

Query  793  ASEDSGFVTGHNLILDGGYT  852
            AS+++ +V+GHNL++DGG T
Sbjct  261  ASDEAKYVSGHNLVVDGGIT  280



>gb|ABK26187.1| unknown [Picea sitchensis]
Length=290

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 169/260 (65%), Gaps = 10/260 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            LNGKVA+ITGGA GIG    +L   +G  VIIADI DE G  LA S+     YVHCDVSK
Sbjct  24   LNGKVAIITGGASGIGEAIVRLFTKHGAKVIIADIADEAGRNLAGSLSPPATYVHCDVSK  83

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHA  447
            E DV +AV LA+E  G+LDIM+NNAGI   G S+AE  MEQ   ++ +N+ GV+ GIKHA
Sbjct  84   EQDVRAAVDLAMEKHGQLDIMYNNAGIIVAGKSVAEYDMEQFDRVMRVNVRGVMLGIKHA  143

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MI   K G II ++S A I+GG A + Y++SK A++GL ++ A ELG++GIRVN VS
Sbjct  144  ARVMIP-RKKGCIISTASIAGIVGGFAPYSYTVSKHAVIGLTKNGAAELGKYGIRVNAVS  202

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVG-----ErgsllrgrggrMEDVAQAVLFL  792
            P+G  + + V   +   G     A EV             + L G   ++ED+A+A L+L
Sbjct  203  PYGSATPLAVEYLKQ--GDASSSASEVDNKAAVEAFCSSVANLEGTIHKVEDIAEAGLYL  260

Query  793  ASEDSGFVTGHNLILDGGYT  852
            AS+++ +V+GHNL++DGG T
Sbjct  261  ASDEAKYVSGHNLVVDGGIT  280



>ref|XP_004302582.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 175/271 (65%), Gaps = 17/271 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GK+A++TG ARGIG  T KL A +G  V+IAD+ D  G  LA S+G    +VHCDVS 
Sbjct  30   LEGKIAIVTGAARGIGEATVKLFAKHGAKVVIADVEDSTGTALANSLGPSVTFVHCDVSL  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ ++  +   G+LDIMFNNAGI G      SI    +++   ++ +N+ G   GI
Sbjct  90   EEDIENLIQSTVSRYGQLDIMFNNAGILGNQSKHKSIVNFDVDEFDRVMRVNVRGTALGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI GG GG II ++S A + GGL  H Y+ SK AI+GL ++AACELG++GIRVN
Sbjct  150  KHAARVMIPGG-GGCIISTASVAGVAGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVN  208

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMA---------EEVGKI--VGErgsllrgrggrME  765
            CVSP GV + MLV+A+RM     +            +EV K+       + L+G   R +
Sbjct  209  CVSPFGVATPMLVNAWRMSDEDDEEEECMDFGMPCEQEVEKMEEFVRGLANLKGPTLRTK  268

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  269  DIAEAALYLASDESKYVSGHNLVVDGGITTS  299



>ref|XP_009378033.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Pyrus x bretschneideri]
Length=303

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 172/266 (65%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA     +G  VIIAD   ELG  + + +G    +V CDV+ 
Sbjct  36   LEGKVAIITGSASGLGKATAHEFIRHGAHVIIADSDSELGPQVVKELGPASYFVQCDVAI  95

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E+ +  AV+ A+   GKLDIM+NNAGI GP    SIA++ +E+  S++ +NL G V GIK
Sbjct  96   ESQIAEAVETAMARHGKLDIMYNNAGITGPAFPPSIADLNLEEFDSVIRVNLRGAVAGIK  155

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI  G G +I+C+SS A ++GGL  HPYS+SK  I GLV+S A EL ++GIRVNC
Sbjct  156  HAARVMIPAGSG-SILCTSSIAGLLGGLGPHPYSISKFTIPGLVKSLASELCRNGIRVNC  214

Query  622  VSPHGVPSEMLVSAYRMIL-GKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  +P+ + V   + +  G T+   +E+   +GE             DVAQA ++LAS
Sbjct  215  ISPGPIPTPLAVREIKQLYPGATEEQVKEIVNGLGELKGAKCEEI----DVAQAAVYLAS  270

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSF  876
            +++ +VTGHNL++DGG+TS  S +SF
Sbjct  271  DEAKYVTGHNLVVDGGFTSFKS-LSF  295



>ref|XP_008246119.1| PREDICTED: secoisolariciresinol dehydrogenase-like, partial [Prunus 
mume]
Length=257

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 169/268 (63%), Gaps = 16/268 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITGGA GIG  T +L + +G  V+IAD+ D+L   +   +      +VHCDV+
Sbjct  1    LEGKVALITGGASGIGESTVRLFSKHGAKVVIADVQDDLAESICRDLSSSSTSFVHCDVT  60

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGS-IAEMKMEQLASLLAINLNGVVHGIK  441
            KE DVE+AVK A    GKLDIMFNNAGIAG   + I +    +   ++ +NL GV  GIK
Sbjct  61   KEEDVENAVKTATSKYGKLDIMFNNAGIAGTAKTNILDNDKAEFEQVIGVNLVGVFLGIK  120

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI+ G+G +II ++S+ + +GG ASH Y+ SK  +LGLVR+ A ELGQHGIRVNC
Sbjct  121  HAARVMISAGQG-SIINTASACSTIGGCASHAYTSSKHGVLGLVRNTAIELGQHGIRVNC  179

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ V + +    +++     D +      + GE            ED+A+A L+L S+
Sbjct  180  VSPYIVATPLAKDFFKL---DDDGVHGVYSNLKGEVLKA--------EDIAEAALYLGSD  228

Query  802  DSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            +S +V+GHNL++DGG+T+  ++     Q
Sbjct  229  ESKYVSGHNLLVDGGFTNVNARFCIFEQ  256



>ref|XP_008450017.1| PREDICTED: momilactone A synthase-like [Cucumis melo]
Length=287

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/259 (49%), Positives = 170/259 (66%), Gaps = 10/259 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA+     G  VIIADI + LG  +AE +G   ++V CDV+ 
Sbjct  24   LEGKVALITGAANGLGQATAQEFVEQGAHVIIADIDNTLGPQVAEQLGPTAKFVQCDVAL  83

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E++V +AV  A+   GKLDIM+NNAGI GP    SIAE+ +     ++++N+ GVV GIK
Sbjct  84   ESEVAAAVNFAVTHHGKLDIMYNNAGITGPALPPSIAELDLADFDRVMSVNVRGVVAGIK  143

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M+  G G +I+C+SS + +MGGL  HPYS+SK AI G+VRSAA EL + G+RVNC
Sbjct  144  HAARVMVPAGSG-SILCTSSMSGLMGGLGPHPYSISKHAIPGIVRSAATELCRSGVRVNC  202

Query  622  VSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  V + M V     M  G +    EE+  I+   G L       + DVA+A LFLAS
Sbjct  203  ISPAPVATAMAVKGIGEMYKGFSK---EEIVGIINGLGVLKGAICEEV-DVAKAALFLAS  258

Query  799  EDSGFVTGHNLILDGGYTS  855
            +DS ++TG NL++DGG+TS
Sbjct  259  DDSKYITGQNLVVDGGFTS  277



>ref|XP_010112720.1| Sex determination protein tasselseed-2 [Morus notabilis]
 gb|EXC34678.1| Sex determination protein tasselseed-2 [Morus notabilis]
Length=299

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 163/262 (62%), Gaps = 17/262 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L GKVA+ITG A GIG  TA     NG  V+IADI  +LG   AE +G    ++ CDV+K
Sbjct  34   LQGKVALITGAASGIGKATATKFINNGAKVVIADIKHDLGRATAEELGPNAVFIPCDVTK  93

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+D+ +AV   L    +LDIM NNAG+      SI+++ M     ++ +NL GVV GIKH
Sbjct  94   ESDISAAVDFTLARHNQLDIMHNNAGVPCNTPPSISDLDMASFDRIIDVNLRGVVAGIKH  153

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            A+R MI   + GTI+C++S   IMGG+A H YS+SKSA++G+V+S A EL QHGIRVNCV
Sbjct  154  ASRVMIPR-RTGTILCTASVTGIMGGMAQHTYSVSKSAVIGIVKSVASELSQHGIRVNCV  212

Query  625  SPHGVPSEMLVSAYRMILGKTD-----VMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            SP  VP++ ++   R +L   D      M    G + G             EDVA A L+
Sbjct  213  SPFAVPTQFVLGEMRHLLPGLDDRRIAEMIHNAGALRGANCEP--------EDVANAALY  264

Query  790  LASEDSGFVTGHNLILDGGYTS  855
            L S+++ +V+GHNL++DGG+T+
Sbjct  265  LVSDEAKYVSGHNLVVDGGFTA  286



>gb|AFK46966.1| unknown [Lotus japonicus]
Length=270

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/255 (45%), Positives = 171/255 (67%), Gaps = 13/255 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI-GGRYVHCDVSKE  270
            L GKVA+ITGGA GIG  TA+L + +G  V+IADI D+LG  + + +    +VHC+V+KE
Sbjct  14   LEGKVALITGGASGIGEATARLFSKHGAQVVIADIQDDLGHSVCKDLESASFVHCNVTKE  73

Query  271  ADVESAVKLALEWRGKLDIMFNNAGIAGPGG-SIAEMKMEQLASLLAINLNGVVHGIKHA  447
             +VE+AV +A+   GKLDIMFNNAGI+G    SI      +   + ++N++G   G KHA
Sbjct  74   DEVETAVNMAVSKHGKLDIMFNNAGISGNNNTSILNNTKSEFEQVFSVNVSGAFLGTKHA  133

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MI   +G +II ++S++ ++GG A HPY+ SK A++GL+R+ A EL  +G+RVNCVS
Sbjct  134  ARVMIPARRG-SIINTASTSGVIGGGAPHPYTSSKHAVVGLMRNTAVELEAYGVRVNCVS  192

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDS  807
            P+ VP+ M+ + ++  LG+ D + +    + G             EDVA+AVL+L S++S
Sbjct  193  PYFVPTPMVKNFFK--LGEEDEVPKFYSNLKG--------ADLVPEDVAEAVLYLGSDES  242

Query  808  GFVTGHNLILDGGYT  852
             +V+GHNL++DGG+T
Sbjct  243  KYVSGHNLVVDGGFT  257



>gb|AER92598.1| putative short-chain alcohol dehydrogenase [Linum usitatissimum]
Length=314

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 176/268 (66%), Gaps = 14/268 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRY------VHC  255
            L GKVA+ITGGARGIG  T +L A +G  V+IADI D LG  L  S+          VHC
Sbjct  42   LEGKVAIITGGARGIGEATVRLFAKHGAKVVIADIQDSLGHALLHSLTNTTSSSIICVHC  101

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGG-SIAEMKMEQLASLLAINLNG  423
            DVS E DVE+ V   L   G+LDI+ NNAGI G   PG  SI +   E+   ++ +N+ G
Sbjct  102  DVSSEEDVENLVASTLSKFGRLDILVNNAGILGSQAPGAKSIMDFDAEEFERVMRVNVKG  161

Query  424  VVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQH  603
                +KHAARAM+A G GG I+ ++S A +MGG+  H Y+ SK A++GL ++AAC+LG++
Sbjct  162  TALCMKHAARAMLAAG-GGCIVSTASVAGVMGGMGPHAYTSSKHAVVGLTKNAACDLGKY  220

Query  604  GIRVNCVSPHGVPSEMLVSAYR---MILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            GIRVNC+SP GV + MLV+A++        T+   EE+ ++V    +L  G   + EDVA
Sbjct  221  GIRVNCISPFGVATSMLVNAWKDGGGGGAVTEGEVEEMEELVRRLANLKGGATLKAEDVA  280

Query  775  QAVLFLASEDSGFVTGHNLILDGGYTSA  858
            +A L+LAS++S +V+GHNL++DGG+TS+
Sbjct  281  EAALYLASDESKYVSGHNLVVDGGFTSS  308



>gb|ABK26305.1| unknown [Picea sitchensis]
Length=290

 Score =   215 bits (547),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 176/280 (63%), Gaps = 17/280 (6%)
 Frame = +1

Query  49   THESTDQM--------LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
            +HE  D+         + S +  L  KVA+ITGGA GIG    +L   +G  VIIADI D
Sbjct  2    SHEEVDEFAACVGSLNIHSSQRRLESKVAIITGGAAGIGEAIVRLFTKHGAKVIIADIAD  61

Query  205  ELGAPLAESIGGR--YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEM  378
            E G  LAES+  +  YVHCDV+KE D+ + V LA+E  G+LDIM+NNAGI   G S+AE 
Sbjct  62   EAGRKLAESLSPQATYVHCDVTKEQDMSATVDLAMEKHGQLDIMYNNAGIIVAGKSVAEY  121

Query  379  KMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSA  558
             MEQ   ++++N+ GV+ GIKHAAR MIA  K G II ++S A+I+GG   + Y+ SK A
Sbjct  122  DMEQFDRVMSVNVRGVMLGIKHAARVMIA-RKKGCIISTASLASIVGGGTPYSYTASKHA  180

Query  559  ILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsl  738
             +GL ++ A ELG++GIRVN VSP+G+ + + V  ++     +   A E+ K   E    
Sbjct  181  AIGLTKNGAAELGKYGIRVNAVSPYGLATALTVEYFKECDAASS--ASEIDKAAVEAFCS  238

Query  739  lrg----rggrMEDVAQAVLFLASEDSGFVTGHNLILDGG  846
                      ++EDVA+A L+LAS+++ +V+GHNL++DGG
Sbjct  239  SVANLEGTILKVEDVAEAGLYLASDEAKYVSGHNLVVDGG  278



>ref|XP_003552289.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Glycine 
max]
Length=298

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 173/277 (62%), Gaps = 12/277 (4%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG-  237
            TD    S    L GKVA++TGGA+GIG  T ++   +G  V+IAD+ D  GA LAE++  
Sbjct  17   TDTTFSSSSKRLEGKVAIVTGGAKGIGEATVRVFVKHGAKVMIADVEDAAGAMLAETLSP  76

Query  238  -GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLL  405
               YVHCDVS E +VE  V   +   G LDIMFNNAG+ G      SI     ++   ++
Sbjct  77   SATYVHCDVSIEKEVEKLVSSTISRYGHLDIMFNNAGVLGNQSKNKSIVNFDPDEFDKVM  136

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
             +N+ GV  GIKHAAR MI  G G  II +SS A +MGGL  H Y+ SK AI+G+ ++ A
Sbjct  137  CVNVKGVALGIKHAARVMIPRGIG-CIISTSSVAGVMGGLGPHAYTASKHAIVGITKNTA  195

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGK-TDV---MAEEVGKIVGErgsllrgrg  753
            CELG++GIRVNC+SP GV + MLV+A+R    + T+      EEV KI      L   RG
Sbjct  196  CELGRYGIRVNCISPFGVATSMLVNAWRPCDDEGTNFGVPFPEEVEKIEEFVRGLANLRG  255

Query  754  grME--DVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
              +   D+A+A L+LAS++S +V+GHNL++DGG TS+
Sbjct  256  PTLRALDIAEAALYLASDESKYVSGHNLVVDGGVTSS  292



>ref|XP_009378032.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Pyrus x bretschneideri]
Length=305

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 172/266 (65%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA     +G  VIIAD   ELG  + + +G    +V CDV+ 
Sbjct  38   LEGKVAIITGSASGLGKATAHEFIRHGAHVIIADSDSELGPQVVKELGPASYFVQCDVAI  97

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E+ +  AV+ A+   GKLDIM+NNAGI GP    SIA++ +E+  S++ +NL G V GIK
Sbjct  98   ESQIAEAVETAMARHGKLDIMYNNAGITGPAFPPSIADLNLEEFDSVIRVNLRGAVAGIK  157

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI  G G +I+C+SS A ++GGL  HPYS+SK  I GLV+S A EL ++GIRVNC
Sbjct  158  HAARVMIPAGSG-SILCTSSIAGLLGGLGPHPYSISKFTIPGLVKSLASELCRNGIRVNC  216

Query  622  VSPHGVPSEMLVSAYRMIL-GKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  +P+ + V   + +  G T+   +E+   +GE             DVAQA ++LAS
Sbjct  217  ISPGPIPTPLAVREIKQLYPGATEEQVKEIVNGLGELKGAKCEEI----DVAQAAVYLAS  272

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSF  876
            +++ +VTGHNL++DGG+TS  S +SF
Sbjct  273  DEAKYVTGHNLVVDGGFTSFKS-LSF  297



>ref|XP_002308240.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
 gb|EEE91763.1| short-chain dehydrogenase/reductase family protein [Populus trichocarpa]
Length=305

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/270 (44%), Positives = 174/270 (64%), Gaps = 14/270 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L G+VA++TGGARGIG  T +L A  G  V+IAD+ D LG  L  S+     +VHCDVS 
Sbjct  33   LEGRVAIVTGGARGIGEATVRLFARQGAKVVIADVEDALGTSLVNSLAPSVSFVHCDVSL  92

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   GKLDI+FNNAG+ G      SI +  +++   ++ +N+ G+  GI
Sbjct  93   EKDIENLINSTISQYGKLDILFNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMALGI  152

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI  G GG II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  153  KHAARVMIPRG-GGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  211

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVM------AEEVGKIVGErgsllrgrggrM--EDVA  774
            C+SP GV + MLV+A+R    + D +       +EV K+      L   +G  +   D+A
Sbjct  212  CISPFGVATSMLVNAWRSSGEEEDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIA  271

Query  775  QAVLFLASEDSGFVTGHNLILDGGYTSAVS  864
            +A L+LAS++S +V+GHNL++DGG T++ +
Sbjct  272  EAALYLASDESKYVSGHNLVVDGGITTSTN  301



>ref|XP_010412483.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Camelina 
sativa]
Length=270

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 151/221 (68%), Gaps = 11/221 (5%)
 Frame = +1

Query  226  ESIGGRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLL  405
             S+  +Y H  VS+E             +   D+MFNNAG+    GSI EM +     L+
Sbjct  60   NSLHTKYPHTSVSRELH---------RPQQSPDVMFNNAGMTFNEGSIMEMDVYMANKLV  110

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            ++N+NGV+HGIKHAA+AMI GG GG+IIC+SSS+ IMGGL  H Y+LSK AI GLVR+ A
Sbjct  111  SVNVNGVLHGIKHAAKAMIKGGGGGSIICTSSSSGIMGGLGGHAYTLSKGAINGLVRTTA  170

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
            CELG HGIRVN +SPHGVP+++LV+AYR  L    +   EV  IV E    L GR G +E
Sbjct  171  CELGSHGIRVNSISPHGVPTDILVNAYRKYLNNDKLDVPEVTDIVAE-KGSLPGRAGAVE  229

Query  766  DVAQAVLFLAS-EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            DVAQA LFLAS E SGF+TGHNL++DGGYTSA S M FIY 
Sbjct  230  DVAQAALFLASQESSGFITGHNLVVDGGYTSATSTMKFIYN  270



>ref|XP_008231034.1| PREDICTED: zerumbone synthase-like isoform X1 [Prunus mume]
Length=304

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/269 (46%), Positives = 169/269 (63%), Gaps = 11/269 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCD  258
            RS L GKVA+ITG A G+G  TA      G  VIIAD   ELG  +A+ +G    +V CD
Sbjct  35   RSRLQGKVALITGSASGLGKATAHEFIQQGAHVIIADTDSELGQQVAKELGPAAHFVQCD  94

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVH  432
            VS E+ +  AV+ A+   GKLDIM+NNAGI GP    SIA++ +E+   ++ +N+ G V 
Sbjct  95   VSVESQIAEAVETAVARHGKLDIMYNNAGITGPAFPPSIADLDLEEFDRVMRVNVRGAVA  154

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            G+KHAAR M+  G  G+I+C+SS + I+GGL  HPYS+SK  I GLV+S A EL + G+R
Sbjct  155  GMKHAARVMVPAG-AGSILCTSSISGILGGLGPHPYSVSKFTIPGLVKSVASELCRSGVR  213

Query  613  VNCVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            VNC+SP  +P+EM V    +   G T     E+   VGE            +DVAQA ++
Sbjct  214  VNCISPGPIPTEMSVREIGQFYPGATREQVIEIVNGVGELKGAKCEE----KDVAQAAVY  269

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            LAS+++ +VTGHNL++DGG+T     +SF
Sbjct  270  LASDEAKYVTGHNLVVDGGFT-CFKTLSF  297



>ref|XP_004981155.1| PREDICTED: short-chain dehydrogenase reductase 5-like [Setaria 
italica]
Length=266

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 170/268 (63%), Gaps = 24/268 (9%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDV  261
             +  L+GKVA++TGGA GIG   A+L A NG  V+IADI D LG  +A S G  ++ CDV
Sbjct  2    SKPRLDGKVAIVTGGASGIGEAAARLFASNGATVVIADIQDALGEAVAASAGCTFMRCDV  61

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            + EA VE+ V   +   G+LD+M +NAG+  P GS+ +M + +L  ++A+N  G    +K
Sbjct  62   TDEAQVEATVGAVVAAHGRLDVMLSNAGVLLPTGSVMDMDLAELDRVMAVNFRGAAACVK  121

Query  442  HAARAMIA----GGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
            HAARAM++    G +GG I+C++S A++ GG     Y+ SK A+LGLVR+AA ELG+HG+
Sbjct  122  HAARAMVSPPDNGARGGAIVCTASVASLQGGFGPASYTASKHALLGLVRAAAGELGRHGV  181

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEV------GKIVGErgsllrgrggrMEDV  771
            RVNCVSP GV + M  S   M +G  ++ A  V      GK++            R EDV
Sbjct  182  RVNCVSPGGVATPM--SCALMGVGPEELEAMTVPHNVLRGKVL------------RAEDV  227

Query  772  AQAVLFLASEDSGFVTGHNLILDGGYTS  855
            A+A LFLAS+ + F++GHNL++DG  T+
Sbjct  228  AEAALFLASDQASFISGHNLVVDGATTA  255



>emb|CDP06416.1| unnamed protein product [Coffea canephora]
Length=298

 Score =   215 bits (547),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 125/285 (44%), Positives = 177/285 (62%), Gaps = 31/285 (11%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI---GGRYVHCDVS  264
            L GKVAV+TGGARGIG  T +L A +G  V+I D+ D LG  LA S+   G  YVHCDVS
Sbjct  9    LEGKVAVVTGGARGIGEATVRLFARHGAKVVIGDVEDVLGHALAASLSPHGVTYVHCDVS  68

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGG----SIAEMKMEQLASLLAINLNGVVH  432
             E DVE  ++  +   G+LDIMFNNAG+ G       SI +   E+   ++ +N+ GV  
Sbjct  69   SEGDVEKLIQSTVSGFGRLDIMFNNAGVLGSQAKHKKSIVDFDAEEFDRIMGVNVRGVAL  128

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            G+KHAARAMI  G G  II ++S A+++GGL  H Y+ SK AI+GL ++AACELG++GIR
Sbjct  129  GMKHAARAMIPRGTG-CIISTASVASVLGGLGPHSYTASKHAIVGLTKNAACELGKYGIR  187

Query  613  VNCVSPHGVPSEMLVSAYR--------------------MILGKTDVMAEEVGKIVGErg  732
            VNC+SP GV + ML++A+R                     ++  ++  A E  +   E  
Sbjct  188  VNCISPFGVATRMLINAWRNSHIDDDDDEDEDDEDAAAATMMSSSNTTAREAVEKAEEMV  247

Query  733  ---sllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
               + L+G   R  D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  248  RGLANLKGATLRTSDIAEAALYLASDESRYVSGHNLVVDGGITTS  292



>ref|XP_002321531.2| hypothetical protein POPTR_0015s07670g [Populus trichocarpa]
 gb|EEF05658.2| hypothetical protein POPTR_0015s07670g [Populus trichocarpa]
Length=264

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 16/266 (6%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIGG--  240
            M C  +  +  KVA++TGGA GIG  TA L A NG   V+IAD+ DE G  LAESIG   
Sbjct  1    MACQHK--VQDKVAIVTGGASGIGEATALLFAENGARAVVIADVQDERGKKLAESIGSDR  58

Query  241  -RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAG-IAGPGGSIAEMKMEQLASLLAIN  414
              ++HCDV+ E  V+S V+  +   G LDIMF NAG ++    ++ +  ++    L A+N
Sbjct  59   STFIHCDVTDEKQVKSLVESTVALYGHLDIMFCNAGTLSFDKQTVVDFDLDMYEKLFAVN  118

Query  415  LNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACEL  594
            + GV   +KHAARAM+ GG+ G+IIC++S AA  GG     Y +SK A+LGLV+SA+ +L
Sbjct  119  VRGVAASVKHAARAMVEGGRKGSIICTASIAANTGGSIHTDYVMSKCAVLGLVKSASYQL  178

Query  595  GQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            G+HGIRVNCVSP  V + ++  A+ M + + +   E    + G           +++ VA
Sbjct  179  GEHGIRVNCVSPGAVATPLICKAFGMGVEEVEKTFESTSCLKG---------VLKLKHVA  229

Query  775  QAVLFLASEDSGFVTGHNLILDGGYT  852
             AVLFLASEDS FVTGHNL++DGG+T
Sbjct  230  NAVLFLASEDSEFVTGHNLVVDGGFT  255



>ref|XP_010243159.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Nelumbo 
nucifera]
Length=263

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 154/256 (60%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITG A GIG   A++ A NG  V+IAD+ DELG  +  SIG     Y HCDV 
Sbjct  6    LEGKVAIITGAASGIGEAAARVFAANGARVVIADVQDELGHKVVASIGEEKASYRHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V   L+  G LD++F+NAGI GP  SI +M ME   + +  N+ GV   IKH
Sbjct  66   DEKQVEEMVGFTLDKYGSLDVLFSNAGILGPLSSILDMDMEDFDNTMVTNVRGVASTIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            A RAM+     G+IIC++S AA +GG A H Y+ SK A++GLVRSA  ELG HGIRVNC+
Sbjct  126  AGRAMVERKIRGSIICTASVAAALGGSAPHAYTTSKHALVGLVRSACSELGAHGIRVNCI  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV + +  +AY +     + +      + G               +A+A LFLAS +
Sbjct  186  SPFGVATPLACNAYNLEPDSMEAVTCAAANLKGTVLKPA--------HIAEAALFLASNE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +++GHNL +DGG+T
Sbjct  238  SVYISGHNLAVDGGFT  253



>ref|XP_008388874.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Malus 
domestica]
Length=309

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 179/273 (66%), Gaps = 18/273 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L+GKVA++TGGARGIG  T +L A +G   +IAD+ D +G  LA S+G    +VHCDVS 
Sbjct  31   LDGKVAIVTGGARGIGEATVRLFARHGAKAVIADVEDAVGTALANSLGPSVTFVHCDVSL  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ ++  +   G+LDIMFNNAG+ G      SI    +++   ++ +N+ G   G+
Sbjct  91   EEDMENLIESTISRYGQLDIMFNNAGVLGNQSKHKSIMNFDVDEFDRVMRVNVRGAALGM  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+A G GG II ++S A + GGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  151  KHAARVMVARGIGGCIISTASVAGVAGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  210

Query  619  CVSPHGVPSEMLVSAYRM--------ILGKTDV---MAEEVGKI--VGErgsllrgrggr  759
            C+SP GV + MLV+A+RM            TD+     +EV K+       + L+G+  R
Sbjct  211  CISPFGVATSMLVNAWRMSSDGDDEDEEECTDLGMPCEQEVEKMEEFVRGLANLKGQTLR  270

Query  760  MEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  271  TKDIAEAALYLASDESKYVSGHNLVVDGGITTS  303



>gb|AHH81852.1| short-chain alcohol dehydrogenase [Perilla citriodora]
 gb|AHH81854.1| short-chain alcohol dehydrogenase [Perilla citriodora]
Length=277

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 172/270 (64%), Gaps = 13/270 (5%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GR  243
            L S    L GKVA+ITGGA GIG  TAKL + +G  V I D+ DELG  + + IG     
Sbjct  7    LSSLTRRLEGKVALITGGAAGIGESTAKLFSKHGAKVAIVDVHDELGHSVIKQIGPSNST  66

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLN  420
            Y+HCDV+ E DV +AV   +   GKLDIMFNNAGIA  P   I + +      +LA+N+ 
Sbjct  67   YIHCDVTNEDDVRNAVDKTVSTYGKLDIMFNNAGIADQPKLRIVDNEKHDFERVLAVNVT  126

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            GV  G+KHAAR MI   +GG II ++S A+ MGG A+H Y+ SK A++GL R++A ELGQ
Sbjct  127  GVFLGMKHAARVMIPA-RGGAIISTASIASGMGGAATHAYTCSKHAVVGLTRNSAIELGQ  185

Query  601  HGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            +GIRVNC+SP+ + S++     R  LG  D   EE+ +++ ++ +L        +D+A A
Sbjct  186  YGIRVNCMSPYALASDL----SRKYLGIED---EELERMMNDKANLKGTTLKA-DDIANA  237

Query  781  VLFLASEDSGFVTGHNLILDGGYTSAVSQM  870
             LFLAS+D+ +V+G NL +DGG+T   S M
Sbjct  238  ALFLASDDAKYVSGQNLFIDGGFTIFNSAM  267



>ref|XP_002463346.1| hypothetical protein SORBIDRAFT_02g042140 [Sorghum bicolor]
 gb|EER99867.1| hypothetical protein SORBIDRAFT_02g042140 [Sorghum bicolor]
Length=301

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 171/259 (66%), Gaps = 9/259 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVAVITGGA GIG  TA     NG  VIIAD+ D+LG  +A  +G    RY HCDV+
Sbjct  33   LAGKVAVITGGASGIGKATAAEFVRNGARVIIADVQDDLGRAVAADLGPDAARYAHCDVT  92

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGG--SIAEMKMEQLASLLAINLNGVVHGI  438
             EA V +AV LA++  G+LD+MFNNAGI G     ++    +     ++A+N+ GV+ G+
Sbjct  93   DEAQVAAAVDLAVQLHGRLDVMFNNAGIGGDMALPALGATDLANFDRVMAVNIRGVLAGV  152

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHP-YSLSKSAILGLVRSAACELGQHGIRV  615
            KHAAR M+   + G+IIC++S+ A++G +A+ P Y +SK+A+LGLVR+ A E+ + G+RV
Sbjct  153  KHAARVMVPR-RAGSIICTASTTAVLGDMAAPPGYCVSKAAVLGLVRAVAAEMARSGVRV  211

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            N +SPH +P+ + ++     L +    AEE  +IV    + + G     ED+A+A L+LA
Sbjct  212  NAISPHIIPTPLAMATMAQWLPEKS--AEERRRIVERDMNEMVGPVLEAEDIARAALYLA  269

Query  796  SEDSGFVTGHNLILDGGYT  852
            S+++ +V GHNL++DGGYT
Sbjct  270  SDEAKYVNGHNLVVDGGYT  288



>ref|XP_004493067.1| PREDICTED: short-chain dehydrogenase reductase 2a-like isoform 
X2 [Cicer arietinum]
Length=331

