BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78795_g1_i1 len=673 path=[651:0-672]

Length=673
                                                                      Score     E

ref|XP_007225954.1|  hypothetical protein PRUPE_ppa013757mg             185   6e-56   
gb|KDP33436.1|  hypothetical protein JCGZ_07007                         181   2e-54   
ref|XP_009363602.1|  PREDICTED: flowering-promoting factor 1-like       179   2e-53   
ref|XP_003544636.1|  PREDICTED: flowering-promoting factor 1-like       178   5e-53   
ref|NP_001237780.1|  uncharacterized protein LOC100527299               177   6e-53   
ref|XP_006371802.1|  FLOWERING PROMOTING FACTOR 1 family protein        177   1e-52   
ref|XP_006483594.1|  PREDICTED: flowering-promoting factor 1-like...    176   2e-52   
ref|XP_008393971.1|  PREDICTED: flowering-promoting factor 1-like       176   2e-52   
ref|XP_010102853.1|  hypothetical protein L484_004425                   176   2e-52   
ref|XP_006382178.1|  hypothetical protein POPTR_0006s29100g             176   2e-52   
ref|XP_009798997.1|  PREDICTED: flowering-promoting factor 1-like       175   5e-52   
ref|XP_009610086.1|  PREDICTED: flowering-promoting factor 1-like       175   5e-52   
ref|XP_009338842.1|  PREDICTED: flowering-promoting factor 1-like       174   1e-51   
ref|XP_006450137.1|  hypothetical protein CICLE_v10009959mg             174   1e-51   
ref|XP_008365164.1|  PREDICTED: flowering-promoting factor 1-like       174   2e-51   
emb|CDP00906.1|  unnamed protein product                                174   2e-51   
ref|XP_010669450.1|  PREDICTED: flowering-promoting factor 1-like...    174   2e-51   
ref|XP_004498589.1|  PREDICTED: flowering-promoting factor 1-like...    174   2e-51   
ref|XP_007161300.1|  hypothetical protein PHAVU_001G058400g             171   2e-50   
gb|EYU22723.1|  hypothetical protein MIMGU_mgv1a016620mg                171   3e-50   
ref|XP_010669448.1|  PREDICTED: flowering-promoting factor 1-like...    171   4e-50   
ref|XP_011008657.1|  PREDICTED: flowering-promoting factor 1-like       170   5e-50   
ref|XP_004303449.1|  PREDICTED: flowering-promoting factor 1-like       170   5e-50   
ref|XP_004138764.1|  PREDICTED: flowering-promoting factor 1-like       169   7e-50   
gb|EYU37354.1|  hypothetical protein MIMGU_mgv1a020346mg                169   9e-50   
ref|XP_011095550.1|  PREDICTED: flowering-promoting factor 1-like       168   2e-49   
gb|EYU37357.1|  hypothetical protein MIMGU_mgv1a016613mg                168   4e-49   
ref|XP_003631818.1|  PREDICTED: flowering-promoting factor 1-like...    167   4e-49   
ref|XP_002872131.1|  hypothetical protein ARALYDRAFT_910533             167   6e-49   
ref|XP_010519600.1|  PREDICTED: flowering-promoting factor 1-like...    167   1e-48   
ref|XP_009122035.1|  PREDICTED: flowering-promoting factor 1-like...    166   1e-48   
ref|XP_011045026.1|  PREDICTED: flowering-promoting factor 1-like       166   1e-48   
ref|XP_006288922.1|  hypothetical protein CARUB_v10002286mg             166   2e-48   
ref|XP_002527969.1|  conserved hypothetical protein                     166   3e-48   Ricinus communis
gb|EYU31640.1|  hypothetical protein MIMGU_mgv1a024104mg                166   3e-48   
emb|CDX97031.1|  BnaC09g45940D                                          165   4e-48   
gb|KEH39770.1|  flowering-promoting factor-like protein                 164   1e-47   
ref|XP_009111644.1|  PREDICTED: flowering-promoting factor 1-like       164   2e-47   
gb|AFK37888.1|  unknown                                                 163   2e-47   
ref|XP_006290133.1|  hypothetical protein CARUB_v10003797mg             163   2e-47   
ref|XP_010525546.1|  PREDICTED: flowering-promoting factor 1-like       163   2e-47   
ref|NP_974763.1|  uncharacterized protein                               163   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422823.1|  PREDICTED: flowering-promoting factor 1-like...    163   3e-47   
ref|XP_010421334.1|  PREDICTED: flowering-promoting factor 1            162   3e-47   
ref|XP_010454815.1|  PREDICTED: flowering-promoting factor 1-like       162   5e-47   
ref|XP_010453098.1|  PREDICTED: flowering-promoting factor 1-like...    162   5e-47   
emb|CDX70361.1|  BnaC03g04450D                                          162   6e-47   
gb|KFK27756.1|  hypothetical protein AALP_AA8G425100                    161   9e-47   
ref|NP_197868.1|  flowering promoting factor 1                          161   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399559.1|  hypothetical protein EUTSA_v10015065mg             161   2e-46   
ref|XP_006394738.1|  hypothetical protein EUTSA_v10005622mg             160   2e-46   
sp|O24340.1|FPF1_SINAL  RecName: Full=Flowering-promoting factor ...    160   3e-46   Sinapis alba [bai jie]
ref|XP_010493733.1|  PREDICTED: flowering-promoting factor 1-like       159   7e-46   
emb|CDY19824.1|  BnaA09g04770D                                          159   7e-46   
ref|XP_010525872.1|  PREDICTED: flowering-promoting factor 1-like...    159   8e-46   
emb|CDX97040.1|  BnaC09g45850D                                          159   1e-45   
emb|CDX80474.1|  BnaC07g29700D                                          158   2e-45   
ref|XP_009151012.1|  PREDICTED: flowering-promoting factor 1            158   3e-45   
gb|AFK46962.1|  unknown                                                 157   5e-45   
ref|XP_010548540.1|  PREDICTED: flowering-promoting factor 1-like...    157   9e-45   
gb|AFK44318.1|  unknown                                                 155   3e-44   
ref|XP_010526274.1|  PREDICTED: flowering-promoting factor 1-like...    154   1e-43   
gb|AID51345.1|  flowering promoting factor 1-like protein 4             150   1e-42   
ref|XP_007011570.1|  Flowering promoting factor 1                       150   1e-42   
ref|XP_010049807.1|  PREDICTED: flowering-promoting factor 1-like       150   2e-42   
gb|AID51346.1|  flowering promoting factor 1-like protein 5             150   2e-42   
ref|XP_010675090.1|  PREDICTED: flowering-promoting factor 1-like...    150   3e-42   
gb|KDP27785.1|  hypothetical protein JCGZ_18865                         149   4e-42   
emb|CDY36444.1|  BnaC03g67640D                                          150   5e-42   
ref|XP_008801065.1|  PREDICTED: flowering-promoting factor 1-like...    149   5e-42   
ref|XP_010259916.1|  PREDICTED: flowering-promoting factor 1            149   6e-42   
ref|XP_004296827.1|  PREDICTED: flowering-promoting factor 1-like...    149   1e-41   
ref|XP_010921805.1|  PREDICTED: flowering-promoting factor 1-like...    148   1e-41   
ref|XP_010259653.1|  PREDICTED: flowering-promoting factor 1-like...    148   2e-41   
ref|XP_009592497.1|  PREDICTED: flowering-promoting factor 1-like...    147   3e-41   
emb|CAB89379.1|  putative protein                                       159   3e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006389236.1|  hypothetical protein POPTR_0034s00300g             147   4e-41   
ref|XP_010037383.1|  PREDICTED: flowering-promoting factor 1-like...    147   4e-41   
ref|XP_009784060.1|  PREDICTED: flowering-promoting factor 1-like...    147   5e-41   
ref|XP_006578196.1|  PREDICTED: flowering-promoting factor 1-like       147   5e-41   
ref|XP_002871430.1|  hypothetical protein ARALYDRAFT_325603             159   6e-41   
emb|CDP19535.1|  unnamed protein product                                146   8e-41   
ref|XP_002516907.1|  conserved hypothetical protein                     146   9e-41   Ricinus communis
ref|XP_006342792.1|  PREDICTED: flowering-promoting factor 1-like...    146   1e-40   
ref|XP_009383890.1|  PREDICTED: flowering-promoting factor 1-like...    145   1e-40   
gb|AID51343.1|  flowering promoting factor 1-like protein 2             146   1e-40   
ref|XP_004136318.1|  PREDICTED: flowering-promoting factor 1-like...    146   2e-40   
dbj|BAJ98475.1|  predicted protein                                      145   2e-40   
ref|XP_010547030.1|  PREDICTED: flowering-promoting factor 1-like...    145   2e-40   
ref|XP_010269480.1|  PREDICTED: flowering-promoting factor 1-like...    145   2e-40   
ref|XP_006412599.1|  hypothetical protein EUTSA_v10027309mg             145   2e-40   
ref|XP_002315557.1|  hypothetical protein POPTR_0010s02530g             145   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010558820.1|  PREDICTED: flowering-promoting factor 1-like...    145   3e-40   
ref|XP_010675089.1|  PREDICTED: flowering-promoting factor 1-like...    145   3e-40   
ref|XP_004229231.1|  PREDICTED: flowering-promoting factor 1-like...    145   3e-40   
gb|AID51344.1|  flowering promoting factor 1-like protein 3             145   3e-40   
ref|XP_010024688.1|  PREDICTED: flowering-promoting factor 1-like...    144   4e-40   
ref|XP_008466327.1|  PREDICTED: flowering-promoting factor 1-like...    145   4e-40   
ref|XP_002869330.1|  hypothetical protein ARALYDRAFT_491604             145   5e-40   
ref|XP_011015015.1|  PREDICTED: flowering-promoting factor 1-like...    144   6e-40   
ref|XP_007154270.1|  hypothetical protein PHAVU_003G104600g             144   6e-40   
ref|XP_009394892.1|  PREDICTED: flowering-promoting factor 1-like...    144   7e-40   
ref|XP_010269481.1|  PREDICTED: flowering-promoting factor 1-like...    144   7e-40   
ref|XP_011090951.1|  PREDICTED: flowering-promoting factor 1-like...    144   7e-40   
ref|XP_010938429.1|  PREDICTED: flowering-promoting factor 1-like...    143   1e-39   
ref|XP_009380278.1|  PREDICTED: flowering-promoting factor 1-like...    143   1e-39   
ref|XP_009127035.1|  PREDICTED: flowering-promoting factor 1-like...    144   1e-39   
sp|Q5Q0B3.2|FLP1_ARATH  RecName: Full=Flowering-promoting factor ...    143   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|EPS67846.1|  hypothetical protein M569_06927                         143   2e-39   
ref|XP_010938503.1|  PREDICTED: flowering-promoting factor 1-like...    143   2e-39   
ref|XP_010269482.1|  PREDICTED: flowering-promoting factor 1-like...    143   2e-39   
ref|XP_008789929.1|  PREDICTED: flowering-promoting factor 1-like...    142   2e-39   
ref|XP_010432870.1|  PREDICTED: flowering-promoting factor 1-like...    143   3e-39   
ref|XP_009138007.1|  PREDICTED: flowering-promoting factor 1-like...    142   3e-39   
ref|XP_006419599.1|  hypothetical protein CICLE_v10006149mg             143   4e-39   
ref|XP_007225940.1|  hypothetical protein PRUPE_ppa013728mg             142   5e-39   
ref|NP_194866.2|  flowering-promoting factor 1-like protein 1           144   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006489102.1|  PREDICTED: flowering-promoting factor 1-like...    141   6e-39   
ref|NP_001042631.1|  Os01g0257300                                       141   6e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006282807.1|  hypothetical protein CARUB_v10006482mg             142   8e-39   
emb|CDX68740.1|  BnaC01g07130D                                          141   9e-39   
ref|XP_011090952.1|  PREDICTED: flowering-promoting factor 1-like...    140   1e-38   
ref|XP_006395105.1|  hypothetical protein EUTSA_v10005169mg             140   1e-38   
ref|XP_008223167.1|  PREDICTED: flowering-promoting factor 1-like...    140   1e-38   
ref|XP_010050895.1|  PREDICTED: flowering-promoting factor 1-like...    140   1e-38   
ref|XP_007035563.1|  Flowering promoting factor 1                       143   2e-38   
ref|XP_003566537.1|  PREDICTED: flowering-promoting factor 1-like...    140   2e-38   
ref|XP_010269628.1|  PREDICTED: flowering-promoting factor 1-like...    140   2e-38   
gb|EAY73364.1|  hypothetical protein OsI_01242                          140   2e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_009414864.1|  PREDICTED: flowering-promoting factor 1-like...    140   2e-38   
ref|XP_008390677.1|  PREDICTED: flowering-promoting factor 1-like...    140   2e-38   
ref|XP_003546352.1|  PREDICTED: flowering-promoting factor 1-like...    139   2e-38   
ref|XP_009151702.1|  PREDICTED: flowering-promoting factor 1-like...    140   3e-38   
gb|AID51342.1|  flowering promoting factor 1-like protein 1             139   3e-38   
ref|XP_010675033.1|  PREDICTED: flowering-promoting factor 1-like...    140   4e-38   
gb|AHI62966.1|  flowering promoting factor 1                            139   4e-38   
ref|XP_006600348.1|  PREDICTED: flowering-promoting factor 1-like...    139   5e-38   
ref|XP_002457591.1|  hypothetical protein SORBIDRAFT_03g009910          139   5e-38   Sorghum bicolor [broomcorn]
ref|XP_009343982.1|  PREDICTED: flowering-promoting factor 1-like...    141   6e-38   
emb|CDY23294.1|  BnaA08g12520D                                          138   7e-38   
ref|XP_007137109.1|  hypothetical protein PHAVU_009G100300g             138   9e-38   
ref|XP_003529571.1|  PREDICTED: flowering-promoting factor 1-like...    138   1e-37   
ref|XP_003566536.1|  PREDICTED: flowering-promoting factor 1-like...    138   1e-37   
gb|EYU43937.1|  hypothetical protein MIMGU_mgv1a018470mg                137   2e-37   
ref|XP_002273066.1|  PREDICTED: flowering-promoting factor 1-like...    137   2e-37   Vitis vinifera
emb|CDY72087.1|  BnaC07g50920D                                          137   2e-37   
gb|EYU43938.1|  hypothetical protein MIMGU_mgv1a024163mg                137   3e-37   
gb|AGT16103.1|  hypothetical protein SHCRBa_134_J05_F_240               137   3e-37   
ref|XP_003565014.1|  PREDICTED: flowering-promoting factor 1-like...    137   5e-37   
ref|NP_001240218.1|  uncharacterized protein LOC100795247               136   6e-37   
ref|XP_004967814.1|  PREDICTED: flowering-promoting factor 1-like...    136   6e-37   
ref|XP_002975506.1|  hypothetical protein SELMODRAFT_103635             136   7e-37   
ref|NP_001151726.1|  FPF1                                               136   8e-37   Zea mays [maize]
ref|XP_002865696.1|  hypothetical protein ARALYDRAFT_917838             135   1e-36   
ref|XP_009780603.1|  PREDICTED: flowering-promoting factor 1-like...    135   1e-36   
gb|EPS62886.1|  hypothetical protein M569_11903                         135   1e-36   
ref|XP_004229230.1|  PREDICTED: flowering-promoting factor 1-like...    135   2e-36   
gb|AGT16493.1|  hypothetical protein SHCRBa_010_E09_R_180               135   2e-36   
ref|XP_009631683.1|  PREDICTED: flowering-promoting factor 1-like...    135   2e-36   
ref|XP_006342791.1|  PREDICTED: flowering-promoting factor 1-like...    134   3e-36   
emb|CDP19536.1|  unnamed protein product                                134   3e-36   
ref|XP_008806479.1|  PREDICTED: flowering-promoting factor 1-like...    134   3e-36   
ref|XP_004229232.1|  PREDICTED: flowering-promoting factor 1-like...    134   5e-36   
ref|XP_009381580.1|  PREDICTED: flowering-promoting factor 1-like...    133   1e-35   
ref|XP_002969301.1|  hypothetical protein SELMODRAFT_231311             132   2e-35   
gb|AFK38483.1|  unknown                                                 132   2e-35   
ref|XP_008655501.1|  PREDICTED: flowering-promoting factor 1-like...    132   2e-35   
ref|XP_002459042.1|  hypothetical protein SORBIDRAFT_03g044960          132   2e-35   Sorghum bicolor [broomcorn]
ref|XP_007138901.1|  hypothetical protein PHAVU_009G247200g             132   3e-35   
ref|XP_008458459.1|  PREDICTED: flowering-promoting factor 1-like...    132   3e-35   
ref|XP_007138902.1|  hypothetical protein PHAVU_009G247300g             131   4e-35   
ref|XP_010914149.1|  PREDICTED: flowering-promoting factor 1-like...    131   5e-35   
gb|EAY85756.1|  hypothetical protein OsI_07114                          131   1e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001046787.1|  Os02g0460200                                       131   1e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004508273.1|  PREDICTED: flowering-promoting factor 1-like...    130   1e-34   
ref|XP_006855542.1|  hypothetical protein AMTR_s00057p00216330          129   2e-34   
ref|XP_006844708.1|  hypothetical protein AMTR_s00016p00249730          129   5e-34   
gb|KFK24886.1|  hypothetical protein AALP_AA8G037400                    128   7e-34   
ref|XP_010098295.1|  hypothetical protein L484_023543                   128   7e-34   
ref|XP_010037406.1|  PREDICTED: flowering-promoting factor 1-like...    128   7e-34   
ref|XP_009775773.1|  PREDICTED: flowering-promoting factor 1-like...    128   9e-34   
ref|XP_004487862.1|  PREDICTED: flowering-promoting factor 1-like...    127   2e-33   
ref|XP_003609664.1|  Flowering promoting factor-like protein            127   2e-33   
ref|NP_001150372.1|  LOC100284002                                       127   3e-33   Zea mays [maize]
ref|NP_001045304.1|  Os01g0933500                                       126   9e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003565015.1|  PREDICTED: flowering-promoting factor 1-like...    125   1e-32   
ref|XP_004134486.1|  PREDICTED: flowering-promoting factor 1-like...    125   1e-32   
ref|XP_006349809.1|  PREDICTED: flowering-promoting factor 1-like...    125   1e-32   
ref|XP_009775363.1|  PREDICTED: flowering-promoting factor 1-like       125   2e-32   
gb|KEH37270.1|  flowering-promoting factor-like protein                 124   3e-32   
ref|XP_009592496.1|  PREDICTED: flowering-promoting factor 1-like...    124   4e-32   
gb|AAR97604.1|  flowering promoting factor-like 1                       124   4e-32   Nicotiana tabacum [American tobacco]
ref|XP_004143087.1|  PREDICTED: flowering-promoting factor 1-like...    124   4e-32   
emb|CDP16310.1|  unnamed protein product                                123   6e-32   
ref|XP_004979083.1|  PREDICTED: flowering-promoting factor 1-like...    123   8e-32   
ref|XP_004252896.1|  PREDICTED: flowering-promoting factor 1-like...    123   9e-32   
dbj|BAK05915.1|  predicted protein                                      123   1e-31   
gb|EMT29206.1|  hypothetical protein F775_43014                         122   1e-31   
gb|KHN26564.1|  hypothetical protein glysoja_019803                     122   2e-31   
gb|EMS50985.1|  hypothetical protein TRIUR3_02177                       122   2e-31   
gb|AFK44942.1|  unknown                                                 122   2e-31   
ref|XP_009403049.1|  PREDICTED: flowering-promoting factor 1-like...    120   6e-31   
ref|XP_003533410.1|  PREDICTED: flowering-promoting factor 1-like...    120   1e-30   
ref|XP_008392931.1|  PREDICTED: flowering-promoting factor 1-like...    119   1e-30   
emb|CDX85386.1|  BnaC07g26970D                                          119   2e-30   
ref|XP_004971177.1|  PREDICTED: flowering-promoting factor 1-like...    119   4e-30   
gb|EMT27717.1|  hypothetical protein F775_43168                         117   2e-29   
ref|XP_009608254.1|  PREDICTED: flowering-promoting factor 1-like       116   3e-29   
ref|XP_004952424.1|  PREDICTED: flowering-promoting factor 1-like...    116   4e-29   
gb|EMS56626.1|  hypothetical protein TRIUR3_28721                       115   5e-29   
ref|XP_003573212.1|  PREDICTED: flowering-promoting factor 1-like...    115   1e-28   
ref|XP_007207669.1|  hypothetical protein PRUPE_ppa023040mg             115   1e-28   
ref|XP_003579379.1|  PREDICTED: flowering-promoting factor 1-like...    114   1e-28   
dbj|BAJ90847.1|  predicted protein                                      114   1e-28   
ref|XP_004143120.1|  PREDICTED: flowering-promoting factor 1-like       114   4e-28   
ref|XP_002314177.2|  hypothetical protein POPTR_0009s03690g             114   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006645285.1|  PREDICTED: flowering-promoting factor 1-like...    114   5e-28   
dbj|BAJ94687.1|  predicted protein                                      112   8e-28   
ref|NP_001148034.1|  flowering promoting factor-like 1                  112   2e-27   Zea mays [maize]
ref|XP_004975093.1|  PREDICTED: flowering-promoting factor 1-like...    111   2e-27   
ref|XP_008802715.1|  PREDICTED: flowering-promoting factor 1-like...    111   3e-27   
gb|AFW57920.1|  hypothetical protein ZEAMMB73_461064                    110   4e-27   
ref|XP_010922314.1|  PREDICTED: flowering-promoting factor 1-like...    111   4e-27   
ref|XP_002446220.1|  hypothetical protein SORBIDRAFT_06g005000          110   5e-27   Sorghum bicolor [broomcorn]
ref|XP_006424840.1|  hypothetical protein CICLE_v10030377mg             111   6e-27   
ref|XP_008358574.1|  PREDICTED: flowering-promoting factor 1-like       110   6e-27   
ref|XP_010257117.1|  PREDICTED: flowering-promoting factor 1-like...    110   7e-27   
ref|XP_007150327.1|  hypothetical protein PHAVU_005G144300g             110   1e-26   
gb|KDP20448.1|  hypothetical protein JCGZ_05293                         110   1e-26   
ref|XP_007016400.1|  FPF1-like protein 1                                111   1e-26   
gb|KEH39443.1|  flowering-promoting factor-like protein                 110   1e-26   
ref|XP_008353230.1|  PREDICTED: flowering-promoting factor 1-like...    108   2e-26   
gb|EMT27194.1|  hypothetical protein F775_17275                         108   2e-26   
ref|XP_008366315.1|  PREDICTED: flowering-promoting factor 1-like       108   6e-26   
ref|XP_004295909.1|  PREDICTED: flowering-promoting factor 1-like...    108   6e-26   
ref|XP_009364435.1|  PREDICTED: flowering-promoting factor 1-like       108   7e-26   
ref|XP_001773789.1|  predicted protein                                  107   9e-26   
dbj|BAJ90965.1|  predicted protein                                      107   1e-25   
emb|CAH66051.1|  OSIGBa0131F24.5                                        106   2e-25   Oryza sativa [red rice]
ref|NP_001052368.1|  Os04g0282400                                       106   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009619711.1|  PREDICTED: flowering-promoting factor 1-like       106   3e-25   
ref|XP_009353807.1|  PREDICTED: flowering-promoting factor 1-like       105   5e-25   
gb|EMT26987.1|  hypothetical protein F775_32604                         105   6e-25   
ref|XP_003542029.1|  PREDICTED: flowering-promoting factor 1-like...    105   7e-25   
emb|CDP09062.1|  unnamed protein product                                105   8e-25   
gb|EMS49142.1|  hypothetical protein TRIUR3_19497                       104   1e-24   
ref|XP_004487001.1|  PREDICTED: flowering-promoting factor 1-like...    105   1e-24   
ref|XP_006846210.1|  hypothetical protein AMTR_s00012p00223910          105   1e-24   
ref|XP_008653451.1|  PREDICTED: flowering-promoting factor 1-like...    103   4e-24   
ref|XP_001781285.1|  predicted protein                                  103   4e-24   
ref|XP_010046401.1|  PREDICTED: flowering-promoting factor 1-like...    103   5e-24   
ref|XP_003562478.1|  PREDICTED: flowering-promoting factor 1-like...    102   5e-24   
ref|XP_002280961.1|  PREDICTED: flowering-promoting factor 1-like...    103   5e-24   Vitis vinifera
gb|EMS35779.1|  hypothetical protein TRIUR3_30879                       102   7e-24   
ref|XP_010242585.1|  PREDICTED: flowering-promoting factor 1-like       102   8e-24   
dbj|BAJ89710.1|  predicted protein                                      101   1e-23   
emb|CAD39791.2|  OSJNBa0071G03.4                                        101   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010106488.1|  hypothetical protein L484_025246                   102   3e-23   
ref|XP_010242586.1|  PREDICTED: flowering-promoting factor 1-like       100   5e-23   
ref|XP_002461183.1|  hypothetical protein SORBIDRAFT_02g042480        99.8    6e-23   Sorghum bicolor [broomcorn]
dbj|BAJ86596.1|  predicted protein                                    99.0    1e-22   
ref|XP_002531438.1|  conserved hypothetical protein                   99.8    1e-22   Ricinus communis
ref|XP_006366491.1|  PREDICTED: flowering-promoting factor 1-like...  99.4    2e-22   
ref|XP_006645726.1|  PREDICTED: flowering-promoting factor 1-like...  97.1    3e-22   
gb|EMT16715.1|  hypothetical protein F775_27105                       97.8    3e-22   
ref|XP_010228632.1|  PREDICTED: flowering-promoting factor 1-like...  98.2    4e-22   
ref|XP_004958641.1|  PREDICTED: flowering-promoting factor 1-like...  97.8    4e-22   
gb|KCW85562.1|  hypothetical protein EUGRSUZ_B02361                   98.2    4e-22   
ref|XP_004240609.1|  PREDICTED: flowering-promoting factor 1-like     98.2    4e-22   
gb|EMT29275.1|  hypothetical protein F775_08225                       97.4    6e-22   
gb|EAY89981.1|  hypothetical protein OsI_11543                        97.1    8e-22   Oryza sativa Indica Group [Indian rice]
gb|EMT20717.1|  hypothetical protein F775_15328                       96.3    1e-21   
ref|XP_006650073.1|  PREDICTED: flowering-promoting factor 1-like...  95.5    3e-21   
ref|XP_006658093.1|  PREDICTED: flowering-promoting factor 1-like...  95.1    4e-21   
ref|NP_001060595.2|  Os07g0671000                                     95.1    4e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC15985.1|  hypothetical protein                                 94.4    6e-21   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99063.1|  predicted protein                                    94.0    1e-20   
gb|EMT31476.1|  hypothetical protein F775_21710                       92.4    4e-20   
gb|EMT15843.1|  hypothetical protein F775_18646                       91.3    1e-19   
emb|CDM86033.1|  unnamed protein product                              89.7    3e-19   
ref|XP_008670648.1|  PREDICTED: flowering-promoting factor 1-like...  89.0    7e-19   
gb|EMS46910.1|  hypothetical protein TRIUR3_17642                     88.6    1e-18   
gb|EEC72106.1|  hypothetical protein OsI_05075                        87.0    3e-18   
gb|EMT20718.1|  hypothetical protein F775_15329                       87.0    4e-18   
gb|KHN33380.1|  hypothetical protein glysoja_005422                   86.7    2e-17   
ref|XP_010234609.1|  PREDICTED: LOW QUALITY PROTEIN: flowering-pr...  82.8    1e-16   
ref|XP_006597271.1|  PREDICTED: flowering-promoting factor 1-like...  82.0    4e-16   
gb|EMS58782.1|  hypothetical protein TRIUR3_28282                     80.9    5e-16   
emb|CAN66164.1|  hypothetical protein VITISV_008127                   80.9    5e-16   
ref|XP_002985524.1|  hypothetical protein SELMODRAFT_122532           80.9    8e-16   
tpg|DAA55964.1|  TPA: hypothetical protein ZEAMMB73_557594            76.6    1e-14   
gb|EMS61641.1|  hypothetical protein TRIUR3_10752                     77.4    2e-14   
gb|EMT20074.1|  hypothetical protein F775_18776                       76.3    3e-14   
gb|EMT24369.1|  hypothetical protein F775_43313                       73.9    9e-14   
emb|CDX87113.1|  BnaC09g04280D                                        72.8    2e-13   
ref|XP_001752252.1|  predicted protein                                70.5    4e-12   
ref|NP_001050091.2|  Os03g0346200                                     68.9    5e-12   
gb|EMS64449.1|  hypothetical protein TRIUR3_29567                     67.4    2e-11   
ref|XP_009761114.1|  PREDICTED: flowering-promoting factor 1-like...  60.1    1e-08   
ref|XP_009761113.1|  PREDICTED: flowering-promoting factor 1-like...  59.7    1e-08   
ref|XP_009761112.1|  PREDICTED: flowering-promoting factor 1-like...  59.7    1e-08   
gb|EMS58326.1|  hypothetical protein TRIUR3_13283                     58.5    2e-08   
gb|EMT10677.1|  hypothetical protein F775_43087                       58.5    2e-08   
ref|XP_002976114.1|  hypothetical protein SELMODRAFT_29400            58.9    3e-08   
ref|XP_002968264.1|  hypothetical protein SELMODRAFT_29401            57.8    7e-08   
gb|ABR25416.1|  flowering promoting factor-like 1                     56.6    1e-07   
ref|XP_009761111.1|  PREDICTED: flowering-promoting factor 1-like...  58.5    1e-07   
ref|XP_009761110.1|  PREDICTED: uncharacterized protein LOC104213...  57.8    2e-07   
gb|EMT24368.1|  hypothetical protein F775_13540                       52.8    4e-06   
gb|EMT00120.1|  hypothetical protein F775_43144                       48.9    9e-05   