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 171/259 (66%), Gaps = 10/259 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA     +G  VIIAD   +LG  +A+ +G   +YV CDV+ 
Sbjct  65   LEGKVAIITGSASGLGKATAHEFVQHGAQVIIADTDTKLGPQVAKQLGPSAQYVECDVTV  124

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGP--GGSIAEMKMEQLASLLAINLNGVVHGIK  441
            EA +E AV +A+   GKLDIM+NNAGI GP    SI E+ +++   ++ IN+ G++ GIK
Sbjct  125  EAQIEEAVNVAITNYGKLDIMYNNAGITGPISPPSITELDLDEFDKVMRINVTGIISGIK  184

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI  G G +IIC+SS + + GGL  HPY++SKS I G+V+S A EL   GIRVNC
Sbjct  185  HAARVMIPKGYG-SIICTSSISGLFGGLGPHPYTISKSTIPGVVKSVASELCGVGIRVNC  243

Query  622  VSPHGVPSEM-LVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  +P+ M L    + + G T    E++ ++V   G L   +   + DVA+A L+LAS
Sbjct  244  ISPAAIPTPMSLTQVGKFLPGFTQ---EQIAEVVSGLGVLKGAKCEDI-DVARAALYLAS  299

Query  799  EDSGFVTGHNLILDGGYTS  855
            +++ F++GHNLI+DGG+TS
Sbjct  300  DEAKFISGHNLIVDGGFTS  318



>ref|XP_008782768.1| PREDICTED: sex determination protein tasselseed-2-like, partial 
[Phoenix dactylifera]
Length=274

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 170/266 (64%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA++TGGARGIG  T +L   +G  V+IADI D LG  LA S+     +VHCDV  
Sbjct  3    LEGKVAIVTGGARGIGEATVRLFVRHGAKVVIADIEDYLGESLAASLAPVATFVHCDVGF  62

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGP----GGSIAEMKMEQLASLLAINLNGVVHG  435
            E DVE  V   L   G+LD++ NNAG+ G       SI  +  ++L  ++ +N+ G   G
Sbjct  63   EPDVERLVDRTLARHGRLDVLVNNAGVLGQQAHAAKSILSLDADELDRVMRVNVRGAALG  122

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAARAM+A  + G+I+  +S A +MGG+  H Y+ SK A++GL R+AACELG HGIRV
Sbjct  123  MKHAARAMVAVRRAGSIVSVASVAGVMGGMGPHAYTASKHALVGLTRNAACELGAHGIRV  182

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDV---MAEEVGKI--VGErgsllrgrggrMEDVAQA  780
            NCVSP GV + MLV+A+R      D+    A EV K+       + L+G      DVA+A
Sbjct  183  NCVSPFGVATHMLVNAWRDDGEGVDLGIPSAAEVEKMEEFVRGLANLKGPTLTARDVAEA  242

Query  781  VLFLASEDSGFVTGHNLILDGGYTSA  858
             L+LAS+D+ +V+GHNL++DGG T++
Sbjct  243  ALYLASDDAKYVSGHNLVVDGGVTTS  268



>ref|NP_189570.3| short-chain dehydrogenase reductase 4 [Arabidopsis thaliana]
 sp|F4J2Z7.1|SDR4_ARATH RecName: Full=Short-chain dehydrogenase reductase 4; Short=AtSDR4 
[Arabidopsis thaliana]
 gb|AEE77556.1| short-chain dehydrogenase reductase 4 [Arabidopsis thaliana]
Length=298

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/280 (44%), Positives = 176/280 (63%), Gaps = 18/280 (6%)
 Frame = +1

Query  22   SFEMDRTTKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADIL  201
            SF+  +  KT       +   R  L+GK+A+ITGGA GIGAE  +L   +G  V+I DI 
Sbjct  27   SFQKWKYNKT-------MSGLRQVLDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDIQ  79

Query  202  DELGAPLAESIG---GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIA  372
            +ELG  LA SIG     +  C+V+ E DVE+AVK  +E  GKLD++F+NAG+    GS+ 
Sbjct  80   EELGQNLAVSIGLDKASFYRCNVTDETDVENAVKFTVEKHGKLDVLFSNAGVLEAFGSVL  139

Query  373  EMKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSK  552
            ++ +E     +A+N+ G    IKHAAR+M+A G  G+I+C++S AA +GG   H Y+ SK
Sbjct  140  DLDLEAFDRTMAVNVRGAAAFIKHAARSMVASGTRGSIVCTTSIAAEIGGPGPHSYTASK  199

Query  553  SAILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErg  732
             A+LGL+RSA   LGQ+GIRVN V+P+GV + M  SAY     K   M EE G+ +G   
Sbjct  200  HALLGLIRSACAGLGQYGIRVNGVAPYGVATGM-TSAYNEEAVK---MLEEYGEALGNLK  255

Query  733  sllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYT  852
             ++         +A+A LFLAS+DS +++G NL++DGG++
Sbjct  256  GVVLKA----RHIAEAALFLASDDSVYISGQNLVVDGGFS  291



>emb|CDX78027.1| BnaA09g32220D [Brassica napus]
Length=296

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 179/278 (64%), Gaps = 17/278 (6%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T K+ A +G  V+IAD+    G+ LA+S+
Sbjct  20   EETNSTLFHKR--LEGKVAIITGGAHGIGKATVKIFARHGATVVIADVDATAGSFLAKSL  77

Query  235  GGR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLA  396
                  ++ CDVS EADVE+ V + +   G+LDI+FNNAG+ G      SI +   E+  
Sbjct  78   SSSQVAFISCDVSVEADVENLVNVTVARFGRLDILFNNAGVLGDQKKHKSILDFNAEEFD  137

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ GV  G+KHAA AMI  G  G II  +S A +MGG+  H Y+ SK AI+GL +
Sbjct  138  QVMRVNVRGVGLGMKHAASAMIKRGFKGCIISMASVAGVMGGMGPHAYTASKHAIVGLTK  197

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDV----MAEEVGKIVGErgsllr  744
            +AACELG++GIRVNC+SP GV + MLV+A+R    K DV      EE+ + V    + L+
Sbjct  198  NAACELGKYGIRVNCISPFGVATSMLVNAWR----KGDVGDGDEVEEMEEFV-RSLANLQ  252

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            G   R  D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  253  GETLRATDIAEAALYLASDESKYVNGHNLVVDGGVTTA  290



>ref|XP_008244807.1| PREDICTED: short-chain dehydrogenase reductase 2a [Prunus mume]
Length=307

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 175/273 (64%), Gaps = 20/273 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L+GKVA++TGGARGIG  + +L   +G  VIIAD+ D +G  LA S+     +VHCDVS 
Sbjct  31   LDGKVAIVTGGARGIGEASVRLFTRHGAKVIIADVEDAVGIALANSLSPSVTFVHCDVSL  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ V+  +   G+LDIMFNNAGI G      SI +   ++   ++ +N+ G   G+
Sbjct  91   EEDIENLVESTISRYGQLDIMFNNAGILGNQSKHKSIMDFDTDEFDQVMRVNVRGAALGM  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+  G GG II +SS A + GGL  H Y+ SK AI+GL ++AACELG++GIRVN
Sbjct  151  KHAARVMVPRGNGGCIISTSSVAGVAGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVN  210

Query  619  CVSPHGVPSEMLVSAYR-----------MILGKTDVMAEEVGKIVGErgsllrgrggrM-  762
            C+SP GV + MLV+A+R           M LG      +EV K+      L   +G  + 
Sbjct  211  CISPFGVATSMLVNAWRTSGDDEEEEECMDLGMP--CEQEVEKMEDFVRGLANLKGQTLR  268

Query  763  -EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  269  AKDIAEAALYLASDESKYVSGHNLVVDGGITTS  301



>ref|XP_007026536.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY07038.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=304

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 177/275 (64%), Gaps = 26/275 (9%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GK+A++TGGARGIG  T +L A +G  V+IAD+ D LGA LA S+     +VHCDV  
Sbjct  30   LEGKIAIVTGGARGIGEATVRLFARHGAKVVIADLEDTLGAALANSLSPSVTFVHCDVRL  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   G+LDI+FNNAG+ G      SI +  +++  +++ +N+ G+  GI
Sbjct  90   EEDIENLINSTISRYGRLDILFNNAGVLGNQKKHKSIVDFDVDEFDNVMRVNVRGMALGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAARAMI  G GG II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  150  KHAARAMIPRG-GGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  208

Query  619  CVSPHGVPSEMLVSAYRM---------------ILGKTDVMAEEVGKIVGErgsllrgrg  753
            C+SP GV + MLV+A+R                   +T+ M E V  +       L+G  
Sbjct  209  CISPFGVATSMLVNAWRSHDDDEEEDSINFGIPCQQETEKMEEFVRGLAN-----LKGPT  263

Query  754  grMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             R +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  264  LRAKDIAEAALYLASDESKYVSGHNLVVDGGVTTS  298



>emb|CDY50919.1| BnaC03g72480D [Brassica napus]
Length=273

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 171/268 (64%), Gaps = 18/268 (7%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR-  243
            Q+L S  + L+GKV +ITGGA GIGAE A+L   +G  V+I D+ +ELG  +A SIG   
Sbjct  6    QVLHSFLNRLDGKVVIITGGASGIGAEAARLFTEHGAKVVIVDLQEELGLSVALSIGKEK  65

Query  244  --YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINL  417
              Y HCDV+ E +VE+AVK  +   GKLD++ +NAGI    GS+ +M +EQ   ++++N+
Sbjct  66   VTYYHCDVTNEMEVENAVKFTVGKYGKLDVLLSNAGIMDQPGSVLDMNLEQFDRIMSVNV  125

Query  418  NGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELG  597
             G    IKHAARAM+  G  G+IIC +S AA +GG  +H Y+ SK  +LGLVRSA  +LG
Sbjct  126  RGAAAFIKHAARAMVVRGTRGSIICMTSCAAEIGGSGAHAYTASKHGLLGLVRSACGDLG  185

Query  598  QHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsll---rgrggrMED  768
            ++GIRVN V+P+ V + M  S             EE  + V E  +     +G   ++  
Sbjct  186  KYGIRVNGVAPYAVATSMNSS------------DEETARTVEEYFAAAGILKGVVLKVGH  233

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYT  852
            VAQA LFLAS+DS +V+GHNL++DGGY+
Sbjct  234  VAQAALFLASDDSAYVSGHNLVVDGGYS  261



>ref|XP_009133799.1| PREDICTED: short-chain dehydrogenase reductase 3a-like isoform 
X1 [Brassica rapa]
Length=273

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 171/268 (64%), Gaps = 18/268 (7%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--  240
            Q+L S  + L+GKV +ITGGA GIGAE A+L   +G  V+I D+ +ELG  +A SIG   
Sbjct  6    QVLHSFLNRLDGKVVIITGGASGIGAEAARLFTEHGAKVVIVDLQEELGLSVALSIGKDM  65

Query  241  -RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINL  417
              Y HCDV+ E +VE+AVK  +   GKLD++ +NAGI    GS+ +M +EQ   ++++N+
Sbjct  66   VTYYHCDVTNEMEVENAVKFTVGKYGKLDVLLSNAGIMDQPGSVLDMNLEQFDRIMSVNV  125

Query  418  NGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELG  597
             G    IKHAARAM+  G  G+IIC +S AA +GG  +H Y+ SK  +LGLVRSA  +LG
Sbjct  126  RGAAAFIKHAARAMVEKGTRGSIICMTSCAAEIGGSGAHAYTASKHGLLGLVRSACGDLG  185

Query  598  QHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsll---rgrggrMED  768
            ++GIRVN V+P+ V + M  S             EE  + V E  +     +G   ++  
Sbjct  186  KYGIRVNGVAPYAVATRMNSS------------DEETARTVEEYFAAAGILKGVVLKVGH  233

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYT  852
            VAQA LFLAS+DS +V+GHNL++DGGY+
Sbjct  234  VAQAALFLASDDSAYVSGHNLVVDGGYS  261



>gb|KDO61663.1| hypothetical protein CISIN_1g041914mg [Citrus sinensis]
Length=264

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/267 (47%), Positives = 170/267 (64%), Gaps = 13/267 (5%)
 Frame = +1

Query  64   DQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIG-  237
            D  +C+ ++ L GKVA+ITGGA GIG  TA+L A +G   ++IADI DELG  +A SIG 
Sbjct  3    DSSMCNAKNKLEGKVAIITGGASGIGETTARLFADHGARMIVIADIQDELGRQVATSIGV  62

Query  238  --GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGI-AGPGGSIAEMKMEQLASLLA  408
                YVHCDV+ E  V++ V   ++  G+LDIMF+NAGI +    ++ ++       L A
Sbjct  63   GKCHYVHCDVTNECQVKALVDSTVQNYGQLDIMFSNAGILSSSDQTVLDLDFSAFDRLFA  122

Query  409  INLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAAC  588
            IN+ G+   +KHAAR M+ GG  G+I+C++S A   GG     Y +SK A++GLVRSA+ 
Sbjct  123  INVRGMAACVKHAARVMVEGGVRGSIVCTASVAGSCGGKRRTDYHMSKHAVIGLVRSASV  182

Query  589  ELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMED  768
            +LG HGIRVNCVSPHG+ + +   AY M        A+EV K+  E  + L G   R   
Sbjct  183  QLGVHGIRVNCVSPHGLATPLTCHAYGM-------PADEVEKLF-EPQTPLEGVVLRAGH  234

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGY  849
            VA AVLFLA  DS FVTGH+L++DGG+
Sbjct  235  VADAVLFLACRDSEFVTGHDLVVDGGF  261



>ref|XP_006384780.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP62577.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=275

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 165/257 (64%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITGGARGIG  TA+    +G  V+IAD  DEL   + + +      ++HCDV+
Sbjct  14   LEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLNSESASFIHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIK  441
            KE DVE+AV  A+   GKLD+MFNNAGI G    ++ ++ M +   ++ +NL G   G K
Sbjct  74   KETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVIRVNLVGAFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M    + G+II +SS   I+GG ASH Y+ SK  +LGL+R+AA ELGQ GIRVNC
Sbjct  134  HAARVM-KPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNAAVELGQFGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ V +EM     R  L  TD   +E+        S L+G     EDVA+A L+LASE
Sbjct  193  VSPYTVATEM----SRNFLKMTD---DEIRS----GYSNLKGAILTPEDVAEAALYLASE  241

Query  802  DSGFVTGHNLILDGGYT  852
            DS +V+GHNL++DGG+T
Sbjct  242  DSRYVSGHNLVVDGGHT  258



>ref|XP_008811702.1| PREDICTED: momilactone A synthase-like [Phoenix dactylifera]
Length=301

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 175/274 (64%), Gaps = 7/274 (3%)
 Frame = +1

Query  43   TKTHESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPL  222
            T +     Q   +    L GKVA+ITG A GIG  TA     +G  VIIADI  +LG   
Sbjct  23   TMSQRRQQQHFSTNPGRLAGKVAMITGAASGIGKATATEFINHGAKVIIADIQQQLGEAA  82

Query  223  AESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQL  393
            AE +G    ++ CDV++E+ V +AV LA+   G LDIM+NNAGIAG    SI  + +   
Sbjct  83   AEELGPDATFITCDVTEESQVAAAVDLAVTEHGHLDIMYNNAGIAGSLTPSITSLDLTNF  142

Query  394  ASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLV  573
              ++A+N+  VV GIKHAAR M+   + G I+C++S  AIMGGLA H YS+SK+A+LG V
Sbjct  143  DRIMAVNVRSVVAGIKHAARVMMPR-RAGCILCTASVTAIMGGLAPHGYSISKAAVLGAV  201

Query  574  RSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrg  753
            +SAA EL ++GIRVNC+SPH +P+   +++   +    D  AE + ++V   G L   R 
Sbjct  202  KSAAAELSKYGIRVNCISPHAIPTPFGINSMLKLFPGAD--AERLAEMVYSTGELEGARC  259

Query  754  grMEDVAQAVLFLASEDSGFVTGHNLILDGGYTS  855
              + DVA+A ++LAS+D+ +V+GHNL++DGG+T+
Sbjct  260  EAV-DVARAAVYLASDDAKYVSGHNLVVDGGFTA  292



>ref|XP_002267041.1| PREDICTED: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial 
[Vitis vinifera]
Length=262

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 171/268 (64%), Gaps = 14/268 (5%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIG  237
            TD    +K+  L GKVA+ITGGA GIG  TA+L A +G   V++ADI DELG  +AESIG
Sbjct  2    TDPTPFNKK--LQGKVAIITGGASGIGEATARLFADHGARAVVVADIQDELGRGVAESIG  59

Query  238  ---GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG-SIAEMKMEQLASLL  405
                RY+HCDV+ E  +++ V+  ++  G+LDIMF+NAG+   G  +I E+ +     + 
Sbjct  60   LHRCRYIHCDVTDEQQIKAMVESTVKMFGQLDIMFSNAGVMSMGDQTILELDLSASDKVF  119

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            A+N  G+   +KHAARAM+ GG  G+I+C++S AA +G      Y +SK A+LGLVRSA+
Sbjct  120  AVNARGMAACVKHAARAMVEGGVKGSIVCTASVAATVGNDKFTDYIMSKHAVLGLVRSAS  179

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
             +LG +GIRVNCVSP  V + ML SA++M +       EE  K   E   L      ++ 
Sbjct  180  KQLGAYGIRVNCVSPTAVATPMLCSAFKMGV-------EEAEKFFVEDMDLKGRGAVQVR  232

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGY  849
             V  A LFLAS+DS F+TGHNL +DGG+
Sbjct  233  HVGDAALFLASDDSEFITGHNLAIDGGF  260



>ref|XP_006388114.1| alcohol dehydroge family protein [Populus trichocarpa]
 gb|ERP47028.1| alcohol dehydroge family protein [Populus trichocarpa]
Length=271

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 164/257 (64%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI---GGRYVHCDVS  264
            L GKVA+ITGG+ GIG  TA+L   +G  V+IADI DELG  + + +      ++HCDV+
Sbjct  14   LEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASFIHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            +E DVE+AV  A+   GKLDIMFNNAG  G P  +I E    +   ++  NL G   G K
Sbjct  74   QEKDVENAVNTAVSKYGKLDIMFNNAGTGGTPKTNIIENDKAEFEKIICANLVGAFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   +G +II ++S  AI+GG +SH Y+ SK  +LGL+R+ A ELGQ+GIRVNC
Sbjct  134  HAARVMIPARRG-SIITTASVCAIIGGGSSHAYTSSKHGVLGLMRNTAVELGQYGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ VP+ +  + ++M   +   +   + + V E            ED+A+A L+L S+
Sbjct  193  VSPYAVPTPLFKNFFKMNDDEVSCIYSNLKEAVLEA-----------EDIAEAALYLGSD  241

Query  802  DSGFVTGHNLILDGGYT  852
            +S +V+GHNL++DGG+T
Sbjct  242  ESKYVSGHNLVVDGGFT  258



>gb|KHN40676.1| Sex determination protein tasselseed-2 [Glycine soja]
Length=298

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 172/277 (62%), Gaps = 12/277 (4%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG-  237
            TD         L GKVA++TGGA+GIG  T ++   +G  V+IAD+ D  GA LAE++  
Sbjct  17   TDTTFSPSSKRLEGKVAIVTGGAKGIGEATVRVFVKHGAKVMIADVEDAAGAMLAETLSP  76

Query  238  -GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLL  405
               YVHCDVS E +VE  V   +   G LDIMFNNAG+ G      SI     ++   ++
Sbjct  77   SATYVHCDVSIEKEVEKLVSSTISRYGHLDIMFNNAGVLGNQSKNKSIVNFDPDEFDKVM  136

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
             +N+ GV  GIKHAAR MI  G G  II +SS A +MGGL  H Y+ SK AI+G+ ++ A
Sbjct  137  CVNVKGVALGIKHAARVMIPRGIG-CIISTSSVAGVMGGLGPHAYTASKHAIVGITKNTA  195

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGK-TDV---MAEEVGKIVGErgsllrgrg  753
            CELG++GIRVNC+SP GV + MLV+A+R    + T+      EEV KI      L   RG
Sbjct  196  CELGRYGIRVNCISPFGVATSMLVNAWRPCDDEGTNFGVPFPEEVEKIEEFVRGLANLRG  255

Query  754  grME--DVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
              +   D+A+A L+LAS++S +V+GHNL++DGG TS+
Sbjct  256  PTLRALDIAEAALYLASDESKYVSGHNLVVDGGVTSS  292



>ref|XP_002967778.1| hypothetical protein SELMODRAFT_88869, partial [Selaginella moellendorffii]
 gb|EFJ31125.1| hypothetical protein SELMODRAFT_88869, partial [Selaginella moellendorffii]
Length=278

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 162/253 (64%), Gaps = 4/253 (2%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            + GKVA++TGGA GIGA T K    +G +VIIAD+ D  G  LA   G  Y HCDVS+E+
Sbjct  2    IKGKVALVTGGASGIGAATVKKFRAHGAEVIIADVQDSRGEALAAETGAHYTHCDVSQES  61

Query  274  DVESAVKLALEWRGKLDIMFNNAGI---AGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             V +AV LA+   G L IMFNNAGI     P  SIA + M  L ++LA+N+ GV HG+KH
Sbjct  62   QVAAAVDLAVSKFGSLGIMFNNAGIISGPKPADSIARLDMSDLDAVLAVNVRGVAHGVKH  121

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR M+     G+II ++S A I+ G A HPY++SK A++G+ +SAA EL  HG+RVNC+
Sbjct  122  AARVMVPR-NSGSIITTASIAHIISGSALHPYTISKHAVVGITKSAASELAFHGVRVNCI  180

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  V +E+    +  ++   +   +      G+ G  LR      E++A+A LFLAS++
Sbjct  181  SPAAVVTEIATKFWENLVPVAEAKLDMQAAFSGKPGFDLRRALMEPEEIAEAALFLASDE  240

Query  805  SGFVTGHNLILDG  843
            S FV+GH+L++DG
Sbjct  241  SRFVSGHDLVVDG  253



>ref|XP_008379054.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Malus 
domestica]
Length=303

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/289 (43%), Positives = 178/289 (62%), Gaps = 22/289 (8%)
 Frame = +1

Query  58   STDQMLCSK-RSF----------LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILD  204
            S +  LC + R F          L GKVA+ITG A G+G  TA     +G  VI+AD   
Sbjct  13   SCNAFLCKRARPFSTRGAAGHGRLQGKVAIITGSASGLGKATAHEFIRHGAHVIVADSDS  72

Query  205  ELGAPLAESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIA  372
            ELG  +A  +G    +V CDV+ E+ +  AV+ A+   GKLDIM+NNAGI GP    SI 
Sbjct  73   ELGPQVAXELGPAAHFVQCDVAVESQIAEAVETAMARHGKLDIMYNNAGITGPAFPPSIV  132

Query  373  EMKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSK  552
            ++ +E+   ++ +N+ G V GIKHAAR MI  G G +I+C+SS A ++GG+  HPYS+SK
Sbjct  133  DLNLEEFDRVIRVNVRGAVAGIKHAARVMIPAGSG-SILCTSSIAGLLGGVGPHPYSISK  191

Query  553  SAILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSA-YRMILGKTDVMAEEVGKIVGEr  729
              I GLV+S A EL ++GIRVNC+SP  +P+ M+V   +++  G  +   +E+   +GE 
Sbjct  192  FTIPGLVKSLASELCRNGIRVNCISPSPIPTSMVVREIWKLYPGAPEDQVKEIVNGLGEL  251

Query  730  gsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
                        DVAQA ++LAS+++ +VTGHNL++DGG+TS  S +SF
Sbjct  252  KGAKCEEI----DVAQAAVYLASDEAKYVTGHNLVVDGGFTSFKS-LSF  295



>ref|XP_011019045.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 173/270 (64%), Gaps = 14/270 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L G+VA++TGGARGIG  T +L A  G  V+IAD+ D LG  L  S+     +VHCDV  
Sbjct  33   LEGRVAIVTGGARGIGEATVRLFARQGAKVVIADVEDALGTSLVNSLAPSVSFVHCDVGL  92

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   GKLDI+FNNAG+ G      SI +  +++   ++ +N+ G+  GI
Sbjct  93   EKDIENLINSTISQYGKLDILFNNAGVLGNQSKNKSIVDFDVDEFDRVMHVNVRGMALGI  152

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI  G GG II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  153  KHAARVMIPRG-GGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  211

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVM------AEEVGKIVGErgsllrgrggrM--EDVA  774
            C+SP GV + MLV+A+R    + D +       +EV K+      L   +G  +   D+A
Sbjct  212  CISPFGVATSMLVNAWRSCGEEEDSLNFGLPSEKEVEKMEDFVRGLANLKGPTLRARDIA  271

Query  775  QAVLFLASEDSGFVTGHNLILDGGYTSAVS  864
            +A L+LAS++S +V+GHNL++DGG T++ +
Sbjct  272  EAALYLASDESKYVSGHNLVVDGGITTSTN  301



>ref|XP_011028706.1| PREDICTED: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial-like 
[Populus euphratica]
Length=264

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 166/266 (62%), Gaps = 16/266 (6%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIGG--  240
            M C  +  +  KVA++TGGA GIG  TA L A NG   V+IAD+ DE G  LAESIG   
Sbjct  1    MACQNK--VQDKVAIVTGGASGIGEATALLFAENGARAVVIADVQDERGKKLAESIGSDR  58

Query  241  -RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAG-IAGPGGSIAEMKMEQLASLLAIN  414
              ++HCDV  E  V+S V+  +   G LDIMF NAG ++    ++ +  ++    L A+N
Sbjct  59   STFIHCDVIDETQVKSLVESTVALYGHLDIMFCNAGTLSFDKQTVVDFDLDMYEKLFAVN  118

Query  415  LNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACEL  594
            + GV   +KHAARAM+ GG+ G+IIC++S AA  GG     Y +SK A+LGLV+ A+ +L
Sbjct  119  VRGVAASVKHAARAMVEGGRKGSIICTASVAATTGGSIHTDYVMSKCAVLGLVKCASYQL  178

Query  595  GQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            G+HGIRVNCVSP  V + ++  A+ M + + +   E    + G           +++ VA
Sbjct  179  GEHGIRVNCVSPGAVATPLICKAFGMGVEEVEKTFESTSCLKG---------VLKLKHVA  229

Query  775  QAVLFLASEDSGFVTGHNLILDGGYT  852
             AVLFLASEDS FVTGHNL++DGG+T
Sbjct  230  NAVLFLASEDSEFVTGHNLVVDGGFT  255



>ref|XP_008231035.1| PREDICTED: zerumbone synthase-like isoform X2 [Prunus mume]
Length=302

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/297 (43%), Positives = 176/297 (59%), Gaps = 21/297 (7%)
 Frame = +1

Query  31   MDRTTKTHESTDQMLCSKRSF----------LNGKVAVITGGARGIGAETAKLLAGNGVD  180
            + R  K +   D +L   R F          L GKVA+ITG A G+G  TA      G  
Sbjct  5    LAREFKLNSCNDFLLKRTRLFSTRAGGGHGRLQGKVALITGSASGLGKATAHEFIQQGAH  64

Query  181  VIIADILDELGAPLAESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG  354
            VIIAD   ELG  +A+ +G    +V CDVS E+ +  AV+ A+   GKLDIM+NNAGI G
Sbjct  65   VIIADTDSELGQQVAKELGPAAHFVQCDVSVESQIAEAVETAVARHGKLDIMYNNAGITG  124

Query  355  PG--GSIAEMKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLA  528
            P    SIA++ +E+   ++ +N+ G V G+KHAAR M+  G  G+I+C+SS + I+GGL 
Sbjct  125  PAFPPSIADLDLEEFDRVMRVNVRGAVAGMKHAARVMVPAG-AGSILCTSSISGILGGLG  183

Query  529  SHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAY-RMILGKTDVMAEE  705
             HPYS+SK  I GLV+S A EL + G+RVNC+SP  +P+EM V    +   G T     E
Sbjct  184  PHPYSVSKFTIPGLVKSVASELCRSGVRVNCISPGPIPTEMSVREIGQFYPGATREQVIE  243

Query  706  VGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            +   VGE            +DVAQA ++LAS+++ +VTGHNL++DGG+T     +SF
Sbjct  244  IVNGVGELKGAKCEE----KDVAQAAVYLASDEAKYVTGHNLVVDGGFT-CFKTLSF  295



>ref|XP_009115857.1| PREDICTED: short-chain dehydrogenase reductase 2a [Brassica rapa]
Length=296

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 178/278 (64%), Gaps = 17/278 (6%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T +L   +G  V+IAD+    G+ LA+S+
Sbjct  20   EETNSTLFHKR--LEGKVAIITGGAHGIGKATVQLFTRHGATVVIADVDATAGSFLAKSL  77

Query  235  GGR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLA  396
                  ++ CDVS EADVE+ V + +   G+LDI+FNNAG+ G      SI +   E+  
Sbjct  78   SSSQVAFISCDVSVEADVENLVNVTVARFGRLDILFNNAGVLGDQKKHKSILDFNTEEFD  137

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ GV  G+KHAA AMI  G  G II  +S A +MGG+  H Y+ SK AI+GL +
Sbjct  138  QVMRVNVRGVGLGMKHAASAMIKRGFKGCIISMASVAGVMGGMGPHAYTASKHAIVGLTK  197

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDV----MAEEVGKIVGErgsllr  744
            +AACELG++GIRVNC+SP GV + MLV+A+R    K DV      EE+ + V    + L+
Sbjct  198  NAACELGKYGIRVNCISPFGVATSMLVNAWR----KGDVGDGDEVEEMEEFV-RSLANLQ  252

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            G   R  D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  253  GETLRATDIAEAALYLASDESKYVNGHNLVVDGGVTTA  290



>ref|XP_003534665.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Glycine 
max]
Length=301

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 170/280 (61%), Gaps = 15/280 (5%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG-  237
            TD         L GKVA++TGGARGIG  T ++   +G  V+IAD+ D  G  LAE++  
Sbjct  17   TDTTFSPSSKRLEGKVAIVTGGARGIGEATVRVFVKHGAKVVIADVEDAAGGMLAETLSP  76

Query  238  -GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLL  405
               YVHCDVS E +VE+ +   +   G LDIMFNNAG+ G      SI     ++   ++
Sbjct  77   SATYVHCDVSIEKEVENLISSTISRYGHLDIMFNNAGVLGNQSKNKSIVNFDPDEFDKVM  136

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
             +N+ GV  GIKHAAR MI  G G  I+ +SS A +MGGL  H Y+ SK AI+G+ ++ A
Sbjct  137  CVNVKGVALGIKHAARVMIPRGVG-CIVSTSSVAGVMGGLGPHAYTASKHAIVGITKNTA  195

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTD-------VMAEEVGKIVGErgsllr  744
            CELG++GIRVNC+SP GV + MLV+A++      D          EEV KI      L  
Sbjct  196  CELGRYGIRVNCISPFGVATSMLVNAWKPCGDGDDEGINFGVPFPEEVEKIEEFVRGLAN  255