>ref|XP_007225954.1| hypothetical protein PRUPE_ppa013757mg [Prunus persica]
 ref|XP_008219799.1| PREDICTED: flowering-promoting factor 1 [Prunus mume]
 gb|EMJ27153.1| hypothetical protein PRUPE_ppa013757mg [Prunus persica]
Length=105

 Score =   185 bits (469),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 2/106 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP AE   +SRKK LV+LP+GQVVSSY  LEQILTGLGWERYY 
Sbjct  1    MSGVWVFKNGVIRLVENPQAE--TSSRKKALVHLPSGQVVSSYSTLEQILTGLGWERYYG  58

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDPDLFQFHK+SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  59   GDPDLFQFHKRSSIDLISLPRDFSKFNSVYMYDIVIKNPNIFHVRD  104



>gb|KDP33436.1| hypothetical protein JCGZ_07007 [Jatropha curcas]
Length=109

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE---HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV RLVENP AE   HG+ SR+K LV+LPTGQV++SY  LEQILT LGWER
Sbjct  1    MSGVWVFKNGVIRLVENPGAETSSHGS-SRRKVLVHLPTGQVITSYSSLEQILTDLGWER  59

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY GDPDLFQFHK SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  60   YYGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNIFHVRD  108



>ref|XP_009363602.1| PREDICTED: flowering-promoting factor 1-like [Pyrus x bretschneideri]
Length=106

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 96/107 (90%), Gaps = 3/107 (3%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKN GV RLVENP AE   +SR+K LV+LP+GQVVSSY  LEQILTGLGWERYY
Sbjct  1    MSGVWVFKNNGVIRLVENPQAE--TSSRRKALVHLPSGQVVSSYSMLEQILTGLGWERYY  58

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             GDPDLFQFHK+SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  59   EGDPDLFQFHKRSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRD  105



>ref|XP_003544636.1| PREDICTED: flowering-promoting factor 1-like [Glycine max]
 gb|KHN31838.1| hypothetical protein glysoja_045521 [Glycine soja]
Length=113

 Score =   178 bits (451),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 97/112 (87%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV+RLVENP AE       G++S++K LV+LPTG+VVSSY  LEQILTGLG
Sbjct  1    MSGVWVFKNGVFRLVENPQAEVSDRHGKGSSSKRKMLVHLPTGEVVSSYAFLEQILTGLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY GDPDL+QFHK SSIDLISLP+D++KFNSI MYDIV+KNPN+F VRD
Sbjct  61   WERYYDGDPDLYQFHKHSSIDLISLPKDFSKFNSINMYDIVIKNPNVFHVRD  112



>ref|NP_001237780.1| uncharacterized protein LOC100527299 [Glycine max]
 gb|ACJ61475.1| flowering promoting factor [Glycine max]
 gb|ACU16370.1| unknown [Glycine max]
 gb|ACU17493.1| unknown [Glycine max]
 gb|KHM99323.1| hypothetical protein glysoja_042736 [Glycine soja]
Length=114

 Score =   177 bits (450),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 97/113 (86%), Gaps = 7/113 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKNGV+RLVENP AE        G++S++K LV+LPTG+VVSSY  LEQILTGL
Sbjct  1    MSGVWVFKNGVFRLVENPQAEASDGRHGKGSSSKRKVLVHLPTGEVVSSYAFLEQILTGL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY GDPDL+QFHK SSIDLISLP+D++KFNSI MYDIV+KNPN+F VRD
Sbjct  61   GWERYYDGDPDLYQFHKHSSIDLISLPKDFSKFNSINMYDIVIKNPNVFHVRD  113



>ref|XP_006371802.1| FLOWERING PROMOTING FACTOR 1 family protein [Populus trichocarpa]
 gb|ERP49599.1| FLOWERING PROMOTING FACTOR 1 family protein [Populus trichocarpa]
Length=112

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAE----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVW FKN GV RLVENPAAE    +G+ SR+K LV+LP+GQVVSSY  LEQIL  LGW
Sbjct  1    MSGVWFFKNNGVIRLVENPAAESNGGNGSGSRRKVLVHLPSGQVVSSYSSLEQILNELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY GDPDLFQFHKQSSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  61   ERYYGGDPDLFQFHKQSSIDLISLPRDFSKFNSVYMYDIVIKNPNIFHVRD  111



>ref|XP_006483594.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Citrus 
sinensis]
 ref|XP_006495484.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Citrus 
sinensis]
 gb|KDO67242.1| hypothetical protein CISIN_1g033867mg [Citrus sinensis]
Length=110

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 3/109 (3%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAEH--GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVF  NGV RL+ENP AE    ++SR+K LV+LPTG+VVSSY  LEQILTGLGWER
Sbjct  1    MSGVWVFNTNGVIRLIENPQAESQGSSSSRRKVLVHLPTGEVVSSYSSLEQILTGLGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY GDPDLFQFHK SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  61   YYGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRD  109



>ref|XP_008393971.1| PREDICTED: flowering-promoting factor 1-like [Malus domestica]
Length=106

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 3/107 (3%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF N GV RLVENP AE   ++R+K LV+LP+GQVVSSY  LEQILTGLGWERYY
Sbjct  1    MSGVWVFNNNGVIRLVENPQAE--TSTRRKALVHLPSGQVVSSYSTLEQILTGLGWERYY  58

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             GDPDLFQFHK+SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  59   GGDPDLFQFHKRSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRD  105



>ref|XP_010102853.1| hypothetical protein L484_004425 [Morus notabilis]
 gb|EXB94234.1| hypothetical protein L484_004425 [Morus notabilis]
Length=115

 Score =   176 bits (447),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 8/114 (7%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAE------HGAASRK-KCLVYLPTGQVVSSYRCLEQILTG  255
            MSGVWVFK NGV  LVENP AE      HG++SR+ K LV+LPTGQVVSSY  LEQILTG
Sbjct  1    MSGVWVFKPNGVMHLVENPQAESAGDGRHGSSSRRNKVLVHLPTGQVVSSYSSLEQILTG  60

Query  256  LGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            LGWERYY GDPDLFQFHK+SSIDLISLPRD+++FNS+YMYDIV+KNPN+F VRD
Sbjct  61   LGWERYYGGDPDLFQFHKRSSIDLISLPRDFSRFNSVYMYDIVIKNPNIFHVRD  114



>ref|XP_006382178.1| hypothetical protein POPTR_0006s29100g [Populus trichocarpa]
 gb|ERP59975.1| hypothetical protein POPTR_0006s29100g [Populus trichocarpa]
Length=112

 Score =   176 bits (446),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 95/111 (86%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAE----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFKN GV RLVENPAAE    +G  SR+K LV+LP+GQVV+SY  LEQIL  LGW
Sbjct  1    MSGVWVFKNNGVIRLVENPAAESNGMNGGGSRRKVLVHLPSGQVVTSYSSLEQILKELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY GDPDLFQFHK SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  61   ERYYGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNMFHVRD  111



>ref|XP_009798997.1| PREDICTED: flowering-promoting factor 1-like [Nicotiana sylvestris]
Length=106

 Score =   175 bits (443),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 94/106 (89%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV+RLVENP++E G   R+K LV+LPTGQVVSSY  LE+IL GLGWERYY 
Sbjct  1    MSGVWVFKNGVFRLVENPSSEQGQ-RRRKVLVHLPTGQVVSSYCSLERILNGLGWERYYG  59

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDP+LFQFHK SSIDLISLP+D+ KFNSI+MYDIVVKNPN+F VRD
Sbjct  60   GDPELFQFHKHSSIDLISLPKDFAKFNSIHMYDIVVKNPNVFHVRD  105



>ref|XP_009610086.1| PREDICTED: flowering-promoting factor 1-like [Nicotiana tomentosiformis]
Length=106

 Score =   175 bits (443),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV+RLVENP++E G   R+K LV+LPTGQVVSSY  LE+IL GLGWERYY 
Sbjct  1    MSGVWVFKNGVFRLVENPSSEQGQ-RRRKVLVHLPTGQVVSSYCSLERILNGLGWERYYG  59

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDP+LFQFHK S+IDLISLP+D++KFNSI+MYDIVVKNPN+F VRD
Sbjct  60   GDPELFQFHKHSTIDLISLPKDFSKFNSIHMYDIVVKNPNVFHVRD  105



>ref|XP_009338842.1| PREDICTED: flowering-promoting factor 1-like [Pyrus x bretschneideri]
Length=104

 Score =   174 bits (440),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVW FKNGV RLVENP AE    S +K LV+LP+G+VVSSY  LE+ILTGLGWERYY 
Sbjct  1    MSGVWTFKNGVIRLVENPQAE---TSSRKALVHLPSGKVVSSYSMLEEILTGLGWERYYG  57

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDPDLFQFHK+SSIDLISLP D++KFNS+YMYDIV+KNPN+F VRD
Sbjct  58   GDPDLFQFHKRSSIDLISLPSDFSKFNSVYMYDIVIKNPNIFHVRD  103



>ref|XP_006450137.1| hypothetical protein CICLE_v10009959mg [Citrus clementina]
 gb|ESR63377.1| hypothetical protein CICLE_v10009959mg [Citrus clementina]
Length=116

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 3/108 (3%)
 Frame = +1

Query  103  SGVWVFK-NGVYRLVENPAAEH--GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            SGVWVF  NGV RL+ENP AE    ++SR+K LV+LPTG+VVSSY  LEQILTGLGWERY
Sbjct  8    SGVWVFNTNGVIRLIENPQAESQGSSSSRRKVLVHLPTGEVVSSYSSLEQILTGLGWERY  67

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y GDPDLFQFHK SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  68   YGGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNVFHVRD  115



>ref|XP_008365164.1| PREDICTED: flowering-promoting factor 1-like [Malus domestica]
Length=105

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 2/106 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVW FKNGV RLVENP AE   +SRKK LV+LP+G+VVSSY  LE+ILTGLGWERYY 
Sbjct  1    MSGVWTFKNGVMRLVENPQAE--TSSRKKALVHLPSGEVVSSYSMLEEILTGLGWERYYG  58

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDLFQFHK+SSIDLISLP D++KFNS++MYDIV+KNPN+F VRD
Sbjct  59   RDPDLFQFHKRSSIDLISLPGDFSKFNSVHMYDIVIKNPNIFHVRD  104



>emb|CDP00906.1| unnamed protein product [Coffea canephora]
Length=111

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAA---SRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVF+N GV +LVENPAAE G A   +R+K LV+LP+GQV+SSY  LE IL GLGWE
Sbjct  1    MSGVWVFRNNGVIQLVENPAAEQGDARNGTRRKALVHLPSGQVISSYSYLENILNGLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY GDPDLFQFHK SSIDLISLPRD++KFNS+YMYDIVVKNPN+F VRD
Sbjct  61   RYYDGDPDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVVKNPNIFHVRD  110



>ref|XP_010669450.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Beta 
vulgaris subsp. vulgaris]
Length=112

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHG----AASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFKN GV RLVENP AEHG    A +RKK LV+LPTG+VVSSY+ LE+IL  LGW
Sbjct  1    MSGVWVFKNNGVIRLVENPQAEHGGSDQARTRKKVLVHLPTGKVVSSYQILEEILKDLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            E Y+SGDPDL+QFHK+SSIDLISLPR+++KF+S+YMYDIVVKNPN+FQVRD
Sbjct  61   EHYFSGDPDLYQFHKRSSIDLISLPREFSKFSSVYMYDIVVKNPNVFQVRD  111



>ref|XP_004498589.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Cicer 
arietinum]
Length=107

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV+RLVENP  E G   ++K LV+LPTG+VV+SY  LE+IL GLGWERYY 
Sbjct  1    MSGVWVFKNGVFRLVENPQGEDGRNGKRKMLVHLPTGEVVTSYAFLERILMGLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDPDL+QFHK SSIDLISLP+D++KFNSI MYDIV+KNPN+F VRD
Sbjct  61   GDPDLYQFHKHSSIDLISLPKDFSKFNSINMYDIVIKNPNVFHVRD  106



>ref|XP_007161300.1| hypothetical protein PHAVU_001G058400g [Phaseolus vulgaris]
 gb|ESW33294.1| hypothetical protein PHAVU_001G058400g [Phaseolus vulgaris]
Length=115

 Score =   171 bits (434),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 8/114 (7%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAE-------HGAASRKKCLVYLPTGQVVSSYRCLEQILTG  255
            MSGVW+FKN GVYRLVENP AE        G++S++K LV+LP+G+VVSSY  LEQILTG
Sbjct  1    MSGVWMFKNNGVYRLVENPQAEGSDGRQGKGSSSKRKVLVHLPSGEVVSSYAFLEQILTG  60

Query  256  LGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            LGWERYY GDPDL+QFHK SSIDLISLP+D++KFNSI MYDIV+KNPN+F VRD
Sbjct  61   LGWERYYDGDPDLYQFHKHSSIDLISLPKDFSKFNSINMYDIVIKNPNVFHVRD  114



>gb|EYU22723.1| hypothetical protein MIMGU_mgv1a016620mg [Erythranthe guttata]
Length=114

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 94/113 (83%), Gaps = 7/113 (6%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEH------GAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKN GV +LVEN +  H       A S++K LVYLPTGQVVSSY CLEQIL GL
Sbjct  1    MSGVWVFKNNGVMQLVENTSDVHCDNGRRSAHSKRKALVYLPTGQVVSSYSCLEQILRGL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY GD DLFQFHK+SSIDLISLP+DY+KFNSIYMYDIVVKNPN+F VRD
Sbjct  61   GWERYYGGDHDLFQFHKRSSIDLISLPKDYSKFNSIYMYDIVVKNPNVFHVRD  113



>ref|XP_010669448.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Beta 
vulgaris subsp. vulgaris]
Length=113

 Score =   171 bits (432),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHG-----AASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKN GV RLVENP AEHG     A +RKK LV+LPTG+V+SSY+ LEQIL  LG
Sbjct  1    MSGVWVFKNNGVIRLVENPQAEHGGSDQAARARKKVLVHLPTGKVISSYQKLEQILKDLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WE Y+ GDPDL+QFHK+SSIDLISLPR+++KF+S+YMYDIVVKNPN+FQVRD
Sbjct  61   WEIYFGGDPDLYQFHKRSSIDLISLPREFSKFSSVYMYDIVVKNPNVFQVRD  112



>ref|XP_011008657.1| PREDICTED: flowering-promoting factor 1-like [Populus euphratica]
Length=112

 Score =   170 bits (431),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAE----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFKN GV RLVENPAAE    +G   R+K LV+LP+GQVV+SY  LEQIL  LGW
Sbjct  1    MSGVWVFKNNGVMRLVENPAAESNEKNGGGPRRKVLVHLPSGQVVNSYSTLEQILKELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY GD DLFQFHK SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  61   ERYYGGDRDLFQFHKHSSIDLISLPRDFSKFNSVYMYDIVIKNPNMFHVRD  111



>ref|XP_004303449.1| PREDICTED: flowering-promoting factor 1-like [Fragaria vesca 
subsp. vesca]
Length=103

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 6/107 (6%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFK NGV RLV++      ++SRKK LV+LPTGQVV+SY  LE+ILTGLGWERYY
Sbjct  1    MSGVWVFKQNGVMRLVDD-----SSSSRKKALVHLPTGQVVNSYSALERILTGLGWERYY  55

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             GDPDL+QFHK SSIDLISLPRD+NKFNS+YMYDIVVKNPNLF VRD
Sbjct  56   GGDPDLYQFHKHSSIDLISLPRDFNKFNSVYMYDIVVKNPNLFHVRD  102



>ref|XP_004138764.1| PREDICTED: flowering-promoting factor 1-like [Cucumis sativus]
 ref|XP_004160847.1| PREDICTED: flowering-promoting factor 1-like [Cucumis sativus]
 ref|XP_008445094.1| PREDICTED: flowering-promoting factor 1-like [Cucumis melo]
 gb|KGN62877.1| hypothetical protein Csa_2G379080 [Cucumis sativus]
Length=111

 Score =   169 bits (429),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEH----GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV RL+ENP A+     G + R K L++LPTGQ V+SY  LE ILT LGWE
Sbjct  1    MSGVWVFKNGVIRLIENPQADSDGRLGNSRRSKVLIHLPTGQPVTSYSSLENILTSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY GDP+LFQFHK+SSIDLISLPRD+ KFNSI+MYDIV+KNPNLF VRD
Sbjct  61   RYYGGDPELFQFHKRSSIDLISLPRDFAKFNSIHMYDIVIKNPNLFHVRD  110



>gb|EYU37354.1| hypothetical protein MIMGU_mgv1a020346mg [Erythranthe guttata]
Length=115

 Score =   169 bits (429),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 92/113 (81%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEH-------GAASRKKCLVYLPTGQVVSSYRCLEQILTG  255
            MSGVWVFKN GV +LVENP+  H        A+ +KK LVYLPTGQVVSSY CLEQIL G
Sbjct  1    MSGVWVFKNNGVMQLVENPSDVHCDNGRRSAASCKKKVLVYLPTGQVVSSYTCLEQILRG  60

Query  256  LGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
            LGWERYY GD DLFQFHK SSIDLISLP+DY KFNS+YMYDIVVKNPN+F VR
Sbjct  61   LGWERYYGGDNDLFQFHKHSSIDLISLPKDYAKFNSVYMYDIVVKNPNVFHVR  113



>ref|XP_011095550.1| PREDICTED: flowering-promoting factor 1-like [Sesamum indicum]
Length=114

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 94/114 (82%), Gaps = 9/114 (8%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAA-------SRKKCLVYLPTGQVVSSYRCLEQILTG  255
            MSGVWVFKN GV +LVENP+ EH  A       S++K LV+LPTGQVVSSY  L+QIL G
Sbjct  1    MSGVWVFKNNGVMQLVENPS-EHSDANGNGKRTSKRKVLVHLPTGQVVSSYSSLDQILRG  59

Query  256  LGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            LGWERYY GDPDLFQFHK +SIDLISLPRD+ KFNSIYMYDIVVKNPN+F VRD
Sbjct  60   LGWERYYGGDPDLFQFHKHTSIDLISLPRDFAKFNSIYMYDIVVKNPNIFHVRD  113



>gb|EYU37357.1| hypothetical protein MIMGU_mgv1a016613mg [Erythranthe guttata]
Length=114

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 92/112 (82%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEH------GAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKN GV +LVENP+  H       A+ +KK LVYLPTGQVVSSY CLEQIL GL
Sbjct  1    MSGVWVFKNSGVMQLVENPSDGHCDNGRRSASCKKKSLVYLPTGQVVSSYTCLEQILRGL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
            GWERYY GD DLFQFHK SSIDLISLP+D+ KFNS+YMYDIV+KNPN+F VR
Sbjct  61   GWERYYGGDNDLFQFHKHSSIDLISLPKDFAKFNSVYMYDIVIKNPNVFHVR  112



>ref|XP_003631818.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Vitis 
vinifera]
 emb|CBI20778.3| unnamed protein product [Vitis vinifera]
Length=108

 Score =   167 bits (424),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 91/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE---HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV+ L ENP AE    G   ++K LVYLPTG+VVSSY  LE+IL GLGWER
Sbjct  1    MSGVWVFKNGVFHL-ENPQAESNGQGGTGQRKVLVYLPTGEVVSSYNSLERILRGLGWER  59

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY GDPDLFQFHK SSIDLISLPR+++KF SIYMYD+V+KNPN+F VRD
Sbjct  60   YYGGDPDLFQFHKSSSIDLISLPREFSKFTSIYMYDLVIKNPNIFHVRD  108



>ref|XP_002872131.1| hypothetical protein ARALYDRAFT_910533 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48390.1| hypothetical protein ARALYDRAFT_910533 [Arabidopsis lyrata subsp. 
lyrata]
Length=109

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     SR+K +VYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGSDTHSRRKVMVYLPTGEVVSSYSTLEQILQSLGWERYF  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             GD DL QFHK+SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD
Sbjct  61   GGDTDLLQFHKRSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRD  107



>ref|XP_010519600.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Tarenaya 
hassleriana]
Length=109

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +   +  R+K LVYLPTG++VSSY  LEQIL  LGWERYY
Sbjct  1    MSGVWVFKNGVIRLVENPNQSSDSSHGRRKVLVYLPTGEIVSSYSSLEQILRSLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             GD DL QFHK+SSIDLISLPRD++KFNS+YMYDIVVKNPN F VRD
Sbjct  61   GGDSDLIQFHKRSSIDLISLPRDFSKFNSVYMYDIVVKNPNSFHVRD  107



>ref|XP_009122035.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Brassica 
rapa]
 emb|CDX69815.1| BnaA10g21640D [Brassica napus]
Length=109

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA-SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP    G    R+  LVYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGGVTHGRRNVLVYLPTGEVVSSYSSLEQILMSLGWERYF  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            SGD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIV+KNPN F VRD
Sbjct  61   SGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVIKNPNTFHVRD  107



>ref|XP_011045026.1| PREDICTED: flowering-promoting factor 1-like [Populus euphratica]
 ref|XP_011015270.1| PREDICTED: flowering-promoting factor 1-like [Populus euphratica]
Length=112

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAASRK----KCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVW FKN GV RLVENPAAE    +      K LV+LP+GQVVSSY  LEQIL  LGW
Sbjct  1    MSGVWFFKNNGVIRLVENPAAESNGGNGGGSRRKVLVHLPSGQVVSSYSSLEQILNELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY GDPDLFQFHKQSSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  61   ERYYGGDPDLFQFHKQSSIDLISLPRDFSKFNSVYMYDIVIKNPNIFHVRD  111



>ref|XP_006288922.1| hypothetical protein CARUB_v10002286mg [Capsella rubella]
 gb|EOA21820.1| hypothetical protein CARUB_v10002286mg [Capsella rubella]
Length=113

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-----AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF NGV RLVENP      A H    R+  LVYLPTG+VVSSY  LEQIL  LGW
Sbjct  1    MSGVWVFNNGVIRLVENPNQSGGVATHQTHGRRNVLVYLPTGEVVSSYSSLEQILRSLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERY+SGD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIVVKNPN F VRD
Sbjct  61   ERYFSGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVVKNPNTFHVRD  111



>ref|XP_002527969.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34381.1| conserved hypothetical protein [Ricinus communis]
Length=112

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 93/112 (83%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAE-----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFK NGV+ ++ENP AE      G +SR+K LV+LP+GQVV+SY  LEQIL  LG
Sbjct  1    MSGVWVFKHNGVF-ILENPGAEASEGRQGGSSRRKVLVHLPSGQVVTSYSSLEQILRNLG  59

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY GDPDLFQFHK SSIDLISLPRD++KF S+YMYDIVVKNPN+F VRD
Sbjct  60   WERYYGGDPDLFQFHKHSSIDLISLPRDFSKFTSVYMYDIVVKNPNIFHVRD  111



>gb|EYU31640.1| hypothetical protein MIMGU_mgv1a024104mg [Erythranthe guttata]
Length=115

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 91/113 (81%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------GAASRKKCLVYLPTGQVVSSYRCLEQILTG  255
            MSGVWVF KNGV +LV+NP+  H        A+ +KK LVYLP GQVVSSY CLEQIL G
Sbjct  1    MSGVWVFNKNGVMQLVKNPSDFHCDNGRRSAASCKKKALVYLPNGQVVSSYTCLEQILRG  60

Query  256  LGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
            LGWERYY GD DLFQFHK SSIDLISLP+DY KFNS+YMYDIVVKNPN+F VR
Sbjct  61   LGWERYYGGDNDLFQFHKHSSIDLISLPKDYAKFNSVYMYDIVVKNPNVFHVR  113



>emb|CDX97031.1| BnaC09g45940D [Brassica napus]
 emb|CDX95472.1| BnaC01g33640D [Brassica napus]
Length=109

 Score =   165 bits (417),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA-SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP    G    R+  LVYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGGVTHGRRNVLVYLPTGEVVSSYSSLEQILMSLGWERYF  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            SGD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIV+KNPN F VR+
Sbjct  61   SGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVIKNPNTFHVRE  107



>gb|KEH39770.1| flowering-promoting factor-like protein [Medicago truncatula]
Length=109

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 7/110 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV+RLVENP AE    HG   ++K LV+LPTG+VV+SY  LE+IL GLGWE
Sbjct  1    MSGVWVFKNGVFRLVENPQAESEVRHG---KRKMLVHLPTGEVVTSYAFLERILIGLGWE  57

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY GD DL+QFHK  SIDLISLP+D++KFNSI+MYDIV+KNPN+F VRD
Sbjct  58   RYYDGDVDLYQFHKHCSIDLISLPKDFSKFNSIHMYDIVIKNPNVFHVRD  107



>ref|XP_009111644.1| PREDICTED: flowering-promoting factor 1-like [Brassica rapa]
Length=122

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 92/113 (81%), Gaps = 4/113 (4%)
 Frame = +1

Query  88   VKIIMSGVWVFKNGVYRLVENPAAEHGAA--SRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            +K IMSGVWVFKNGV RLVENP  + GA   SR+K +VYLPTG+VVSSY  LEQIL  LG
Sbjct  11   IKKIMSGVWVFKNGVIRLVENPN-QSGADTYSRRKVMVYLPTGEVVSSYSMLEQILQSLG  69