Query  745  grggrME--DVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             RG  +   D+AQA L+LAS++S +V+GHNL++DGG TS+
Sbjct  256  LRGPTLRALDIAQAALYLASDESKYVSGHNLVVDGGVTSS  295



>ref|XP_008665711.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Zea mays]
 ref|XP_008665712.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Zea mays]
 tpg|DAA52318.1| TPA: hypothetical protein ZEAMMB73_093594 [Zea mays]
Length=262

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 168/260 (65%), Gaps = 12/260 (5%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHC  255
             +  L+GKVA++TGGA GIG   A+L A +G  V+IAD+ D LG  +A S+G R  Y  C
Sbjct  2    SKPRLDGKVAIVTGGASGIGEAAARLFASSGATVVIADVQDALGEAVAASVGPRCAYARC  61

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHG  435
            DV+ EA VE+ V  A+   G+LD+M +NAG+  P GS+ +M + +L  ++A+N  G    
Sbjct  62   DVTDEAQVEATVARAVAAHGRLDVMLSNAGVLLPTGSVMDMDLAELDRVMAVNFRGAAAC  121

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAARAM +G  GG I+C++S A++ GG     Y+ SK A+LGLVR+AA ELG+HG+RV
Sbjct  122  VKHAARAMASG--GGAIVCTASVASLQGGFGPASYTASKHALLGLVRAAAGELGRHGVRV  179

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP GV + +  S   M +G  ++ A  V   V +   L        EDVA+A LFLA
Sbjct  180  NCVSPGGVATPL--SCALMGVGPRELEAMTVPHNVLQGKVLRA------EDVAEAALFLA  231

Query  796  SEDSGFVTGHNLILDGGYTS  855
            S+ + F++GHNL++DG  T+
Sbjct  232  SDQAAFISGHNLVVDGATTA  251



>ref|XP_004151171.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Cucumis 
sativus]
 gb|KGN58243.1| hypothetical protein Csa_3G598890 [Cucumis sativus]
Length=297

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 169/259 (65%), Gaps = 10/259 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA+     G  VIIADI   LG  +AE +G   ++V CDV+ 
Sbjct  34   LEGKVALITGAANGLGQATAQEFVDQGAHVIIADIDTTLGPQVAEQLGHTAKFVECDVAL  93

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E++V +AV  A+   GKLDIM+NNAGI GP    SIAE+ +     ++ +N+ GVV GIK
Sbjct  94   ESEVAAAVNFAVTHHGKLDIMYNNAGITGPAVPPSIAELDLADFDRVMNVNVRGVVAGIK  153

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M+  G  G+I+C+SS + +MGGL  HPYS+SK AI G+VRSAA EL + G+RVNC
Sbjct  154  HAARVMVPAG-CGSILCTSSISGLMGGLGPHPYSISKHAIPGIVRSAATELCRSGVRVNC  212

Query  622  VSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  V + M V     M  G   V  EE+  I+     +L+G      DVA+A LFLA 
Sbjct  213  ISPAPVATAMAVKGIGEMYKG---VSKEEIVGII-NGLGVLKGAICEEADVAKAALFLAC  268

Query  799  EDSGFVTGHNLILDGGYTS  855
            +DS ++TGHNL++DGG+TS
Sbjct  269  DDSKYITGHNLVVDGGFTS  287



>ref|NP_001118737.1| short-chain dehydrogenase reductase 4 [Arabidopsis thaliana]
 gb|AEE77557.1| short-chain dehydrogenase reductase 4 [Arabidopsis thaliana]
Length=260

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 168/256 (66%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GK+A+ITGGA GIGAE  +L   +G  V+I DI +ELG  LA SIG     +  C+V+
Sbjct  6    LDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDIQEELGQNLAVSIGLDKASFYRCNVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E DVE+AVK  +E  GKLD++F+NAG+    GS+ ++ +E     +A+N+ G    IKH
Sbjct  66   DETDVENAVKFTVEKHGKLDVLFSNAGVLEAFGSVLDLDLEAFDRTMAVNVRGAAAFIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR+M+A G  G+I+C++S AA +GG   H Y+ SK A+LGL+RSA   LGQ+GIRVN V
Sbjct  126  AARSMVASGTRGSIVCTTSIAAEIGGPGPHSYTASKHALLGLIRSACAGLGQYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P+GV + M  SAY     K   M EE G+ +G    ++         +A+A LFLAS+D
Sbjct  186  APYGVATGM-TSAYNEEAVK---MLEEYGEALGNLKGVVLKA----RHIAEAALFLASDD  237

Query  805  SGFVTGHNLILDGGYT  852
            S +++G NL++DGG++
Sbjct  238  SVYISGQNLVVDGGFS  253



>emb|CDX73704.1| BnaC08g22990D [Brassica napus]
Length=306

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 179/278 (64%), Gaps = 17/278 (6%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T +L A +G  V+IAD+    G+ LA+S+
Sbjct  20   EETNSTLFHKR--LEGKVAIITGGAHGIGKATVQLFARHGATVVIADVDATAGSFLAKSL  77

Query  235  GGR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLA  396
                  ++ CDVS EADVE+ V + +   G+LDI+FNNAG+ G      SI +   E+  
Sbjct  78   SSSQVAFISCDVSVEADVENLVNVTMARCGRLDILFNNAGVLGDQKKHKSILDFNAEEFD  137

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ GV  G+KHAA AMI  G  G II  +S A +MGG+  H Y+ SK AI+GL +
Sbjct  138  QVMRVNVRGVGLGMKHAASAMIKRGFKGCIISMASVAGVMGGMGPHAYTASKHAIVGLTK  197

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDV----MAEEVGKIVGErgsllr  744
            +AACELG++GIRVNC+SP GV + MLV+A+R    K DV      EE+ + V    + L+
Sbjct  198  NAACELGKYGIRVNCISPFGVATSMLVNAWR----KGDVGDGDEVEEMEEFV-RSLANLK  252

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            G   R  D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  253  GETLRPTDIAEAALYLASDESKYVNGHNLVVDGGVTTA  290



>ref|XP_007134614.1| hypothetical protein PHAVU_010G061700g [Phaseolus vulgaris]
 gb|ESW06608.1| hypothetical protein PHAVU_010G061700g [Phaseolus vulgaris]
Length=308

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 173/275 (63%), Gaps = 23/275 (8%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA++TGGARGIG  T ++   NG  V+IAD+ D LG  LAE++     YVHCDVS 
Sbjct  31   LEGKVAIVTGGARGIGEATVRVFVKNGARVVIADVEDALGTMLAETLAPSATYVHCDVSV  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E +VE+ V   +   G++DIMFNNAG+ G      SI      +   ++ +N+ G+  GI
Sbjct  91   EEEVENLVSSTVSRYGQVDIMFNNAGVLGNQSKNKSILNFDPNEFDRVMQVNVKGMALGI  150

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAARAMI  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  151  KHAARAMIPKGIG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  209

Query  619  CVSPHGVPSEMLVSAYRMILGKTD-------------VMAEEVGKIVGErgsllrgrggr  759
            C+SP GV + MLV+A+R   G  D                EEV K+ G    L   +G  
Sbjct  210  CISPFGVATNMLVNAWRS--GGCDGEEGDDEGINFGLPFQEEVEKMEGFVRGLANLKGQT  267

Query  760  M--EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            +  +D+A+A L+LAS++S +V+GHNL++DGG TS+
Sbjct  268  LRAKDIAEAALYLASDESKYVSGHNLVVDGGVTSS  302



>ref|XP_004136143.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Cucumis 
sativus]
 gb|KGN45053.1| hypothetical protein Csa_7G414500 [Cucumis sativus]
Length=265

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 163/256 (64%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            LNGKVA+ITGGA GIG ETA++ A NG  V+IADI DELG  +A  IG     + HCDV 
Sbjct  6    LNGKVALITGGASGIGEETARVFAENGAIVVIADIQDELGEKVAREIGENKASFHHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E DVE  VK  +E  G LDI+F+NA + GP   I E+ ME+  + +  N+ GV   IKH
Sbjct  66   NEEDVEKTVKFTVEKHGVLDILFSNAAVMGPLTGILELNMEEFENTMRSNVKGVTATIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AA  M+     G+IIC++S AA +GG+    Y+++K+A++G+V++A  ELG++GIRVN V
Sbjct  126  AAGEMVKRKTRGSIICTASVAATLGGVGPFGYTVAKNAVVGVVKAACGELGKYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + M   +Y M + + +     +  + G               VA+AVLFLAS++
Sbjct  186  SPYGVATPMTCGSYNMSVEEAEEGTSALANLKG--------IVLNCRHVAEAVLFLASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+GHNL +DGG+T
Sbjct  238  SVYVSGHNLAVDGGFT  253



>ref|XP_011032578.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Populus 
euphratica]
Length=305

 Score =   213 bits (543),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/281 (44%), Positives = 177/281 (63%), Gaps = 15/281 (5%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            +ST+   CS    L G+VAV+TGGARGIG  T +L A +G  V+IAD+ D LG  +A S+
Sbjct  21   KSTENSPCSP-GRLEGRVAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGTLVANSL  79

Query  235  GGR--YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLAS  399
                 +VHCDVS E D+E+ +   +   GKLD++FNNAG+ G      SI     E+   
Sbjct  80   APSVSFVHCDVSLEGDIENLINSTVSHYGKLDVLFNNAGVLGNQSKNKSIVNFDAEEFDR  139

Query  400  LLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRS  579
            ++ +N+ GV  GIKHAAR MI  G G  II ++S A +MGGL  H Y+ SK AI+GL ++
Sbjct  140  VMHVNVRGVALGIKHAARVMIPRGVG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKN  198

Query  580  AACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVM------AEEVGKIVGErgsll  741
             ACELG++GIRVNC+SP GV + MLV+A+R    + D +       +EV K+      L 
Sbjct  199  TACELGRYGIRVNCISPFGVATSMLVNAWRSGGEEEDCLNFGLPSEKEVEKMEDFVRGLA  258

Query  742  rgrggrM--EDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
              +G  +   D+A+A L+LAS++S +V+GHNL++DGG T+ 
Sbjct  259  NLKGPTLRARDIAEAALYLASDESKYVSGHNLVVDGGITTT  299



>ref|XP_010507925.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Camelina 
sativa]
Length=257

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 170/256 (66%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L+GK+ +ITGGA GIGAE+ +L   +G  V+I D+ DELG  LA SIGG    Y HCDV+
Sbjct  6    LDGKIVIITGGASGIGAESVRLFTEHGARVVIVDVQDELGQNLAASIGGGKASYYHCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E +VE+AVK  +   GKLD++F+NAG+  P  SI ++ +++L  + A+NL G    IKH
Sbjct  66   NETEVENAVKFTVHKHGKLDVLFSNAGVIEPFASILDLNLDELDRIFAVNLRGAAAFIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+  G  G+I+C++S AA + G A H Y+ SK  +LGL++SA+  LGQ+GIRVN V
Sbjct  126  AARAMVEKGTRGSIVCTTSVAAEISGTAPHGYTASKHGLLGLIKSASGGLGQYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P GV + ++ + +++   + +V+ E          + L+G   +   VA+A LFLAS++
Sbjct  186  APFGVATPLVCNGFKI---EANVVEENT-----LASANLKGIVLKARHVAEAALFLASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+G NL +DGGY+
Sbjct  238  SAYVSGQNLAVDGGYS  253



>ref|XP_007026535.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY07037.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=306

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/278 (45%), Positives = 180/278 (65%), Gaps = 21/278 (8%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVH  252
            SKR  L GK+A++TGGARGIGA T +L A +G  V+IAD+ D+ G  LA+S+     +VH
Sbjct  26   SKR--LEGKIAIVTGGARGIGAATVRLFAIHGAKVVIADVEDKAGTALADSLDPWVTFVH  83

Query  253  CDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNG  423
            CDVS E D+E+ +   +   G++DI+FNNAG+ G      SI +  +E+   ++ +N+ G
Sbjct  84   CDVSLEGDIENLIDSIILRYGRIDILFNNAGVLGDQKKHKSIVDFDIEEFDRVMRVNVRG  143

Query  424  VVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQH  603
            V  G+KHAAR MI  G GG II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++
Sbjct  144  VALGMKHAARVMIPKG-GGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRY  202

Query  604  GIRVNCVSPHGVPSEMLVSAYRMILGKTD-----------VMAEEVGKI--VGErgsllr  744
            GIRVNC+SP GV + MLV+A+R      D              +EV K+       + L+
Sbjct  203  GIRVNCISPFGVATSMLVNAWRSSAASDDEEEGERMNWGSPFEQEVEKMEEFVRGLASLK  262

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            G   R +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  263  GPTLRAKDIAEAALYLASDESKYVSGHNLVVDGGVTTS  300



>ref|XP_002533789.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF28591.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=303

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/270 (45%), Positives = 174/270 (64%), Gaps = 16/270 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GKVA++TGGARGIG  T +L A +G  V+IAD+ D  G  LA S+     +VHCDVS+
Sbjct  29   LEGKVAIVTGGARGIGEATVRLFAKHGAKVVIADVEDTPGTILANSLSPFVTFVHCDVSQ  88

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   G+LDI+FNNAG+ G      SI E  +++   ++ +N+ GV  GI
Sbjct  89   EEDIENLINSTVSHYGRLDILFNNAGLLGNQPKNKSILEFDVDEFDRVMRVNVKGVALGI  148

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  149  KHAARVMIPRGVG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  207

Query  619  CVSPHGVPSEMLVSAYRMILGKTD--------VMAEEVGKIVGErgsllrgrggrM--ED  768
            C+SP GV + MLV+A+R    + D           +EV K+      L   +G  +  +D
Sbjct  208  CISPFGVATSMLVNAWRSSDDQEDDECMNFGLPCEQEVEKMEEFVRGLANLKGTTLRGKD  267

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            +A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  268  IAEAALYLASDESKYVSGHNLVVDGGITTS  297



>ref|XP_010921066.1| PREDICTED: LOW QUALITY PROTEIN: sex determination protein tasselseed-2-like 
[Elaeis guineensis]
Length=301

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/266 (46%), Positives = 169/266 (64%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GKVA++TGGARGIG  T +L   +G  V+IADI D LG  LA S+     +VHCDV  
Sbjct  30   LEGKVAIVTGGARGIGEATVRLFVRHGAKVVIADIEDCLGESLAASLAPAVTFVHCDVGS  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG----PGGSIAEMKMEQLASLLAINLNGVVHG  435
            E DVE  V   L   G+LD++ NNAG+ G       SI     ++L  ++ +N+ G   G
Sbjct  90   EPDVERLVDRTLARHGRLDVLVNNAGVLGRQAPEAKSILAFDADELDLVMRVNVRGAALG  149

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAARAM+AG + G+I+  +S A +MGG+  H Y+ SK A++GL ++AACELG HGIRV
Sbjct  150  MKHAARAMLAGRRAGSIVSVASVAGVMGGMGPHAYTASKHALVGLTKNAACELGAHGIRV  209

Query  616  NCVSPHGVPSEMLVSAYR-----MILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            NCVSP GV + MLVSA+R     + LG       E  +      + L+G    + DVA+A
Sbjct  210  NCVSPFGVATHMLVSAWRDGDEGVDLGIPSAAEVEKMEEFVRGLANLKGPTLTVWDVAEA  269

Query  781  VLFLASEDSGFVTGHNLILDGGYTSA  858
             L+LAS+D+ +V+GHNL++DGG T++
Sbjct  270  ALYLASDDAKYVSGHNLVVDGGVTTS  295



>ref|XP_009133800.1| PREDICTED: short-chain dehydrogenase reductase 3a-like isoform 
X2 [Brassica rapa]
Length=265

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/264 (46%), Positives = 168/264 (64%), Gaps = 18/264 (7%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYV  249
            S  S L+GKV +ITGGA GIGAE A+L   +G  V+I D+ +ELG  +A SIG     Y 
Sbjct  2    SGSSRLDGKVVIITGGASGIGAEAARLFTEHGAKVVIVDLQEELGLSVALSIGKDMVTYY  61

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDV+ E +VE+AVK  +   GKLD++ +NAGI    GS+ +M +EQ   ++++N+ G  
Sbjct  62   HCDVTNEMEVENAVKFTVGKYGKLDVLLSNAGIMDQPGSVLDMNLEQFDRIMSVNVRGAA  121

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
              IKHAARAM+  G  G+IIC +S AA +GG  +H Y+ SK  +LGLVRSA  +LG++GI
Sbjct  122  AFIKHAARAMVEKGTRGSIICMTSCAAEIGGSGAHAYTASKHGLLGLVRSACGDLGKYGI  181

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsll---rgrggrMEDVAQA  780
            RVN V+P+ V + M  S             EE  + V E  +     +G   ++  VAQA
Sbjct  182  RVNGVAPYAVATRMNSS------------DEETARTVEEYFAAAGILKGVVLKVGHVAQA  229

Query  781  VLFLASEDSGFVTGHNLILDGGYT  852
             LFLAS+DS +V+GHNL++DGGY+
Sbjct  230  ALFLASDDSAYVSGHNLVVDGGYS  253



>ref|XP_009133801.1| PREDICTED: short-chain dehydrogenase reductase 3a-like isoform 
X3 [Brassica rapa]
Length=264

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 167/261 (64%), Gaps = 18/261 (7%)
 Frame = +1

Query  88   SFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCD  258
            S L+GKV +ITGGA GIGAE A+L   +G  V+I D+ +ELG  +A SIG     Y HCD
Sbjct  4    SRLDGKVVIITGGASGIGAEAARLFTEHGAKVVIVDLQEELGLSVALSIGKDMVTYYHCD  63

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            V+ E +VE+AVK  +   GKLD++ +NAGI    GS+ +M +EQ   ++++N+ G    I
Sbjct  64   VTNEMEVENAVKFTVGKYGKLDVLLSNAGIMDQPGSVLDMNLEQFDRIMSVNVRGAAAFI  123

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAARAM+  G  G+IIC +S AA +GG  +H Y+ SK  +LGLVRSA  +LG++GIRVN
Sbjct  124  KHAARAMVEKGTRGSIICMTSCAAEIGGSGAHAYTASKHGLLGLVRSACGDLGKYGIRVN  183

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsll---rgrggrMEDVAQAVLF  789
             V+P+ V + M  S             EE  + V E  +     +G   ++  VAQA LF
Sbjct  184  GVAPYAVATRMNSS------------DEETARTVEEYFAAAGILKGVVLKVGHVAQAALF  231

Query  790  LASEDSGFVTGHNLILDGGYT  852
            LAS+DS +V+GHNL++DGGY+
Sbjct  232  LASDDSAYVSGHNLVVDGGYS  252



>ref|XP_011006659.1| PREDICTED: momilactone A synthase-like [Populus euphratica]
Length=275

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 164/257 (64%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITGGARGIG  TA+    +G  V+IAD  DEL   + + +      ++HCD++
Sbjct  14   LEGKVALITGGARGIGESTARHFFKHGAKVVIADTQDELAHSVCKDLNSESASFIHCDIT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIK  441
            KE DVE+AV  A+   GKLD+MFNNAGI G    ++ ++ M +   ++ +NL G   G K
Sbjct  74   KETDVENAVNTAISRHGKLDVMFNNAGIVGVVKTNMVDVSMSEFEEVIRVNLVGPFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M    + G+II +SS   I+GG ASH Y+ SK  +LGL+R+ A ELGQ GIRVNC
Sbjct  134  HAARVM-KPARQGSIITTSSVCGILGGFASHAYTSSKHGVLGLMRNTAVELGQFGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ V +EM     R  L  TD   +E+        S L+G     EDVA+A L+LAS+
Sbjct  193  VSPYTVATEM----SRNFLKMTD---DEIRS----GYSNLKGAILTPEDVAEAALYLASD  241

Query  802  DSGFVTGHNLILDGGYT  852
            DS +V+GHNL++DGGYT
Sbjct  242  DSRYVSGHNLVVDGGYT  258



>ref|XP_011006635.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 165/257 (64%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITGG+ GIG   A+L A +G  V+IAD+ DELG  + E +      +VHCDV+
Sbjct  14   LEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKNESASFVHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            +E DVE+AV  A+   GKLDIMFNNAG+ G P  +I +    +   ++++N+ G   G K
Sbjct  74   QEKDVENAVNTAVSKHGKLDIMFNNAGVVGSPKPNILDNDKAEFEKVISVNIVGAFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   +G +II ++S    +GG+ASH Y+ SK  ++GL+R+ A ELGQHGIRVNC
Sbjct  134  HAARVMIPARRG-SIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ V + +    +++   K + +   + + V            + EDVA+A LFL S+
Sbjct  193  VSPYLVSTPLAKDFFKLDDNKVNRVYSNLKEAV-----------LKAEDVAEAALFLGSD  241

Query  802  DSGFVTGHNLILDGGYT  852
            +S +V+GHNLI+DGG+T
Sbjct  242  ESKYVSGHNLIVDGGFT  258



>ref|XP_011079747.1| PREDICTED: zerumbone synthase isoform X2 [Sesamum indicum]
Length=273

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 169/265 (64%), Gaps = 7/265 (3%)
 Frame = +1

Query  70   MLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--  243
            ML +  S L GKVA+ITG A GIG ETA     +G  V++ADI  + G   A  +G    
Sbjct  1    MLRAGFSKLEGKVALITGAASGIGKETATKFINDGAKVVLADIQKDQGQQTARELGPNAA  60

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLN  420
            ++ CDV++E+DV  AV   +   G+LDIM+NNAGIA     S+ ++ +     ++AIN+ 
Sbjct  61   FIPCDVTRESDVSQAVDFTVSKHGQLDIMYNNAGIACHTPPSVVDLDLATFDRVMAINVR  120

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            GV+ G+KHAAR MI   + G I+C++S   +MGGLA H YS+SKS+++G+V+SAA EL  
Sbjct  121  GVLAGLKHAARVMIPR-QSGVILCTASVTGLMGGLAQHTYSISKSSVIGIVKSAASELCS  179

Query  601  HGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            HGIR+NC+SP  +P+  ++   +      D  A+++ K+V +   L         D+A A
Sbjct  180  HGIRINCISPMAIPTPFVMEELKKYYPGVD--AQKLVKMVHDFSVLRGAFCEP-SDIANA  236

Query  781  VLFLASEDSGFVTGHNLILDGGYTS  855
             LFLAS+D+ FV+GHNL++DGG+TS
Sbjct  237  ALFLASDDAKFVSGHNLVVDGGFTS  261



>ref|XP_006450496.1| hypothetical protein CICLE_v10009218mg [Citrus clementina]
 gb|ESR63736.1| hypothetical protein CICLE_v10009218mg [Citrus clementina]
Length=264

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 170/267 (64%), Gaps = 13/267 (5%)
 Frame = +1

Query  64   DQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIG-  237
            D  +C+ ++ L GKVA+ITGGA GIG  TA+L A +G   ++IADI +ELG  +A SIG 
Sbjct  3    DSSMCNAKNKLEGKVAIITGGASGIGETTARLFADHGARMIVIADIQEELGRQVATSIGV  62

Query  238  --GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGI-AGPGGSIAEMKMEQLASLLA  408
                YVHCDV+ E  V++ V   ++  G+LDIMF+NAGI +    ++ ++       L A
Sbjct  63   GKCHYVHCDVTNECQVKALVDSTVQNYGQLDIMFSNAGILSSSDQTVLDLDFSAFDRLFA  122

Query  409  INLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAAC  588
            IN+ G+   +KHAAR M+ GG  G+I+C++S A   GG     Y +SK A++GLVRSA+ 
Sbjct  123  INVRGMAACVKHAARVMVEGGVRGSIVCTASVAGSCGGKRRTDYHMSKHAVIGLVRSASV  182

Query  589  ELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMED  768
            +LG HGIRVNCVSPHG+ + +   AY M        A+EV K+  E  + L G   R   
Sbjct  183  QLGVHGIRVNCVSPHGLATPLTCHAYGM-------PADEVEKLF-EPQTPLEGVVLRAGH  234

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGY  849
            VA AVLFLA  DS FVTGH+L++DGG+
Sbjct  235  VADAVLFLACRDSEFVTGHDLVVDGGF  261



>ref|XP_006838732.1| hypothetical protein AMTR_s00002p00253880 [Amborella trichopoda]
 gb|ERN01301.1| hypothetical protein AMTR_s00002p00253880 [Amborella trichopoda]
Length=273

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 173/266 (65%), Gaps = 16/266 (6%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIGGR--YV  249
            + +  L GK A+ITGGA GIG  TA+L A +G   V+IAD+ D+LG  +A SIG R  + 
Sbjct  6    TPKKRLEGKAAIITGGASGIGEATARLFAEHGARAVVIADVQDQLGEQVAASIGDRAAFK  65

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDV+ E  V++ V+  ++  G LD+MF+NAGI G   SI ++ ++ +  L ++N+ G+ 
Sbjct  66   HCDVTDEDQVKAVVEWTVQTYGCLDVMFSNAGIIGRTTSIMDLDLKGMDLLYSVNVRGMA  125

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
              +KHA +AM+ GG  G+I+C++S AA +GG++ H Y L+K A+LGLVRS   ELG+HGI
Sbjct  126  AALKHAGKAMVDGGVRGSIVCTTSIAAAVGGVSPHDYCLTKHAVLGLVRSTCSELGKHGI  185

Query  610  RVNCVSPHGVPSEMLVSAYRM-----ILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            RVNCVSP+GV + +L  A R        G  + +  ++  + G           R E VA
Sbjct  186  RVNCVSPYGVATPLLSLALRDNGFEGDTGDIEDLCAQLSNLKG--------VVLRSEHVA  237

Query  775  QAVLFLASEDSGFVTGHNLILDGGYT  852
            +AVLFLAS+++ FV+GHNL +DGG+T
Sbjct  238  EAVLFLASDEAAFVSGHNLAVDGGFT  263



>emb|CDY29039.1| BnaC07g32450D [Brassica napus]
Length=288

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 127/277 (46%), Positives = 175/277 (63%), Gaps = 23/277 (8%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T K+ A +G  V+IAD+    G+ LA+SI
Sbjct  20   EDTNSTLFHKR--LEGKVAIITGGAHGIGKATVKIFARHGATVVIADVDATAGSSLAKSI  77

Query  235  GGR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLA  396
                  ++ CDVS EADVE+ V + +   G+LD++FNNAG+ G      SI +   E+  
Sbjct  78   SSSQVAFISCDVSVEADVENLVNVTIARYGRLDVLFNNAGVLGDQKKHKSILDFNAEEFD  137

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ G   G+KHAARAMI  G  G II ++S A +MGG+  H Y+ SK AI+GL +
Sbjct  138  QVMRVNVRGAGLGMKHAARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTK  197

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEV---GKIVGErgsllrg  747
            +AACELG++GIRVNC+SP GV + MLV+A+R    KT  M E V     + GE       
Sbjct  198  NAACELGRYGIRVNCISPFGVATSMLVNAWR----KTKEMEEFVRSLANLKGETLRAT--  251

Query  748  rggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
                  D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  252  ------DIAEAALYLASDESKYVNGHNLVVDGGVTTA  282



>dbj|BAB01821.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=296

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/256 (46%), Positives = 168/256 (66%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GK+A+ITGGA GIGAE  +L   +G  V+I DI +ELG  LA SIG     +  C+V+
Sbjct  42   LDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDIQEELGQNLAVSIGLDKASFYRCNVT  101

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E DVE+AVK  +E  GKLD++F+NAG+    GS+ ++ +E     +A+N+ G    IKH
Sbjct  102  DETDVENAVKFTVEKHGKLDVLFSNAGVLEAFGSVLDLDLEAFDRTMAVNVRGAAAFIKH  161

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR+M+A G  G+I+C++S AA +GG   H Y+ SK A+LGL+RSA   LGQ+GIRVN V
Sbjct  162  AARSMVASGTRGSIVCTTSIAAEIGGPGPHSYTASKHALLGLIRSACAGLGQYGIRVNGV  221

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P+GV + M  SAY     K   M EE G+ +G    ++         +A+A LFLAS+D
Sbjct  222  APYGVATGM-TSAYNEEAVK---MLEEYGEALGNLKGVVLKA----RHIAEAALFLASDD  273

Query  805  SGFVTGHNLILDGGYT  852
            S +++G NL++DGG++
Sbjct  274  SVYISGQNLVVDGGFS  289



>gb|KHN29548.1| Sex determination protein tasselseed-2 [Glycine soja]
Length=341

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/280 (45%), Positives = 170/280 (61%), Gaps = 15/280 (5%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG-  237
            TD         L GKVA++TGGARGIG  T ++   +G  V+IAD+ D  G  LAE++  
Sbjct  57   TDTTFSPSSKRLEGKVAIVTGGARGIGEATVRVFVKHGAKVVIADVEDAAGGMLAETLSP  116

Query  238  -GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLL  405
               YVHCDVS E +VE+ +   +   G LDIMFNNAG+ G      SI     ++   ++
Sbjct  117  SATYVHCDVSIEKEVENLISSTISRYGHLDIMFNNAGVLGNQSKNKSIVNFDPDEFDKVM  176

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
             +N+ GV  GIKHAAR MI  G G  I+ +SS A +MGGL  H Y+ SK AI+G+ ++ A
Sbjct  177  CVNVKGVALGIKHAARVMIPRGVG-CIVSTSSVAGVMGGLGPHAYTASKHAIVGITKNTA  235

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTD-------VMAEEVGKIVGErgsllr  744
            CELG++GIRVNC+SP GV + MLV+A++      D          EEV KI      L  
Sbjct  236  CELGRYGIRVNCISPFGVATSMLVNAWKPCGDGDDEGINFGVPFPEEVEKIEEFVRGLAN  295

Query  745  grggrME--DVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             RG  +   D+AQA L+LAS++S +V+GHNL++DGG TS+
Sbjct  296  LRGPTLRALDIAQAALYLASDESKYVSGHNLVVDGGVTSS  335



>ref|XP_007037208.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY21709.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=265

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 167/269 (62%), Gaps = 16/269 (6%)
 Frame = +1

Query  64   DQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIGG  240
            D+  C+K+  L GKVA+ITGGA GIG  TA L A +G   ++IADI DE G  LA SIG 
Sbjct  3    DREPCNKK--LEGKVAIITGGASGIGEATAHLFADHGARAIVIADIQDEKGEKLAASIGQ  60

Query  241  R-----YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGI-AGPGGSIAEMKMEQLASL  402
                  +VHCDV+KE DVES V+  ++  G+LDIMF+NAG+ +    +I ++ +     L
Sbjct  61   NRCACTFVHCDVTKEQDVESLVQSTIQLYGRLDIMFSNAGVMSKSQQTILDLDLSSYEKL  120

Query  403  LAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSA  582
             AIN+ GV   IKHA RAM+ G   G+IIC++S AA +G      Y +SK+A+L L+R A
Sbjct  121  FAINVGGVAASIKHAGRAMVEGNTKGSIICTASVAARIGSDRHTDYVMSKNAVLALMRCA  180

Query  583  ACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrM  762
            + +LG HGIRVNCVSP  V + +L  A RM +       EEV         L      ++
Sbjct  181  STQLGAHGIRVNCVSPGPVATPLLCEALRMGV-------EEVETSFARSYCLKNNGVLKV  233

Query  763  EDVAQAVLFLASEDSGFVTGHNLILDGGY  849
            + VA AVLFLA E+S F+TGHNL +DGG+
Sbjct  234  KHVADAVLFLACEESQFITGHNLAVDGGF  262



>ref|NP_190736.1| short-chain dehydrogenase reductase 2a [Arabidopsis thaliana]
 sp|Q9SCU0.1|SDR2A_ARATH RecName: Full=Short-chain dehydrogenase reductase 2a; Short=AtSDR2a 
[Arabidopsis thaliana]
 emb|CAB63154.1| short-chain alcohol dehydrogenase-like protein [Arabidopsis thaliana]
 gb|AEE78826.1| short-chain dehydrogenase reductase 2a [Arabidopsis thaliana]
Length=303

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 174/287 (61%), Gaps = 29/287 (10%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T  L A +G  V+IAD+ +  G+ LA+S+
Sbjct  21   EETNTTLYPKR--LEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGSSLAKSL  78

Query  235  GGR-------YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKM  384
                      ++ CDVS EADVE+ V + +   G+LDI+FNNAG+ G      SI +   
Sbjct  79   SSHKTSPMVAFISCDVSVEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDA  138

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            ++   ++ +N+ GV  G+KH ARAMI  G  G II ++S A +MGG+  H Y+ SK AI+
Sbjct  139  DEFDHVMRVNVRGVGLGMKHGARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIV  198

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILG---------KTDVMAEEVGKI  717
            GL ++AACELG++GIRVNC+SP GV + MLV+A+R   G         + +     +  +
Sbjct  199  GLTKNAACELGKYGIRVNCISPFGVATSMLVNAWRKTSGGDVEDDDVEEMEEFVRSLANL  258

Query  718  VGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             GE             D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  259  KGETLRA--------NDIAEAALYLASDESKYVNGHNLVVDGGVTTA  297



>gb|KDP22808.1| hypothetical protein JCGZ_00395 [Jatropha curcas]
Length=306

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 174/273 (64%), Gaps = 19/273 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GKVA++TGGARGIG  TA+L A +G  V+IADI D LG  +A ++     YVHCDVS+
Sbjct  29   LEGKVAIVTGGARGIGEATARLFARHGAKVVIADIEDTLGTIIANALSPSVTYVHCDVSQ  88

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   G+LDI+FNNAGI G      SI +  +++   ++ +N+ GV  GI
Sbjct  89   EEDIENLINSTVSHYGRLDILFNNAGILGNQPKNKSILDFDVDEFDKIMRVNVKGVALGI  148

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI   K G II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  149  KHAARVMIPR-KVGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  207

Query  619  CVSPHGVPSEMLVSAYR-------------MILGKTDVMAEEVGKIVGErgsllrgrggr  759
            C+SP GV + MLV+A+R             M  G       E  +      + LRG   R
Sbjct  208  CISPFGVATSMLVNAWRSSSSGEEEEEEDCMNYGLPCEEEVEKMEEFVRGLANLRGPTLR  267

Query  760  MEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  268  AKDIAEAALYLASDESKYVSGHNLVVDGGITTS  300



>ref|XP_009621472.1| PREDICTED: zerumbone synthase-like [Nicotiana tomentosiformis]
Length=296

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/257 (45%), Positives = 165/257 (64%), Gaps = 7/257 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A GIG ETA     NG  VII DI  +LG   A  +G    +V CDVSK
Sbjct  33   LEGKVALITGAASGIGKETAAKFISNGAKVIITDIRRQLGEETASELGPNATFVVCDVSK  92

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+D+ +AV  A+   G+LDIM+NNAGIA     SI ++ +     ++AIN+ GVV GIKH
Sbjct  93   ESDISNAVDFAVSSHGQLDIMYNNAGIACSTPPSIMDLDLGAFNRVMAINVGGVVAGIKH  152

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI   + G+I+C++S   +MGGLA   YS SKS I+G++RS   EL ++GIR+NC+
Sbjct  153  AARVMIPR-QTGSILCTASVTGVMGGLAPFTYSTSKSCIIGIMRSVTPELCKNGIRINCI  211

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+ + V   ++     +V A+++ K+V     L       + DVA A L+LAS+D
Sbjct  212  SPFAIPTPLTVDEMKLFF--PEVEAQQLAKMVNNASELKGAYCEPI-DVANAALYLASDD  268

Query  805  SGFVTGHNLILDGGYTS  855
            + +V+G NL++DGG+T+
Sbjct  269  AKYVSGQNLVVDGGFTT  285



>ref|XP_006366370.1| PREDICTED: zerumbone synthase-like isoform X2 [Solanum tuberosum]
Length=273

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 166/257 (65%), Gaps = 7/257 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A GIG ETA     NG  V+IAD+ ++LG   A  +G    +V CDV+K
Sbjct  9    LEGKVALITGAASGIGKETAAKFINNGAKVVIADVQNQLGQETASELGPNASFVVCDVTK  68

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+DV +AV   +   G+LDIM+NNAGIA     +IA++ ++    ++AIN+ GV+ GIKH
Sbjct  69   ESDVSNAVDFTVSSHGQLDIMYNNAGIACRTPRTIADLDLDAFDRVMAINVRGVIAGIKH  128

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI   K G+I+C++S   ++GGLA   YS +KS ++G++RS   EL +HGIR+NCV
Sbjct  129  AARVMIPR-KTGSILCTASVTGVIGGLAQPTYSTTKSCVIGIMRSVTAELSEHGIRINCV  187

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+   +   +  L   ++  E + K++     L       + DVA A LFLAS+D
Sbjct  188  SPFAIPTPFYLDEIK--LHYPELEPEVLVKMLRHTSELKGAYCEPI-DVANAALFLASDD  244

Query  805  SGFVTGHNLILDGGYTS  855
            + +V+GHNL++DGG+TS
Sbjct  245  AKYVSGHNLVIDGGFTS  261



>ref|XP_010937967.1| PREDICTED: sex determination protein tasselseed-2-like [Elaeis 
guineensis]
Length=301

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 168/266 (63%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA++TGGARGIG  T +L   +G  V+IADI D LG  LA S+     +VHCDV  
Sbjct  30   LEGKVAIVTGGARGIGEATVRLFVRHGAKVVIADIEDSLGESLAASLAPLATFVHCDVGS  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG----PGGSIAEMKMEQLASLLAINLNGVVHG  435
            E DVE  V   L   G+LD++ NNAG+ G       SI  +  ++L  ++ +N+ G   G
Sbjct  90   EPDVERLVDRTLGRYGRLDVLVNNAGVLGRQARAAKSIMALDADELDRVMRVNVRGAALG  149

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAARAM+AGG+ G+I+  +S A +MGG+  H Y+ SK A++GL ++AACELG  GIRV
Sbjct  150  MKHAARAMVAGGRVGSIVSVASVAGVMGGMGPHAYTASKHALVGLTKNAACELGARGIRV  209

Query  616  NCVSPHGVPSEMLVSAYR-----MILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            NCVSP GV + MLV A+R     + LG       E  +      + L+G      DVA+A
Sbjct  210  NCVSPFGVATRMLVDAWRDGEEGVDLGTPSEEEVEKMEEFVRGLANLKGPTLTARDVAEA  269

Query  781  VLFLASEDSGFVTGHNLILDGGYTSA  858
             L+LAS+++ +V+GHNL++DGG T++
Sbjct  270  ALYLASDEAKYVSGHNLVVDGGVTTS  295



>emb|CDY34214.1| BnaA02g28260D [Brassica napus]
Length=305

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 175/276 (63%), Gaps = 17/276 (6%)
 Frame = +1

Query  58   STDQM-----LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPL  222
            ST++M     LCSK+  L GKVA+ITGGA G+G  TA     +G  V+I D  +E G   
Sbjct  25   STEKMQIYACLCSKK--LEGKVALITGGASGLGKATAGEFIRHGARVVIVDSDEESGFKA  82

Query  223  AESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGP--GGSIAEMKMEQ  390
            A+ +G    ++ CDV+ EAD+  AV+  +E  GKLD+M+NNAGI GP    SI+E+ M++
Sbjct  83   AKELGVAAEFMVCDVTVEADIARAVETTVERHGKLDVMYNNAGIVGPMIPASISELDMKE  142

Query  391  LASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGL  570
              +++ IN+ GVV GIKHAA+ MI  G  G I+C+SS A ++GGLA H Y++SK  I G+
Sbjct  143  FENVMRINVIGVVSGIKHAAKVMIPAG-SGCILCTSSVAGVLGGLAPHSYTISKFTIPGM  201

Query  571  VRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGK-TDVMAEEVGKIVGErgsllrg  747
            V+SAA EL +HG+R+NC+SP  V + +++   R +    T+    E  K + E       
Sbjct  202  VKSAASELCEHGVRINCISPGTVATPLVLRYLRKVFPTATEEKLRETVKGMSELKGAECE  261

Query  748  rggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTS  855
                  DVA+A LFLASED  +VTGHNL++DGG T+
Sbjct  262  EA----DVAKAALFLASEDGKYVTGHNLVVDGGMTA  293



>ref|XP_011043649.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=276

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 172/269 (64%), Gaps = 12/269 (4%)
 Frame = +1

Query  58   STDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG  237
            ST   + S    L GKVA+ITGGA GIG  TAK+ + +G  VIIADI DELG  + E++G
Sbjct  2    STTAFISSIAKRLQGKVALITGGASGIGECTAKVFSHHGAKVIIADIQDELGHSVVEALG  61

Query  238  ---GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGS-IAEMKMEQLASLL  405
                 YV CDV++EA +++ V  A+   GKLDIM NNAGIA    S I + +M     +L
Sbjct  62   PSNSTYVRCDVTEEAQIKNVVDTAISTYGKLDIMLNNAGIADDNKSRIIDNEMADFERVL  121

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
             IN+ GV  GIKHAAR MI   + GTII ++S ++++G  ASH Y  SK A+LGL R+AA
Sbjct  122  KINVTGVFLGIKHAARVMIPA-RSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAA  180

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
             ELGQ GIRVNC+SP+ + + +     R  +G  D   +E  +I     + L+G   + E
Sbjct  181  AELGQFGIRVNCLSPYALATPLA----RKFIGVDD---DEALEIAMNSFANLKGVTLKTE  233

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGYT  852
            DVA A L+LAS+++ +++GHNL +DGG++
Sbjct  234  DVANAALYLASDEARYISGHNLFIDGGFS  262



>ref|XP_007162946.1| hypothetical protein PHAVU_001G193500g [Phaseolus vulgaris]
 gb|ESW34940.1| hypothetical protein PHAVU_001G193500g [Phaseolus vulgaris]
Length=279

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/266 (44%), Positives = 169/266 (64%), Gaps = 16/266 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG----RYVHCDV  261
            L GKVA+ITGGA GIGA TAKL   +G  VIIAD+ D LG  L ++        Y+HCDV
Sbjct  8    LEGKVAIITGGASGIGASTAKLFLQHGAKVIIADVQDALGHSLCKTFSTNTPIHYLHCDV  67

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG-SIAEMKMEQLASLLAINLNGVVHGI  438
            + ++D+++ V++A+   GKLDIM+NNAGI+G    SI     E+   +  +N+ G   G 
Sbjct  68   TSDSDIKNVVEVAITKYGKLDIMYNNAGISGDSNRSIVTSDEEEFKRVFEVNVYGAFLGS  127

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+   K G I+ +SS A+I+GG  +H Y++SK A++GL+++   ELGQHGIRVN
Sbjct  128  KHAARFMVPA-KRGVILFTSSVASILGGETTHAYAVSKHAVVGLMKNLCVELGQHGIRVN  186

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            CV P GVP+ ML  A +M   +T  +  +V  + G             ED+A+A ++L S
Sbjct  187  CVCPGGVPTPMLNKALKMNKKETQEVLCKVAVLKGTVLEA--------EDIAKAAVYLCS  238

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSF  876
            +++ FV+G N +LDGGY++  + MSF
Sbjct  239  DEAKFVSGVNFVLDGGYST--TNMSF  262



>emb|CAN73475.1| hypothetical protein VITISV_042532 [Vitis vinifera]
Length=262

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 170/268 (63%), Gaps = 14/268 (5%)
 Frame = +1

Query  61   TDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIG  237
            TD   CSK+  L GKV +ITGGA GIG  TA+L A +G   ++IADI D+LG  +AESIG
Sbjct  2    TDPTACSKK--LQGKVIIITGGASGIGEGTARLFANHGARAIVIADIQDQLGQGVAESIG  59

Query  238  ---GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG-GSIAEMKMEQLASLL  405
                RY+HCDV+ E  +++ V+  +   G+LDIMF+NAG+      +I E+ +    +L 
Sbjct  60   LHCCRYIHCDVTDEQQIKAMVESTVRMYGQLDIMFSNAGMMSKTLTTILELDLSDYDTLF  119

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            A+N  G+   +KHAARAM+ GG  G+I+C++S  A  G      Y++SK A+LGL+RSA+
Sbjct  120  AVNARGMAACVKHAARAMVEGGVKGSIVCTASVTATTGSDKFIDYTMSKHAVLGLMRSAS  179

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
             +LG +GIRVNCVSP GV + +   A +M +       EE     G+   L      +++
Sbjct  180  KQLGAYGIRVNCVSPAGVATPLACDAGQMGV-------EETENYFGQLMGLKGRGALKVK  232

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGY  849
             VA AVLFLAS+DS FVTGHNL++DG Y
Sbjct  233  HVADAVLFLASDDSEFVTGHNLVVDGHY  260



>ref|XP_010039348.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Eucalyptus 
grandis]
 gb|KCW88250.1| hypothetical protein EUGRSUZ_A00637 [Eucalyptus grandis]
Length=304

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 178/270 (66%), Gaps = 16/270 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GK+A++TGG +GIG  T +L A +G  V+IADI D LG  LA S+     YVHCDVS 
Sbjct  30   LEGKIAIVTGGVKGIGEATVRLFARHGAKVVIADIEDLLGTALANSLSPSVTYVHCDVSS  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E DVE+ V   +   G+LD+MFNNAG+ G      SI +  + +  S+++IN+ G   GI
Sbjct  90   EEDVENLVTSTVSRYGRLDVMFNNAGLLGNQSKRKSIMDFDVGEFESVMSINVKGSALGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M A  + G II ++S A +MGGL  H Y+ SK AI+GL ++AACELG++GIRVN
Sbjct  150  KHAARVM-APRRSGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNAACELGRYGIRVN  208

Query  619  CVSPHGVPSEMLVSAYRMILGKTD-------VMAE-EVGKI--VGErgsllrgrggrMED  768
            C+SP GV + ML++A+R   G+ +       V +E EV K+       + L+G   R +D
Sbjct  209  CISPFGVATSMLINAWRSSDGEEEDEGMSFGVPSEGEVEKMEEFVRGLANLKGATLRAKD  268

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            +A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  269  IAEAALYLASDESKYVSGHNLVVDGGVTTS  298



>ref|XP_008362092.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X2 
[Malus domestica]
Length=305

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 169/266 (64%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA     +G  VIIAD   ELG  +A+ +G    +V CDV+ 
Sbjct  38   LEGKVAIITGSASGLGKATAHEFIRHGAHVIIADSDSELGPQVAKELGPAAYFVQCDVTI  97

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E+ +  AV+ A+   GKLDIM+NNAGI GP    SIA++ +E+   ++ +NL G V GIK
Sbjct  98   ESQIAEAVETAMARHGKLDIMYNNAGITGPAFPPSIADLNLEEFDRVIRVNLRGAVAGIK  157

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M   G G +I+C+SS A ++GGL  H YS+SK  I GLV+S A EL ++GIRVNC
Sbjct  158  HAARVMKPAGSG-SILCTSSIAGLLGGLGPHSYSISKFTIPGLVKSLASELCRNGIRVNC  216

Query  622  VSPHGVPSEMLVSAYRMIL-GKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  +P+ M V   +    G T+   +E+   +GE             DVAQA ++LAS
Sbjct  217  ISPGPIPTPMAVREIKQFYPGATEEQVKEIVNGLGELKGAKCEEI----DVAQAAVYLAS  272

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSF  876
            +++ +VTGHNL+LDGG+TS  S +SF
Sbjct  273  DEAKYVTGHNLVLDGGFTSFKS-LSF  297



>ref|XP_010683578.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Beta 
vulgaris subsp. vulgaris]
Length=299

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 176/275 (64%), Gaps = 19/275 (7%)
 Frame = +1

Query  73   LCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--Y  246
            L +KR  L GKVA++TGGARGIG    +L A +G  V+IADILD LG  +A S+     Y
Sbjct  25   LSTKR--LQGKVAIVTGGARGIGEAIVRLFASHGAKVVIADILDNLGMSIANSLSPTVSY  82

Query  247  VHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG--SIAEMKMEQLASLLAINLN  420
            +HCDVS E DVE  V   +   GKLDI FNNA I G     SI +   ++  +++ +N+ 
Sbjct  83   IHCDVSHEEDVEKLVTNTIAIHGKLDIFFNNAAILGQQKRKSIMDFNEDEFDTIMRVNVK  142

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            G+  G K+AA+AM+   K G II +SS A ++GG A H Y+ SK AI+GL ++ A ELG+
Sbjct  143  GMALGTKYAAKAMVPR-KTGCIISTSSVAGVLGGCAPHAYTASKHAIVGLTKNVASELGK  201

Query  601  HGIRVNCVSPHGVPSEMLVSA---------YRMILGKTDVMAEEVGKIVGErgsllrgrg  753
            +GIRVNC+SP GV + ML++A         Y  +L +  V  E+V ++V +  +L     
Sbjct  202  YGIRVNCISPFGVATSMLINAWCNESEEEEYSNVLREHQV--EKVEELVNKLANLKGVTL  259

Query  754  grMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
               +DVA+A L+LAS++S +++GHNL++DGG+T++
Sbjct  260  KA-QDVAEAALYLASDESKYISGHNLVIDGGFTTS  293



>emb|CDX83342.1| BnaA03g21640D [Brassica napus]
Length=273

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 170/268 (63%), Gaps = 18/268 (7%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--  240
            Q+L S  + L+GKV +ITGGA GIGAE A+L   +G  V+I D+ +ELG  +A SIG   
Sbjct  6    QVLHSFLNRLDGKVVIITGGASGIGAEAARLFTEHGAKVVIVDLQEELGLSVALSIGKDM  65

Query  241  -RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINL  417
              Y HCDV+ E +VE+AVK  +   GKLD++ +NAGI    GS+ +M +E    ++++N+
Sbjct  66   VTYYHCDVTNEMEVENAVKFTVGKYGKLDVLLSNAGIMDQPGSVLDMNLEHFDRIMSVNV  125

Query  418  NGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELG  597
             G    IKHAARAM+  G  G+IIC +S AA +GG  +H Y+ SK  +LGLVRSA  +LG
Sbjct  126  RGSAAFIKHAARAMVEKGTRGSIICMTSCAAEIGGSGAHAYTASKHGLLGLVRSACGDLG  185

Query  598  QHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsll---rgrggrMED  768
            ++GIRVN V+P+ V + M  S             EE  + V E  S     +G   ++  
Sbjct  186  KYGIRVNGVAPYAVATRMNSS------------DEETARTVEEFFSATGILKGVVLKVGH  233

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYT  852
            VAQA LFLAS+DS +V+GHNL++DGGY+
Sbjct  234  VAQAALFLASDDSAYVSGHNLVVDGGYS  261



>ref|XP_008362091.1| PREDICTED: secoisolariciresinol dehydrogenase-like isoform X1 
[Malus domestica]
Length=306

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/266 (46%), Positives = 169/266 (64%), Gaps = 11/266 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A G+G  TA     +G  VIIAD   ELG  +A+ +G    +V CDV+ 
Sbjct  39   LEGKVAIITGSASGLGKATAHEFIRHGAHVIIADSDSELGPQVAKELGPAAYFVQCDVTI  98

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E+ +  AV+ A+   GKLDIM+NNAGI GP    SIA++ +E+   ++ +NL G V GIK
Sbjct  99   ESQIAEAVETAMARHGKLDIMYNNAGITGPAFPPSIADLNLEEFDRVIRVNLRGAVAGIK  158

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M   G G +I+C+SS A ++GGL  H YS+SK  I GLV+S A EL ++GIRVNC
Sbjct  159  HAARVMKPAGSG-SILCTSSIAGLLGGLGPHSYSISKFTIPGLVKSLASELCRNGIRVNC  217

Query  622  VSPHGVPSEMLVSAYRMIL-GKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  +P+ M V   +    G T+   +E+   +GE             DVAQA ++LAS
Sbjct  218  ISPGPIPTPMAVREIKQFYPGATEEQVKEIVNGLGELKGAKCEEI----DVAQAAVYLAS  273

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSF  876
            +++ +VTGHNL+LDGG+TS  S +SF
Sbjct  274  DEAKYVTGHNLVLDGGFTSFKS-LSF  298



>ref|XP_003520764.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Glycine 
max]
Length=264

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 156/259 (60%), Gaps = 11/259 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHC  255
            +  L GKVA++TGGA GIGAE  ++   NG  V+IADI DELG  LA S+G     Y HC
Sbjct  3    KQRLQGKVAIVTGGATGIGAEAVRIFVENGASVVIADIKDELGHNLATSLGLDKVDYRHC  62

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHG  435
            DV  E  VE  V   LE  G L+I+F+NAGIAGP  SI +  + +  + +A+NL G +  
Sbjct  63   DVRDEKQVEETVSFTLEKYGSLEILFSNAGIAGPLSSILDFDLNEFDNTMAVNLRGAMAA  122

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            IKHAAR M+A    G+IIC++S A    G A H Y+ SK  ++GLVRSA  ELG  GIRV
Sbjct  123  IKHAARVMVARETRGSIICTTSVAGSFAGCAGHDYTASKHGLIGLVRSACSELGAKGIRV  182

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            N +SP+ V + +    + M  G+ +     +  + G           +   +AQ  LFLA
Sbjct  183  NSISPYAVATPLTCETFDMEPGEVEAAGHALANLHG--------ITLKPTHIAQVALFLA  234

Query  796  SEDSGFVTGHNLILDGGYT  852
            S++S +++GHNL++DGG++
Sbjct  235  SDESAYISGHNLVVDGGFS  253



>ref|XP_002265892.1| PREDICTED: short-chain dehydrogenase reductase 2a [Vitis vinifera]
Length=303

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 176/274 (64%), Gaps = 25/274 (9%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GK+AV+TGGARGIG  T +L A +G  V+IAD+ D LGA LA S+     +VHCDVS 
Sbjct  30   LEGKIAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGAALASSLAPSVTFVHCDVSL  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   G+LDI+FNNAG+ G      SI +  +++   ++ +N+ G+  GI
Sbjct  90   EEDIENVINSTVSRYGRLDILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  150  KHAARVMVPRGMG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  208

Query  619  CVSPHGVPSEMLVSAYR---------MILG-----KTDVMAEEVGKIVGErgsllrgrgg  756
            C+SP GV + MLV+A+R         M  G     + + M E V  +       L+G   
Sbjct  209  CISPFGVATSMLVNAWRSSDEEEEDCMNFGIPCEREVEKMEEFVSGLAN-----LKGHIL  263

Query  757  rMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            R +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  264  RAKDIAEAALYLASDESKYVSGHNLVVDGGITTS  297



>ref|XP_002877816.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54075.1| short-chain dehydrogenase/reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=302

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 174/287 (61%), Gaps = 29/287 (10%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T  L A +G  V+IAD+ +  G+ LA+S+
Sbjct  20   EETNTTLYHKR--LEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGSSLAKSL  77

Query  235  GGR-------YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKM  384
                      ++ CDVS E+DVE+ V   +   G+LDI+FNNAG+ G      SI +   
Sbjct  78   SSHLTAFTVTFISCDVSVESDVENLVNATVARYGRLDILFNNAGVLGDQKKHKSILDFDA  137

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            ++   ++ +N+ G+  G+KHAARAMI  G  G II ++S A +MGG+  H Y+ SK AI+
Sbjct  138  DEFDRVMRVNVRGIGLGMKHAARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIV  197

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILG---------KTDVMAEEVGKI  717
            GL ++AACELG++GIRVNC+SP GV + MLV+A+R   G         + +     +  +
Sbjct  198  GLTKNAACELGKYGIRVNCISPFGVATSMLVNAWRKTSGGDVEDDEVEEMEEFVRSLANL  257

Query  718  VGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             GE             D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  258  KGESLRA--------NDIAEAALYLASDESKYVNGHNLVVDGGVTTA  296



>ref|XP_010914852.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Elaeis 
guineensis]
Length=267

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 163/259 (63%), Gaps = 11/259 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHC  255
            R  L GKV +ITGGA GIG  TA+L A  G  VIIADI DELG  +A SIG     Y HC
Sbjct  3    RPRLEGKVTIITGGASGIGEATARLFASQGALVIIADIQDELGRAVAASIGLDRCAYRHC  62

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHG  435
            DV  E  VE+ V  A++  G+LD++F+NAG  GP G+  E  +E+   ++AIN  GV   
Sbjct  63   DVRDEKQVEATVDFAVQTHGRLDVLFSNAGKMGPAGAFLEASLEEWDDIMAINARGVAAT  122

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAARAM+A    G+I+C+ S  A  GG  +  Y  SK A+LGLVR+AA ELG+HGIRV
Sbjct  123  VKHAARAMVARKTRGSIVCTGSVVASRGGTRAAAYVASKHAVLGLVRAAAAELGEHGIRV  182

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP  V + +  + +    G +    EE     GE  S L+G   +   +A+AVLFLA
Sbjct  183  NCVSPSAVATPLACALH----GWSPSEVEE----YGEALSRLKGVVLKASHIAEAVLFLA  234

Query  796  SEDSGFVTGHNLILDGGYT  852
            S++S ++TG +L++DGG T
Sbjct  235  SDESEYITGLDLVVDGGRT  253



>ref|XP_006366369.1| PREDICTED: zerumbone synthase-like isoform X1 [Solanum tuberosum]
Length=295

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 167/260 (64%), Gaps = 7/260 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A GIG ETA     NG  V+IAD+ ++LG   A  +G    +V CDV+K
Sbjct  31   LEGKVALITGAASGIGKETAAKFINNGAKVVIADVQNQLGQETASELGPNASFVVCDVTK  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+DV +AV   +   G+LDIM+NNAGIA     +IA++ ++    ++AIN+ GV+ GIKH
Sbjct  91   ESDVSNAVDFTVSSHGQLDIMYNNAGIACRTPRTIADLDLDAFDRVMAINVRGVIAGIKH  150

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI   K G+I+C++S   ++GGLA   YS +KS ++G++RS   EL +HGIR+NCV
Sbjct  151  AARVMIPR-KTGSILCTASVTGVIGGLAQPTYSTTKSCVIGIMRSVTAELSEHGIRINCV  209

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+   +   +  L   ++  E + K++     L       + DVA A LFLAS+D
Sbjct  210  SPFAIPTPFYLDEIK--LHYPELEPEVLVKMLRHTSELKGAYCEPI-DVANAALFLASDD  266

Query  805  SGFVTGHNLILDGGYTSAVS  864
            + +V+GHNL++DGG+TS  S
Sbjct  267  AKYVSGHNLVIDGGFTSYKS  286



>ref|XP_011079746.1| PREDICTED: zerumbone synthase isoform X1 [Sesamum indicum]
Length=296

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/259 (44%), Positives = 166/259 (64%), Gaps = 7/259 (3%)
 Frame = +1

Query  88   SFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDV  261
            S L GKVA+ITG A GIG ETA     +G  V++ADI  + G   A  +G    ++ CDV
Sbjct  30   SKLEGKVALITGAASGIGKETATKFINDGAKVVLADIQKDQGQQTARELGPNAAFIPCDV  89

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGI  438
            ++E+DV  AV   +   G+LDIM+NNAGIA     S+ ++ +     ++AIN+ GV+ G+
Sbjct  90   TRESDVSQAVDFTVSKHGQLDIMYNNAGIACHTPPSVVDLDLATFDRVMAINVRGVLAGL  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI   + G I+C++S   +MGGLA H YS+SKS+++G+V+SAA EL  HGIR+N
Sbjct  150  KHAARVMIPR-QSGVILCTASVTGLMGGLAQHTYSISKSSVIGIVKSAASELCSHGIRIN  208

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            C+SP  +P+  ++   +      D  A+++ K+V +   L         D+A A LFLAS
Sbjct  209  CISPMAIPTPFVMEELKKYYPGVD--AQKLVKMVHDFSVLRGAFCEP-SDIANAALFLAS  265

Query  799  EDSGFVTGHNLILDGGYTS  855
            +D+ FV+GHNL++DGG+TS
Sbjct  266  DDAKFVSGHNLVVDGGFTS  284



>ref|XP_002512852.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF49355.1| short chain alcohol dehydrogenase, putative [Ricinus communis]
Length=302

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 172/268 (64%), Gaps = 11/268 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITGGA G+G  TA     +G  VIIAD+  +LG  +A  +G    +V CDV+ 
Sbjct  36   LEGKVALITGGASGLGNATAHQFIQHGARVIIADVDSKLGQQVATELGSAAHFVRCDVTV  95

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            EA V+ AV+ A+   GKLDIM+NNAGI GP    SIA++ +++   ++ IN+ G+V GIK
Sbjct  96   EAQVKDAVEAAMGRHGKLDIMYNNAGIPGPSVPPSIADLDLDEFDKVMQINVRGIVAGIK  155

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI  G G +I+C+SS   ++GGL  HPY++SK AI G+V++ A EL ++GIR+NC
Sbjct  156  HAARVMIPAGSG-SILCTSSICGVLGGLGPHPYTISKFAIPGIVKTVASELCKNGIRINC  214

Query  622  VSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  +P+ M V    +   G T     E+   VGE             DVA+A L+LAS
Sbjct  215  ISPGPIPTPMSVGQIAQFYPGATREKIVEIMNGVGELKGANCEEI----DVAKAALYLAS  270

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIY  882
            +++ ++TGHNL++DGG+TS  S  SF +
Sbjct  271  DEAKYITGHNLVVDGGFTSFKS-FSFPH  297



>ref|XP_004158218.1| PREDICTED: LOW QUALITY PROTEIN: short-chain dehydrogenase reductase 
3b-like [Cucumis sativus]
Length=265

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 162/256 (63%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            LNGKVA+ITGGA GIG ETA++ A NG  V+IADI DELG  +A  IG     + HCDV 
Sbjct  6    LNGKVALITGGASGIGEETARVFAENGAIVVIADIQDELGEKVAREIGENKASFHHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E DVE  VK  +E  G LDI+F+NA + GP   I E+ ME+  + +  N+ GV   IKH
Sbjct  66   NEEDVEKTVKFTVEKHGVLDILFSNAAVMGPLTGILELNMEEFENTMRSNVKGVTATIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AA  M+     G+IIC++S AA +GG+    Y+++K+A++G+V++A  ELG++GIRVN V
Sbjct  126  AAGEMVKRKTRGSIICTASVAATLGGVGPFGYTVAKNAVVGVVKAACGELGKYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + M   +Y M + + +     +  + G               VA+AVLF AS++
Sbjct  186  SPYGVATPMTCGSYNMSVEEAEEGTSALANLKG--------IVLNCRHVAEAVLFXASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+GHNL +DGG+T
Sbjct  238  SVYVSGHNLAVDGGFT  253