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            WERY+ GD +L QFHK SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD 
Sbjct  70   WERYF-GDTELLQFHKPSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRDS  121



>gb|AFK37888.1| unknown [Medicago truncatula]
Length=109

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 7/110 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV+RLVENP AE    HG   ++K LV+LPTG+VV+SY  LE+IL GLGWE
Sbjct  1    MSGVWVFKNGVFRLVENPQAESEVRHG---KRKMLVHLPTGEVVTSYVFLERILIGLGWE  57

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY GD DL+QFHK  SIDLISLP+D++KFNSI+MYDIV+KNPN+F VRD
Sbjct  58   RYYDGDVDLYQFHKHCSIDLISLPKDFSKFNSIHMYDIVIKNPNVFHVRD  107



>ref|XP_006290133.1| hypothetical protein CARUB_v10003797mg [Capsella rubella]
 gb|EOA23031.1| hypothetical protein CARUB_v10003797mg [Capsella rubella]
Length=108

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     SR+K +VYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGSDTQSRRKVMVYLPTGEVVSSYSTLEQILQSLGWERYF  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
             GD DL QFHK+SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD 
Sbjct  61   -GDTDLLQFHKRSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRDS  107



>ref|XP_010525546.1| PREDICTED: flowering-promoting factor 1-like [Tarenaya hassleriana]
Length=109

 Score =   163 bits (413),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +   +  R+K LVYLPTG++VSSY  LEQIL  LGWERYY
Sbjct  1    MSGVWVFKNGVIRLVENPNQSSDSSHGRRKVLVYLPTGEIVSSYSSLEQILQRLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             GD DL QFHK+SSIDLISLPRD++KF+S+YMYDIVVKNPN F VRD
Sbjct  61   GGDIDLIQFHKRSSIDLISLPRDFSKFSSVYMYDIVVKNPNSFHVRD  107



>ref|NP_974763.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LXB5.1|FLP2_ARATH RecName: Full=Flowering-promoting factor 1-like protein 2; AltName: 
Full=FPF1-like protein 2 [Arabidopsis thaliana]
 emb|CAB89380.1| FPF1 protein-like [Arabidopsis thaliana]
 gb|AAT41844.1| At5g10630 [Arabidopsis thaliana]
 gb|AED91573.1| uncharacterized protein AT5G10625 [Arabidopsis thaliana]
Length=112

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----RKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVF NGV RLVENP    G ++    R+  LVYLPTG+ VSSY  LEQIL  LGWE
Sbjct  1    MSGVWVFNNGVIRLVENPNQSGGVSTQSHGRRNVLVYLPTGEAVSSYSSLEQILRSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RY+SGD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIVVKNPN F VRD
Sbjct  61   RYFSGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVVKNPNSFHVRD  110



>ref|XP_010422823.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Camelina 
sativa]
Length=113

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 88/111 (79%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-----AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF NGV RLVENP      A H    R+  LVYLPTG+VVSSY  LEQIL  LGW
Sbjct  1    MSGVWVFNNGVIRLVENPNQSGGVATHQTHGRRNVLVYLPTGEVVSSYSSLEQILRSLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERY++GD DL Q+HK+S+IDLISLPRD++KFNS+YMYDIV+KNPN F VRD
Sbjct  61   ERYFNGDSDLIQYHKRSTIDLISLPRDFSKFNSVYMYDIVIKNPNSFHVRD  111



>ref|XP_010421334.1| PREDICTED: flowering-promoting factor 1 [Camelina sativa]
Length=110

 Score =   162 bits (411),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     SR+K +VYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGSDTQSRRKVMVYLPTGEVVSSYSTLEQILQSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRD  108



>ref|XP_010454815.1| PREDICTED: flowering-promoting factor 1-like [Camelina sativa]
Length=110

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     SR+K +VYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGFDTQSRRKVMVYLPTGEVVSSYSTLEQILQSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRD  108



>ref|XP_010453098.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Camelina 
sativa]
 ref|XP_010491739.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Camelina 
sativa]
Length=113

 Score =   162 bits (410),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 87/111 (78%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-----AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF NGV RLVENP      A H    R+  LVYLPTG+VVSSY  LEQIL  LGW
Sbjct  1    MSGVWVFNNGVIRLVENPNQSGGVATHQTHGRRNVLVYLPTGEVVSSYSSLEQILRSLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERY+ GD DL Q+HK+S+IDLISLPRD++KFNS+YMYDIV+KNPN F VRD
Sbjct  61   ERYFHGDSDLIQYHKRSTIDLISLPRDFSKFNSVYMYDIVIKNPNSFHVRD  111



>emb|CDX70361.1| BnaC03g04450D [Brassica napus]
Length=109

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA-SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVW+F NGV RLVENP    G    R+  LVYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWIFNNGVIRLVENPNQSGGVTHGRRNVLVYLPTGEVVSSYSSLEQILMSLGWERYF  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            +GD +L Q+HK+SSIDLISLPRD++KFNS+YMYDIV+KNPN+F VRD
Sbjct  61   NGDSNLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVIKNPNIFHVRD  107



>gb|KFK27756.1| hypothetical protein AALP_AA8G425100 [Arabis alpina]
Length=108

 Score =   161 bits (408),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RLVENP  + GA +  R+K +VYLPTG+VVSSY  LEQIL  LGWERY
Sbjct  1    MSGVWVFKNGVIRLVENPN-QSGADTHVRRKVIVYLPTGEVVSSYSTLEQILQSLGWERY  59

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            + GD DL QFHK+SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD 
Sbjct  60   F-GDTDLLQFHKRSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRDS  107



>ref|NP_197868.1| flowering promoting factor 1 [Arabidopsis thaliana]
 sp|O23624.1|FPF1_ARATH RecName: Full=Flowering-promoting factor 1; Short=AtFPF1 [Arabidopsis 
thaliana]
 emb|CAA72717.1| FPF1 protein [Arabidopsis thaliana]
 gb|ABE02402.1| At5g24860 [Arabidopsis thaliana]
 gb|AED93370.1| flowering promoting factor 1 [Arabidopsis thaliana]
Length=110

 Score =   161 bits (407),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     +R+K +VYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGSDTQNRRKVMVYLPTGEVVSSYSTLEQILQSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRD  108



>ref|XP_006399559.1| hypothetical protein EUTSA_v10015065mg [Eutrema salsugineum]
 gb|ESQ41012.1| hypothetical protein EUTSA_v10015065mg [Eutrema salsugineum]
Length=112

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----RKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVF NGV RLVENP     A +    R+  LVYLPTG+VVSSY  LEQIL  LGWE
Sbjct  1    MSGVWVFNNGVIRLVENPNQSGRAPTQTHGRRNVLVYLPTGEVVSSYSSLEQILRSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RY++GD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIVVKNPN F VRD
Sbjct  61   RYFNGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVVKNPNTFHVRD  110



>ref|XP_006394738.1| hypothetical protein EUTSA_v10005622mg [Eutrema salsugineum]
 gb|ESQ32024.1| hypothetical protein EUTSA_v10005622mg [Eutrema salsugineum]
Length=110

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGA--ASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RLVENP  + GA   SR+K +VYLPTG+VVSSY  L QIL GLGWERY
Sbjct  1    MSGVWVFKNGVIRLVENPN-QSGADTHSRRKVMVYLPTGEVVSSYSTLGQILQGLGWERY  59

Query  274  YSG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            + G D DL QFHK+SSIDLISLP+D+ KFNS+YMYDIVVKNPN F VRD
Sbjct  60   FGGGDADLLQFHKRSSIDLISLPKDFTKFNSVYMYDIVVKNPNYFHVRD  108



>sp|O24340.1|FPF1_SINAL RecName: Full=Flowering-promoting factor 1; Short=SaFPF1 [Sinapis 
alba]
 emb|CAA72716.1| FPF1 protein [Sinapis alba]
Length=110

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG-AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP    G   SR+K +VYLPTG+V+SSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGGDTNSRRKVMVYLPTGEVISSYSTLEQILRSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLP+D+ KF+S+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPKDFTKFSSVYMYDIVVKNPNYFHVRD  108



>ref|XP_010493733.1| PREDICTED: flowering-promoting factor 1-like [Camelina sativa]
Length=110

 Score =   159 bits (403),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 87/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEH-GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP        SR+K +VYLPTG+VVSSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGCDTQSRRKVMVYLPTGEVVSSYSTLEQILQSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLPR++ KFNS+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPREFTKFNSVYMYDIVVKNPNYFHVRD  108



>emb|CDY19824.1| BnaA09g04770D [Brassica napus]
 emb|CDX87109.1| BnaC09g04240D [Brassica napus]
Length=108

 Score =   159 bits (402),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA--SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RLVENP  + GA   SR+K +VYLPTG+VVSSY  LEQIL  LGWERY
Sbjct  1    MSGVWVFKNGVIRLVENPN-QSGADTYSRRKVMVYLPTGEVVSSYSMLEQILQSLGWERY  59

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            + GD +L QFHK SSIDLISLPRD+ KFNS+YMYDIVVKNPN F VRD 
Sbjct  60   F-GDTELLQFHKPSSIDLISLPRDFTKFNSVYMYDIVVKNPNYFHVRDS  107



>ref|XP_010525872.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Tarenaya 
hassleriana]
Length=122

 Score =   159 bits (403),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 93/121 (77%), Gaps = 15/121 (12%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--------------RKKCLVYLPTGQVVSSYRCL  237
            MSGVWVFKNGV RLVENP  + GA                +KK LV+LPTG++VSSYR L
Sbjct  1    MSGVWVFKNGVMRLVENPYNQSGAGESPESSSSGGQQQRMKKKFLVHLPTGEIVSSYRSL  60

Query  238  EQILTGLGWERYYSGD-PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
            ++IL GLGWERY+ G+ PDL QFHK++SIDLISLPRD+ KFNSI+MYDIVVKNPN+F VR
Sbjct  61   DRILVGLGWERYHGGENPDLIQFHKKTSIDLISLPRDFAKFNSIHMYDIVVKNPNIFHVR  120

Query  415  D  417
            D
Sbjct  121  D  121



>emb|CDX97040.1| BnaC09g45850D [Brassica napus]
Length=111

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA-SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP    G    R+  LVYLPTG+V+SSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPYQSGGVTHGRRNVLVYLPTGEVISSYSSLEQILMSLGWERYF  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            SGD DL Q+HK+ SIDLISLPRD++KFNS+YMYDIV+KNPN F V
Sbjct  61   SGDSDLIQYHKRYSIDLISLPRDFSKFNSVYMYDIVIKNPNTFHV  105



>emb|CDX80474.1| BnaC07g29700D [Brassica napus]
Length=110

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     SR+K +VYLPTG+V+SSY  LEQIL  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGSDTNSRRKVMVYLPTGKVISSYSTLEQILRSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLP+D+ KF+S+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPKDFTKFSSVYMYDIVVKNPNYFHVRD  108



>ref|XP_009151012.1| PREDICTED: flowering-promoting factor 1 [Brassica rapa]
 emb|CDX88138.1| BnaA06g27290D [Brassica napus]
Length=110

 Score =   158 bits (399),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP-AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  +     SR+K +VYLPTG+V+SSY  LEQ+L  LGWERY+
Sbjct  1    MSGVWVFKNGVIRLVENPNQSGSDTNSRRKVMVYLPTGEVISSYSTLEQVLGSLGWERYF  60

Query  277  SG-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             G D DL QFHK+SSIDLISLP+D+ KF+S+YMYDIVVKNPN F VRD
Sbjct  61   GGGDTDLLQFHKRSSIDLISLPKDFTKFSSVYMYDIVVKNPNYFHVRD  108



>gb|AFK46962.1| unknown [Lotus japonicus]
Length=114

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAA---SRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVW F+N GV RLVENP AE   A   S++K LVYLPTG+VV+SY  LE+IL GLGWE
Sbjct  1    MSGVWFFRNNGVMRLVENPQAEGSEARQGSKRKVLVYLPTGEVVNSYTFLERILIGLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
            RYY GDPDL+QFHK  SIDLISLPRD++KF+S+ MYDIV+KNPN+F VR
Sbjct  61   RYYEGDPDLYQFHKHCSIDLISLPRDFSKFSSVNMYDIVMKNPNVFHVR  109



>ref|XP_010548540.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Tarenaya 
hassleriana]
Length=120

 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 89/119 (75%), Gaps = 13/119 (11%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS------------RKKCLVYLPTGQVVSSYRCLEQ  243
            MSGVWVFKNGV RLVENP  + GA              RKK L +LPTG+VVSSY  LE+
Sbjct  1    MSGVWVFKNGVMRLVENPYNQSGAGESTESSGGQQQRMRKKILFHLPTGEVVSSYGSLER  60

Query  244  ILTGLGWERYYSGD-PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            IL  LGWERYY G+  DL QFHK+SSIDLISLPRD+ KFNSI+MYDIVVKNPN+F VRD
Sbjct  61   ILVSLGWERYYGGENSDLIQFHKKSSIDLISLPRDFLKFNSIHMYDIVVKNPNIFHVRD  119



>gb|AFK44318.1| unknown [Lotus japonicus]
Length=114

 Score =   155 bits (393),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAA---SRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVW F+N GV +LVENP AE   A   S++K LVYLPTG+VV+SY  LE+IL GLGWE
Sbjct  1    MSGVWFFRNNGVMQLVENPQAEGSEARQGSKRKVLVYLPTGEVVNSYTFLERILIGLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
            RYY GDPDL+QFHK  SIDLISLPRD++KF+S+ MYDIV+KNPN+F VR
Sbjct  61   RYYEGDPDLYQFHKHCSIDLISLPRDFSKFSSVNMYDIVMKNPNVFHVR  109



>ref|XP_010526274.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Tarenaya 
hassleriana]
Length=121

 Score =   154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 90/120 (75%), Gaps = 14/120 (12%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS-------------RKKCLVYLPTGQVVSSYRCLE  240
            MSGVWVFKNGV +LVENP  + GA               RKK LVYLPT +VVSSY  L+
Sbjct  1    MSGVWVFKNGVMKLVENPYNQSGAGEYPEYSSGGQQQRMRKKILVYLPTSEVVSSYGSLD  60

Query  241  QILTGLGWERYYSGD-PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            +IL  LGWERYY G+  DLFQFHK +SIDLISLPRD++KFNSI+MYDIVVKNP++F VRD
Sbjct  61   RILVSLGWERYYGGENSDLFQFHKNTSIDLISLPRDFSKFNSIHMYDIVVKNPSIFHVRD  120



>gb|AID51345.1| flowering promoting factor 1-like protein 4 [Gossypium hirsutum]
Length=99

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/106 (69%), Positives = 87/106 (82%), Gaps = 8/106 (8%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M+GVWVF NGVYRL EN       + R++ LV+LP+G+VVSSY  LE IL GLGWERYY 
Sbjct  1    MAGVWVFNNGVYRL-EN-------SLRRRVLVHLPSGEVVSSYSSLEHILRGLGWERYYG  52

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDPDL+QFHK SSIDLISLP+D++KF S++MYDIVVKNPN+F VRD
Sbjct  53   GDPDLYQFHKHSSIDLISLPKDFSKFCSVHMYDIVVKNPNVFHVRD  98



>ref|XP_007011570.1| Flowering promoting factor 1 [Theobroma cacao]
 gb|EOY29189.1| Flowering promoting factor 1 [Theobroma cacao]
Length=99

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 85/106 (80%), Gaps = 8/106 (8%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M+GVWVF NGVYRL  +P        R+K LV+LP+G+V+SSY  LE IL GLGWERYY 
Sbjct  1    MAGVWVFNNGVYRLESSP--------RRKVLVHLPSGEVISSYSSLENILRGLGWERYYG  52

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDPDL+QF K SSIDLISLPRD++KF S++MYDIVVKNPN+F VRD
Sbjct  53   GDPDLYQFDKHSSIDLISLPRDFSKFCSVHMYDIVVKNPNVFHVRD  98



>ref|XP_010049807.1| PREDICTED: flowering-promoting factor 1-like [Eucalyptus grandis]
 gb|KCW82610.1| hypothetical protein EUGRSUZ_C04001 [Eucalyptus grandis]
Length=106

 Score =   150 bits (380),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 88/107 (82%), Gaps = 4/107 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M+GVWVFKNGVYRLVENP A+   A  +K LV+LP+G+V+SSY  LEQIL GLGWERY+ 
Sbjct  1    MAGVWVFKNGVYRLVENPQAD---AQARKVLVHLPSGEVISSYSSLEQILRGLGWERYHG  57

Query  280  G-DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            G D  L +FHK +S DLI +PRD++KFNS++M+DIVVKNPN+F VRD
Sbjct  58   GGDAGLIRFHKHNSNDLICIPRDFSKFNSVHMFDIVVKNPNIFHVRD  104



>gb|AID51346.1| flowering promoting factor 1-like protein 5 [Gossypium hirsutum]
Length=99

 Score =   150 bits (378),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 84/106 (79%), Gaps = 8/106 (8%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF NGVYRL  +P        +++ LV+LP+G+ VSSY  LE IL GLGWERYY 
Sbjct  1    MSGVWVFNNGVYRLESSP--------KRRVLVHLPSGEAVSSYSSLENILRGLGWERYYG  52

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GDPD +Q+HK SSIDLISLP+D++KF S++MYDIVVKNPN+F VRD
Sbjct  53   GDPDFYQYHKHSSIDLISLPKDFSKFGSVHMYDIVVKNPNVFHVRD  98



>ref|XP_010675090.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Beta 
vulgaris subsp. vulgaris]
Length=106

 Score =   150 bits (378),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENPAAE     ++K L+++PT +V++ Y  LEQ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPAAESMERGQRKVLIHVPTNEVITGYDVLEQKLLALGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLPRD+ KF S++M+DIVVKN N+F+VRD
Sbjct  61   -DPDLLQFHKRSTVHLISLPRDFRKFKSMHMFDIVVKNRNMFEVRD  105



>gb|KDP27785.1| hypothetical protein JCGZ_18865 [Jatropha curcas]
Length=112

 Score =   149 bits (377),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 89/112 (79%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP AE       G++SR+K LV+ P+ ++++SY  LE  L+ LG
Sbjct  1    MSGVWVFKNGVVRLVENPGAESLDGSRQGSSSRRKVLVHTPSNEIITSYSVLEHKLSSLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFHK+S++ LISLP+D++KF S++MYDIVVKN N+F+VRD
Sbjct  61   WERYYD-DPDLLQFHKRSTVHLISLPKDFSKFKSMHMYDIVVKNRNMFEVRD  111



>emb|CDY36444.1| BnaC03g67640D [Brassica napus]
Length=115

 Score =   150 bits (378),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 8/114 (7%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAAS-----RKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVF KNGV RL ENP  + G        R+K LV+LPT +VVSSY+ LE+IL GLG
Sbjct  1    MSGVWVFNKNGVMRLDENPYNQSGGDCQQQRMRRKILVHLPTSEVVSSYKSLERILKGLG  60

Query  262  WERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY+GD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F VRD
Sbjct  61   WERYYNGDNADHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFHVRD  114



>ref|XP_008801065.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Phoenix 
dactylifera]
Length=106

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 86/106 (81%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENPA E  +  R+K L++ PT +V++SY  LE+ LT LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPANEQSSTVRRKVLLHTPTNEVINSYASLERKLTSLGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+SSIDLISLPRD+++F S++MYDIVVKN + F+V D
Sbjct  61   -DPDLLQFHKRSSIDLISLPRDFSQFKSMHMYDIVVKNRDSFRVID  105



>ref|XP_010259916.1| PREDICTED: flowering-promoting factor 1 [Nelumbo nucifera]
Length=101

 Score =   149 bits (376),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 88/106 (83%), Gaps = 6/106 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF NGV RLVENPA +     ++K LV+LP+G+V++SY  LE+ILT LGWERYY 
Sbjct  1    MSGVWVFNNGVIRLVENPAGD-----QRKVLVHLPSGEVITSYSALERILTRLGWERYYD  55

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             +P++ QFHK SS+DLISLP+D++KF SI+MYDIVVKNPN+F VRD
Sbjct  56   -NPNMLQFHKASSLDLISLPKDFSKFKSIHMYDIVVKNPNIFHVRD  100



>ref|XP_004296827.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Fragaria 
vesca subsp. vesca]
Length=108

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE--HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RLVENP A+  HG+  R+K LV+ P+ +V+SSY  LE+ L  LGWERY
Sbjct  1    MSGVWVFKNGVVRLVENPGADSLHGSNGRRKVLVHTPSDEVISSYAVLERKLFSLGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DPDL Q+HK+S++ LISLP+D+N+F S++MYDIVVKN NLF+VRD
Sbjct  61   YD-DPDLLQYHKRSTVHLISLPKDFNRFKSMHMYDIVVKNRNLFEVRD  107



>ref|XP_010921805.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Elaeis 
guineensis]
Length=106

 Score =   148 bits (373),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENPA E  +  R+K L++ PT +V++SY  LE+ LT LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPANEQSSTVRRKVLLHTPTNEVINSYASLERKLTSLGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+SSIDLISLPRD++ F S++MYDIVVKN   F+V D
Sbjct  61   -DPDLLQFHKRSSIDLISLPRDFSHFKSMHMYDIVVKNRESFRVID  105



>ref|XP_010259653.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nelumbo 
nucifera]
Length=112

 Score =   148 bits (373),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (77%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENPA E       G+ +R+K LV+ PT +V++SY  LE+ L  LG
Sbjct  1    MSGVWVFKNGVVRLVENPAIESLDGSRQGSTTRRKVLVHSPTNEVITSYAVLERKLLELG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFHK+S++ LISLPRD+ KF S++MYDIVVKN N FQVRD
Sbjct  61   WERYYD-DPDLLQFHKRSTVHLISLPRDFTKFKSMHMYDIVVKNRNCFQVRD  111



>ref|XP_009592497.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nicotiana 
tomentosiformis]
Length=106

 Score =   147 bits (372),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP   HGA  R+K LV+L + +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGDFHGATGRRKVLVHLSSNEVIASYSALERKLYSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL Q+HK+S++ LISLP+D+N+F S++MYDIVVKN N F+VRD
Sbjct  61   -DPDLLQYHKRSTVHLISLPKDFNRFKSMHMYDIVVKNRNEFEVRD  105



>emb|CAB89379.1| putative protein [Arabidopsis thaliana]
Length=804

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 4/107 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----RKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVF NGV RLVENP    G ++    R+  LVYLPTG+ VSSY  LEQIL  LGWE
Sbjct  1    MSGVWVFNNGVIRLVENPNQSGGVSTQSHGRRNVLVYLPTGEAVSSYSSLEQILRSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            RY+SGD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIVVKNPN F 
Sbjct  61   RYFSGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVVKNPNSFH  107



>ref|XP_006389236.1| hypothetical protein POPTR_0034s00300g [Populus trichocarpa]
 gb|ERP48150.1| hypothetical protein POPTR_0034s00300g [Populus trichocarpa]
Length=112

 Score =   147 bits (371),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP AE       G+ +R+K LV+ P+ +V++SY  LE+ L+ LG
Sbjct  1    MSGVWVFKNGVVRLVENPGAESLDGSRQGSNTRRKVLVHTPSNEVITSYAVLERKLSSLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFH +S++ LISLP+D+NKF S++MYDIVVKN N+F+VRD
Sbjct  61   WERYYD-DPDLLQFHIRSTVHLISLPKDFNKFKSMHMYDIVVKNRNMFEVRD  111



>ref|XP_010037383.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Eucalyptus 
grandis]
 gb|KCW84468.1| hypothetical protein EUGRSUZ_B01304 [Eucalyptus grandis]
Length=107

 Score =   147 bits (370),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP  E  G   R+K L+++PT +V++SY  LE+ L+ LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENPGGEVSGGIGRRKVLIHIPTNEVITSYSDLERKLSSLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DPDL QFHK+S++ LISLP+D+NK  S++MYDIVVKN N+F+VRD
Sbjct  61   D-DPDLLQFHKRSTVHLISLPKDFNKLKSMHMYDIVVKNRNIFEVRD  106



>ref|XP_009784060.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nicotiana 
sylvestris]
Length=106

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP   HGA  R+K LV+L + +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGDCHGATGRRKVLVHLSSNEVITSYSALERKLYSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL Q+HK+S++ LISLP+D+N+F S++MYDIVVKN N F+VRD
Sbjct  61   -DPDLLQYHKRSTVHLISLPKDFNRFKSMHMYDIVVKNRNEFEVRD  105



>ref|XP_006578196.1| PREDICTED: flowering-promoting factor 1-like [Glycine max]
 gb|KHN10276.1| hypothetical protein glysoja_017880 [Glycine soja]
Length=109

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFK   +RL+E   AE  A S  +KK LV+L +G+VVSSY  LEQIL+ LGWERY
Sbjct  1    MSGVWVFKKDGFRLMEKRKAEGIACSSLKKKVLVHLASGEVVSSYSSLEQILSNLGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DP L+QFHK+SS DLISLP++++KF S+YMYDIV+KNPN+F VRD
Sbjct  61   YGRDPQLYQFHKRSSTDLISLPKNFSKFTSVYMYDIVIKNPNVFHVRD  108



>ref|XP_002871430.1| hypothetical protein ARALYDRAFT_325603 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47689.1| hypothetical protein ARALYDRAFT_325603 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 85/107 (79%), Gaps = 4/107 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----RKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVF NGV RLVENP    G A+    R+  LVYLPTG+ VSS+  LEQIL  LGWE
Sbjct  1    MSGVWVFNNGVIRLVENPNQSEGVATQTNGRRYVLVYLPTGEAVSSHSSLEQILRSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            RY+SGD DL Q+HK+SSIDLISLPRD++KFNS+YMYDIVVKNPN F 
Sbjct  61   RYFSGDSDLIQYHKRSSIDLISLPRDFSKFNSVYMYDIVVKNPNSFH  107



>emb|CDP19535.1| unnamed protein product [Coffea canephora]
Length=107

 Score =   146 bits (368),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF NGV RLVENP    G++SR+K LV+L + +V++SY  LE  L  LGWERYY 
Sbjct  1    MSGVWVFSNGVVRLVENPGEYQGSSSRRKVLVHLASKEVITSYSVLESKLLSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S+IDLISLP+D+ KF S++MYDIVVKN + F+VRD
Sbjct  61   -DPDLLQFHKRSTIDLISLPKDFRKFKSMHMYDIVVKNRDEFEVRD  105



>ref|XP_002516907.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45521.1| conserved hypothetical protein [Ricinus communis]
Length=112

 Score =   146 bits (369),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP AE       G+ +R+K LV+ P+ ++++SY  LE  L  LG
Sbjct  1    MSGVWVFKNGVVRLVENPGAESLDGSRQGSTARRKVLVHTPSNEIITSYSVLEHKLYSLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFHK+S++ LISLP+D++KF S++MYDIVVKN N+F+VRD
Sbjct  61   WERYYD-DPDLLQFHKRSTVHLISLPKDFSKFKSMHMYDIVVKNRNMFEVRD  111



>ref|XP_006342792.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Solanum 
tuberosum]
Length=106

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN    HGA  R+K LV+L + +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENAGDFHGATGRRKVLVHLSSNEVITSYASLERNLYSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLP+D+N+F S++MYDIVVKN N F+VRD
Sbjct  61   -DPDLLQFHKRSTVHLISLPKDFNRFKSMHMYDIVVKNRNEFEVRD  105



>ref|XP_009383890.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Musa 
acuminata subsp. malaccensis]
Length=106

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M+GVWVFKNGV RLVENP  E  +  R+K L++ PT +V++SY  LE+ L GLGWERYY 
Sbjct  1    MAGVWVFKNGVVRLVENPGDEQASTVRRKALLHTPTNEVITSYATLERELLGLGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             +PDL QFHK+SSIDLISLP+D+++F SI+MYDIVVKN + F+V D
Sbjct  61   -EPDLLQFHKRSSIDLISLPKDFSRFKSIHMYDIVVKNRHSFKVID  105



>gb|AID51343.1| flowering promoting factor 1-like protein 2 [Gossypium hirsutum]
Length=112

 Score =   146 bits (368),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 86/112 (77%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENPAAE        + +R+K LV+ P+ +V++SY  LE  L  LG
Sbjct  1    MSGVWVFKNGVVRLVENPAAESLDGSRQSSNTRRKVLVHTPSNEVITSYAVLEHKLWSLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DP L QFHK+S++ LISLP+D+NKF SI+MYDIVVKN N+F+VRD
Sbjct  61   WERYYE-DPSLLQFHKRSTVHLISLPKDFNKFKSIHMYDIVVKNRNVFEVRD  111



>ref|XP_004136318.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Cucumis 
sativus]
 ref|XP_004166759.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Cucumis 
sativus]
 gb|KGN60157.1| hypothetical protein Csa_3G881700 [Cucumis sativus]
Length=123

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 89/122 (73%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAEHGAAS---------------RKKCLVYLPTGQVVSSYR  231
            MSGVWVF+ NGV RLVEN  A    +S               RKK LV+LP+GQ V SY 
Sbjct  1    MSGVWVFRSNGVMRLVENSQAGDDYSSDGHGHQHHHHGGGGGRKKVLVHLPSGQPVCSYG  60

Query  232  CLEQILTGLGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
             L++IL GLGWERYY GDPD FQFHK+SSIDLISLP D++KFNSIYM+D+V+KNPN+F V
Sbjct  61   FLQKILEGLGWERYYEGDPDFFQFHKRSSIDLISLPMDFSKFNSIYMFDLVIKNPNVFHV  120

Query  412  RD  417
            R+
Sbjct  121  RE  122



>dbj|BAJ98475.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AEO14653.1| RAA1 [Hordeum vulgare]
 gb|EMT15834.1| hypothetical protein F775_19611 [Aegilops tauschii]
 emb|CDM82688.1| unnamed protein product [Triticum aestivum]
Length=106

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP +E  +  R+K L++ P+GQVVSSY  LE  LT LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGSERTSTVRRKALLHTPSGQVVSSYATLEAKLTALGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
             DP L+QFHK+  +DLISLPRD+N F+S++MYD+V+KN   F+V D 
Sbjct  61   -DPALYQFHKRGCLDLISLPRDFNHFSSVHMYDVVIKNRESFRVVDA  106



>ref|XP_010547030.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Tarenaya 
hassleriana]
Length=110

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----RKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV RLVENPAAE         R+K LVY P+ +V++SY  LE+ L+GLGWE
Sbjct  1    MSGVWVFKNGVVRLVENPAAETTVDGSRQMRRKVLVYRPSNEVMASYAALERKLSGLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY  DP L QFHK S+I LISLP+D+ KF SI+MYDIVVKN N+F+VRD
Sbjct  61   RYYE-DPHLLQFHKSSTIHLISLPKDFCKFKSIHMYDIVVKNRNMFEVRD  109



>ref|XP_010269480.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nelumbo 
nucifera]
Length=113

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKNGV RLVENPAAE         + +R+K LV+ PT +V++SY  LE+ L  L
Sbjct  1    MSGVWVFKNGVVRLVENPAAEPLDGSSRQASTTRRKVLVHTPTNEVMTSYAVLERKLLEL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY  DPDLFQFHK S++ LISLPR++++F S++MYDIVVKN N F+VRD
Sbjct  61   GWERYYD-DPDLFQFHKPSTVHLISLPREFSRFRSMHMYDIVVKNRNSFEVRD  112



>ref|XP_006412599.1| hypothetical protein EUTSA_v10027309mg, partial [Eutrema salsugineum]
 gb|ESQ54052.1| hypothetical protein EUTSA_v10027309mg, partial [Eutrema salsugineum]
Length=130

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 15/123 (12%)
 Frame = +1

Query  94   IIMSGVWVF-KNGVYRLVENP------------AAEHGAASRKKCLVYLPTGQVVSSYRC  234
            I MSGVWVF KNGV RLVENP                    R+K LV+LPT +VVSSY  
Sbjct  7    ITMSGVWVFNKNGVMRLVENPYNQSDSSDSSSSGGSQQQRMRRKILVHLPTSEVVSSYGS  66

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL GLGWERYY+GD      QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  67   LERILKGLGWERYYNGDNADHFLQFHKKTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  126

Query  409  VRD  417
            VRD
Sbjct  127  VRD  129



>ref|XP_002315557.1| hypothetical protein POPTR_0010s02530g [Populus trichocarpa]
 ref|XP_011000528.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Populus 
euphratica]
 gb|EEF01728.1| hypothetical protein POPTR_0010s02530g [Populus trichocarpa]
Length=112

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP AE       G++ R+K LV+ P+ +V++SY  LE+ L  LG
Sbjct  1    MSGVWVFKNGVVRLVENPGAESLDGSRQGSSMRRKVLVHSPSNEVITSYAVLERKLYSLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFHK+S++ LISLP+D+NK  S++MYDIVVKN N+F+VRD
Sbjct  61   WERYYD-DPDLLQFHKRSTVHLISLPKDFNKLRSMHMYDIVVKNRNMFEVRD  111



>ref|XP_010558820.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Tarenaya 
hassleriana]
Length=110

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 86/110 (78%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----RKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV RLVENPAAE         ++K LV+ P+ +V++SY  LE+ L GLGWE
Sbjct  1    MSGVWVFKNGVVRLVENPAAETTVEGSRQMKRKVLVHTPSNEVITSYAALERRLFGLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY  DPDL QFHK+S+I LISLP+D+ +F S++MYDIVVKN N+F+VRD
Sbjct  61   RYYD-DPDLLQFHKRSTIHLISLPKDFGRFKSMHMYDIVVKNRNMFEVRD  109



>ref|XP_010675089.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Beta 
vulgaris subsp. vulgaris]
Length=106

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENPAAE     ++K LV++ T +V+++Y  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPAAESMERGQRKVLVHISTNEVITNYDVLERKLMALGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
             DP+L QFHK+S++ LISLPRD+ KF S++MYDIVVKN N+F+VR+ 
Sbjct  61   -DPNLLQFHKRSTVHLISLPRDFRKFKSMHMYDIVVKNRNMFEVREN  106



>ref|XP_004229231.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Solanum 
lycopersicum]
Length=106

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP   HGA  R+K LV+L + +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGDFHGATGRRKVLVHLSSNEVITSYAVLERKLYSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLP+D+N   S++MYDIVVKN N F VRD
Sbjct  61   -DPDLLQFHKRSTVHLISLPKDFNNLKSMHMYDIVVKNRNEFTVRD  105



>gb|AID51344.1| flowering promoting factor 1-like protein 3 [Gossypium hirsutum]
Length=113

 Score =   145 bits (365),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAAS-RKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKNGV RLVENP AE       G++S R+K LV++P+ +V++ Y  LE  L  L
Sbjct  1    MSGVWVFKNGVVRLVENPGAEPLDGNRQGSSSARRKVLVHVPSNEVITCYEDLESKLLSL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY  DPDL QFHK+S++ LISLPRD+NKF SI+MYDIVVKN N+F+VRD
Sbjct  61   GWERYYD-DPDLLQFHKRSTVHLISLPRDFNKFKSIHMYDIVVKNRNMFEVRD  112



>ref|XP_010024688.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Eucalyptus 
grandis]
 gb|KCW61129.1| hypothetical protein EUGRSUZ_H03903 [Eucalyptus grandis]
Length=108

 Score =   144 bits (364),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 3/109 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAA--EHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RL+ENP A    G   R+K LV+ PT +V++SY  LE+ L  LGWERY
Sbjct  1    MSGVWVFKNGVVRLIENPGANPSSGLNLRRKVLVHSPTNEVITSYADLERKLVSLGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y+ DPDL QFHK S++ LISLP+D+NKF S++MYDIVVKN N+F+VRD 
Sbjct  61   YN-DPDLLQFHKSSTVHLISLPKDFNKFKSVHMYDIVVKNRNIFKVRDA  108



>ref|XP_008466327.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Cucumis 
melo]
Length=129

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 89/128 (70%), Gaps = 22/128 (17%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAEHGAAS---------------------RKKCLVYLPTGQ  213
            MSGVWVF+ NGV RLVEN  A    +S                     RKK LV+LP+GQ
Sbjct  1    MSGVWVFRSNGVMRLVENSQAGDDYSSDGHHQHHHHHHHHHGGGGGGGRKKVLVHLPSGQ  60

Query  214  VVSSYRCLEQILTGLGWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKN  393
             V SY  L++IL GLGWERYY GDPD FQFHK+SSIDLISLP D++KFNSIYMYD+VVKN
Sbjct  61   PVCSYGFLQKILEGLGWERYYEGDPDFFQFHKRSSIDLISLPMDFSKFNSIYMYDLVVKN  120