>ref|XP_010096039.1| Sex determination protein tasselseed-2 [Morus notabilis]
 gb|EXB62845.1| Sex determination protein tasselseed-2 [Morus notabilis]
Length=288

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 174/266 (65%), Gaps = 11/266 (4%)
 Frame = +1

Query  73   LCS-KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GR  243
            +CS  R+ L GKVAVITGGA G+G  TA     NG  VIIADI  ELG+ +A+ +G    
Sbjct  12   ICSLPRNRLQGKVAVITGGASGLGKATAHEFIQNGAQVIIADINTELGSKVAKDLGPLAH  71

Query  244  YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGP--GGSIAEMKMEQLASLLAINL  417
            +V CDV+ EA V  AV+ A+   GKLDIM+NNAGI GP    SIAE+ ++    ++ IN+
Sbjct  72   FVQCDVTDEAQVAGAVEAAVGLHGKLDIMYNNAGIVGPVLPPSIAELDLDTFDRVMRINV  131

Query  418  NGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELG  597
             G V GIKHAAR MI  G G +I+C+SS + ++GGL  H Y++SK  I G+V+  A EL 
Sbjct  132  WGTVAGIKHAARFMIPTGSG-SILCTSSMSGLLGGLGPHSYTISKYTIPGIVKFVASELC  190

Query  598  QHGIRVNCVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            + G+R+NC+SP  +P+ + V    +   G T    E+V +IV   G L   +G  M DVA
Sbjct  191  RTGVRINCISPGPIPTPLSVGQLAQFYPGAT---TEQVAQIVNGLGELKGAKGEEM-DVA  246

Query  775  QAVLFLASEDSGFVTGHNLILDGGYT  852
            QA ++LAS++S ++TGHNL++DGG+T
Sbjct  247  QAAVYLASDESKYITGHNLVVDGGFT  272



>ref|XP_010652542.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Vitis 
vinifera]
Length=324

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 151/254 (59%), Gaps = 11/254 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITG A GIG   AKL A NG  V+IADI DELG  +  SIG     Y HC+V 
Sbjct  66   LEGKVAIITGAASGIGEAAAKLFAENGAFVVIADIQDELGHQVVASIGPEKSSYFHCNVR  125

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V  A++  G LDIMF+NA I GP GSI EM M+     +A N  G    IKH
Sbjct  126  DERQVEETVAYAIQKYGTLDIMFSNAAITGPIGSILEMDMDGFDDTIATNFRGPASTIKH  185

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+     G+IIC+ S ++ +GG     Y+ SK A+LGLVRSAA +LGQ+GIRVNCV
Sbjct  186  AARAMVEKQVRGSIICTGSVSSTLGGSGPPAYTASKHAVLGLVRSAADDLGQYGIRVNCV  245

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  V + M    Y +     +  A    ++ G           +   VA+A LFLAS++
Sbjct  246  SPFAVATRMSTGMYNVDASIVEASASSFSQLKG--------IILKPRHVAEAALFLASDE  297

Query  805  SGFVTGHNLILDGG  846
            S +VTGHNL +DGG
Sbjct  298  SAYVTGHNLAVDGG  311



>ref|XP_007221495.1| hypothetical protein PRUPE_ppa009931mg [Prunus persica]
 gb|EMJ22694.1| hypothetical protein PRUPE_ppa009931mg [Prunus persica]
Length=271

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 157/256 (61%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITG A GIG E  +L A NG  V+ ADI DELG  +  SIG     Y HCDV 
Sbjct  15   LEGKVALITGAAGGIGEEAVRLFAENGAFVVAADIQDELGPHVVASIGSERVSYCHCDVR  74

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V   L+  G LDI+F+NAG+ GP   I ++ ++   + +A N+ GV   IKH
Sbjct  75   DENQVEKTVNYTLDKYGSLDILFSNAGVMGPMTGILDLDIQGFDNTMATNVRGVAATIKH  134

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+A    G+IIC++S AA +GG A H Y+ SK A+LGLVR A  ELG +GIRVN +
Sbjct  135  AARAMVARKVHGSIICTTSVAASLGGTAPHAYTTSKHALLGLVRGACSELGAYGIRVNSI  194

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV + +   AY +   + +  +  +  + G           +   VA+A LFLAS++
Sbjct  195  SPFGVATPLSCKAYNLQPSEVEANSSAIANLKG--------IVLKARHVAEAALFLASDE  246

Query  805  SGFVTGHNLILDGGYT  852
            S +V+GHNL++DGG+T
Sbjct  247  SVYVSGHNLVVDGGFT  262



>ref|XP_007140172.1| hypothetical protein PHAVU_008G089900g [Phaseolus vulgaris]
 gb|ESW12166.1| hypothetical protein PHAVU_008G089900g [Phaseolus vulgaris]
Length=303

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/284 (43%), Positives = 172/284 (61%), Gaps = 17/284 (6%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            + +D   C     L GK+A++TGGARGIG  T ++   +G  V+IAD+ D  GA LAE++
Sbjct  15   QVSDTTFCPSSKRLEGKIAIVTGGARGIGEATVRVFVKHGAKVVIADVEDAAGAMLAETL  74

Query  235  G--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLAS  399
                 YVHCDV  E +VE+ V   +   G LDIMFNNAG+ G      SI     ++   
Sbjct  75   SPSASYVHCDVRLEKEVENLVSSTISRYGHLDIMFNNAGVLGNQSKNKSIVNFDPDEFNR  134

Query  400  LLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRS  579
            ++ +N+ GV  G+KHAAR MI  G G  II ++S A +MGGL  H Y+ SK AI+GL ++
Sbjct  135  VMCVNVKGVALGMKHAARVMIPRGVG-CIISTTSVAGLMGGLGPHAYTASKHAIVGLTKN  193

Query  580  AACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTD---------VMAEEVGKIVGErg  732
             +CELG++GIRVNC+SP GV + MLV+A+R    +              EEV K+     
Sbjct  194  TSCELGKYGIRVNCISPFGVATSMLVNAWRSCDDEEADHEGINFGVPFPEEVEKMEEFVR  253

Query  733  sllrgrggrME--DVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             L   RG  +   D+A+A L+LAS++S +V+GHNL++DGG TS+
Sbjct  254  GLANLRGTTLRAVDIAEAALYLASDESKYVSGHNLVVDGGVTSS  297



>ref|XP_009136629.1| PREDICTED: short-chain dehydrogenase reductase 2a [Brassica rapa]
Length=300

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 180/278 (65%), Gaps = 13/278 (5%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T+  L  KR  L GKVA+ITGGA GIG  T KL A +G  V+IAD+    G+ LA+SI
Sbjct  20   EDTNSTLFHKR--LEGKVAIITGGAHGIGKATVKLFARHGATVVIADVDATAGSSLAKSI  77

Query  235  GGR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLA  396
                  ++ CDVS EADVE+ V + +   G+LD++FNNAG+ G      SI +   E+  
Sbjct  78   SSSQVAFISCDVSVEADVENLVNVTIARYGRLDVLFNNAGVLGDQKKHKSILDFNAEEFD  137

Query  397  SLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVR  576
             ++ +N+ G   G+KHAARAMI  G  G II ++S A +MGG+  H Y+ SK AI+GL +
Sbjct  138  QVMRVNVRGAGLGMKHAARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTK  197

Query  577  SAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVM----AEEVGKIVGErgsllr  744
            +AACELG++GIRVNC+SP GV + MLV+A+R   G  D+      EE+ + V    + L+
Sbjct  198  NAACELGRYGIRVNCISPFGVATSMLVNAWRKTSGCGDMEDGDDVEEMEEFV-RSLANLK  256

Query  745  grggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            G   R  D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  257  GETLRATDIAEAALYLASDESKYVNGHNLVVDGGVTTA  294



>ref|XP_010523897.1| PREDICTED: short-chain dehydrogenase reductase 3b-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010523898.1| PREDICTED: short-chain dehydrogenase reductase 3b-like isoform 
X2 [Tarenaya hassleriana]
Length=261

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 171/264 (65%), Gaps = 16/264 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GK+A+ITGGA GIGAE A+L AG+G  V+I D+ D+LG  +A SIG     Y  CDV+
Sbjct  6    LEGKIAIITGGASGIGAEAARLFAGHGARVVIVDVQDKLGRKVAVSIGEDRATYYRCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             EA VE+AVK  ++  G+LDI+F+NAGI    GSI ++ +  L   +A+NL G    IKH
Sbjct  66   DEAQVENAVKFTVDKYGRLDILFSNAGIMEQFGSILDLNLAHLDRTMAVNLRGSTAFIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+A G  G+I+C++S AA + G   H Y+ SK A++GLV+SA  ELG+HGIRVN V
Sbjct  126  AARAMVASGIRGSIVCTTSVAAEIAGAGPHAYTASKHALVGLVKSACGELGRHGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME--DVAQAVLFLAS  798
            +P GV + +           +D  AE    + G   +    +G  ++  DVA+A LFLAS
Sbjct  186  APFGVATGI----------TSDGTAEGDKNVEGLIAASGNLKGVVLKTRDVAEAALFLAS  235

Query  799  EDSGFVTGHNLILDGGYTSAVSQM  870
            ++S +++G NL++DGGY S V Q+
Sbjct  236  DESVYISGQNLVIDGGY-SVVKQL  258



>ref|XP_011022234.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=268

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/257 (44%), Positives = 162/257 (63%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI---GGRYVHCDVS  264
            L GKVA+ITGG+ GIG  TA+L   +G  V+IADI DELG  + + +      ++HCDV+
Sbjct  14   LEGKVALITGGSSGIGESTARLFVKHGAKVVIADIQDELGHSVCKELEPEPASFIHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            +E DVE+AV  A+   GKLDIMFNNAGI G P  +I E    +   ++ +NL G   G K
Sbjct  74   QEKDVENAVNTAVSKYGKLDIMFNNAGIGGTPKTNILENDKAEFEKIICVNLVGAFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   +G +II ++S  AI+GG  SH Y+ SK  +LGL R+ A ELG +GIRVNC
Sbjct  134  HAARVMIPARRG-SIITTASVCAIIGGGLSHAYTSSKHGVLGLTRNTAVELGHYGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ VP+ +  + ++M   +   +   +   V +            ED+A+A L+L S+
Sbjct  193  VSPYAVPTPLFKNFFKMNDDELKCIYSNLKGAVLQA-----------EDIAEAALYLGSD  241

Query  802  DSGFVTGHNLILDGGYT  852
            +S +V+GHNL++DGG+T
Sbjct  242  ESKYVSGHNLVVDGGFT  258



>gb|KDP28314.1| hypothetical protein JCGZ_14085 [Jatropha curcas]
Length=263

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 161/261 (62%), Gaps = 11/261 (4%)
 Frame = +1

Query  79   SKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYV  249
            S +  L GKVA+ITG A GIG ET +L A +G  V+ AD+ D+LG  + ES+G     Y 
Sbjct  2    STKPRLEGKVALITGAASGIGEETVRLFAEHGAFVVAADVQDKLGQQVVESLGQDKATYR  61

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVV  429
            HCDV  E  VE  V   LE  GK+DI+F+NAGI GP   I E+ +    + +A N+ GV 
Sbjct  62   HCDVRDEKQVEETVNYTLEKYGKIDILFSNAGIIGPLAGILELDINGFDNTMATNVRGVA  121

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
              IKHAARAM+A    G+IIC++S A+ +GG   H Y +SK A++GLV++A  ELG +GI
Sbjct  122  ATIKHAARAMVAKKIRGSIICTASVASSLGGAGPHAYVISKHALVGLVKTACGELGAYGI  181

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVNC+SP GV + +  +AY +   + +     +  + G           + + +A A LF
Sbjct  182  RVNCISPFGVATPLSCTAYNLKPSEVEANTSALANLKG--------VILKAKHIADAALF  233

Query  790  LASEDSGFVTGHNLILDGGYT  852
            LAS++S +++GHNL +DGG+T
Sbjct  234  LASDESAYISGHNLAVDGGFT  254



>ref|XP_010244665.1| PREDICTED: secoisolariciresinol dehydrogenase isoform X5 [Nelumbo 
nucifera]
Length=272

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 170/269 (63%), Gaps = 10/269 (4%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHC  255
            K+  L GKVA+ITG ARGIG  TA     NG  V+IADI  +LG   A  +G    +V C
Sbjct  3    KKMSLEGKVALITGAARGIGKATATEFIKNGAKVVIADIRRQLGQDAAVELGPNATFVSC  62

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVH  432
            DV++E+D+  AV   +   G LDIM+NNAGIAG    SI ++ M +   +++IN+ GVV 
Sbjct  63   DVTRESDISDAVDFTISKHGCLDIMYNNAGIAGNTPPSIVDLDMTEFDRIMSINVRGVVA  122

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            GIKHAAR MI   + G I+C+ S  A+MGGL+   YS+SK A++G+V+S A E+ ++GIR
Sbjct  123  GIKHAARVMIPR-RSGCILCTGSVTALMGGLSPPSYSISKGAVVGIVKSVASEMCKYGIR  181

Query  613  VNCVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            VNC+SP  +P+  ++    +M  G  +    E+ +  GE            ED+A A L+
Sbjct  182  VNCISPFAIPTPFVMEEMVKMFPGVDEQRLVEMVQGPGELAGANCEA----EDIANAALY  237

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            LAS+D+ +V+GHNL++DGG+TS + ++ F
Sbjct  238  LASDDAKYVSGHNLVVDGGFTS-IKRLGF  265



>ref|XP_009773745.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Nicotiana 
sylvestris]
Length=266

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/258 (47%), Positives = 166/258 (64%), Gaps = 13/258 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L+GK+A+ITGGA GIG  T++L A +G  V+IADI +E G  +AESIG     ++ CDV+
Sbjct  12   LDGKIAIITGGASGIGEATSRLFAQHGAKVVIADIQEEKGRSVAESIGSNHCIFIKCDVT  71

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHG  435
             E  ++S V+  +E  G++DIMF+NAGIA        I    ++ L +L AIN+ G V  
Sbjct  72   DEQQIQSLVQSTVEIHGRVDIMFSNAGIASTNDHEQDILGFNLDALDNLFAINVRGSVAC  131

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAA+AM+ GG  G IIC+ S  A MG      Y++SK AILGLV+SA+  LG++GIRV
Sbjct  132  VKHAAKAMVEGGVKGKIICTGSVTATMGVTKQIDYAMSKHAILGLVKSASKGLGKYGIRV  191

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP  V + +L  + +M +       EE+ K+      L  G   +  +VA AVLFLA
Sbjct  192  NCVSPAAVATPLLEKSMKMSV-------EEIEKLFDSFNCLKTGAAIKASNVADAVLFLA  244

Query  796  SEDSGFVTGHNLILDGGY  849
            S+DS FVTGHNL++DGG+
Sbjct  245  SDDSLFVTGHNLVVDGGF  262



>ref|XP_009118132.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Brassica 
rapa]
Length=257

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 165/251 (66%), Gaps = 10/251 (4%)
 Frame = +1

Query  112  VITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVSKEADVE  282
            VITGGA GIGAE A+L   +G  V+I D+ DELG  +A SIG     YVHCDV KE +VE
Sbjct  9    VITGGASGIGAEAARLFTEHGARVVITDVKDELGRNVAVSIGEDKVSYVHCDVRKETEVE  68

Query  283  SAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAMI  462
            SAVK A+E  G++D++F+NAG+  P   I ++ +E    ++A+N+ G    IKH ARAM+
Sbjct  69   SAVKFAVEKHGRIDVIFSNAGVPEPLLDIRDLNLEAFDRVMAVNVRGAAAFIKHVARAMV  128

Query  463  AGGKGGTIICSSSSAAIMGG-LASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
                 G+I+C++S A+++ G +  H Y+ SK A++GL+RSAA +LG+HGIRVN V+P GV
Sbjct  129  EKKTRGSIVCTTSVASVIAGTVVPHGYTASKHALVGLIRSAAGDLGKHGIRVNGVAPFGV  188

Query  640  PSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGFVT  819
             + ++   Y     K  + A E+ +I  E  +L          VA+A LFLAS+DS +V+
Sbjct  189  ATPLVCEGY-----KIKMEASELEEIFSETANLKGIVLKA-RHVAEAALFLASDDSAYVS  242

Query  820  GHNLILDGGYT  852
            GHNL++DGG++
Sbjct  243  GHNLLVDGGFS  253



>ref|XP_004247470.1| PREDICTED: zerumbone synthase [Solanum lycopersicum]
Length=295

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 166/260 (64%), Gaps = 7/260 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A GIG ETA     NG  V+IAD+ +++G   A  +G    +V CDV+K
Sbjct  31   LEGKVALITGAASGIGKETAAKFINNGAKVVIADVQNQVGQETASELGPNASFVVCDVTK  90

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+DV +AV   +   GKLDIM+NNAGI      SIA++ ++    ++AIN+ GV+ GIKH
Sbjct  91   ESDVSNAVDFTISSHGKLDIMYNNAGIPCCTPRSIADLDLDAFDRVMAINVRGVIAGIKH  150

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI   K G+I+C++S   ++GGLA   YS +KS ++G++RS   EL Q+GIR+NCV
Sbjct  151  AARVMIPR-KTGSILCTASVTGVIGGLAQPTYSTTKSCVIGIMRSVTAELSQNGIRINCV  209

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+   +   ++   K +   E + K++     L       + DVA A LFLAS+D
Sbjct  210  SPFAIPTPFYMDEIKLHFPKLE--PEVLVKMLHRTSELKGAYCEPI-DVANAALFLASDD  266

Query  805  SGFVTGHNLILDGGYTSAVS  864
            + +V+GHNL++DGG+TS  S
Sbjct  267  AKYVSGHNLMIDGGFTSYKS  286



>ref|XP_003540813.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Glycine max]
Length=271

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 164/255 (64%), Gaps = 14/255 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI-GGRYVHCDVSKE  270
            L GKVA+ITGGA GIG  TA+L + +G  V+IADI D+LG  L + +    YVHCDV+KE
Sbjct  14   LEGKVAIITGGASGIGEATARLFSKHGAHVVIADIQDDLGLSLCKHLESASYVHCDVTKE  73

Query  271  ADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIKHA  447
             DVE+ V  A+   GKLDIM NNAGI      SI +       S++++NL G   G KHA
Sbjct  74   EDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHA  133

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MIA  K G+II ++S A  +GG+A+H Y+ SK A++GL++S A ELGQ GIRVNCVS
Sbjct  134  ARVMIAA-KRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVNCVS  192

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDS  807
            P+ VP+          L K     +E G  V E  S L+G      DVA+A L+LA ++S
Sbjct  193  PYVVPTP---------LTKKHANIDEEG--VREIYSNLKGVHLVPNDVAEAALYLAGDES  241

Query  808  GFVTGHNLILDGGYT  852
             +V+GHNL+LDGGYT
Sbjct  242  KYVSGHNLVLDGGYT  256



>gb|AGY49282.1| short chain alcohol dehydrogenase/reductase [Hedychium coronarium]
Length=262

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 166/261 (64%), Gaps = 15/261 (6%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG----GRYV  249
            +R  L GKVAVITGGA GIG  T KL   +G  VI+AD+ D+ G  L   +G      Y+
Sbjct  2    ERRRLEGKVAVITGGASGIGEATVKLFVRHGARVIVADLQDDKGKALCADLGSDDVASYI  61

Query  250  HCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLA---SLLAINLN  420
            HCDV  E+DV+ AV  A+   GKLDIMFNNAGI+ P GS    + +  A    ++ +N+ 
Sbjct  62   HCDVRCESDVKRAVDTAISLHGKLDIMFNNAGISDPSGSSILGEDDTTAVFERVMGVNVL  121

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            G + G KHA RAM+A G+GG+II ++S A+++G L    YS SK A+LGL RSAA ELG+
Sbjct  122  GALLGTKHAGRAMVAAGRGGSIIITASLASVVGALGHPVYSCSKHAVLGLARSAAAELGK  181

Query  601  HGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQA  780
            HG+RVNCVSP  V + + VS Y+    + + + E +  + G           + ED+A+A
Sbjct  182  HGVRVNCVSPAIVATPLTVSYYQTSEEELEGLGEMISTLKG--------VRLKAEDIAEA  233

Query  781  VLFLASEDSGFVTGHNLILDG  843
             LFLAS++S FV+GHNL++DG
Sbjct  234  ALFLASDESRFVSGHNLMIDG  254



>gb|KHN21176.1| Momilactone A synthase [Glycine soja]
Length=269

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 126/255 (49%), Positives = 165/255 (65%), Gaps = 14/255 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI-GGRYVHCDVSKE  270
            L GKVA+ITGGA GIG  TA+L + +G  ++IADI D+LG  L + +    YVHCDV+KE
Sbjct  14   LEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHLESASYVHCDVTKE  73

Query  271  ADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIKHA  447
             DVE+ V  A+   GKLDIM NNAGI      SI +       S++++NL G   G KHA
Sbjct  74   EDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHA  133

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MIA  K G+II ++S A I+GG+A+H Y+ SK A++GL++S A ELGQ GIRVNCVS
Sbjct  134  ARVMIAA-KRGSIINTASVAGILGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVNCVS  192

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDS  807
            P+ VP+          L K     +E G  V E  S L+G      DVA+A L+LA ++S
Sbjct  193  PYVVPTP---------LTKKHANIDEEG--VREIYSNLKGVHLVPNDVAEAALYLAGDES  241

Query  808  GFVTGHNLILDGGYT  852
             +V+GHNL+LDGGYT
Sbjct  242  KYVSGHNLVLDGGYT  256



>ref|XP_010518405.1| PREDICTED: short-chain dehydrogenase reductase 3b [Camelina sativa]
Length=257

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 169/256 (66%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GK+ +ITGGA GIGAE+ +L   +G  V+I D+ DELG  LA SIG     Y HCDV+
Sbjct  6    LDGKIVIITGGASGIGAESVRLFTEHGARVVIVDVQDELGQNLAASIGEDKASYYHCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E +VE+AVK  ++  GKLD++F+NAG+  P  SI ++ +++   +LA+NL G    IKH
Sbjct  66   NETEVENAVKFTVDKHGKLDVLFSNAGVIEPFASILDLNLDEFDRILAVNLRGAAAFIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+  G  G+I+C++S AA + G A H Y+ SK  +LGL++SA+  LGQ+GIRVN V
Sbjct  126  AARAMVEKGTRGSIVCTTSVAAEISGTAPHGYTASKHGLLGLIKSASGGLGQYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P GV + ++ + +++   + +V+ E          + L+G   +   VA+A LFLAS+ 
Sbjct  186  APFGVATPLVCNGFKI---EANVVEENT-----LASANLKGIVLKARHVAEAALFLASDA  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+G NL +DGGY+
Sbjct  238  SAYVSGQNLAVDGGYS  253



>ref|XP_007051232.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOX95389.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=264

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 162/260 (62%), Gaps = 11/260 (4%)
 Frame = +1

Query  82   KRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVH  252
            + S L GKVA+ITG A GIG ET +L A +G  V+IAD+ D+LG  +A S+G     Y H
Sbjct  2    RFSRLEGKVALITGAASGIGEETVRLFAEHGAFVVIADVQDDLGNQVAASLGLDKVSYHH  61

Query  253  CDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVH  432
            CDV  E  VE  V   +E  GKLDI+F+NAGI GP   I E+ M+   + +A N+ GV  
Sbjct  62   CDVRDEKQVEETVSYTVEKYGKLDILFSNAGILGPLTGILELDMDGFDNTIATNVRGVAA  121

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
             IKHAAR M+A    G+IIC++S ++ +GG   H Y+ SK AI+GLVR+   ELG +GIR
Sbjct  122  TIKHAARTMVARNIRGSIICTASVSSSLGGTGPHGYTTSKHAIVGLVRATCSELGAYGIR  181

Query  613  VNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFL  792
            VNCVSP+GV + +  ++Y     + +  +  V  + G           +   +A+AVLFL
Sbjct  182  VNCVSPYGVATPLACNSYNWKPSEVEANSCSVSNLKG--------IVLKARHIAEAVLFL  233

Query  793  ASEDSGFVTGHNLILDGGYT  852
            AS++S +++G NL +DGG+T
Sbjct  234  ASDESTYISGQNLAVDGGFT  253



>ref|XP_002272838.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=269

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 166/257 (65%), Gaps = 15/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVAVITGGA GIG+ TAKL   +G  V+IADI  E G  + + +G     +VHCDV+
Sbjct  14   LEGKVAVITGGAGGIGSCTAKLFCQHGAKVLIADIQYEKGHSICKDLGPTSASFVHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIK  441
            KE DV +A+  A+   GKLDIMFNNAGI GP   +I +   ++  + + +N+ G   G K
Sbjct  74   KELDVGNAIDKAISKYGKLDIMFNNAGILGPYRPNILDNDADEFENTMRVNVLGTFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M   G+G +II ++S  +++GG+A+H Y+ SK AILGL R+ A ELG+ GIRVNC
Sbjct  134  HAARVMAPAGRG-SIINTASVCSVVGGVATHSYTSSKHAILGLTRNTAVELGKFGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ VP+ +  S   M LG+ D   +    + G            +EDVA+AVL++ S+
Sbjct  193  VSPYLVPTSL--SRKFMNLGEDDPFVKVYSNLKG--------VSLEVEDVAEAVLYMGSD  242

Query  802  DSGFVTGHNLILDGGYT  852
            DS +V+GHNL+LDGG T
Sbjct  243  DSKYVSGHNLVLDGGVT  259



>ref|XP_003553613.1| PREDICTED: secoisolariciresinol dehydrogenase [Glycine max]
 gb|KHN02191.1| Momilactone A synthase [Glycine soja]
Length=280

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 170/265 (64%), Gaps = 15/265 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITGGA GIGA TAKL   +G  VIIAD+ DELG    +++G     YVHCDV+
Sbjct  14   LEGKVAIITGGASGIGAATAKLFVQHGAKVIIADVQDELGQFHCKTLGTTNIHYVHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGG-SIAEMKMEQLASLLAINLNGVVHGIK  441
             ++DV++ V+ A+   GKLDIM+NNAGI+G    SI     E   ++  +N+ G   G K
Sbjct  74   SDSDVKNVVEFAVSKYGKLDIMYNNAGISGDSNRSITTSDNEGFKNVFGVNVYGAFLGAK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   K G I+ +SS A+++GG  +H Y++SK A++GL+++   ELG+HGIRVNC
Sbjct  134  HAARVMIPA-KRGVILFTSSVASLLGGETTHAYAVSKHAVVGLMKNLCVELGEHGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            V P G+P+ ML +A +M   +T  +  +V  + G             ED+A+A ++L S+
Sbjct  193  VCPGGIPTPMLNNALKMNKKETQEVLCKVAVLKGTVLEA--------EDIAKAAVYLCSD  244

Query  802  DSGFVTGHNLILDGGYTSAVSQMSF  876
            ++ FV+G N +LDGGY+  ++  SF
Sbjct  245  EAKFVSGVNFVLDGGYS--ITNNSF  267



>ref|XP_008809990.1| PREDICTED: sex determination protein tasselseed-2-like [Phoenix 
dactylifera]
Length=301

 Score =   210 bits (535),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 173/275 (63%), Gaps = 11/275 (4%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELG--APLAESIGG  240
            + +  +   L GKVA++TGGARGIG  T +L   +G  V+IADI D LG     + +   
Sbjct  21   EPVAPQHKRLEGKVAIVTGGARGIGEATVRLFVRHGAKVVIADIEDSLGESLAASLAPAA  80

Query  241  RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG----PGGSIAEMKMEQLASLLA  408
             +VHCDV  E DVE  V   L   G+LD++ NNAG+ G       SI  +  ++L  ++ 
Sbjct  81   TFVHCDVGSEPDVERLVDRTLARHGRLDVLVNNAGVLGRQAREAKSIMALDADELDWVMR  140

Query  409  INLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAAC  588
            +N+ G   G+KHAARAM+AGG+ G+I+  +S A +MGG+  H Y+ SK A++GL R+AAC
Sbjct  141  VNVRGAALGMKHAARAMVAGGRAGSIVSVASVAGVMGGMGPHAYTASKHALVGLTRNAAC  200

Query  589  ELGQHGIRVNCVSPHGVPSEMLVSAYR---MILGKTDVMAEEVGKI--VGErgsllrgrg  753
            ELG  GIRVNCVSP GV + MLV A+R     + +    AEEV K+  +    + LRG  
Sbjct  201  ELGARGIRVNCVSPFGVATHMLVDAWRDGDEGVDRGTPSAEEVEKMEEIVRGLANLRGPT  260

Query  754  grMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
                DVA+A L+LAS+++ +V+GHNL++DGG T++
Sbjct  261  LTPRDVAEAALYLASDEAKYVSGHNLVVDGGVTTS  295



>ref|XP_003626026.1| Momilactone A synthase [Medicago truncatula]
 gb|AES82244.1| short-chain dehydrogenase/reductase [Medicago truncatula]
Length=266

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 158/260 (61%), Gaps = 12/260 (5%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHC  255
            R  L GKVA++TGGA GIGAETAK    NG  V+IADI DELG  +A SIG     Y HC
Sbjct  3    RKRLEGKVAIVTGGASGIGAETAKTFVENGAFVVIADINDELGHQVATSIGLDKVSYHHC  62

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVH  432
            DV  E  VE  V  ALE  G LDIMF+NAGI G    SI E  + +  + +AIN+ G + 
Sbjct  63   DVRDEKQVEETVAFALEKYGTLDIMFSNAGIEGGMSSSILEFDLNEFDNTMAINVRGSLA  122

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
             IKHAAR M+     G+IIC++S AA + G   H Y  SK  +LGLVRS   ELG +GIR
Sbjct  123  AIKHAARFMVERKIRGSIICTASVAASVAGNRGHDYVTSKHGLLGLVRSTCGELGAYGIR  182

Query  613  VNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFL  792
            VN +SP+GV + +   A  M + K +   ++   + G           +   +A+A LFL
Sbjct  183  VNSISPYGVATPLACRALNMEMSKVEANMKDSANLKG--------ITLKATHIAEAALFL  234

Query  793  ASEDSGFVTGHNLILDGGYT  852
            ASE+S +++GHNL++DGG++
Sbjct  235  ASEESAYISGHNLVVDGGFS  254



>ref|XP_007027903.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
 gb|EOY08405.1| Short chain alcohol dehydrogenase, putative [Theobroma cacao]
Length=277

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/277 (44%), Positives = 170/277 (61%), Gaps = 10/277 (4%)
 Frame = +1

Query  58   STDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG  237
            S +  + S    L GKVA+ITGGA GIG  TA+L    G  V+IADI D+LG  + E +G
Sbjct  2    SANSSVASNLRRLQGKVALITGGASGIGECTARLFVHQGAKVVIADIQDDLGQSICEELG  61