Query  394  PNLFQVRD  417
            PN+F VR+
Sbjct  121  PNVFHVRE  128



>ref|XP_002869330.1| hypothetical protein ARALYDRAFT_491604 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45589.1| hypothetical protein ARALYDRAFT_491604 [Arabidopsis lyrata subsp. 
lyrata]
Length=124

 Score =   145 bits (365),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 87/123 (71%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENP--------------AAEHGAASRKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP                      R+K LV+LPT +VVSSY  
Sbjct  1    MSGVWVFNKNGVMRLVENPYNQSAGDSSESSSSGGNQQQRMRRKILVHLPTSEVVSSYGS  60

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL  LGWERYYSGD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  61   LEKILKNLGWERYYSGDNTDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  120

Query  409  VRD  417
            VRD
Sbjct  121  VRD  123



>ref|XP_011015015.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Populus 
euphratica]
 ref|XP_011016075.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Populus 
euphratica]
Length=112

 Score =   144 bits (363),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP AE       G+ +R+K LV+ P+ +V++SY  LE+ L+ LG
Sbjct  1    MSGVWVFKNGVVRLVENPGAESLDGSRQGSNTRRKVLVHTPSNEVITSYAVLERKLSSLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFH + ++ LISLP+D+NKF S++MYDIVVKN N+F+VRD
Sbjct  61   WERYYD-DPDLLQFHIRFTVHLISLPKDFNKFKSMHMYDIVVKNRNMFEVRD  111



>ref|XP_007154270.1| hypothetical protein PHAVU_003G104600g [Phaseolus vulgaris]
 gb|ESW26264.1| hypothetical protein PHAVU_003G104600g [Phaseolus vulgaris]
Length=109

 Score =   144 bits (363),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 84/109 (77%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP---AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV RLVENP   A E     R+K LV+L + +V++SY  LE+ L  LGWER
Sbjct  1    MSGVWVFKNGVVRLVENPGGEAVEGSRGGRRKMLVHLASNEVITSYSVLERKLYSLGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY  DPDL QFHK+S++ LISLPRD+NKF S++MYDIVVKN N F+VRD
Sbjct  61   YYD-DPDLLQFHKRSTVHLISLPRDFNKFKSMHMYDIVVKNKNAFEVRD  108



>ref|XP_009394892.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=106

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN   E GA  R+K LV++PT +V++SY  LE+ L  LGWERY S
Sbjct  1    MSGVWVFKNGVVRLVENVGGEQGAVGRRKVLVHVPTSEVITSYDVLEEKLAVLGWERYPS  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
              PDL QFHK+SS+ LIS+P D++KF S++MYDIVVK+ N+F+VRD 
Sbjct  61   -TPDLIQFHKRSSVHLISVPTDFSKFRSVHMYDIVVKSRNIFEVRDA  106



>ref|XP_010269481.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Nelumbo 
nucifera]
Length=114

 Score =   144 bits (363),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 85/113 (75%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKNGV RLVEN A E         + +R+K LV+ PT +V++SY  LEQ L  L
Sbjct  1    MSGVWVFKNGVVRLVENLAVESLDGSSRQASTTRRKVLVHTPTNEVMTSYAVLEQKLLEL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY  DPDLFQFHK S+I LISLPRD+++F S++MYDIVVKN N F+VRD
Sbjct  61   GWERYYD-DPDLFQFHKPSTIHLISLPRDFSRFRSMHMYDIVVKNRNRFEVRD  112



>ref|XP_011090951.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Sesamum 
indicum]
Length=102

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 83/106 (78%), Gaps = 5/106 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP    G   R+K LV+LPT + ++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENP----GDCPRRKLLVHLPTNEAITSYEVLERKLLSLGWERYYD  56

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S+I LISLPRD++KF SI+MYDIVVKN N F+VRD
Sbjct  57   -DPDLLQFHKRSTIHLISLPRDFSKFKSIHMYDIVVKNRNEFEVRD  101



>ref|XP_010938429.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Elaeis 
guineensis]
Length=106

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF+NGV RLVENPA E  +  R+K L++ PT +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFRNGVVRLVENPANEQSSTVRRKVLLHTPTNEVITSYGSLERKLMSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+SS+DLISLP+D+++F S++MYDIVVKN   F+V D
Sbjct  61   -DPDLLQFHKRSSLDLISLPKDFSRFKSMHMYDIVVKNRESFRVVD  105



>ref|XP_009380278.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Musa 
acuminata subsp. malaccensis]
Length=108

 Score =   143 bits (361),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M+GVWVF+NGV RL+ENPA E  +  R+K L++ PT +V++SY  LE+ L GLGWERYY 
Sbjct  1    MAGVWVFRNGVVRLIENPANEQQSTVRRKVLLHTPTNEVITSYASLERKLIGLGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             +PDL QFHK+SSIDLISLP+++++F S++MYDIVVKN   F+V D
Sbjct  61   -EPDLLQFHKRSSIDLISLPKEFSRFKSMHMYDIVVKNREAFKVVD  105



>ref|XP_009127035.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Brassica 
rapa]
 ref|XP_009127059.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Brassica 
rapa]
 emb|CDY28263.1| BnaA01g05860D [Brassica napus]
Length=124

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 89/123 (72%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAAS--------------RKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP  +    S              R+K LV+LPT +VVSSY  
Sbjct  1    MSGVWVFNKNGVMRLVENPYNQSSGDSSDSTSSGGSQQQRMRRKILVHLPTSEVVSSYGS  60

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL GLGWERYY GD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  61   LERILKGLGWERYYYGDNADHLLQFHKKTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  120

Query  409  VRD  417
            VRD
Sbjct  121  VRD  123



>sp|Q5Q0B3.2|FLP1_ARATH RecName: Full=Flowering-promoting factor 1-like protein 1; AltName: 
Full=FPF1-like protein 1 [Arabidopsis thaliana]
 emb|CAA16541.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79856.1| hypothetical protein [Arabidopsis thaliana]
Length=124

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 87/123 (71%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENP--------------AAEHGAASRKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP                      R+K LV+LP+ +VVSSY  
Sbjct  1    MSGVWVFNKNGVMRLVENPYNQSAGDSSESSSSGGNQQQRMRRKILVHLPSSEVVSSYGS  60

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL  LGWERYYSGD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  61   LEKILKNLGWERYYSGDNTDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  120

Query  409  VRD  417
            VRD
Sbjct  121  VRD  123



>gb|EPS67846.1| hypothetical protein M569_06927, partial [Genlisea aurea]
Length=108

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 85/110 (77%), Gaps = 6/110 (5%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAE-HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKN GV  LVEN   E HG   R+K LV+L TG++VSSY  LE+IL GLGWERY
Sbjct  1    MSGVWVFKNNGVMELVENSGGENHG--QRRKVLVHLATGRIVSSYSGLEEILRGLGWERY  58

Query  274  YSG--DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y G  D DL QFHK SSIDLISLP+ + KF S++MYDIVVKNPN+F VRD
Sbjct  59   YGGGGDCDLLQFHKPSSIDLISLPKHFAKFTSVHMYDIVVKNPNVFHVRD  108



>ref|XP_010938503.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Elaeis 
guineensis]
Length=109

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENPA    +  R+K L+Y PT ++++SY  LE  LT LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPANVQSSTVRRKVLLYTPTNEIINSYSSLEPKLTSLGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L QFHK+SSIDLISLPRD+ +F S++MYDIV+KN   F+V D
Sbjct  61   -DPNLLQFHKRSSIDLISLPRDFTQFKSMHMYDIVLKNRESFRVID  105



>ref|XP_010269482.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Nelumbo 
nucifera]
Length=113

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 84/113 (74%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKNGV R VENP  E         + +R+K LVY PT +V++SY  LE  L GL
Sbjct  1    MSGVWVFKNGVVRRVENPKVESLDGSGRQASTTRRKVLVYTPTNEVMTSYAVLELKLLGL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY  DPDLFQFHK S+I LISLPRD+++F S++M+DIVVKN N F+VRD
Sbjct  61   GWERYYD-DPDLFQFHKPSTIHLISLPRDFSRFRSMHMFDIVVKNRNSFEVRD  112



>ref|XP_008789929.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Phoenix 
dactylifera]
Length=106

 Score =   142 bits (359),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF+NGV RLVENPA E  +  R+K L++ PT ++++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFRNGVVRLVENPANEQSSTVRRKVLLHTPTNEIIASYASLERKLMSLGWERYY-  59

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK++S+DLISLP+D+++F S++MYDIVVKN   F+V D
Sbjct  60   DDPDLLQFHKRASLDLISLPKDFSRFKSMHMYDIVVKNRESFRVID  105



>ref|XP_010432870.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Camelina 
sativa]
 ref|XP_010438047.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Camelina 
sativa]
 ref|XP_010447564.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Camelina 
sativa]
Length=124

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 88/123 (72%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAAS--------------RKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP  +    S              R+K LV+LPT +VVSSY  
Sbjct  1    MSGVWVFNKNGVMRLVENPYNQSTGDSSESSSSGGSQQQRMRRKILVHLPTSEVVSSYGS  60

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL  LGWERYY GD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  61   LEKILKNLGWERYYDGDNTDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  120

Query  409  VRD  417
            VRD
Sbjct  121  VRD  123



>ref|XP_009138007.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Brassica 
rapa]
 emb|CDY13426.1| BnaA03g51440D [Brassica napus]
Length=124

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAAS--------------RKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP  +    S              R+K LV+LPT +VVSSY  
Sbjct  1    MSGVWVFNKNGVMRLVENPYNQSAGDSSESSSSSGNQQQRLRRKILVHLPTNEVVSSYGS  60

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL GLGWERYY+ D    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  61   LERILKGLGWERYYNEDNFDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  120

Query  409  VRD  417
            VRD
Sbjct  121  VRD  123



>ref|XP_006419599.1| hypothetical protein CICLE_v10006149mg [Citrus clementina]
 gb|ESR32839.1| hypothetical protein CICLE_v10006149mg [Citrus clementina]
Length=150

 Score =   143 bits (361),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 90/112 (80%), Gaps = 4/112 (4%)
 Frame = +1

Query  88   VKIIMSGVWVFKNGVYRLVENPAAE--HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            +K  MSGVWVFKNGV RL ENP AE    + +R+K LV++PT +V++SY  LE+ L+ LG
Sbjct  40   IKTKMSGVWVFKNGVVRL-ENPGAEACSNSNTRRKVLVHVPTNEVMTSYAVLERKLSSLG  98

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DP+L QFHK+S++ LISLP+D+NKF S++MYDIVVKN N+F+VRD
Sbjct  99   WERYYD-DPELLQFHKRSTVHLISLPKDFNKFKSMHMYDIVVKNRNVFEVRD  149



>ref|XP_007225940.1| hypothetical protein PRUPE_ppa013728mg [Prunus persica]
 gb|EMJ27139.1| hypothetical protein PRUPE_ppa013728mg [Prunus persica]
Length=106

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLV+   +  G+ +R+K LV+ P+ +V+SSY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVDGADSMQGSNARRKVLVHTPSEEVISSYAVLERKLLSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLP+D++KF S++MYDIVVKN N+F+VRD
Sbjct  61   -DPDLLQFHKRSTVHLISLPKDFSKFKSMHMYDIVVKNRNVFEVRD  105



>ref|NP_194866.2| flowering-promoting factor 1-like protein 1 [Arabidopsis thaliana]
 gb|AAV68874.1| hypothetical protein AT4G31380 [Arabidopsis thaliana]
 gb|AAX23901.1| hypothetical protein At4g31380 [Arabidopsis thaliana]
 gb|AEE85902.1| flowering-promoting factor 1-like protein 1 [Arabidopsis thaliana]
Length=181

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 89/123 (72%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAAS--------------RKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP  +    S              R+K LV+LP+ +VVSSY  
Sbjct  58   MSGVWVFNKNGVMRLVENPYNQSAGDSSESSSSGGNQQQRMRRKILVHLPSSEVVSSYGS  117

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL  LGWERYYSGD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  118  LEKILKNLGWERYYSGDNTDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  177

Query  409  VRD  417
            VRD
Sbjct  178  VRD  180



>ref|XP_006489102.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Citrus 
sinensis]
 gb|KDO71622.1| hypothetical protein CISIN_1g033957mg [Citrus sinensis]
Length=107

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE--HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RL ENP AE    + +R+K LV++PT +V++SY  LE+ L+ LGWERY
Sbjct  1    MSGVWVFKNGVVRL-ENPGAEACSNSNTRRKVLVHVPTNEVMTSYAVLERKLSSLGWERY  59

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DP+L QFHK+S++ LISLP+D+NKF S++MYDIVVKN N+F+VRD
Sbjct  60   YD-DPELLQFHKRSTVHLISLPKDFNKFKSMHMYDIVVKNRNVFEVRD  106



>ref|NP_001042631.1| Os01g0257300 [Oryza sativa Japonica Group]
 sp|Q9LGE3.1|FLP1_ORYSJ RecName: Full=Flowering-promoting factor 1-like protein 1; AltName: 
Full=FPF1-like protein 1; AltName: Full=Protein ROOT 
ARCHITECTURE ASSOCIATED 1; Short=OsRAA1 [Oryza sativa Japonica 
Group]
 dbj|BAB07982.1| FPF1 protein-like [Oryza sativa Japonica Group]
 gb|AAT94064.1| RAA1 [Oryza sativa Japonica Group]
 dbj|BAF04545.1| Os01g0257300 [Oryza sativa Japonica Group]
 gb|EAY73362.1| hypothetical protein OsI_01240 [Oryza sativa Indica Group]
 gb|EAZ11300.1| hypothetical protein OsJ_01159 [Oryza sativa Japonica Group]
Length=109

 Score =   141 bits (356),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG---AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV RLVE   A  G   A  R+K LV+ P+GQVVSSY  LE  LT LGWER
Sbjct  1    MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVSSYAALEARLTALGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            YY  DP LFQFHK+ S+DLISLP D++ F+S++MYDIVVKN + F+V D 
Sbjct  61   YYE-DPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRDSFRVVDA  109



>ref|XP_006282807.1| hypothetical protein CARUB_v10006482mg, partial [Capsella rubella]
 gb|EOA15705.1| hypothetical protein CARUB_v10006482mg, partial [Capsella rubella]
Length=133

 Score =   142 bits (357),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 87/123 (71%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAAS--------------RKKCLVYLPTGQVVSSYRC  234
            MSGVWVF KNGV RLVENP  +    S              R+K LV+LPT + VSSY  
Sbjct  10   MSGVWVFNKNGVMRLVENPYNQSAGDSSESSSSGGSQQQRMRRKILVHLPTNEAVSSYGS  69

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL  LGWERYY GD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  70   LEKILKNLGWERYYGGDNTDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  129

Query  409  VRD  417
            VRD
Sbjct  130  VRD  132



>emb|CDX68740.1| BnaC01g07130D [Brassica napus]
Length=124

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 88/123 (72%), Gaps = 17/123 (14%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAE--------------HGAASRKKCLVYLPTGQVVSSYRC  234
            MSGVW+F KNGV RLVENP  +                   R+K L++LPT +VVSSY  
Sbjct  1    MSGVWMFNKNGVMRLVENPYNQSSGDSSDSTSSGGSQQQRMRRKILLHLPTSEVVSSYGS  60

Query  235  LEQILTGLGWERYYSGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQ  408
            LE+IL GLGWERYY GD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F 
Sbjct  61   LERILKGLGWERYYYGDNADHLLQFHKKTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFH  120

Query  409  VRD  417
            VRD
Sbjct  121  VRD  123



>ref|XP_011090952.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Sesamum 
indicum]
Length=102

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 5/106 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN    HG    KK LV++PT +V++SY  LE+ L+ LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENAGDCHG----KKVLVHVPTNEVITSYSVLERKLSSLGWERYYD  56

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L QFHK+S++ LISLP+D+NKF S++MYDIVVKN N F+VRD
Sbjct  57   -DPELLQFHKRSTVHLISLPKDFNKFKSMHMYDIVVKNRNEFEVRD  101



>ref|XP_006395105.1| hypothetical protein EUTSA_v10005169mg [Eutrema salsugineum]
 gb|ESQ32391.1| hypothetical protein EUTSA_v10005169mg [Eutrema salsugineum]
Length=107

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP AE  + ++K K LVY P+ +V++SY  LE+ L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENPGAETNSENKKRKVLVYTPSNEVITSYSHLERHLYALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              +P L QFHK S++ LISLP D+++F S++MYDIVVKN N+FQVRD
Sbjct  61   E-EPHLLQFHKASTVHLISLPTDFSRFKSMHMYDIVVKNRNMFQVRD  106



>ref|XP_008223167.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Prunus 
mume]
Length=106

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLV+   +  G+ +R+K LV+ P+ +V+SSY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVDGADSMQGSNARRKVLVHTPSEEVISSYAVLERKLLSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLP+D++KF S++M+DIVVKN N+F+VRD
Sbjct  61   -DPDLLQFHKRSTVHLISLPKDFSKFKSMHMFDIVVKNRNVFEVRD  105



>ref|XP_010050895.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Eucalyptus 
grandis]
 gb|KCW80702.1| hypothetical protein EUGRSUZ_C02099 [Eucalyptus grandis]
Length=100

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M GVW FK+GV R      A+ G   ++K LV+LP+G+VVSSY  LEQIL GLGWERY S
Sbjct  1    MGGVWNFKDGVIR-----QADQGG--QRKALVHLPSGEVVSSYSSLEQILRGLGWERYSS  53

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
               +L QFHK SSIDLISLPRD++KFNS++MYDIV+KNPN+F+VRD
Sbjct  54   TGSELLQFHKHSSIDLISLPRDFSKFNSVHMYDIVIKNPNIFRVRD  99



>ref|XP_007035563.1| Flowering promoting factor 1 [Theobroma cacao]
 gb|EOY06489.1| Flowering promoting factor 1 [Theobroma cacao]
Length=193

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP AE       G+  R+K LV+ P+ +V++SY  LE+ L+ LG
Sbjct  82   MSGVWVFKNGVVRLVENPGAESMDGSRQGSNIRRKVLVHTPSNEVITSYAVLERKLSSLG  141

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFHK+S++ LISLP+D++KF S++M+DIVVKN N F+VRD
Sbjct  142  WERYYD-DPDLLQFHKRSTVHLISLPKDFSKFKSMHMFDIVVKNRNAFEVRD  192



>ref|XP_003566537.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Brachypodium 
distachyon]
Length=106