Query  238  GR---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLA  408
             +   YVHCDV++++DV +AV LA+   G LDIMFNNAGIAGP  SI     E+   +L 
Sbjct  62   HQSISYVHCDVTRDSDVRNAVDLAVSTYGSLDIMFNNAGIAGPDKSIVSSDDEKFKKVLD  121

Query  409  INLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAAC  588
            +N+ G   G K+AA+ MI   KG  +  SS  + I G  A H Y  SK A++GL ++   
Sbjct  122  VNVFGGYLGAKYAAKVMIPARKGCILFTSSVFSVIGGTDAGHAYVTSKHALVGLAKNLCV  181

Query  589  ELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMED  768
            ELGQ+GIRVNC+SP GV + +L   + M+        E+V ++V +  +L        +D
Sbjct  182  ELGQYGIRVNCISPFGVATPLLRKPFGMM------EKEKVEELVSKGANLKGTVLKP-DD  234

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSFI  879
            VAQA L+LAS++S +V+G NL++DGGY++    MS +
Sbjct  235  VAQAALYLASDESKYVSGLNLVIDGGYSTTNPSMSTV  271



>ref|XP_002323405.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEF05166.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=276

 Score =   209 bits (532),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/269 (45%), Positives = 172/269 (64%), Gaps = 12/269 (4%)
 Frame = +1

Query  58   STDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG  237
            ST   + +    L GKVA+ITGGA GIG  TAK+ + +G  V+IADI DELG  + E++G
Sbjct  2    STTAFISTIARRLQGKVALITGGASGIGECTAKVFSHHGAKVVIADIQDELGHSVVEALG  61

Query  238  ---GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG-GSIAEMKMEQLASLL  405
                 YV CDV++EA +++AV  A+   GKLDIM NNAGIA      I + +M     +L
Sbjct  62   PSNSTYVRCDVTEEAQIKNAVDKAISTYGKLDIMLNNAGIADDSKARIIDNEMADFERVL  121

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
             IN+ GV  GIKHAAR MI   + GTII ++S ++++G  ASH Y  SK A+LGL R+AA
Sbjct  122  KINVTGVFLGIKHAARVMIPA-RSGTIISTASVSSLLGAAASHAYCCSKHAVLGLTRNAA  180

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
             ELGQ GIRVNC+SP+ + + +     R  +G  D   +E  +I     + L+G   + E
Sbjct  181  AELGQFGIRVNCLSPYALATPLA----RKFIGVDD---DEALEIAMNSFANLKGVTLKTE  233

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGYT  852
            DVA A L+LAS+++ +++GHNL +DGG++
Sbjct  234  DVANAALYLASDEARYISGHNLFIDGGFS  262



>ref|XP_006367066.1| PREDICTED: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial-like 
[Solanum tuberosum]
Length=266

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 168/258 (65%), Gaps = 14/258 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            LNGK+A+ITGGA GIG  TA L A +G  V+IADI +E G  +AESIG     ++ CDV+
Sbjct  13   LNGKIAIITGGASGIGEATAYLFAQHGAQVVIADIQEEKGRSVAESIGSTHCTFIKCDVT  72

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPG---GSIAEMKMEQLASLLAINLNGVVHG  435
             E  V+S V+  +E  G++DIMF+NAGIA        I    ++ L +L A+N+ G V  
Sbjct  73   DEQQVQSLVQSTVEIHGRVDIMFSNAGIASHNEHAQDILGFNLDALDNLFAVNVRGSVAC  132

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAA+AM+ GG  G IIC++S+AA MG      Y++SK A+LGLVRSA+  LG +GIRV
Sbjct  133  VKHAAKAMVEGGVKGKIICTASAAATMGVTRQIDYAMSKHAVLGLVRSASKGLGAYGIRV  192

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP  V + +L  + +M +       EE+ K+  E  + L+    R   VA AVLFLA
Sbjct  193  NCVSPAAVATPLLEKSMKMGV-------EELEKLF-ESFNCLKVGALRASHVADAVLFLA  244

Query  796  SEDSGFVTGHNLILDGGY  849
            S+DS F+TGHNL++DGGY
Sbjct  245  SDDSQFITGHNLVVDGGY  262



>ref|XP_008238188.1| PREDICTED: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial-like 
[Prunus mume]
Length=270

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 173/264 (66%), Gaps = 12/264 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVD-VIIADILDELGAPLAESIGGR---YVHCDV  261
            L GKVA++TGGA GIG  TA+  A +GV  V+IAD+ DE G  +A SIG     Y+HCDV
Sbjct  12   LQGKVAIVTGGASGIGEGTARKFALHGVRAVVIADVQDEKGQNVAASIGSDRSIYIHCDV  71

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPG-GSIAEMKMEQLASLLAINLNGVVHGI  438
            + E  V+S ++  +   G+LDIMF+NAG+   G  ++ E+ +     ++A+N  G+   +
Sbjct  72   TDEDQVKSLIESTVRIYGRLDIMFSNAGVGSAGEQTVLELDLAMYDRVMAVNARGMAASV  131

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAARAM+ GG  G+I+C++S  A MG      Y++SK A+LGL+RSA+ +LG +GIRVN
Sbjct  132  KHAARAMVEGGVRGSIVCTASVTASMGSAKFADYTMSKHAVLGLMRSASVQLGAYGIRVN  191

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEE--VGKIVGErgsllrgrggrMEDVAQAVLFL  792
            CVSP  V + +L S++     K   +AEE  VG +V     L  G+   +E++A  V+FL
Sbjct  192  CVSPGSVTTPLLRSSF-----KAGAVAEEEDVGMLVESSLRLKVGKTISVENIADGVVFL  246

Query  793  ASEDSGFVTGHNLILDGGYTSAVS  864
            AS+DS FVTGHNL++DGG+ S ++
Sbjct  247  ASDDSEFVTGHNLVVDGGFISRIT  270



>ref|XP_002272206.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Vitis vinifera]
Length=268

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 166/259 (64%), Gaps = 19/259 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAP----LAESIGGRYVHCDV  261
            L GKVA+ITGGA GIG  TA+L + +G  V+IADI D LG      L+      +VHCDV
Sbjct  14   LQGKVALITGGASGIGESTARLFSRHGAKVVIADIQDNLGQSVCKELSSPTSASFVHCDV  73

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG-SIAEMKMEQLASLLAINLNGVVHGI  438
            + E DVE+A+ +A+   GKLDIMFNNAGI G    +I +    +   +L +N+ G   G 
Sbjct  74   TSEKDVENAINVAVAKYGKLDIMFNNAGIVGESKPNILDNDKTEFEKILNVNVVGAFLGT  133

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI  G G +II ++S  + +GG+ASH Y+ SK A++GL R+AA ELG++GIRVN
Sbjct  134  KHAARVMIPAGNG-SIITTASVCSTVGGVASHAYTSSKHAVVGLARNAAVELGKYGIRVN  192

Query  619  CVSPHGVPSEMLVSAYRM-ILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            CVSP+ V + +    +++   G + V +   GK++              EDVA+A L+LA
Sbjct  193  CVSPYLVVTPLAKDFFKLDDDGASGVYSNLKGKVLNP------------EDVAEAALYLA  240

Query  796  SEDSGFVTGHNLILDGGYT  852
            SE+S +V+GHNL++DGG+T
Sbjct  241  SEESKYVSGHNLLIDGGFT  259



>ref|XP_010244664.1| PREDICTED: secoisolariciresinol dehydrogenase isoform X4 [Nelumbo 
nucifera]
Length=296

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 173/278 (62%), Gaps = 10/278 (4%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            ES  +   ++   L GKVA+ITG ARGIG  TA     NG  V+IADI  +LG   A  +
Sbjct  18   ESIKRGFSTQSGRLEGKVALITGAARGIGKATATEFIKNGAKVVIADIRRQLGQDAAVEL  77

Query  235  G--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLL  405
            G    +V CDV++E+D+  AV   +   G LDIM+NNAGIAG    SI ++ M +   ++
Sbjct  78   GPNATFVSCDVTRESDISDAVDFTISKHGCLDIMYNNAGIAGNTPPSIVDLDMTEFDRIM  137

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            +IN+ GVV GIKHAAR MI   + G I+C+ S  A+MGGL+   YS+SK A++G+V+S A
Sbjct  138  SINVRGVVAGIKHAARVMIPR-RSGCILCTGSVTALMGGLSPPSYSISKGAVVGIVKSVA  196

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrM  762
             E+ ++GIRVNC+SP  +P+  ++    +M  G  +    E+ +  GE            
Sbjct  197  SEMCKYGIRVNCISPFAIPTPFVMEEMVKMFPGVDEQRLVEMVQGPGELAGANCEA----  252

Query  763  EDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            ED+A A L+LAS+D+ +V+GHNL++DGG+TS + ++ F
Sbjct  253  EDIANAALYLASDDAKYVSGHNLVVDGGFTS-IKRLGF  289



>ref|XP_002272942.2| PREDICTED: short-chain dehydrogenase reductase 3b-like [Vitis 
vinifera]
Length=262

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 157/259 (61%), Gaps = 11/259 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHC  255
            R  L GKVA++TG A GIG E  +L A NG  V++AD+ DELG  +  SIG     Y HC
Sbjct  3    RPRLEGKVALVTGAASGIGEEAVRLFAENGAFVVVADVQDELGHQVISSIGSEKVSYRHC  62

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHG  435
            DV  E  VE  V   L+  G LD++F+NAGI GP   I E+ ++   + +A N+ GV   
Sbjct  63   DVRDEKQVEETVAYTLDKYGSLDVLFSNAGIIGPLTGILELDLQGFDNTMATNVRGVAAT  122

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            IKHAARAM+A    G+IIC++S AA +GG   H Y+ SK A++GLVR+A  ELG +GIRV
Sbjct  123  IKHAARAMVARSIRGSIICTTSVAAALGGAGPHAYTTSKHALIGLVRAACSELGAYGIRV  182

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP G  + +   AY +   + +     +  + G           +   +A+A +FLA
Sbjct  183  NCVSPFGTATPLSCRAYNLEPSEVEANILALSNLKG--------IVLKARHIAEAAVFLA  234

Query  796  SEDSGFVTGHNLILDGGYT  852
            S++S +++GHNL +DGG+T
Sbjct  235  SDESAYISGHNLAIDGGFT  253



>ref|XP_009615792.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Nicotiana 
tomentosiformis]
Length=266

 Score =   208 bits (530),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 168/268 (63%), Gaps = 13/268 (5%)
 Frame = +1

Query  64   DQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR  243
            D  + S    L+ K+A+ITGGA GIG  TA+L A +G  V+IADI +E G  +AESIG  
Sbjct  2    DSPIPSLTKKLDSKIAIITGGASGIGEATARLFAEHGAKVVIADIQEEKGRSVAESIGSS  61

Query  244  ---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGS---IAEMKMEQLASLL  405
               ++ CDV+ E  V+S V+  +E  G++DIMF+NAGIA    +   I    ++ L +L 
Sbjct  62   HCSFIKCDVTDEQQVQSLVQSTVEIHGRVDIMFSNAGIASTNDNEQDILGFNLDALDNLF  121

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            AIN+ G    +KHAA+AM+ GG  G IIC+ S  A MG      Y++SK AILGLV+SA+
Sbjct  122  AINVRGSAACVKHAAKAMVEGGVKGKIICTGSVTATMGVTKQIDYAMSKHAILGLVKSAS  181

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrME  765
              LG++GIRVNCVSP  V + +L  + +M +       EE+ K+      L  G   +  
Sbjct  182  KGLGKYGIRVNCVSPAAVATPLLEKSMKMSV-------EEIEKLFDSFNCLKTGAAIKAS  234

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGY  849
            +VA AVLFLAS+DS FVTGHNL++DGG+
Sbjct  235  NVADAVLFLASDDSQFVTGHNLVVDGGF  262



>ref|XP_007215764.1| hypothetical protein PRUPE_ppa009553mg [Prunus persica]
 gb|EMJ16963.1| hypothetical protein PRUPE_ppa009553mg [Prunus persica]
Length=287

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 176/294 (60%), Gaps = 34/294 (12%)
 Frame = +1

Query  37   RTTKTHESTDQMLCSKRSF----------LNGKVAVITGGARGIGAETAKLLAGNGVDVI  186
            R  K +   D +L   R F          L GKVA+ITG A G+G  TA+     G  VI
Sbjct  7    REFKLNSCNDFLLKRTRLFSTRAGGGHGRLEGKVALITGSASGLGKATAQEFIQQGAHVI  66

Query  187  IADILDELGAPLAESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG  360
            IAD   ELG  +A+ +G    +V CDVS E+ +  AV+ A+   GKLDIM+NNAGI GP 
Sbjct  67   IADTDSELGQQVAKELGPAAHFVQCDVSLESQIAEAVETAVARHGKLDIMYNNAGITGPA  126

Query  361  --GSIAEMKMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASH  534
               SIA++ +E+   ++ +N+ G V G+KHAAR M+  G  G+I+C+SS + ++GGL  H
Sbjct  127  FPPSIADLDLEEFDRVMRVNVRGAVAGMKHAARVMVPAG-AGSILCTSSISGVLGGLGPH  185

Query  535  PYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGK  714
            PYS+SK  I GLV+S A EL + G+RVNC+SP  +P+EM  S   ++ G        VG+
Sbjct  186  PYSISKFTIPGLVKSVASELCRSGVRVNCISPGPIPTEM--SVIEIVNG--------VGE  235

Query  715  IVGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            + G             +DVAQA ++LAS+++ +VTGHNL++DGG+T     +SF
Sbjct  236  LKG--------AKCEEKDVAQAAVYLASDEAKYVTGHNLVVDGGFT-CFKTLSF  280



>ref|XP_008442351.1| PREDICTED: short-chain dehydrogenase reductase 2a [Cucumis melo]
Length=307

 Score =   209 bits (533),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/273 (44%), Positives = 173/273 (63%), Gaps = 17/273 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA++TGGA+GIG  T +L A +G  V+IAD+ D LG  LA+++      +VHCDVS
Sbjct  32   LEGKVAIVTGGAKGIGEATVRLFAKHGAKVVIADVEDILGQALADTLSPSPVSFVHCDVS  91

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGG----SIAEMKMEQLASLLAINLNGVVH  432
             E DVE  V   +   G +DI+FNNAG+ G       SI +   ++   ++ +N+ GV  
Sbjct  92   SEDDVERLVSTTVCLHGHVDIIFNNAGVLGSQSKSHKSILDFDPDEFERVMRVNVKGVAL  151

Query  433  GIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIR  612
            GIKHAAR MI    G  II ++S A ++GGL  H Y+ SK AI+GL ++ ACELG+HGIR
Sbjct  152  GIKHAARVMIPRATG-CIISTASVAGVLGGLGPHAYTASKHAIVGLTKNTACELGRHGIR  210

Query  613  VNCVSPHGVPSEMLVSAYRMILGKTDVM-------AEEVGKIVGErgsllrgrggrM--E  765
            VNC+SP GV + MLV+A+R  + + D         A EV K+      L   +G  +  +
Sbjct  211  VNCISPFGVATSMLVNAWRADVEEEDQCMNYGVPSAAEVDKMEEFVRGLANLKGPTLRPK  270

Query  766  DVAQAVLFLASEDSGFVTGHNLILDGGYTSAVS  864
            D+AQA L+LAS++S +++GHNL++DGG T++ +
Sbjct  271  DIAQAALYLASDESKYISGHNLVVDGGITTSTN  303



>ref|XP_006294086.1| hypothetical protein CARUB_v10023080mg, partial [Capsella rubella]
 gb|EOA26984.1| hypothetical protein CARUB_v10023080mg, partial [Capsella rubella]
Length=495

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/256 (45%), Positives = 169/256 (66%), Gaps = 14/256 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGRYVHCDVSKEA  273
            L+GK+ +ITGGA GIGAE+A L   +G  V+I D+ DELG  LA SIG  Y HCDV+ E 
Sbjct  247  LDGKIVIITGGASGIGAESAMLFTEHGARVVIVDVQDELGQNLAASIGASYYHCDVTNET  306

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            +VE+AVK  +   GKLD++F+NAG+  P  SI ++ +++L  +LAINL G    IKHAAR
Sbjct  307  EVENAVKFTIGKHGKLDVLFSNAGVIEPFASILDLNLDELDRILAINLRGAAAFIKHAAR  366

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
            AM+  G  G+I+C++S AA + G A H Y+ SK  +LGL++SA+  LGQ+GIRVN V+P 
Sbjct  367  AMVEKGTRGSIVCTTSVAAEISGTAPHGYTASKHGLLGLIKSASGGLGQYGIRVNGVAPF  426

Query  634  GVPSEMLVSAYRM---ILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            GV + ++ + +++   ++ +  + +  +  IV            +   VA+A LFLAS++
Sbjct  427  GVATPLVCNGFKIEPAVVEENTLASANLKGIV-----------LKARHVAEAALFLASDE  475

Query  805  SGFVTGHNLILDGGYT  852
            S +V+G NL +DGGY+
Sbjct  476  SAYVSGQNLAVDGGYS  491


 Score =   169 bits (428),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 128/197 (65%), Gaps = 11/197 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GK+ +ITGGA GIGAE+A+L   +G  V+I D+ +ELG  +  SIG     +  CDV+
Sbjct  2    LDGKIVIITGGASGIGAESARLFTEHGAKVVIVDVQEELGQNVVVSIGTEKASFYCCDVT  61

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIA--------GPGGSIAEMKMEQLASLLAINLN  420
             E +VE+AVK  +E  GKLD++F+NAG+          P GSI ++ +E+    +A+N+ 
Sbjct  62   NETEVENAVKFTVEKHGKLDVLFSNAGVILFSQPGVLEPPGSILDLDLEKFDRTMAVNVR  121

Query  421  GVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQ  600
            G    IKHAARAM+  G  G+I+C++S  A +GG   H Y+ SK  ++GL+RS   +LG+
Sbjct  122  GAAVFIKHAARAMVEKGTRGSIVCTTSVTAEIGGQGPHEYTASKHGLVGLIRSVCGDLGK  181

Query  601  HGIRVNCVSPHGVPSEM  651
            HGIR+N V+P GV + M
Sbjct  182  HGIRINGVAPFGVATAM  198



>ref|XP_002971756.1| hypothetical protein SELMODRAFT_96102, partial [Selaginella moellendorffii]
 gb|EFJ27505.1| hypothetical protein SELMODRAFT_96102, partial [Selaginella moellendorffii]
Length=270

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/258 (45%), Positives = 165/258 (64%), Gaps = 22/258 (9%)
 Frame = +1

Query  121  GGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG----RYVHCDVSKEADVESA  288
            GGA GIGA TA+L A NG  ++IADI DE GA L   +GG    RYVHCDV  EAD+  A
Sbjct  1    GGANGIGAATARLFASNGARLVIADIDDESGARLEAEVGGPAVCRYVHCDVGSEADIVRA  60

Query  289  VKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGIKHAARAM  459
            V+ A+   G+LD+M NNAG+     P  SI+ M+  +L  L A+N+ G   GIKHA+R M
Sbjct  61   VRTAVSEFGRLDVMHNNAGVLNGRHPSPSISSMEAAELDFLYAVNVRGAALGIKHASRVM  120

Query  460  IAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPHGV  639
            I     G+I+C++S +A++ GLA HPY+++K AILGLV++ A EL  +GIRVNC++P+GV
Sbjct  121  IEQHVQGSILCTASVSAMVAGLALHPYTITKHAILGLVKTCALELAHYGIRVNCITPNGV  180

Query  640  PSEMLVSAYRMIL------GKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
             +++L S  R +       GK+   AE    +               EDVA+A LFLAS+
Sbjct  181  LTDLLCSVGRHLRHLEIRDGKSCPGAENCEDL---------RTMLAPEDVAKAALFLASD  231

Query  802  DSGFVTGHNLILDGGYTS  855
            DS +++GH+L++DG +++
Sbjct  232  DSKYISGHSLVIDGSFSA  249



>gb|ABK24336.1| unknown [Picea sitchensis]
 gb|ACN40053.1| unknown [Picea sitchensis]
Length=291

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 171/268 (64%), Gaps = 26/268 (10%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITGGA GIG    +L   +G  VI+ADI DE G  LA S+     YVHCDVSK
Sbjct  25   LKGKVAIITGGASGIGEAIVRLFTKHGAKVILADIADEAGRNLAGSLSPPATYVHCDVSK  84

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG--SIAEMKMEQLASLLAINLNGVVHGIK  441
            E DV +AV LA+E  G+LDIM+NNAG        S+AE +MEQ   ++++N+ G + GIK
Sbjct  85   EQDVRAAVDLAMEKHGQLDIMYNNAGTIEFVAVESVAEYEMEQFDRVMSVNVRGAMLGIK  144

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   KG  II ++S A I+GGL  + Y+ SK AILGL ++ A ELG++GIRVN 
Sbjct  145  HAARVMIPRKKG-CIISTASVAGILGGLTPYAYTASKHAILGLTKNGAAELGKYGIRVNT  203

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEE-----------VGKIVGErgsllrgrggrMED  768
            VSP GV + +LV+  +   G   V++EE           +G + G           R ED
Sbjct  204  VSPSGVATALLVNYNKQ--GNGSVVSEEDKAAVEAYCTSIGNLEG--------ATLRAED  253

Query  769  VAQAVLFLASEDSGFVTGHNLILDGGYT  852
            +A+A L+LAS+++ +V+GHNL++DGG++
Sbjct  254  IAEAGLYLASDEAKYVSGHNLVVDGGFS  281



>ref|XP_008780581.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Phoenix 
dactylifera]
Length=268

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 166/258 (64%), Gaps = 11/258 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITG A GIG  TA++ A +G  V+IADI DELGA +  SIG    +Y HCDV 
Sbjct  5    LEGKVAIITGAASGIGEATARIFAAHGALVVIADIQDELGAGVVASIGPDKCKYKHCDVR  64

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIK  441
             E +VE  V  A++  G+LDIMF+NAGI+     SI ++  + L +++A+N+ GV   IK
Sbjct  65   SEKEVEELVGFAIKAYGRLDIMFSNAGISEKITSSILDVDFDVLDNVIAVNVRGVAATIK  124

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HA RAM+A G  G+IIC++S AA  GG     Y+ SK A++GLVRSAA ELG+HGIR NC
Sbjct  125  HAGRAMVASGTRGSIICTASVAATRGGYGRAVYTTSKHAMVGLVRSAAAELGRHGIRANC  184

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP GV +  + +   +   +T+   E +  + G       G   +  D+ +A LFLAS+
Sbjct  185  VSPAGVATPRVQNYTGLSQSQTEEFFEGMMVLKG-------GGPLKASDIGEAALFLASD  237

Query  802  DSGFVTGHNLILDGGYTS  855
            +S FVTG NLI+DGG T+
Sbjct  238  ESAFVTGQNLIVDGGVTA  255



>ref|XP_006855389.1| hypothetical protein AMTR_s00057p00137740 [Amborella trichopoda]
 gb|ERN16856.1| hypothetical protein AMTR_s00057p00137740 [Amborella trichopoda]
Length=296

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 170/265 (64%), Gaps = 7/265 (3%)
 Frame = +1

Query  67   QMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--G  240
            ++L +++  L GKV +ITG A GIG   A+    NG  VII D+ D LG   A  +G   
Sbjct  25   RLLSTQQRRLEGKVTIITGAASGIGKAIAEEFIRNGAKVIITDVQDALGEQTAAQLGPNA  84

Query  241  RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG-GSIAEMKMEQLASLLAINL  417
             Y HCDV++E++V + V LA+   G+LD+M NNAG+ GP   S+  + +     ++ +NL
Sbjct  85   SYSHCDVTQESEVSAVVDLAVSGHGRLDVMHNNAGVPGPLIPSVTNLDLTDFDKVMQVNL  144

Query  418  NGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELG  597
             G + G+KHAAR MI   K G I+C++S   I+ GLA HPYS+SK AI+GL++S A ELG
Sbjct  145  RGALAGMKHAARVMIPN-KSGCILCTASITGILTGLAPHPYSVSKFAIIGLMKSMASELG  203

Query  598  QHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQ  777
            +HGIRVNC+SP  +P+ + +     +    D+  E+  +I+      L+G    +ED+A+
Sbjct  204  RHGIRVNCISPFAIPTPLALDGMAHMF--PDMGVEKRSEIL-RGTGELQGANCEVEDIAK  260

Query  778  AVLFLASEDSGFVTGHNLILDGGYT  852
            A ++LAS+D+ +V+GHNL++DGG+T
Sbjct  261  AAVYLASDDAKYVSGHNLVVDGGFT  285



>ref|XP_010244663.1| PREDICTED: secoisolariciresinol dehydrogenase isoform X3 [Nelumbo 
nucifera]
Length=297

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 169/267 (63%), Gaps = 10/267 (4%)
 Frame = +1

Query  88   SFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDV  261
            S L GKVA+ITG ARGIG  TA     NG  V+IADI  +LG   A  +G    +V CDV
Sbjct  30   SRLEGKVALITGAARGIGKATATEFIKNGAKVVIADIRRQLGQDAAVELGPNATFVSCDV  89

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            ++E+D+  AV   +   G LDIM+NNAGIAG    SI ++ M +   +++IN+ GVV GI
Sbjct  90   TRESDISDAVDFTISKHGCLDIMYNNAGIAGNTPPSIVDLDMTEFDRIMSINVRGVVAGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI   + G I+C+ S  A+MGGL+   YS+SK A++G+V+S A E+ ++GIRVN
Sbjct  150  KHAARVMIPR-RSGCILCTGSVTALMGGLSPPSYSISKGAVVGIVKSVASEMCKYGIRVN  208

Query  619  CVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            C+SP  +P+  ++    +M  G  +    E+ +  GE            ED+A A L+LA
Sbjct  209  CISPFAIPTPFVMEEMVKMFPGVDEQRLVEMVQGPGELAGANCEA----EDIANAALYLA  264

Query  796  SEDSGFVTGHNLILDGGYTSAVSQMSF  876
            S+D+ +V+GHNL++DGG+TS + ++ F
Sbjct  265  SDDAKYVSGHNLVVDGGFTS-IKRLGF  290



>ref|XP_002321085.2| short-chain dehydrogenase/reductase family protein, partial [Populus 
trichocarpa]
 gb|EEE99400.2| short-chain dehydrogenase/reductase family protein, partial [Populus 
trichocarpa]
Length=291

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 176/271 (65%), Gaps = 13/271 (5%)
 Frame = +1

Query  67   QMLCSKRSF-----LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAES  231
            ++L + R F     L GKVA+ITGGA GIG  TA     +G  VIIAD+  E+G   A  
Sbjct  11   RVLLASRCFGLGSKLEGKVALITGGASGIGKTTAHEFIKHGARVIIADVDSEIGPQAANE  70

Query  232  IG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLAS  399
            +G    +V CDV+ EA VE AV +AL   GKLDIM+NNAGI GP    SIA++ +++   
Sbjct  71   LGPAAHFVQCDVTAEAQVEKAVGIALTNHGKLDIMYNNAGITGPSFPPSIADLDLDEFDK  130

Query  400  LLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRS  579
            ++ IN+ G+V GIKHAARAMI  G G  I+C+SS + +MGGL SH YS SKS I G+V+S
Sbjct  131  VMQINVRGMVAGIKHAARAMIPAGSG-CILCTSSISGLMGGLGSHSYSASKSTIPGIVKS  189

Query  580  AACELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggr  759
             A EL ++G+R+NC+SP  +P+ + ++   ++        E++ +IV   G L   +   
Sbjct  190  VASELCENGVRINCISPGPIPTTLSLAQIGLVY--PGASQEQLIEIVNGLGKLKGAKCEE  247

Query  760  MEDVAQAVLFLASEDSGFVTGHNLILDGGYT  852
            + DVA+A L+LAS+++ ++TGHNL++DGG T
Sbjct  248  I-DVAEAALYLASDEAKYITGHNLVVDGGLT  277



>ref|XP_010244662.1| PREDICTED: secoisolariciresinol dehydrogenase isoform X2 [Nelumbo 
nucifera]
Length=309

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 173/278 (62%), Gaps = 10/278 (4%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            ES  +   ++   L GKVA+ITG ARGIG  TA     NG  V+IADI  +LG   A  +
Sbjct  31   ESIKRGFSTQSGRLEGKVALITGAARGIGKATATEFIKNGAKVVIADIRRQLGQDAAVEL  90

Query  235  G--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLL  405
            G    +V CDV++E+D+  AV   +   G LDIM+NNAGIAG    SI ++ M +   ++
Sbjct  91   GPNATFVSCDVTRESDISDAVDFTISKHGCLDIMYNNAGIAGNTPPSIVDLDMTEFDRIM  150

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            +IN+ GVV GIKHAAR MI   + G I+C+ S  A+MGGL+   YS+SK A++G+V+S A
Sbjct  151  SINVRGVVAGIKHAARVMIPR-RSGCILCTGSVTALMGGLSPPSYSISKGAVVGIVKSVA  209

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrM  762
             E+ ++GIRVNC+SP  +P+  ++    +M  G  +    E+ +  GE            
Sbjct  210  SEMCKYGIRVNCISPFAIPTPFVMEEMVKMFPGVDEQRLVEMVQGPGELAGANCEA----  265

Query  763  EDVAQAVLFLASEDSGFVTGHNLILDGGYTSAVSQMSF  876
            ED+A A L+LAS+D+ +V+GHNL++DGG+TS + ++ F
Sbjct  266  EDIANAALYLASDDAKYVSGHNLVVDGGFTS-IKRLGF  302



>ref|XP_007206370.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
 gb|EMJ07569.1| hypothetical protein PRUPE_ppa017863mg [Prunus persica]
Length=270

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/269 (44%), Positives = 169/269 (63%), Gaps = 18/269 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITGGA GIG  TA+L + +G  V+IAD+ D L   +   +      +VHCDV+
Sbjct  14   LEGKVALITGGASGIGESTARLFSKHGAKVVIADVQDNLAESICRDLSSSSTSFVHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGS-IAEMKMEQLASLLAINLNGVVHGIK  441
            KE DVE+AVK A    GKLDIMFNNAGIAG   + I +    +   ++ +NL GV  GIK
Sbjct  74   KEEDVENAVKTATSKYGKLDIMFNNAGIAGIAKTNILDNDKAEFEQVIGVNLVGVFLGIK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI  G+G +II ++S+ + +GG ASH Y+ SK  +LGL+R+ A ELGQHGIRVNC
Sbjct  134  HAARVMIPAGQG-SIINTASACSTIGGCASHAYTSSKHGVLGLMRNTAIELGQHGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRM-ILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            VSP+ V + +    +++   G   V +   G ++            + ED+A+A L+L S
Sbjct  193  VSPYIVATPLAKDFFKLDDDGVHGVYSNLKGGVL------------KAEDIAEAALYLGS  240

Query  799  EDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            ++S +V+GHNL++DGG+T   ++     Q
Sbjct  241  DESKYVSGHNLLVDGGFTIVNARFCIFEQ  269



>emb|CDP19818.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 161/259 (62%), Gaps = 11/259 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHC  255
            +  L GKVA+ITG A GIG ET +L A NG  ++ AD+ DELG  +A ++G     Y HC
Sbjct  17   KPRLEGKVALITGAASGIGKETVRLFAENGAYIVAADVQDELGQKVAATMGSEKVSYHHC  76

Query  256  DVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHG  435
            DV  E  VE+ V   L+  G LDI+F+NAG  GP  SI ++ ++ L + +A N+ GV   
Sbjct  77   DVRDEMQVEATVNYTLDKYGSLDILFSNAGTIGPLTSILDLDLQGLDNAMATNVRGVAAT  136

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            IKHAARAM+A    G+IIC++S AA +GG   H Y+ SK A++GLVR+A  ELG +GIRV
Sbjct  137  IKHAARAMVARKVRGSIICTASVAACLGGAGPHAYTTSKHALVGLVRTACHELGAYGIRV  196

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            N ++P GV + +   AY +   + +        + G           + + +A+A LFLA
Sbjct  197  NAIAPFGVATPLCCKAYNLEPSQVEENCLNAANLKG--------IVLKAKHIAEAALFLA  248

Query  796  SEDSGFVTGHNLILDGGYT  852
            S++S +++GHNL++DGG+T
Sbjct  249  SDESAYISGHNLVIDGGFT  267



>gb|ACN40791.1| unknown [Picea sitchensis]
Length=297

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/259 (46%), Positives = 165/259 (64%), Gaps = 10/259 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L GKVAVITGGA GIG  +AKL   NG  V+IADI D+ G  LA+S+     + HCDVSK
Sbjct  3    LKGKVAVITGGASGIGEASAKLFVENGAQVVIADIQDDHGNRLAQSLAPNACFFHCDVSK  62

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E DV + V  ALE  G+LDI+F+NAGI  PGG   S+A++ +E L  ++++N+ G     
Sbjct  63   ETDVSALVDYALEKHGRLDIVFSNAGI--PGGLFSSMADVTLEDLERVISVNVRGAYLCT  120

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI     G+I+ +SS A++M       Y+ SK A+LG+++SAA +L  HGIRVN
Sbjct  121  KHAARVMIGAKTRGSILLTSSMASVMAMPNGPSYTASKHAVLGIMKSAATDLAPHGIRVN  180

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            CVSP GV + ML+ A +      D   +     + E    L+G     +DVA++ LFL S
Sbjct  181  CVSPAGVSTPMLIDAMKKSFPSFD---KHCADEMLETTMELKGLTLEADDVAKSALFLCS  237

Query  799  EDSGFVTGHNLILDGGYTS  855
            +D+ +++GHNL++DG +TS
Sbjct  238  DDARYISGHNLVIDGAFTS  256



>emb|CBI18081.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 165/260 (63%), Gaps = 19/260 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG--RYVHCDVSK  267
            L GK+AV+TGGARGIG  T +L A +G  V+IAD+ D LGA LA S+     +VHCDVS 
Sbjct  30   LEGKIAVVTGGARGIGEATVRLFARHGAKVVIADVEDTLGAALASSLAPSVTFVHCDVSL  89

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEMKMEQLASLLAINLNGVVHGI  438
            E D+E+ +   +   G+LDI+FNNAG+ G      SI +  +++   ++ +N+ G+  GI
Sbjct  90   EEDIENVINSTVSRYGRLDILFNNAGVLGNQSKHKSIIDFDIDEFDQVMRVNVRGMALGI  149

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+  G G  II ++S A +MGGL  H Y+ SK AI+GL ++ ACELG++GIRVN
Sbjct  150  KHAARVMVPRGMG-CIISTASVAGVMGGLGPHAYTASKHAIVGLTKNTACELGRYGIRVN  208

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            C+SP GV + ML    +M     +     +  + G             +D+A+A L+LAS
Sbjct  209  CISPFGVATSMLREVEKM-----EEFVSGLANLKGHILRA--------KDIAEAALYLAS  255

Query  799  EDSGFVTGHNLILDGGYTSA  858
            ++S +V+GHNL++DGG T++
Sbjct  256  DESKYVSGHNLVVDGGITTS  275



>ref|XP_009771385.1| PREDICTED: short-chain dehydrogenase reductase 3c isoform X1 
[Nicotiana sylvestris]
Length=295

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 162/257 (63%), Gaps = 7/257 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVAVITG A GIG ETA     +G  V+IADI  +LG   A  +G    +V CDV+K
Sbjct  32   LEGKVAVITGAASGIGKETAAQFINHGAKVVIADIQRQLGQETASELGPNATFVPCDVTK  91

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+++   V  A+   G+LDIM+NNAGIA     SI ++ + +   ++AIN+ GVV GIKH
Sbjct  92   ESEISDVVDYAVSQHGQLDIMYNNAGIACRTPPSIVDLDLARFDRVMAINVRGVVAGIKH  151

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI  G  G I+C++S   ++GGLA   YS SKS+++G+V+S   +L + GIR+NC+
Sbjct  152  AARVMIPRG-SGCILCTASVTGVIGGLAQPTYSTSKSSVIGIVKSVTAQLSKQGIRINCI  210

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+   +   +    +  V  +++ KI+     L       + DVA A LFLASED
Sbjct  211  SPFAIPTPFSLDEMKHYFPR--VEPQDLAKILHSASELKGAYCEPI-DVANAALFLASED  267

Query  805  SGFVTGHNLILDGGYTS  855
            + F++GHNL++DGG+TS
Sbjct  268  AKFISGHNLVVDGGFTS  284



>ref|XP_010244661.1| PREDICTED: secoisolariciresinol dehydrogenase isoform X1 [Nelumbo 
nucifera]
Length=310

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/260 (45%), Positives = 165/260 (63%), Gaps = 9/260 (3%)
 Frame = +1

Query  88   SFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDV  261
            S L GKVA+ITG ARGIG  TA     NG  V+IADI  +LG   A  +G    +V CDV
Sbjct  43   SRLEGKVALITGAARGIGKATATEFIKNGAKVVIADIRRQLGQDAAVELGPNATFVSCDV  102

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            ++E+D+  AV   +   G LDIM+NNAGIAG    SI ++ M +   +++IN+ GVV GI
Sbjct  103  TRESDISDAVDFTISKHGCLDIMYNNAGIAGNTPPSIVDLDMTEFDRIMSINVRGVVAGI  162

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI   + G I+C+ S  A+MGGL+   YS+SK A++G+V+S A E+ ++GIRVN
Sbjct  163  KHAARVMIPR-RSGCILCTGSVTALMGGLSPPSYSISKGAVVGIVKSVASEMCKYGIRVN  221

Query  619  CVSPHGVPSEMLVSAY-RMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            C+SP  +P+  ++    +M  G  +    E+ +  GE            ED+A A L+LA
Sbjct  222  CISPFAIPTPFVMEEMVKMFPGVDEQRLVEMVQGPGELAGANCEA----EDIANAALYLA  277

Query  796  SEDSGFVTGHNLILDGGYTS  855
            S+D+ +V+GHNL++DGG+TS
Sbjct  278  SDDAKYVSGHNLVVDGGFTS  297



>ref|XP_009771386.1| PREDICTED: short-chain dehydrogenase reductase 3c isoform X2 
[Nicotiana sylvestris]
Length=287

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 162/257 (63%), Gaps = 7/257 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVAVITG A GIG ETA     +G  V+IADI  +LG   A  +G    +V CDV+K
Sbjct  24   LEGKVAVITGAASGIGKETAAQFINHGAKVVIADIQRQLGQETASELGPNATFVPCDVTK  83

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+++   V  A+   G+LDIM+NNAGIA     SI ++ + +   ++AIN+ GVV GIKH
Sbjct  84   ESEISDVVDYAVSQHGQLDIMYNNAGIACRTPPSIVDLDLARFDRVMAINVRGVVAGIKH  143

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI  G  G I+C++S   ++GGLA   YS SKS+++G+V+S   +L + GIR+NC+
Sbjct  144  AARVMIPRG-SGCILCTASVTGVIGGLAQPTYSTSKSSVIGIVKSVTAQLSKQGIRINCI  202

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+   +   +    +  V  +++ KI+     L       + DVA A LFLASED
Sbjct  203  SPFAIPTPFSLDEMKHYFPR--VEPQDLAKILHSASELKGAYCEPI-DVANAALFLASED  259

Query  805  SGFVTGHNLILDGGYTS  855
            + F++GHNL++DGG+TS
Sbjct  260  AKFISGHNLVVDGGFTS  276



>ref|XP_010691689.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 161/258 (62%), Gaps = 17/258 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITGGA GIGA TAKL   +G  V+IA+I D+LG  + +S+      Y+HCDV+
Sbjct  14   LEGKVALITGGASGIGACTAKLFTKHGAKVMIAEIQDDLGLSVCKSLDPSVASYIHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG--PGGSIAEMKMEQLASLLAINLNGVVHGI  438
             E  V++AV   +    KLDIMFNNAGIAG  P  +I ++        +  NL G   G 
Sbjct  74   NEDHVQNAVDSTVAKYKKLDIMFNNAGIAGSHPKPNILDITQSDFEETVKTNLIGPFLGT  133

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI   + G+II ++S  +I+GG+A H Y+ SK  +LGL RS   E GQ+GIRVN
Sbjct  134  KHAARVMIPA-RQGSIITTASVCSIIGGVAPHAYTSSKHGVLGLTRSTTVEFGQYGIRVN  192

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            CVSPH VP+ +    +   L   D   E + KI       L+G   ++EDVA A LFLAS
Sbjct  193  CVSPHAVPTPL----FNKFLQLDD---EGISKIYSN----LKGTWCKVEDVANAALFLAS  241

Query  799  EDSGFVTGHNLILDGGYT  852
            +DS +V+GHNL +DGG+T
Sbjct  242  DDSKYVSGHNLTVDGGFT  259



>ref|XP_002309406.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE92929.1| putative short-chain alcohol dehydrogenase family protein [Populus 
trichocarpa]
Length=270

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 169/271 (62%), Gaps = 14/271 (5%)
 Frame = +1

Query  91   FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDV  261
            +L GKVA+ITGGA GIG  TAK+ A +G  V++ADI DE G  LA+++G     YVHCDV
Sbjct  9    WLEGKVALITGGASGIGECTAKVFAHHGAKVVVADIQDESGRSLAKALGPSNSTYVHCDV  68

Query  262  SKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGS-IAEMKMEQLASLLAINLNGVVHGI  438
            + EA V++AV  A+   GKLDIMFNNAGIA    + I + +      +L  N+ GV  GI
Sbjct  69   TDEAQVKNAVNAAVTTYGKLDIMFNNAGIADESKARIIDNEKVDFERVLQTNVTGVFLGI  128

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI G + GTII ++S ++ +G  ASH Y  SK A+LGL ++AA ELGQ GIRVN
Sbjct  129  KHAARVMIPG-RNGTIISTASVSSKVGAAASHAYCCSKHAVLGLTKNAAVELGQFGIRVN  187

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            C+SP+ + + +     + ++G  D   E +    G    +        EDVA A L+LAS
Sbjct  188  CLSPYALATPLA----KQVIGLDDEQLENLMHAFGTLKGVTLQA----EDVANAALYLAS  239

Query  799  EDSGFVTGHNLILDGGYT-SAVSQMSFIYQE  888
            +++ +V+GHNL +DGG+T    S   F Y E
Sbjct  240  DEARYVSGHNLFIDGGFTIQNPSFRMFQYPE  270



>ref|XP_011006647.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=271

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 164/257 (64%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            L GKVA+ITGG+ GIG   A+L A +G  V+IAD+ DELG  + E +      +VHCDV+
Sbjct  14   LEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHFVCEELKNESASFVHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            +E DVE+AV  A+   GKLDIMFNNAG A  P  +I +    +   +L++N+ G   G K
Sbjct  74   QEKDVENAVNTAVSKHGKLDIMFNNAGAADTPKPNILDNDKAEFEKVLSVNIVGAFLGTK  133

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   +G +II ++S    +GG+ASH Y+ SK  ++GL+R+ A ELGQHGIRVNC
Sbjct  134  HAARVMIPARRG-SIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNC  192

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ V + ++   +++   + +     + + V            + ED+A+A LFL S+
Sbjct  193  VSPYVVLTPLVKDFFKLDDNEVNRFYSNLREAV-----------LKAEDIAEAALFLGSD  241

Query  802  DSGFVTGHNLILDGGYT  852
            +S +V+GHNLI+DGG+T
Sbjct  242  ESKYVSGHNLIVDGGFT  258



>ref|XP_010239603.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Brachypodium 
distachyon]
Length=273

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/262 (46%), Positives = 165/262 (63%), Gaps = 16/262 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI-----GGR--YVH  252
            L GKVA++TGGA GIG   A+L A  G  V+IAD+ D LG  +A SI      GR  Y  
Sbjct  9    LAGKVAIVTGGASGIGEAAARLFASRGATVVIADVQDALGERVAASIVSSAGAGRCSYAR  68

Query  253  CDVSKEADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVV  429
            CDVS EA V + V   +   G LDIM +NAG+   P   + +M +  L  +LA+NL G  
Sbjct  69   CDVSNEAQVAATVSSTVSAHGHLDIMLSNAGVLLHPAQPVTDMDLGLLDRVLAVNLRGAA  128

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
              +KHAARAM++GG+ G+I+C++S A++ GG     Y+ SK A+LGLVR+AA ELG+HG+
Sbjct  129  ACLKHAARAMVSGGRPGSIVCTASVASVQGGYGPATYTASKHAVLGLVRAAAGELGRHGV  188

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            RVNCVSP GV + +      M   + + MAE    + G+          R++DVA+A LF
Sbjct  189  RVNCVSPGGVATPLSCGVTGMGPKEMEAMAEAHNVLKGK--------VLRVQDVAEAALF  240

Query  790  LASEDSGFVTGHNLILDGGYTS  855
            LAS++SGFV+GHNL++DG  T+
Sbjct  241  LASDESGFVSGHNLVVDGAATA  262



>ref|NP_566097.1| short-chain dehydrogenase reductase 5 [Arabidopsis thaliana]
 sp|Q94K41.1|SDR3B_ARATH RecName: Full=Short-chain dehydrogenase reductase 3b; Short=AtSDR3b 
[Arabidopsis thaliana]
 gb|AAK44134.1|AF370319_1 putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAL34280.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAC34234.2| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEC10806.1| short-chain dehydrogenase reductase 3b [Arabidopsis thaliana]
Length=257

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 169/256 (66%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L+GK+ +ITGGA GIGAE+ +L   +G  V+I D+ DELG  +A SIG     Y HCDV+
Sbjct  6    LDGKIVIITGGASGIGAESVRLFTEHGARVVIVDVQDELGQNVAVSIGEDKASYYHCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E +VE+AVK  +E  GKLD++F+NAG+  P  SI ++ + +L   +AINL G    IKH
Sbjct  66   NETEVENAVKFTVEKYGKLDVLFSNAGVIEPFVSILDLNLNELDRTIAINLRGTAAFIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+  G  G+I+C++S AA + G A H Y+ SK  +LGL++SA+  LG++GIRVN V
Sbjct  126  AARAMVEKGIRGSIVCTTSVAAEIAGTAPHGYTTSKHGLLGLIKSASGGLGKYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P GV + ++ + ++M   + +V+ +          + L+G   +   VA+A LFLAS++
Sbjct  186  APFGVATPLVCNGFKM---EPNVVEQNT-----SASANLKGIVLKARHVAEAALFLASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+G NL +DGGY+
Sbjct  238  SAYVSGQNLAVDGGYS  253



>ref|XP_006367070.1| PREDICTED: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial-like 
[Solanum tuberosum]
Length=266

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 166/258 (64%), Gaps = 14/258 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            LNGK+A+ITGGA GIG  TA L A +G  V+IADI +E G  +AESIG     ++ CDV+
Sbjct  13   LNGKIAIITGGASGIGEATAHLFAQHGAQVVIADIQEEKGRSVAESIGSTHCTFIKCDVT  72

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPG---GSIAEMKMEQLASLLAINLNGVVHG  435
             E  V+S V+  +E  G++DIMF+NAGIA        I    ++ L +L A+N+ G V  
Sbjct  73   DEQQVQSLVQSTVEIHGRVDIMFSNAGIASHNEHAQDILGFNLDALDNLFAVNVRGSVAC  132

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            +KHAA+AM+ GG  G IIC++S AA MG      Y++SK A+LGLVRSA+  LG +GIRV
Sbjct  133  VKHAAKAMVEGGVKGKIICTASPAATMGVTTIIDYAMSKHAVLGLVRSASKGLGAYGIRV  192

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP  V + +L    +M +       EE+ K+  E  + L+    R   VA AVLFLA
Sbjct  193  NCVSPAAVATPLLEKMMKMGV-------EELEKLF-ESSNCLKIGALRASHVADAVLFLA  244

Query  796  SEDSGFVTGHNLILDGGY  849
            S+DS F+TGHNL++DGGY
Sbjct  245  SDDSQFITGHNLVVDGGY  262



>ref|XP_006492460.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Citrus 
sinensis]
Length=258

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 160/256 (63%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            + GKVA+ITG A GIG    +L A +G  V+ AD+ DELG  +A S+G     Y HCDV 
Sbjct  1    MEGKVALITGAASGIGEAAVRLFAEHGAFVVAADVQDELGHQVAASVGTDQVCYHHCDVR  60

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V+  LE  GKLD++F+NAGI GP   I E+ +    + +A N+ GV   IKH
Sbjct  61   DEKQVEETVRYTLEKYGKLDVLFSNAGIMGPLTGILELDLTGFGNTMATNVCGVAATIKH  120

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+     G+IIC++S A+ +GG A H Y+ SK A++GLVR+A  ELG +GIRVNC+
Sbjct  121  AARAMVDKNIRGSIICTTSVASSLGGTAPHAYTTSKHALVGLVRTACSELGAYGIRVNCI  180

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV + +  +AY +   + +  +  +  + G           + + +A+A LFLAS++
Sbjct  181  SPFGVATPLSCTAYNLRPDEVEANSCALANLKG--------IVLKAKHIAEAALFLASDE  232

Query  805  SGFVTGHNLILDGGYT  852
            S +++GHNL +DGG+T
Sbjct  233  SAYISGHNLAVDGGFT  248



>ref|XP_011040603.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Populus 
euphratica]
Length=262

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/256 (44%), Positives = 157/256 (61%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITG A GIG E  KL   NG  V+ AD+ D+LG  +  SIG     Y HCDV 
Sbjct  6    LEGKVALITGAASGIGEEAVKLFVDNGGFVVAADVQDDLGHQVVASIGADRATYRHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  VK  +E  GKLD++F+NAGI GP   I E+ +E   + +A N+ G    IKH
Sbjct  66   DEKQVEETVKYIMEKYGKLDVLFSNAGIIGPLTGILELDIEGFDNTMATNVRGAAATIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM++    G+IIC++S A+ + G   H Y+ SK A++GLVR+A  ELG +GIRVNCV
Sbjct  126  AARAMVSKNIRGSIICTTSVASSLAGTGPHAYTTSKHALVGLVRAACSELGAYGIRVNCV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + +   AY +   + +  +  +  + G           +   +A+A LFLAS++
Sbjct  186  SPYGVATPLSCRAYNLQPSEVEANSCALANLKG--------IVLKARHIAEAALFLASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +++GHNL +DGG+T
Sbjct  238  SAYISGHNLAVDGGFT  253



>ref|XP_010422493.1| PREDICTED: zerumbone synthase-like [Camelina sativa]
Length=300

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/270 (44%), Positives = 162/270 (60%), Gaps = 18/270 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L GKVA+ITGGA GIG  TA     +G  VIIADI  + G   A+ +G    YV CDV+K
Sbjct  35   LEGKVALITGGASGIGKATAGKFISHGAKVIIADIQPQFGKETAQELGPHAAYVQCDVTK  94

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIA-GPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+D+ +AV  A+    KLDIM+NNAGI      SI ++ +     ++  N+ GV+ GIKH
Sbjct  95   ESDIANAVDFAVSLHTKLDIMYNNAGIPCKTPPSIVDLDLNVFDKVINTNVRGVIAGIKH  154

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AAR MI    G +IIC+ S   +MGGLA H YS+SKSA++G+VRS A EL +H IRVNC+
Sbjct  155  AARVMIPRNTG-SIICAGSVTGMMGGLAQHTYSVSKSAVIGIVRSTASELCKHRIRVNCI  213

Query  625  SPHGVPSEMLVSAYRMILGKTD-----VMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            SP  + +  ++   R I    D      + +  G + GE             DVA A ++
Sbjct  214  SPFAITTSFVMDEMRQIYPGVDDSRLIQIVQSTGVLDGEVCEPT--------DVANAAVY  265

Query  790  LASEDSGFVTGHNLILDGGYTSAVSQMSFI  879
            LAS+DS +V GHNL++DGG+T+ V  + F+
Sbjct  266  LASDDSKYVNGHNLVVDGGFTT-VKTLDFL  294



>ref|XP_001762586.1| predicted protein [Physcomitrella patens]
 gb|EDQ72709.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 157/253 (62%), Gaps = 5/253 (2%)
 Frame = +1

Query  100  GKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSKEA  273
            GKV ++TGGA GIG  TA+L A NG  V+IADI  + G+ L+  +G   ++VHCDV KE 
Sbjct  4    GKVVIVTGGASGIGEATARLFAKNGAYVVIADINTKGGSQLSSELGSQAKFVHCDVKKEQ  63

Query  274  DVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKHAAR  453
            DV + V  A+ W+GKLD+ F+NAG  G  GSI E+ ++     LA+NL G V GIKHA R
Sbjct  64   DVAAVVDEAMSWKGKLDVYFSNAGFVGALGSIEELNLDDFDETLAVNLRGAVVGIKHATR  123

Query  454  AMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVSPH  633
            AM    K G I+C+ S+A+ M GL  H Y  SK+A+ GLVRS A EL  +GIRVN VSP 
Sbjct  124  AM-KSVKSGAIVCTGSTASQMAGLGPHTYCASKTALKGLVRSTALELRSYGIRVNMVSPD  182

Query  634  GVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDSGF  813
               + M         GK   + E++ + + ++  L       + DVA AVLFL S+++G+
Sbjct  183  ATATPMFQRVMEDSTGKPHTL-EQIKERMAKKALLPNRPLTPL-DVANAVLFLCSDEAGY  240

Query  814  VTGHNLILDGGYT  852
            ++GHNL+LD   T
Sbjct  241  ISGHNLLLDAART  253



>ref|XP_002320953.2| hypothetical protein POPTR_0014s11070g, partial [Populus trichocarpa]
 gb|EEE99268.2| hypothetical protein POPTR_0014s11070g, partial [Populus trichocarpa]
Length=288

 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/257 (44%), Positives = 159/257 (62%), Gaps = 11/257 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITG A GIG E  KL   NG  V+ AD+ D+LG  +  SIG     Y HCDV 
Sbjct  1    LEGKVALITGAASGIGEEAVKLFVENGGFVVAADVQDDLGHQVVASIGADRATYRHCDVR  60

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  VK  ++  GKLD++F+NAGI GP   I E+ +E   + +A N+ GV   IKH
Sbjct  61   DEKQVEETVKYIMDKYGKLDVLFSNAGIIGPLTGILELDIEGFDNTMATNVRGVAATIKH  120

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM++    G+IIC++S A+ + G   H Y+ SK A++GLVR+A  ELG +GIRVNC+
Sbjct  121  AARAMVSKNIRGSIICTTSVASSLAGTGPHAYTTSKHALVGLVRAACSELGAYGIRVNCI  180

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + +   AY +   + +  +  +  + G           +   +A+A LFLAS++
Sbjct  181  SPYGVATPLSCRAYNLQPSEVEANSCALANLKG--------IVLKARHIAEAALFLASDE  232

Query  805  SGFVTGHNLILDGGYTS  855
            S +++GHNL +DGG+TS
Sbjct  233  SAYISGHNLAVDGGFTS  249



>ref|XP_010249204.1| PREDICTED: momilactone A synthase-like isoform X1 [Nelumbo nucifera]
Length=305

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 171/261 (66%), Gaps = 10/261 (4%)
 Frame = +1

Query  85   RSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCD  258
            R  L GKVA+ITGGA G+G  TA+     G  VIIADI  E+G  LA  +G +  +VHCD
Sbjct  37   RLRLEGKVALITGGASGLGKATAQEFIQEGAKVIIADINAEVGPQLATDLGPQAHFVHCD  96

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVV  429
            V  E+ V  AV  A+   GKLDIM+NNAGI G   P G IA + +E+   ++ +N+ G V
Sbjct  97   VVNESQVAEAVDFAVAHYGKLDIMYNNAGIPGALTPPG-IANLNLEEFDRVMRVNVRGTV  155

Query  430  HGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGI  609
             GIKHAAR M+   K G+I+C+SS + ++GGL  HPY+ SK AI G+V+SAA EL +HG+
Sbjct  156  AGIKHAARVMVPL-KRGSILCTSSISGLLGGLGPHPYTASKFAIAGIVKSAASELCKHGV  214

Query  610  RVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLF  789
            R+NCVSP  VP+ ++V   R++     +  E + K++   G L   R   + DVA+A + 
Sbjct  215  RINCVSPFVVPTPLVVD--RLVASYPGIGDEWIRKMIDGLGELHGARCEEI-DVARAAVH  271

Query  790  LASEDSGFVTGHNLILDGGYT  852
            LAS+D+ +VTGHNL++DGG+T
Sbjct  272  LASDDAKYVTGHNLVVDGGFT  292



>ref|XP_004136145.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Cucumis 
sativus]
Length=260

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 163/260 (63%), Gaps = 11/260 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITG A GIGAETA+L A NG  V+IADI DE G  + +SIG     + HCDV 
Sbjct  9    LQGKVALITGAASGIGAETARLFAANGAFVVIADIDDEPGHKVVDSIGIDQASFHHCDVR  68

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E+ VE  V   ++  G+LDI+F+NAGI G   SI E+ M    +++  N+ GVV  IKH
Sbjct  69   DESQVEKIVSYTIKKHGRLDILFSNAGIIGSLSSIRELDMFDFDNVMTTNVRGVVATIKH  128

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
              RAM+     G+IIC++S AA +GG+A   Y+ SK A+LG+VRS+  ELG +GIRVNCV
Sbjct  129  GGRAMVERNIRGSIICTTSVAATVGGIALMAYTCSKHAVLGVVRSSCAELGVYGIRVNCV  188

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + +   + ++   K + +      + G           +   +A+A LFLAS++
Sbjct  189  SPNGVATPLACQSLKIEESKLEEIVSSKASLKG--------VVLKASHIAEAALFLASDE  240

Query  805  SGFVTGHNLILDGGYTSAVS  864
            S +++G NL++DGG+T+  S
Sbjct  241  SVYISGQNLVVDGGFTAVRS  260



>ref|XP_006291556.1| hypothetical protein CARUB_v10017712mg [Capsella rubella]
 gb|EOA24454.1| hypothetical protein CARUB_v10017712mg [Capsella rubella]
Length=304

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 165/259 (64%), Gaps = 10/259 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITGGA G+G  TA     +G  V+IAD+  E G   A+ +G    +V CDV+ 
Sbjct  39   LEGKVALITGGASGLGKATAGEFLRHGARVVIADLDVETGVKAAKELGSAAEFVRCDVTV  98

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGP--GGSIAEMKMEQLASLLAINLNGVVHGIK  441
            EAD+  AV++ +E  GKLD+M+NNAGIAGP    SI+E+ M +   ++  N+ GVV+GIK
Sbjct  99   EADIAEAVEMTVERYGKLDVMYNNAGIAGPMTPASISELDMMEFERVMRTNVFGVVYGIK  158

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAA+ M+   K G I+C+SS A + GGLA H Y++SK  I G+V+S A EL +HG+R+NC
Sbjct  159  HAAKFMVRA-KSGCILCTSSIAGVTGGLAPHSYTISKFTIPGIVKSVASELCEHGVRINC  217

Query  622  VSPHGVPSEMLVSAYRMILGK-TDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            +SP  V + + +   + +  K T+    E  K +GE             DVA+A L+LAS
Sbjct  218  ISPGTVATPLTLLYLKKVFPKVTEEKLRETVKGMGELKGAECEEA----DVAKAALYLAS  273

Query  799  EDSGFVTGHNLILDGGYTS  855
            ED  +VTGHNL++DGG T+
Sbjct  274  EDGKYVTGHNLVVDGGMTA  292



>ref|XP_009383702.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Musa 
acuminata subsp. malaccensis]
Length=263

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 160/256 (63%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG-GR--YVHCDVS  264
            L GKVA+ITG A GIG   A+L A NG  V++ADI DELG  +A SIG GR  Y  CDV+
Sbjct  6    LEGKVAIITGAASGIGEAAARLFASNGATVVVADIQDELGTRVAASIGLGRCSYRRCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            +E +VE+ V   +   G+LD+M +NAG+ GP  S+  + + ++  ++A+NL G    +KH
Sbjct  66   REEEVEATVDYVVRTHGRLDVMLSNAGVLGPLASVLNVDLGEMDHVMAVNLRGAAAAVKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            +ARAM+A G  G+IIC+ S  A  GGL    Y+ SK A++GLV +AA ELG HGIRVNCV
Sbjct  126  SARAMVAKGTRGSIICTGSVTACQGGLGPVAYTASKHALVGLVSAAAGELGLHGIRVNCV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV + +    +    G++    EE          ++         VA+A LFLASE+
Sbjct  186  SPFGVATPLACGYH----GRSPEQVEESSCAAANLKGVVLKA----HHVAEAALFLASEE  237

Query  805  SGFVTGHNLILDGGYT  852
            S F++GHNL++DGG T
Sbjct  238  SAFISGHNLVIDGGTT  253



>ref|XP_006292209.1| hypothetical protein CARUB_v10018415mg [Capsella rubella]
 gb|EOA25107.1| hypothetical protein CARUB_v10018415mg [Capsella rubella]
Length=302

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 175/287 (61%), Gaps = 29/287 (10%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E  +  +  KR  L GKVA+ITGGA GIG  T  L A +G  V+IAD+ +  G+ LA+S+
Sbjct  20   EEMNTTVYHKR--LEGKVAIITGGAHGIGKATVILFARHGATVVIADMDNVAGSSLAKSL  77

Query  235  GGR-------YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKM  384
                      ++ CDVS EADVE+ V + +   G+LDI+FNNAG+ G      SI ++  
Sbjct  78   SSHLTTSTVAFISCDVSVEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDLDA  137

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            ++  +++ +N+ G   G+KHAARAM+  G  G II ++S A +MGG+  H Y+ SK AI+
Sbjct  138  DEFDTVMRVNVRGAGLGMKHAARAMVKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIV  197

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYRMILG---------KTDVMAEEVGKI  717
            GL ++AACELG++GIRVNC+SP GV + MLV+A+R   G         + +     +  +
Sbjct  198  GLTKNAACELGKYGIRVNCISPFGVATSMLVNAWRKTSGGDVENDEVEEMEEFVRSMANL  257