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP +E  +  R+K L++ P+GQVVSSY  LE  LT LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGSERSSTVRRKALLHTPSGQVVSSYASLEAKLTALGWERYYE  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP L+QF+K  ++DLISLP+D++ F+S++MYD+V+KN + F+V D
Sbjct  61   -DPALYQFNKPGALDLISLPKDFSHFSSVHMYDVVIKNRDAFRVVD  105



>ref|XP_010269628.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Nelumbo 
nucifera]
Length=114

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 83/113 (73%), Gaps = 8/113 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGL  258
            MSGVWVFKNGV RLVENP  E         + +R+K LV+ PT +V++SY  LEQ L  L
Sbjct  1    MSGVWVFKNGVVRLVENPTVESLDGSGRQTSTTRRKVLVHTPTNEVMTSYAVLEQKLLEL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            GWERYY  DPDLFQFHK S+I LISLPRD+ +F S++M+DIVVKN   F+VRD
Sbjct  61   GWERYYD-DPDLFQFHKPSTIHLISLPRDFIRFRSMHMFDIVVKNRKKFEVRD  112



>gb|EAY73364.1| hypothetical protein OsI_01242 [Oryza sativa Indica Group]
Length=109

 Score =   140 bits (353),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG---AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVW+FKNGV RLVE   A  G   A  R+K LV+ P+GQVVSSY  LE  LT LGWER
Sbjct  1    MSGVWLFKNGVVRLVEKQQATAGTSVAGGRRKALVHTPSGQVVSSYAALEARLTALGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            YY  DP LFQFHK+ S+DLISLP D++ F+S++MYDIVVKN + F+V D 
Sbjct  61   YYE-DPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRDSFRVVDA  109



>ref|XP_009414864.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Musa 
acuminata subsp. malaccensis]
Length=106

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RL+ENPA E  +  R+K L+++PT +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLIENPANEQSSTIRRKVLLHIPTNEVITSYDNLERKLMSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP L QFHK+SS+DLISLP+++++F S++MYDIVVKN   F+V D
Sbjct  61   -DPGLLQFHKRSSVDLISLPKEFSRFKSMHMYDIVVKNRESFRVVD  105



>ref|XP_008390677.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Malus 
domestica]
 ref|XP_009352243.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Pyrus 
x bretschneideri]
Length=107

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASR-KKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLV+   +  G+ SR +K LV+ PT +V+SSY  LE+ L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVDGADSLQGSNSRPRKVLVHTPTDEVISSYAVLERKLYSLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DPDL QFHK+S++ LISLP+D+NKF S++MYDIVVKN N+F+VRD
Sbjct  61   D-DPDLLQFHKRSTVHLISLPKDFNKFKSMHMYDIVVKNRNVFEVRD  106



>ref|XP_003546352.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Glycine 
max]
 gb|KHN14632.1| hypothetical protein glysoja_024727 [Glycine soja]
Length=100

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP +E      +K LV+  + ++++SY  LE  L+ LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGSE------RKVLVHTASNEIITSYAVLEHKLSSLGWERYYD  54

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLPRD+NKF S++MYDIVVKN N F+VRD
Sbjct  55   -DPDLLQFHKRSTVHLISLPRDFNKFRSMHMYDIVVKNKNYFEVRD  99



>ref|XP_009151702.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Brassica 
rapa]
Length=108

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE--HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RLVENP A+  +   +++K LVY P+ ++++SY  L++ L  LGWERY
Sbjct  1    MSGVWVFKNGVIRLVENPGADETNTVKAKRKVLVYTPSNEIITSYSHLQRHLYALGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y GDP+L QFHK S++ LISLP D+++F +++MYDIVVKN N+FQVRD
Sbjct  61   Y-GDPNLLQFHKASTVHLISLPTDFSRFKTMHMYDIVVKNRNMFQVRD  107



>gb|AID51342.1| flowering promoting factor 1-like protein 1 [Gossypium hirsutum]
Length=112

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 87/112 (78%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVFKNGV RLVENP  +       G+ +R+K L++ P+ + ++SY  LE+ L+ LG
Sbjct  1    MSGVWVFKNGVVRLVENPGVDSFDGSRQGSNARRKLLIHTPSNEAITSYAVLERKLSILG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DPDL QFHK+S++ LISLP+D++KF S++M+DIVVKN N+F+VRD
Sbjct  61   WERYYD-DPDLLQFHKRSTVHLISLPKDFSKFKSMHMFDIVVKNRNMFEVRD  111



>ref|XP_010675033.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Beta 
vulgaris subsp. vulgaris]
Length=129

 Score =   140 bits (353),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            M+GVWVF NGV +LVEN A   GA S +K LV++PT + ++SY+ LE+ L  LGWERYY 
Sbjct  1    MAGVWVFNNGVPKLVENQA---GAGSSQKLLVHVPTDEAITSYQMLEEKLVALGWERYYD  57

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG*LA  429
             DP+  QFHK+SSIDLIS+PRD+ KFN++YMYDIVVKNPN+F+V +  +A
Sbjct  58   -DPNFLQFHKRSSIDLISVPRDFLKFNAVYMYDIVVKNPNMFRVMNNYVA  106



>gb|AHI62966.1| flowering promoting factor 1 [Gossypium hirsutum]
Length=109

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVF--KNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSG W F  KNGV RLVEN  ++       K LV++P+ +V++SY  L+  L  LGWERY
Sbjct  1    MSGPWCFNHKNGVVRLVENSGSDQRPKPEGKVLVHIPSNEVITSYEILKTKLLSLGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              GDPDLFQFHK+SSIDLISLP+D+ KF S+YMYDIVVKNPN+F V D
Sbjct  61   DGGDPDLFQFHKRSSIDLISLPKDFTKFKSVYMYDIVVKNPNMFMVMD  108



>ref|XP_006600348.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Glycine 
max]
 gb|KHN03368.1| hypothetical protein glysoja_004394 [Glycine soja]
Length=109

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 82/109 (75%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP---AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV RLVENP   A E     R+K LV+  + +V++SY  LE+ L  LGWER
Sbjct  1    MSGVWVFKNGVVRLVENPGGEAVEGSRGGRRKVLVHRASNEVITSYAVLERKLYSLGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY  DPDL QFHK+S++ LISLPRD+NKF  ++MYDIVVKN N F+VRD
Sbjct  61   YYD-DPDLLQFHKRSTVHLISLPRDFNKFKPMHMYDIVVKNKNAFEVRD  108



>ref|XP_002457591.1| hypothetical protein SORBIDRAFT_03g009910 [Sorghum bicolor]
 gb|EES02711.1| hypothetical protein SORBIDRAFT_03g009910 [Sorghum bicolor]
Length=107

 Score =   139 bits (350),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG-AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVEN AA  G A  R+K LV+ P+GQVV SY  LE  L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENGAAAGGEAVRRRKALVHTPSGQVVRSYAELESELRALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DP L+QFHK+ S+DLISLP D+N+F+S++MYDIV+KN + F+V D
Sbjct  61   E-DPALYQFHKRGSLDLISLPADFNRFSSVHMYDIVIKNRDSFRVVD  106



>ref|XP_009343982.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Pyrus 
x bretschneideri]
 ref|XP_009343994.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Pyrus 
x bretschneideri]
Length=179

 Score =   141 bits (355),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASR-KKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLV+   +  G+ +R +K LV+ PT +V+SSY  LE+ L+ LGWERYY
Sbjct  73   MSGVWVFKNGVVRLVDGADSLQGSNARPRKVLVHTPTDEVISSYAVLERKLSALGWERYY  132

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DPDL QFHK+S++ LISLP+D+NKF S++MYDIVVKN N+F+VRD
Sbjct  133  -DDPDLLQFHKRSTVHLISLPKDFNKFKSMHMYDIVVKNRNVFEVRD  178



>emb|CDY23294.1| BnaA08g12520D [Brassica napus]
Length=102

 Score =   138 bits (348),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 11/109 (10%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF KNGV RL +          R+K LV+LPT +VVSSY+ LE+IL  LGWERYY
Sbjct  1    MSGVWVFNKNGVMRLQQR--------MRRKILVHLPTSEVVSSYKSLERILKCLGWERYY  52

Query  277  SGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            +GD    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F VRD
Sbjct  53   NGDNADHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFHVRD  101



>ref|XP_007137109.1| hypothetical protein PHAVU_009G100300g [Phaseolus vulgaris]
 gb|ESW09103.1| hypothetical protein PHAVU_009G100300g [Phaseolus vulgaris]
Length=106

 Score =   138 bits (348),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFK   +RL+EN  AE  + + KK LVYL +G+VVSSY  LE+IL+ LGWERYY 
Sbjct  1    MSGVWVFKKDGFRLMENRQAERCSLN-KKVLVYLASGEVVSSYSSLEEILSNLGWERYYG  59

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             D   +QFHK SS DLISLP +++KF+S++MYDIV+KNPN+F VRD
Sbjct  60   RDLQFYQFHKHSSTDLISLPLNFSKFSSVHMYDIVIKNPNVFHVRD  105



>ref|XP_003529571.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Glycine 
max]
 gb|KHN02977.1| hypothetical protein glysoja_009843 [Glycine soja]
Length=109

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP---AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV RLVENP   A E     R+K LV+  + +V++SY  LEQ L  LGWER
Sbjct  1    MSGVWVFKNGVVRLVENPGGEAVEGSRGGRRKVLVHRASNEVITSYAVLEQKLYSLGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY  D DL QFHK+S++ LISLPRD+NKF  ++MYDIVVKN N F+VRD
Sbjct  61   YYD-DADLLQFHKRSTVHLISLPRDFNKFKPMHMYDIVVKNKNAFEVRD  108



>ref|XP_003566536.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Brachypodium 
distachyon]
Length=107

 Score =   138 bits (347),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVEN-PAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVEN P +E   A R+K L++ P+GQVVSSY  LE  LT LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENGPGSEQLPAVRRKALLHTPSGQVVSSYASLEAKLTALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DP L+QFHK+  +DLISLPRD++ F+S++MYD+V+KN + F+V D
Sbjct  61   E-DPALYQFHKRGCMDLISLPRDFHHFSSVHMYDVVIKNRDSFRVVD  106



>gb|EYU43937.1| hypothetical protein MIMGU_mgv1a018470mg [Erythranthe guttata]
Length=103

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 85/106 (80%), Gaps = 4/106 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP+     +SR+K LV++ +G+ ++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVLRLVENPSE---CSSRRKLLVHVASGEAITSYSVLERKLFCLGWERYYD  57

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             +P+L Q+HK+S++ LISLPRD+NKF SI+MYDIVVKN N F+VRD
Sbjct  58   -EPELLQYHKRSTVHLISLPRDFNKFKSIHMYDIVVKNRNEFEVRD  102



>ref|XP_002273066.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Vitis 
vinifera]
 emb|CBI26069.3| unnamed protein product [Vitis vinifera]
Length=107

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE--HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RL ENP  +   G+  R+K L++ PT +V++SY  LE+ L+ LGWERY
Sbjct  1    MSGVWVFKNGVVRL-ENPGGDSLQGSGGRRKVLIHTPTNEVITSYAMLERKLSSLGWERY  59

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DP+L QFHK+S++ LISLP+D+ KF S++M+DIVVKN N+F+VRD
Sbjct  60   YD-DPELLQFHKRSTVHLISLPKDFGKFKSMHMFDIVVKNRNIFEVRD  106



>emb|CDY72087.1| BnaC07g50920D [Brassica napus]
Length=102

 Score =   137 bits (345),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 11/109 (10%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF KNGV RL +          R+K LV+LPT +VVSSY  LE+IL GLGWERYY
Sbjct  1    MSGVWVFNKNGVMRLQQRL--------RRKILVHLPTNEVVSSYGALERILKGLGWERYY  52

Query  277  SGD--PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            + D    L QFHK++SIDLISLPRD++KFNSI+MYDIVVKNPN+F VRD
Sbjct  53   NEDNVDHLLQFHKRTSIDLISLPRDFSKFNSIHMYDIVVKNPNVFHVRD  101



>gb|EYU43938.1| hypothetical protein MIMGU_mgv1a024163mg [Erythranthe guttata]
Length=103

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN     G    KK LV++ + +V++SY  LE+ L+ LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENA----GECHSKKMLVHVNSKEVITSYSILERKLSALGWERYYD  56

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L QFHK+S++ LISLPRD+NKF SI+MYDIVVKN N F+VRD
Sbjct  57   -DPELLQFHKRSTVHLISLPRDFNKFKSIHMYDIVVKNRNEFEVRD  101



>gb|AGT16103.1| hypothetical protein SHCRBa_134_J05_F_240 [Saccharum hybrid cultivar 
R570]
Length=107

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG-AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVEN AA  G A  R+K LV+ P+GQVV SY  LE  L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENGAAAGGEAVRRRKALVHTPSGQVVRSYAELESELRALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DP L+QFHK+ S+DLISLP D+ +F+S++MYDIVVKN + F+V D
Sbjct  61   E-DPALYQFHKRGSLDLISLPADFARFSSVHMYDIVVKNRDSFRVVD  106



>ref|XP_003565014.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Brachypodium 
distachyon]
Length=115

 Score =   137 bits (344),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 85/114 (75%), Gaps = 8/114 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVF+NGV RLVENPA+        G   R+K L++ PTG+VV+SY  LE+ L GLG
Sbjct  1    MSGVWVFRNGVVRLVENPASAVTGGTGGGGGGRRKALLHTPTGEVVASYASLERKLLGLG  60

Query  262  WERYYSGDPD--LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY G  D  + QFHK+SS+DLISLP+D+ KFNS+ MYD+VVKN + F+V D
Sbjct  61   WERYYGGGDDGKMLQFHKRSSVDLISLPKDFGKFNSMQMYDVVVKNRDAFRVID  114



>ref|NP_001240218.1| uncharacterized protein LOC100795247 [Glycine max]
 gb|ACU24265.1| unknown [Glycine max]
 gb|KHN26565.1| hypothetical protein glysoja_019804 [Glycine soja]
Length=100

 Score =   136 bits (342),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 82/106 (77%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN    HG  S +K LV+  + ++++SY  LE  L+ LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVEN----HG--SDRKVLVHTASNEIITSYAVLEHKLSSLGWERYYD  54

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLPRD+NKF S++MYDIVVKN N F+VRD
Sbjct  55   -DPDLLQFHKRSTVHLISLPRDFNKFRSMHMYDIVVKNKNYFEVRD  99



>ref|XP_004967814.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Setaria 
italica]
Length=107

 Score =   136 bits (343),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVEN AA  G A RK K LV+ P+GQVV SY  LE  L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENGAAGGGEAVRKRKALVHTPSGQVVRSYAELESELRALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DP L+QFHK+ S+DLISLP D+ +F+S++MYDIV+KN + F+V D
Sbjct  61   E-DPALYQFHKRGSLDLISLPADFARFSSVHMYDIVIKNRDSFRVVD  106



>ref|XP_002975506.1| hypothetical protein SELMODRAFT_103635 [Selaginella moellendorffii]
 ref|XP_002993536.1| hypothetical protein SELMODRAFT_137184 [Selaginella moellendorffii]
 gb|EFJ05428.1| hypothetical protein SELMODRAFT_137184 [Selaginella moellendorffii]
 gb|EFJ23135.1| hypothetical protein SELMODRAFT_103635 [Selaginella moellendorffii]
Length=117

 Score =   136 bits (343),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 82/112 (73%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVF+NGV RLV NP  E          +R+K LV++P+ +++SSY CLE  L  LG
Sbjct  1    MSGVWVFRNGVARLVSNPLMEPIDGGMEPVVTRRKVLVHVPSNEIISSYSCLEPKLLALG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERY   +PDL QFHK  S+DLISLP D++KF +I+MYDIVVKN ++F+VRD
Sbjct  61   WERYPLEEPDLIQFHKVYSVDLISLPADFSKFKTIHMYDIVVKNKSIFEVRD  112



>ref|NP_001151726.1| FPF1 [Zea mays]
 gb|ACG44143.1| FPF1 [Zea mays]
Length=108

 Score =   136 bits (342),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNGV RLVEN AA  G A+  R+K LV+ P+GQVV SY  LE  L  LGWERY
Sbjct  1    MSGVWVFKNGVVRLVENGAAVGGEAAVRRRKALVHTPSGQVVRSYAELEAELRALGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DP L+QFHK+ S+DLISLP D+ +F+S++MYDIV+KN + F+V D
Sbjct  61   YE-DPALYQFHKRGSLDLISLPADFARFSSVHMYDIVIKNRDSFRVVD  107



>ref|XP_002865696.1| hypothetical protein ARALYDRAFT_917838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41955.1| hypothetical protein ARALYDRAFT_917838 [Arabidopsis lyrata subsp. 
lyrata]
Length=107

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA-SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVENP AE     +++K LVY P+ +V++SY  L+Q L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENPGAETNIENTKRKVLVYTPSNEVITSYSHLQQHLYALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              +P L QFHK S++ LISLP D+++F  ++MYDIVVKN N+FQV+D
Sbjct  61   E-EPHLLQFHKASTVHLISLPSDFSRFKLMHMYDIVVKNRNMFQVKD  106



>ref|XP_009780603.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nicotiana 
sylvestris]
Length=104

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP  +H   SRK  LV++PT +V++SY  LE  L  LGWERYY 
Sbjct  1    MSGVWVFKNGVLRLVENPG-DHFQGSRK-VLVHVPTNEVITSYAILETKLYNLGWERYYD  58

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L Q+HK+S+  LISLP+D+NKF +++MYDIVVKN N F+VRD
Sbjct  59   -DPELLQYHKRSTTHLISLPKDFNKFKTMHMYDIVVKNRNEFEVRD  103



>gb|EPS62886.1| hypothetical protein M569_11903, partial [Genlisea aurea]
Length=102

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 81/106 (76%), Gaps = 4/106 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFK+G+ RLVENP    G   R+K L++LP+ +V++SY  LE  L  LGWERYY 
Sbjct  1    MSGVWVFKDGIVRLVENPG---GDYKRRKQLIHLPSNEVITSYSVLESKLVALGWERYYD  57

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+ ++ LISLP+D+ +FNSI M+DIVVKN N F+VRD
Sbjct  58   -DPDLLQFHKRHTVHLISLPKDFARFNSIQMFDIVVKNRNEFEVRD  102



>ref|XP_004229230.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Solanum 
lycopersicum]
Length=105

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN    HGA   +K LV+LP+ +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENSDC-HGANGLRKVLVHLPSNEVITSYAVLERKLYSLGWERYYD  59