Query  718  VGErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
             GE             D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  258  KGETLRA--------NDIAEAALYLASDESKYVNGHNLVVDGGVTTA  296



>ref|XP_004290718.1| PREDICTED: zerumbone synthase-like [Fragaria vesca subsp. vesca]
Length=298

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 168/257 (65%), Gaps = 7/257 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITG A GIG  TA     NG  V++ADI  +LG  +A+ +G    ++ CDV+K
Sbjct  33   LEGKVALITGAASGIGKATASKFISNGAKVVLADIQQQLGQEVAKELGPNASFIACDVTK  92

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
            E+D+ SAV   +    +LDIM++NAG+A     SI ++ +     ++ IN+ GV+ GIKH
Sbjct  93   ESDISSAVDFTISKHSQLDIMYSNAGVACMTPPSIVDLDLAVFDCVMNINVRGVLAGIKH  152

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            A+R MI   K G+I+C++S   +MGGLA H YSLSK A++G+V+S A EL QHGIR+NC+
Sbjct  153  ASRVMIPR-KTGSILCTASITGLMGGLAQHTYSLSKFAVIGIVKSLAAELCQHGIRINCI  211

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP  +P+  ++     I    DV  E++ +I+   G+L       + D+A A L+LAS+D
Sbjct  212  SPFAIPTPFVIEEMSKIYQGADV--EKLIEIIHRSGALEGANCEPI-DIANAALYLASDD  268

Query  805  SGFVTGHNLILDGGYTS  855
            + +V+GHNL++DGG+TS
Sbjct  269  AKYVSGHNLVVDGGFTS  285



>ref|XP_010685947.1| PREDICTED: sex determination protein tasselseed-2-like [Beta 
vulgaris subsp. vulgaris]
Length=306

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/279 (44%), Positives = 174/279 (62%), Gaps = 17/279 (6%)
 Frame = +1

Query  64   DQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--  237
            D   C     L GK+A++TGGARGIG  T +L   +G  V+IAD+ D LG  LA ++   
Sbjct  25   DNPPCMSFRRLEGKIAIVTGGARGIGEATVRLFIRHGAKVVIADVEDTLGNALANALSPS  84

Query  238  GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG----SIAEMKMEQLASLL  405
              ++HCDVS E DV + V  A+   G+LDI+ NNAG+ G       SI      +   ++
Sbjct  85   ATFIHCDVSVEDDVCTVVDTAVALHGRLDILVNNAGVLGSQTKSRKSILNFDPNEFDQIM  144

Query  406  AINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAA  585
            +IN+ G+  GIKHAAR M+  G G  II  SS A +MGGL  H Y+ SK AI+GL ++ A
Sbjct  145  SINVKGMALGIKHAARVMMPKGSG-CIISISSVAGVMGGLGPHAYTASKHAIVGLTKNTA  203

Query  586  CELGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVM------AEEVGKI--VGErgsll  741
            CELG+ GIRVNCVSP GV + ML++A+R   G+ D M       EEV K+       + L
Sbjct  204  CELGRFGIRVNCVSPFGVATSMLINAWRS--GEEDDMELGLPNGEEVEKMEEFVRGLATL  261

Query  742  rgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
            +G   + +D+A+A L+LAS++S +V+GHNL++DGG+T++
Sbjct  262  KGATLKPKDIAEASLYLASDESRYVSGHNLVVDGGFTTS  300



>gb|KDP34634.1| hypothetical protein JCGZ_11952 [Jatropha curcas]
Length=270

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 172/270 (64%), Gaps = 18/270 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRY---VHCD  258
            L GKVA+ITG A GIG  TA+L + +G  V+IADI DELG  L + I   G+Y   VHCD
Sbjct  11   LEGKVALITGAASGIGECTARLFSKHGAQVVIADIQDELGHSLCKEIDRDGKYCSFVHCD  70

Query  259  VSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG-SIAEMKMEQLASLLAINLNGVVHG  435
            V+KE DVE+A+  A+   GKLDIMFNNAGI G    +I + +  +   ++++NL G   G
Sbjct  71   VTKEEDVENALNSAVSKYGKLDIMFNNAGIIGVAKPNILDNEKAEFEKIISVNLVGAFLG  130

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
             KHAAR MI   KG +II ++S  + +GG+ASH Y+ SK  ++GL+R+ A ELGQHGIRV
Sbjct  131  TKHAARVMIPNRKG-SIITTASICSTIGGVASHAYTSSKHGVVGLMRNTAVELGQHGIRV  189

Query  616  NCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLA  795
            NCVSP+ V + +    +++         ++ G  + +  S L+    + EDVAQA L+L 
Sbjct  190  NCVSPYVVNTPLARDFFKL---------DDNG--IYDVYSNLKEAVLQPEDVAQAALYLG  238

Query  796  SEDSGFVTGHNLILDGGYTSAVSQMSFIYQ  885
            S+DS +++GHN+I+DGG+T      S   Q
Sbjct  239  SDDSKYISGHNMIIDGGFTIVNPAFSIFPQ  268



>gb|KDO86849.1| hypothetical protein CISIN_1g046931mg [Citrus sinensis]
Length=258

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 160/256 (63%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR---YVHCDVS  264
            + GKVA+ITG A GIG    +L A +G  V+ AD+ DELG  +A S+G     Y HCDV 
Sbjct  1    MEGKVALITGAASGIGEAAVRLFAEHGAFVVAADVHDELGHQVAASVGTDQVCYHHCDVR  60

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E  VE  V+  LE  GKLD++F+NAGI GP   I E+ +    + +A N+ GV   IKH
Sbjct  61   DEKQVEETVRYTLEKYGKLDVLFSNAGIMGPLTGILELDLTGFGNTMATNVCGVAATIKH  120

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+     G+IIC++S A+ +GG A H Y+ SK A++GLVR+A  ELG +GIRVNC+
Sbjct  121  AARAMVDKNIRGSIICTTSVASSLGGTAPHAYTTSKHALVGLVRTACSELGAYGIRVNCI  180

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP GV + +  +AY +   + +  +  +  + G           + + +A+A LFLAS++
Sbjct  181  SPFGVATPLSCTAYNLRPDEVEANSCALANLKG--------IVLKAKHIAEAALFLASDE  232

Query  805  SGFVTGHNLILDGGYT  852
            S +++GHNL +DGG+T
Sbjct  233  SAYISGHNLAVDGGFT  248



>ref|XP_011006108.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Populus euphratica]
Length=300

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/281 (45%), Positives = 176/281 (63%), Gaps = 27/281 (10%)
 Frame = +1

Query  64   DQMLCSK--RSF-------LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGA  216
            D +L S+  RS+       L GKVA+ITGGA GIG  TA     +G  VIIAD+  E+G 
Sbjct  15   DDVLISRQGRSYSTGSGRRLEGKVALITGGASGIGKTTAHEFIKHGARVIIADVDSEIGP  74

Query  217  PLAESIG--GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKM  384
              A  +G    +  CDV+ EA VE AV++AL   GKLDIM+NNAGI GP    SIA++ +
Sbjct  75   QAANELGPAAHFAQCDVTAEAQVEKAVEIALTNYGKLDIMYNNAGITGPSFPPSIADLDL  134

Query  385  EQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAIL  564
            ++   ++ IN+ G+V GIKHAARAMI  G G  I+C+SS + +MGGL SH YS SKS I 
Sbjct  135  DEFDKVMQINVRGMVAGIKHAARAMIPAGSG-CILCTSSISGLMGGLGSHSYSASKSTIP  193

Query  565  GLVRSAACELGQHGIRVNCVSPHGVPSEM-LVSAYRMILGKTDVMAEEV----GKIVGEr  729
            G+V+S A EL ++G+R+NC+SP  +P+ + L     M  G +     E+    GK+ G +
Sbjct  194  GIVKSVASELCENGVRINCISPGPIPTTLSLAQIGLMYPGASQEQLIEIVNGLGKLKGAK  253

Query  730  gsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYT  852
               +        DVA+A L+LAS+++ ++TGHNL++DGG T
Sbjct  254  CEEI--------DVAEAALYLASDEAKYITGHNLVVDGGLT  286



>gb|KGN45049.1| hypothetical protein Csa_7G414460 [Cucumis sativus]
Length=258

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 163/260 (63%), Gaps = 11/260 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITG A GIGAETA+L A NG  V+IADI DE G  + +SIG     + HCDV 
Sbjct  7    LQGKVALITGAASGIGAETARLFAANGAFVVIADIDDEPGHKVVDSIGIDQASFHHCDVR  66

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E+ VE  V   ++  G+LDI+F+NAGI G   SI E+ M    +++  N+ GVV  IKH
Sbjct  67   DESQVEKIVSYTIKKHGRLDILFSNAGIIGSLSSIRELDMFDFDNVMTTNVRGVVATIKH  126

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
              RAM+     G+IIC++S AA +GG+A   Y+ SK A+LG+VRS+  ELG +GIRVNCV
Sbjct  127  GGRAMVERNIRGSIICTTSVAATVGGIALMAYTCSKHAVLGVVRSSCAELGVYGIRVNCV  186

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            SP+GV + +   + ++   K + +      + G           +   +A+A LFLAS++
Sbjct  187  SPNGVATPLACQSLKIEESKLEEIVSSKASLKG--------VVLKASHIAEAALFLASDE  238

Query  805  SGFVTGHNLILDGGYTSAVS  864
            S +++G NL++DGG+T+  S
Sbjct  239  SVYISGQNLVVDGGFTAVRS  258



>ref|XP_010249205.1| PREDICTED: momilactone A synthase-like isoform X2 [Nelumbo nucifera]
Length=303

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 170/258 (66%), Gaps = 10/258 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR--YVHCDVSK  267
            L GKVA+ITGGA G+G  TA+     G  VIIADI  E+G  LA  +G +  +VHCDV  
Sbjct  38   LEGKVALITGGASGLGKATAQEFIQEGAKVIIADINAEVGPQLATDLGPQAHFVHCDVVN  97

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHGI  438
            E+ V  AV  A+   GKLDIM+NNAGI G   P G IA + +E+   ++ +N+ G V GI
Sbjct  98   ESQVAEAVDFAVAHYGKLDIMYNNAGIPGALTPPG-IANLNLEEFDRVMRVNVRGTVAGI  156

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR M+   K G+I+C+SS + ++GGL  HPY+ SK AI G+V+SAA EL +HG+R+N
Sbjct  157  KHAARVMVPL-KRGSILCTSSISGLLGGLGPHPYTASKFAIAGIVKSAASELCKHGVRIN  215

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            CVSP  VP+ ++V   R++     +  E + K++   G L   R   + DVA+A + LAS
Sbjct  216  CVSPFVVPTPLVVD--RLVASYPGIGDEWIRKMIDGLGELHGARCEEI-DVARAAVHLAS  272

Query  799  EDSGFVTGHNLILDGGYT  852
            +D+ +VTGHNL++DGG+T
Sbjct  273  DDAKYVTGHNLVVDGGFT  290



>ref|XP_006444587.1| hypothetical protein CICLE_v10023411mg [Citrus clementina]
 gb|ESR57827.1| hypothetical protein CICLE_v10023411mg [Citrus clementina]
Length=276

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 114/266 (43%), Positives = 165/266 (62%), Gaps = 12/266 (5%)
 Frame = +1

Query  67   QMLCSKRS-FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGGR  243
            +M   KR  ++ GKVA+ITG A GIG    +L A +G  V+ AD+ DELG  +A S+G  
Sbjct  9    KMKKRKRCGWMEGKVALITGAASGIGEAAVRLFAEHGAFVVAADVHDELGHQVAASVGTD  68

Query  244  ---YVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAIN  414
               Y HCDV  E  VE  V+  LE  GKLD++F+NAGI GP   I E+ +    + +A N
Sbjct  69   QVCYHHCDVRDEKQVEETVRYTLEKYGKLDVLFSNAGIMGPLTGILELDLTGFGNTMATN  128

Query  415  LNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACEL  594
            + GV   IKHAARAM+     G+IIC++S A+ +GG A H Y+ SK A++GLVR+A  EL
Sbjct  129  VCGVAATIKHAARAMVDKNIRGSIICTTSVASSLGGTAPHAYTTSKHALVGLVRTACSEL  188

Query  595  GQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVA  774
            G +GIRVNC+SP GV + +  +AY +   + +  +  +  + G           + + +A
Sbjct  189  GAYGIRVNCISPFGVATPLSCTAYNLRPDEVEANSCALANLKG--------IVLKAKHIA  240

Query  775  QAVLFLASEDSGFVTGHNLILDGGYT  852
            +A LFLAS++S +++GHNL +DGG+T
Sbjct  241  EAALFLASDESAYISGHNLAVDGGFT  266



>ref|XP_011093172.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Sesamum 
indicum]
Length=257

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 157/260 (60%), Gaps = 12/260 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITG A GIG  TA+L   +G  ++IADI DELGA +A SIG     Y HCDV 
Sbjct  6    LEGKVAIITGAASGIGEATARLFVHHGAFIVIADIQDELGAQVAASIGEHRATYKHCDVR  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQ-LASLLAINLNGVVHGIK  441
             E  VE  V   +   GKLDIM++NAGI GP  SI +M +       +A+N  G    IK
Sbjct  66   DEKQVEETVAFTVAKYGKLDIMYSNAGILGPIESILDMDISDGFDKTVAVNARGAAIAIK  125

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M+AG   G+IIC++S+ A   G A   Y  SK A+LGLVR+AA ELG HGIRVNC
Sbjct  126  HAARVMVAGKVQGSIICTASTEATRAGRAPAAYVASKHAVLGLVRAAARELGPHGIRVNC  185

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSPHGV + M+     M +   +     +G + G           + + VA+AVLFLAS+
Sbjct  186  VSPHGVATPMVCDVLGMDVASVEARFSGMGNLKG--------VVLKKDHVAEAVLFLASD  237

Query  802  DSGFVTGHNLILDGGYTSAV  861
            +S +V+  NL +DGG ++ +
Sbjct  238  ESAYVSATNLSIDGGLSTMI  257



>emb|CDY37786.1| BnaC04g00390D [Brassica napus]
 emb|CDX80081.1| BnaA05g00750D [Brassica napus]
Length=262

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/256 (45%), Positives = 167/256 (65%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKV +ITGGA GIGAE+ +L   +G  V+I D+ DELG  LA SIG     Y HCDV+
Sbjct  11   LEGKVVIITGGASGIGAESVRLFTKHGARVVIVDVQDELGQKLAVSIGEDKASYYHCDVT  70

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E +VE+AVK  ++  GKLD++F+NAG+  P  SI ++ ++ L   +++NL G    IKH
Sbjct  71   NETEVENAVKYTVDKHGKLDVVFSNAGVIEPFVSILDLNLDALDRTISVNLRGAAAFIKH  130

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+  G  G+IIC++S AA + G A H Y+ SK  +LGL++SA+  LG++GIRVN V
Sbjct  131  AARAMVEKGTRGSIICTTSVAAEIAGTAPHGYTASKHGLLGLIKSASGGLGKYGIRVNGV  190

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P GV + ++ + + M   + +V+ E          + L+G   +   VA+A LFLAS++
Sbjct  191  APFGVATPLVCNGFNM---EPNVVEENT-----SASANLKGIVLKASHVAEAALFLASDE  242

Query  805  SGFVTGHNLILDGGYT  852
            S +V+G NL +DGGYT
Sbjct  243  SAYVSGQNLAVDGGYT  258



>ref|XP_010691680.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691681.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691682.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691683.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691684.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691685.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691686.1| PREDICTED: secoisolariciresinol dehydrogenase-like [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 118/258 (46%), Positives = 170/258 (66%), Gaps = 17/258 (7%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GKVA+ITGGA GIG  TA+L   +G  V+IADI D+LG  + +++G     Y+HCDV+
Sbjct  14   LEGKVALITGGASGIGEYTAELFTKHGAKVMIADIQDDLGQSVCKNLGPSVASYIHCDVT  73

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG--PGGSIAEMKMEQLASLLAINLNGVVHGI  438
             EA V++AV   +    KLDIMFNNAGIAG  P  +I ++   +   ++ +NL G   G 
Sbjct  74   NEAHVQNAVDSTVAKYEKLDIMFNNAGIAGSYPKLNILDITQSEFEEIIKVNLIGPFLGT  133

Query  439  KHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVN  618
            KHAAR MI   K G+II ++S+ +++GG A H Y+ SK  I+GL R+ A ELG++GIRVN
Sbjct  134  KHAARVMIPA-KQGSIITTASTCSVIGGGAPHAYTSSKHGIVGLTRNTAVELGKYGIRVN  192

Query  619  CVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLAS  798
            CVSPH + + ++ +  ++         ++ G  V +  S L+G   ++EDVA A LFLAS
Sbjct  193  CVSPHVISTPLVKNFLKL---------DDEG--VSKFYSNLKGASCKVEDVANAALFLAS  241

Query  799  EDSGFVTGHNLILDGGYT  852
            +DS F++GHNL++DGG+T
Sbjct  242  DDSKFISGHNLVVDGGFT  259



>ref|XP_006397907.1| hypothetical protein EUTSA_v10001593mg [Eutrema salsugineum]
 gb|ESQ39360.1| hypothetical protein EUTSA_v10001593mg [Eutrema salsugineum]
Length=257

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 166/256 (65%), Gaps = 11/256 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG---GRYVHCDVS  264
            L GK+ +ITGGA GIGAE  +L   +G  V+I D+ DELG  +A SIG     Y HCDV+
Sbjct  6    LEGKIVIITGGASGIGAEAVRLFTEHGARVVIVDVQDELGQNVAVSIGEDKASYYHCDVT  65

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGSIAEMKMEQLASLLAINLNGVVHGIKH  444
             E +VE+AVK  +E  GK+D++F+NAG+  P  SI ++ ++ L    A+NL G    IKH
Sbjct  66   NETEVENAVKFTVEKHGKIDVLFSNAGVIEPFVSILDLNLDVLDRTFAVNLRGAATFIKH  125

Query  445  AARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCV  624
            AARAM+  G  G+I+C++S AA + G A H Y+ SK  +LGL++SA+  LG++GIRVN V
Sbjct  126  AARAMVEKGTRGSIVCTTSVAAEISGTAPHGYTASKHGLLGLIKSASGGLGKYGIRVNGV  185

Query  625  SPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASED  804
            +P GV + ++ + ++M   + +V+ E          + L+G   +   VA+A LFLAS++
Sbjct  186  APFGVATPLVCNGFKM---EPNVVEENT-----SASANLKGIVLKARHVAEAALFLASDE  237

Query  805  SGFVTGHNLILDGGYT  852
            S +V+G NL +DGGYT
Sbjct  238  SAYVSGQNLAVDGGYT  253



>ref|XP_006429516.1| hypothetical protein CICLE_v10012298mg [Citrus clementina]
 ref|XP_006481135.1| PREDICTED: short-chain dehydrogenase reductase 2a-like [Citrus 
sinensis]
 gb|ESR42756.1| hypothetical protein CICLE_v10012298mg [Citrus clementina]
 gb|KDO63299.1| hypothetical protein CISIN_1g021960mg [Citrus sinensis]
Length=305

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/280 (43%), Positives = 173/280 (62%), Gaps = 34/280 (12%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITGGARGIG    +L A +G  V+IAD+ D LG+ LA ++      +VHCDVS
Sbjct  29   LEGKVAIITGGARGIGEAAVRLFARHGAKVVIADVEDTLGSVLASTLAPAPVTFVHCDVS  88

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG---PGGSIAEMKMEQLASLLAINLNGVVHG  435
             E D+E+ +   +   G+LDI++NNAG+ G      SI +   ++  +++ +N+ G+  G
Sbjct  89   LEEDIENLINSTVSRYGRLDILYNNAGVLGNQRKHKSIIDFDADEFDNVMRVNVKGMALG  148

Query  436  IKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRV  615
            IKHAAR MI  G GG II ++S A +MGGL  H Y+ SK AI+GL ++AACELG++GIRV
Sbjct  149  IKHAARVMINRG-GGCIISTASVAGVMGGLGPHAYTASKHAIVGLTKNAACELGRYGIRV  207

Query  616  NCVSPHGVPSEMLVSAYR-----------MILG--------KTDVMAEEVGKIVGErgsl  738
            NC+SP GV + MLV+A+R           M  G        K +     +G + G     
Sbjct  208  NCISPFGVATSMLVNAWRNSGDGEEEDECMNFGIPSQKEVRKMEEFVSGLGNLKGTTLRS  267

Query  739  lrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
                    +D+A+A L+LAS++S +V+GHNL++DGG T++
Sbjct  268  --------KDIAEAALYLASDESRYVSGHNLVVDGGVTTS  299



>ref|XP_007032007.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY02933.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=291

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 175/265 (66%), Gaps = 9/265 (3%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG--GRYVHCDVSK  267
            L GKVA+ITGGA G+G  TA     NG  VIIADI  + G   A+ +G   ++V CDV+ 
Sbjct  29   LGGKVALITGGASGLGKATAFEFIKNGAQVIIADIDSQTGPQAADDLGPAAQFVQCDVAM  88

Query  268  EADVESAVKLALEWRGKLDIMFNNAGIAGPG--GSIAEMKMEQLASLLAINLNGVVHGIK  441
            E+ V  AV++A+   GKLDIMFNNAG+AG     SIA++ +++   ++ IN+ G++ GIK
Sbjct  89   ESQVAEAVEIAMARHGKLDIMFNNAGVAGQAFPPSIADLDLDEFDRVMRINVRGMMAGIK  148

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR M+     G+I+C+SS + +MGGL  HPY+++K  I G+V+S A EL + G+R+NC
Sbjct  149  HAARVMVPA-VSGSILCTSSISGLMGGLGPHPYTVAKFTIPGIVKSVASELCRSGVRINC  207

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            +SP  +P+ M+++    I     V  E+V +I+   G L   +   + DVA+A L+LAS+
Sbjct  208  ISPAPIPTPMVINQIAQIY--QGVPKEKVMEIINGLGELKGAKCEDI-DVAKAALYLASD  264

Query  802  DSGFVTGHNLILDGGYTSAVSQMSF  876
            ++ +VTGHNL++DGG+TS    +SF
Sbjct  265  EAKYVTGHNLVVDGGFTS-FKNLSF  288



>gb|KHN21177.1| Momilactone A synthase [Glycine soja]
Length=340

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 164/255 (64%), Gaps = 14/255 (5%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI-GGRYVHCDVSKE  270
            L GKVA+ITGGA GIG  TA+L + +G  ++IADI D+LG  L + +    YVHCDV+KE
Sbjct  83   LEGKVAIITGGASGIGEATARLFSKHGAHLVIADIQDDLGLSLCKHLESASYVHCDVTKE  142

Query  271  ADVESAVKLALEWRGKLDIMFNNAGIAGP-GGSIAEMKMEQLASLLAINLNGVVHGIKHA  447
             DVE+ V  A+   GKLDIM NNAGI      SI +       S++++NL G   G KHA
Sbjct  143  EDVENCVNTAVSKYGKLDIMLNNAGICDEIKTSILDNNKSDFESVISVNLVGPFLGTKHA  202

Query  448  ARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNCVS  627
            AR MIA  K G+II ++S A  +GG+A+H Y+ SK A++GL++S A ELGQ GIRVNCVS
Sbjct  203  ARVMIAA-KRGSIINTASVAGTLGGVATHAYTSSKHALIGLMKSTAVELGQFGIRVNCVS  261

Query  628  PHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASEDS  807
            P+ VP+          L K     +E G  V E  S L+G      DVA+A L+LA ++S
Sbjct  262  PYVVPTP---------LTKKHANIDEEG--VREIYSNLKGVHLVPNDVAEAALYLAGDES  310

Query  808  GFVTGHNLILDGGYT  852
             +V+GHNL+LDGGYT
Sbjct  311  KYVSGHNLVLDGGYT  325



>ref|XP_006384778.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
 gb|ERP62575.1| hypothetical protein POPTR_0004s21020g [Populus trichocarpa]
Length=305

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 166/257 (65%), Gaps = 16/257 (6%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI---GGRYVHCDVS  264
            L GKVA+ITGG+ GIG   A+L A +G  V+IAD+ DELG  + E +      +VHCDV+
Sbjct  48   LEGKVALITGGSSGIGESAARLFAKHGAKVVIADVQDELGHSVCEELKTESASFVHCDVT  107

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAG-PGGSIAEMKMEQLASLLAINLNGVVHGIK  441
            +E DVE+AV  A+   GKLDIMFNNAGI G P  +I +    +   ++++N+ G   G K
Sbjct  108  QEKDVENAVNTAVSKHGKLDIMFNNAGIVGTPKPNILDNDKAEFEKVISVNVVGAFLGTK  167

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAAR MI   +G +II ++S    +GG+ASH Y+ SK  ++GL+R+ A ELGQHGIRVNC
Sbjct  168  HAARVMIPVRRG-SIISTASVCGTIGGVASHAYTSSKHGVIGLMRNTAVELGQHGIRVNC  226

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            VSP+ V + ++   +++   + + +   + + V            + ED+A+A LFL S+
Sbjct  227  VSPYVVLTPLVKDFFKLDDDEVNRLYSNLKEAV-----------LKAEDIAEAALFLGSD  275

Query  802  DSGFVTGHNLILDGGYT  852
            +S +V+GHNLI+DGG+T
Sbjct  276  ESKYVSGHNLIVDGGFT  292



>dbj|BAD30315.1| putative sex determination protein tasselseed 2 [Oryza sativa 
Japonica Group]
Length=294

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 172/267 (64%), Gaps = 9/267 (3%)
 Frame = +1

Query  70   MLCSKRS---FLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIG-  237
            +LC K      L GKVAVITGGA GIG  TAK    NG  VIIAD+ D+LG  +A  +G 
Sbjct  21   LLCVKTRKVYTLAGKVAVITGGASGIGEATAKEFIRNGAKVIIADVQDDLGHTVAAELGP  80

Query  238  -GRYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPG-GSIAEMKMEQLASLLAI  411
               Y  CDV+ EA + + V LA+   G LDI++NNAGI     G +A + +     ++A+
Sbjct  81   GSAYTRCDVTDEAQIAATVDLAVARHGHLDILYNNAGITSSSVGHLASLDLADFDRVMAV  140

Query  412  NLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACE  591
            N   V+ GIKHAAR M A  + G+I+C++S A +MGG   H Y++SK+A++G+VRSAA E
Sbjct  141  NARAVLAGIKHAARVM-APRRTGSILCTASVAGMMGGEMPHAYNVSKAAVIGVVRSAAGE  199

Query  592  LGQHGIRVNCVSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDV  771
            L +HG+R+N +SP G+ + + +  +  +L   D  AE V +++ E  + L G     ED+
Sbjct  200  LARHGVRLNAISPLGIATPLAMRGFGDMLAWAD--AERVRRLIEEDMNELEGATLEAEDI  257

Query  772  AQAVLFLASEDSGFVTGHNLILDGGYT  852
            A+A ++LAS+++ +VTGHNL++DGG+T
Sbjct  258  ARAAVYLASDEAKYVTGHNLVVDGGFT  284



>gb|KFK34412.1| hypothetical protein AALP_AA5G141400 [Arabis alpina]
Length=306

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 179/286 (63%), Gaps = 23/286 (8%)
 Frame = +1

Query  55   ESTDQMLCSKRSFLNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESI  234
            E T   L  KR  L GKVA+ITGGA GIG  T  L A +G  V+IAD+ D  G+ LA+S+
Sbjct  20   EETSSTLFHKR--LEGKVAIITGGAHGIGKATVTLFARHGATVVIADVDDAAGSSLAKSL  77

Query  235  GG---------RYVHCDVSKEADVESAVKLALEWRGKLDIMFNNAGIAGPGG---SIAEM  378
                        ++ CDVS EADVE+ V   +   G+LD++FNNAG+ G      SI + 
Sbjct  78   SSSQLSATNVVTFISCDVSVEADVENLVNQTVAQYGRLDVLFNNAGVLGDQKKHKSILDF  137

Query  379  KMEQLASLLAINLNGVVHGIKHAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSA  558
              E+   ++ +N+ G   G+KHAARAM+  G  G II ++S A +MGG+  H Y+ SK A
Sbjct  138  DAEEFDQVMRVNVRGTGLGMKHAARAMVKRGFKGCIISTASVAGVMGGMGPHAYTASKHA  197

Query  559  ILGLVRSAACELGQHGIRVNCVSPHGVPSEMLVSAYR------MILGKTDVMAEEVGKIV  720
            I+GL ++AACELG++GIRVNC+SP GV + MLV+A+R      M  G  DV  EE+ + V
Sbjct  198  IVGLTKNAACELGKYGIRVNCISPFGVATSMLVNAWRKPSGCDMEEGNDDV--EEMEEFV  255

Query  721  GErgsllrgrggrMEDVAQAVLFLASEDSGFVTGHNLILDGGYTSA  858
                + L+G   R  D+A+A L+LAS++S +V GHNL++DGG T+A
Sbjct  256  -RNLANLKGETLRANDIAEAALYLASDESKYVNGHNLVVDGGVTTA  300



>ref|XP_010911608.1| PREDICTED: short-chain dehydrogenase reductase 3b-like [Elaeis 
guineensis]
Length=267

 Score =   206 bits (524),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 162/257 (63%), Gaps = 11/257 (4%)
 Frame = +1

Query  94   LNGKVAVITGGARGIGAETAKLLAGNGVDVIIADILDELGAPLAESIGG---RYVHCDVS  264
            L GKVA+ITG A GIG  TA++   +G  V+IADI DELGA +  SIG    +Y  CDV 
Sbjct  5    LEGKVAIITGAAGGIGEATARIFTSHGALVVIADIKDELGARVVASIGPEKCQYKRCDVR  64

Query  265  KEADVESAVKLALEWRGKLDIMFNNAGIAGPGGS-IAEMKMEQLASLLAINLNGVVHGIK  441
             E +VE  V   ++  G+LDIMF+NAG++    S I +M  + L +++A+N  GV   IK
Sbjct  65   NEKEVEELVDFTIKAYGRLDIMFSNAGMSEKATSTILDMDFDVLDNVMAVNFRGVAATIK  124

Query  442  HAARAMIAGGKGGTIICSSSSAAIMGGLASHPYSLSKSAILGLVRSAACELGQHGIRVNC  621
            HAARAM+A G  G+IIC++S A   GG     Y+ SK A++GLVRSAA ELG+HGIR NC
Sbjct  125  HAARAMVASGARGSIICTASIAVTKGGFGPAAYTASKLAVVGLVRSAAAELGRHGIRANC  184

Query  622  VSPHGVPSEMLVSAYRMILGKTDVMAEEVGKIVGErgsllrgrggrMEDVAQAVLFLASE  801
            +SP GV + + +  + +   + +  A E G ++        G   +  D+ +A LFLAS+
Sbjct  185  ISPGGVATPLTMEYFGLTQSQVEERA-ETGMVL------KGGGTLKASDIGEAALFLASD  237

Query  802  DSGFVTGHNLILDGGYT  852
            +S FVTG NLI+DGG T
Sbjct  238  ESAFVTGQNLIVDGGRT  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2797048251622