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             +P+L Q+HK+S++ LISLP+D+N+F S++M+DIVVKN N F+VRD
Sbjct  60   -EPELLQYHKRSTVHLISLPKDFNRFKSMHMFDIVVKNRNEFEVRD  104



>gb|AGT16493.1| hypothetical protein SHCRBa_010_E09_R_180 [Saccharum hybrid cultivar 
R570]
Length=107

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG-AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF NGV RLVEN AA  G A  R+K LV+ P+GQVV SY  LE  L  LGWERYY
Sbjct  1    MSGVWVFNNGVVRLVENGAAAGGEAVRRRKALVHTPSGQVVRSYAELESELRALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DP L+QFHK+ S+DLISLP D+ +F+S++MYDIVVKN + F+V D
Sbjct  61   E-DPALYQFHKRGSLDLISLPADFARFSSVHMYDIVVKNRDSFRVVD  106



>ref|XP_009631683.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nicotiana 
tomentosiformis]
Length=104

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 83/106 (78%), Gaps = 3/106 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP  +H   SRK  LV++PT +V++SY  LE  L  LGWERYY 
Sbjct  1    MSGVWVFKNGVLRLVENPG-DHFQGSRK-VLVHVPTNEVITSYAILETKLYNLGWERYYD  58

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L Q+HK+S+  LI+LP+D+NKF +++MYDIVVKN N F+VRD
Sbjct  59   -DPELLQYHKRSTTHLITLPKDFNKFKTMHMYDIVVKNRNEFEVRD  103



>ref|XP_006342791.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Solanum 
tuberosum]
Length=105

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 2/106 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVEN    HGA   +K LV+LP+ +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENSDC-HGANGLRKVLVHLPSDEVITSYAVLERKLYSLGWERYYD  59

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             +P+L Q+HK+S++ LISLP+D+N+F S++M+DIVVKN N F+VRD
Sbjct  60   -EPELLQYHKRSTVHLISLPKDFNRFKSMHMFDIVVKNRNEFEVRD  104



>emb|CDP19536.1| unnamed protein product [Coffea canephora]
Length=100

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF+NGV RLVENP         +K LV++P+ +V++SY  LE+ L+ LGWERY+ 
Sbjct  1    MSGVWVFRNGVLRLVENPG------DSRKALVHVPSNEVITSYAVLERKLSALGWERYHD  54

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L QFHK+S+I LISLP+D++KF S++MYDIVVKN N F+VRD
Sbjct  55   -DPELLQFHKRSTIHLISLPKDFSKFKSMHMYDIVVKNRNEFEVRD  99



>ref|XP_008806479.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Phoenix 
dactylifera]
 ref|XP_008777768.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Phoenix 
dactylifera]
 ref|XP_008778674.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Phoenix 
dactylifera]
Length=106

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF K GV RLVE P  E  ++SR+K LV++PTG+V++SY  LEQ L  LGWERY+
Sbjct  1    MSGVWVFNKRGVVRLVEVPGGE-PSSSRRKVLVHVPTGEVITSYELLEQKLAPLGWERYH  59

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            S +P+L QFH++SS+ LISLPRD+++  S++MYD+VVK+ N+F+VRD 
Sbjct  60   S-NPELVQFHQRSSVHLISLPRDFSRLTSVHMYDVVVKSRNVFEVRDA  106



>ref|XP_004229232.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Solanum 
lycopersicum]
Length=106

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 1/106 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVW  KNGV RLVEN    HGA  R+K LV+L + +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWKIKNGVVRLVENLGDFHGATGRRKVLVHLSSNEVITSYAVLERKLYSLGWERYYD  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL Q+HK+S++ LISLP D+N   S++MYDIVVKN N F VRD
Sbjct  61   -DPDLLQYHKRSTVHLISLPNDFNNLRSMHMYDIVVKNRNEFAVRD  105



>ref|XP_009381580.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=107

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAA-EHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV R VENP+  E G   R+K LV+LPT +VV+S   LE  L  LGWERY 
Sbjct  1    MSGVWVFKNGVLRRVENPSGGEPGGGLRRKVLVHLPTDEVVTSLAMLESELAELGWERYP  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            S  PDL QFHK+SS+ LIS+PRD+++F S++MYDIVVK   +F+VRD 
Sbjct  61   S-TPDLIQFHKRSSVHLISVPRDFSRFTSVHMYDIVVKCRTVFEVRDA  107



>ref|XP_002969301.1| hypothetical protein SELMODRAFT_231311 [Selaginella moellendorffii]
 ref|XP_002986813.1| hypothetical protein SELMODRAFT_235104 [Selaginella moellendorffii]
 gb|EFJ12143.1| hypothetical protein SELMODRAFT_235104 [Selaginella moellendorffii]
 gb|EFJ29389.1| hypothetical protein SELMODRAFT_231311 [Selaginella moellendorffii]
Length=115

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 79/111 (71%), Gaps = 5/111 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFKNGV RLV NP  E          RKK LV++P+ Q++SSY  LE  L  LGW
Sbjct  1    MSGVWVFKNGVARLVSNPLMEPIDSGERGILRKKVLVHVPSNQIISSYAHLEAKLLDLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERY   +PDL QFHK SS+DLISLP D+ +F +I+MYDIVVKN + F+VRD
Sbjct  61   ERYPYEEPDLIQFHKISSVDLISLPADFTRFKTIHMYDIVVKNRSFFEVRD  111



>gb|AFK38483.1| unknown [Lotus japonicus]
Length=108

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEH-GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVF+N GV +LVENP AE   +  R+K LV+  + +V++SY  LE  L  LGWERY
Sbjct  1    MSGVWVFRNNGVMKLVENPGAEALESGRRRKVLVHTASNEVITSYAVLEHKLYSLGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DPDL QFHK+S++ LISLPRD+++F S++M+DIVVKN N F+VRD
Sbjct  61   YD-DPDLLQFHKRSTVHLISLPRDFSRFKSMHMFDIVVKNKNSFEVRD  107



>ref|XP_008655501.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Zea mays]
 gb|AFW79660.1| FPF1 [Zea mays]
Length=107

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA-SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV RLVEN AA   AA  R+K LV+ P+GQVV SY  LE  L  LGWERYY
Sbjct  1    MSGVWVFKNGVVRLVENGAAGGEAAVRRRKALVHTPSGQVVRSYAELEPELRALGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
              DP L+QFHK+ S+DLISLP D+  F+S++MYDIVVKN + F+V
Sbjct  61   E-DPALYQFHKRGSLDLISLPADFASFSSVHMYDIVVKNRDSFRV  104



>ref|XP_002459042.1| hypothetical protein SORBIDRAFT_03g044960 [Sorghum bicolor]
 gb|EES04162.1| hypothetical protein SORBIDRAFT_03g044960 [Sorghum bicolor]
Length=111

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVF+NGV RLVENP + + AA+  ++K L++ P+G+VV+SY  LE+ L  LGWERY
Sbjct  1    MSGVWVFRNGVVRLVENPTSGNAAAASGKRKALLHTPSGEVVTSYASLERKLAALGWERY  60

Query  274  YS--GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y+  G   L Q+HK++S+DLISLP+D+  F S++MYDIV+KN + F+V D
Sbjct  61   YADNGGGGLLQYHKRTSVDLISLPKDFAHFGSVHMYDIVIKNRDAFRVID  110



>ref|XP_007138901.1| hypothetical protein PHAVU_009G247200g [Phaseolus vulgaris]
 gb|ESW10895.1| hypothetical protein PHAVU_009G247200g [Phaseolus vulgaris]
Length=100

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF  GV RLVE+P +E      +K LV+  + ++++SY  LE  L+ LGWERYY 
Sbjct  1    MSGVWVFNKGVVRLVESPNSE------RKVLVHSTSNEIITSYTVLEHKLSSLGWERYY-  53

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLPRD+N+F S++MYDIVVKN N F+VRD
Sbjct  54   DDPDLLQFHKRSTVHLISLPRDFNRFKSMHMYDIVVKNKNYFEVRD  99



>ref|XP_008458459.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Cucumis 
melo]
Length=111

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVEN---PAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF+NGV RL+EN    AA+ G  S  R+K LV+ PT +V++SY  LE+ L  LGW
Sbjct  1    MSGVWVFRNGVVRLMENGGGTAAKGGQQSQLRRKALVFSPTAEVMTSYEALEKKLVTLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY  DP+L QFHK+S++ LISLP+D+ KF S++MYDIVVKN N F+V D
Sbjct  61   ERYYD-DPNLLQFHKRSTVHLISLPKDFAKFKSMHMYDIVVKNRNHFEVID  110



>ref|XP_007138902.1| hypothetical protein PHAVU_009G247300g [Phaseolus vulgaris]
 gb|ESW10896.1| hypothetical protein PHAVU_009G247300g [Phaseolus vulgaris]
Length=100

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF  GV RLVENP +E      +K L++  + ++++SY  LE  L+ LGWERYY 
Sbjct  1    MSGVWVFNKGVVRLVENPNSE------RKVLIHSASNEIITSYTVLEHKLSTLGWERYYD  54

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DPDL QFHK+S++ LISLP+D+N+F S++MYDIVVKN N F+VRD
Sbjct  55   -DPDLLQFHKRSTVHLISLPKDFNRFRSMHMYDIVVKNKNYFEVRD  99



>ref|XP_010914149.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Elaeis 
guineensis]
Length=105

 Score =   131 bits (329),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF K GV RLVE P AE   +SR+K LV++PT +VV+SY  LE+ L  LGWERY+
Sbjct  1    MSGVWVFNKKGVVRLVEVPGAE--PSSRRKVLVHVPTNEVVTSYEMLERKLAPLGWERYH  58

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
              +PDL QFH++SS+ LISLPRD+++  S++MYD+VVK+ N+F+VRD 
Sbjct  59   C-NPDLVQFHQRSSVHLISLPRDFSRLTSVHMYDVVVKSRNVFEVRDA  105



>gb|EAY85756.1| hypothetical protein OsI_07114 [Oryza sativa Indica Group]
Length=122

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS-------RKKCLVYLPTGQVVSSYRCLEQILTGL  258
            M+GVWVFK+G+ R VENP +E  +++       R+K LV++P+G+VV+SY  LE+ L  L
Sbjct  1    MAGVWVFKDGIVRRVENPGSEESSSAGNGGGGGRRKVLVHVPSGEVVASYEVLERRLREL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            GWERY + DP L QFH++S++ LIS+PRD++KF  ++MYDIVVK  N+F+VRD 
Sbjct  61   GWERYLT-DPCLLQFHQRSTVHLISVPRDFSKFKLVHMYDIVVKTRNVFEVRDA  113



>ref|NP_001046787.1| Os02g0460200 [Oryza sativa Japonica Group]
 sp|Q0E1D7.1|FLP3_ORYSJ RecName: Full=Flowering-promoting factor 1-like protein 3; AltName: 
Full=FPF1-like protein 3 [Oryza sativa Japonica Group]
 dbj|BAF08701.1| Os02g0460200 [Oryza sativa Japonica Group]
 gb|EAZ22941.1| hypothetical protein OsJ_06629 [Oryza sativa Japonica Group]
 dbj|BAG87613.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89387.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96765.1| unnamed protein product [Oryza sativa Japonica Group]
Length=122

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 86/114 (75%), Gaps = 8/114 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS-------RKKCLVYLPTGQVVSSYRCLEQILTGL  258
            M+GVWVFK+G+ R VENP +E  +++       R+K LV++P+G+VV+SY  LE+ L  L
Sbjct  1    MAGVWVFKDGIVRRVENPGSEESSSAGDGGGGGRRKVLVHVPSGEVVASYEVLERRLREL  60

Query  259  GWERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            GWERY + DP L QFH++S++ LIS+PRD++KF  ++MYDIVVK  N+F+VRD 
Sbjct  61   GWERYLT-DPCLLQFHQRSTVHLISVPRDFSKFKLVHMYDIVVKTRNVFEVRDA  113



>ref|XP_004508273.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Cicer 
arietinum]
Length=111

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 81/112 (72%), Gaps = 8/112 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS-----RKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFK GV RLVENP  E GA+S     R+K LVY P+ +V++SY  LE  L  LGW
Sbjct  1    MSGVWVFKKGVVRLVENPGGE-GASSNSGSGRRKVLVYTPSNEVITSYSMLEHKLYSLGW  59

Query  265  ERYYSGDPD-LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY  DPD L QFHK+S++ LISLP+D+NK   ++MYDIVVKN N F V D
Sbjct  60   ERYYD-DPDHLLQFHKRSTVYLISLPKDFNKLKPMHMYDIVVKNKNFFHVMD  110



>ref|XP_006855542.1| hypothetical protein AMTR_s00057p00216330 [Amborella trichopoda]
 gb|ERN17009.1| hypothetical protein AMTR_s00057p00216330 [Amborella trichopoda]
Length=110

 Score =   129 bits (325),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 7/111 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEH-----GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVW F NGV RLV +P ++         +R+K LV++ TG+VV+SY  LE +LT LGW
Sbjct  1    MSGVWTFNNGVVRLV-SPGSDSLDGSDAMGARRKVLVHVATGEVVTSYASLESMLTSLGW  59

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY  +PDL QFHK+SS+ LISLPR++++F S++MYDIVVK  ++F+VRD
Sbjct  60   ERYYE-NPDLLQFHKRSSVHLISLPREFSRFRSMHMYDIVVKTRSVFEVRD  109



>ref|XP_006844708.1| hypothetical protein AMTR_s00016p00249730 [Amborella trichopoda]
 gb|ERN06383.1| hypothetical protein AMTR_s00016p00249730 [Amborella trichopoda]
Length=111

 Score =   129 bits (323),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFKNGV RLV NPA E       A ++++ LVY P+ +V++SY  LE  L GLGW
Sbjct  1    MSGVWVFKNGVARLVSNPAVESIDGSELACTKRRVLVYTPSDEVITSYAFLESKLRGLGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            ER+Y  DPD  QFHK  S  LISLPRD+++F S++M+DIVVKN + F+VR+ 
Sbjct  61   ERWYE-DPDKIQFHKACSSHLISLPRDFSRFKSVHMFDIVVKNRSSFEVRES  111



>gb|KFK24886.1| hypothetical protein AALP_AA8G037400 [Arabis alpina]
Length=108

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 78/109 (72%), Gaps = 3/109 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG--AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            M+G WVF NGV RLVEN  AE       RK  LVY  + +V++SY  LEQ L  LGWERY
Sbjct  1    MAGQWVFNNGVVRLVENTGAEMSIDKTKRKDVLVYTSSDEVITSYSLLEQHLNELGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
               DP L QFHK+SS+DLI+LP+D++ F+S++M+DI  KNP++F+VRD 
Sbjct  61   -EEDPSLLQFHKRSSLDLITLPKDFSWFHSVHMHDIATKNPDMFEVRDA  108



>ref|XP_010098295.1| hypothetical protein L484_023543 [Morus notabilis]
 gb|EXB74799.1| hypothetical protein L484_023543 [Morus notabilis]
Length=100

 Score =   128 bits (321),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 80/106 (75%), Gaps = 7/106 (7%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RL      + G   R+K LV+ P+ +V++SY  LE  L+ LGWERYY 
Sbjct  1    MSGVWVFKNGVVRL------DPGLDGRRKVLVHTPSNEVITSYAVLEHKLSSLGWERYYD  54

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             DP+L QFHK+S++ LISLP+D+ +F S++MYDIVVKN N+F+VRD
Sbjct  55   -DPELLQFHKRSTVHLISLPKDFGRFKSMHMYDIVVKNRNVFEVRD  99



>ref|XP_010037406.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Eucalyptus 
grandis]
 gb|KCW84472.1| hypothetical protein EUGRSUZ_B01307 [Eucalyptus grandis]
Length=107

 Score =   128 bits (322),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 84/107 (79%), Gaps = 2/107 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            M+GV VFKN V RL ++P +E  G   R+K L+++PT +V++SY  LE+ L+ LGWERYY
Sbjct  1    MNGVSVFKNDVVRLAKDPGSEVSGGIGRRKVLIHIPTNEVITSYADLERKLSSLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            S  P+L QFHK+S++DLISLP+D+  F S++MYDI++KN N+F+VRD
Sbjct  61   SY-PELLQFHKRSTLDLISLPKDFKNFKSMHMYDIIIKNCNIFEVRD  106



>ref|XP_009775773.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nicotiana 
sylvestris]
Length=102

 Score =   128 bits (321),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RL +      G++ R+K LV++P+ +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLEDC----QGSSGRRKVLVHIPSNEVITSYAVLERKLYSLGWERYYD  56

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             D DL Q+HK+S++ LISLP+D+NKF S++MYDIVVKN N F+VRD
Sbjct  57   -DLDLLQYHKRSTVHLISLPKDFNKFKSMHMYDIVVKNRNEFEVRD  101



>ref|XP_004487862.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Cicer 
arietinum]
Length=112

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAA----EHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV RLV+   A     HG+  R+K LV+  + ++++SY  L+  L+ LGWE
Sbjct  1    MSGVWVFKNGVVRLVDGADAIGGGRHGSGGRRKVLVHTASNEIITSYAVLDHKLSSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY  DPDL QFHK+S++ LISLPRD+NKF S++MYDIVVKN N F+VRD
Sbjct  61   RYYD-DPDLLQFHKRSTVHLISLPRDFNKFKSMHMYDIVVKNKNNFEVRD  109



>ref|XP_003609664.1| Flowering promoting factor-like protein [Medicago truncatula]
 gb|AES91861.1| flowering-promoting factor-like protein [Medicago truncatula]
Length=111

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK---KCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVFKNGV RLVENP  E G +S     K LVY PT +V++SY  LE+ L  LGWER
Sbjct  1    MSGVWVFKNGVVRLVENPGGEGGESSSGRSRKVLVYTPTNEVITSYSLLERKLQSLGWER  60

Query  271  YYSGDPD-LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YY  DPD L QFHK+S++ LISLP+D+NK   ++MYDIVVKN N F VRD
Sbjct  61   YYD-DPDHLLQFHKRSTVYLISLPKDFNKLKPMHMYDIVVKNKNYFHVRD  109



>ref|NP_001150372.1| LOC100284002 [Zea mays]
 gb|ACG38838.1| FLP1 [Zea mays]
 gb|ACR37959.1| unknown [Zea mays]
 tpg|DAA55963.1| TPA: FLP1 [Zea mays]
Length=114

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 86/114 (75%), Gaps = 7/114 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVF+NGV RLVENP + + AA+  ++K L++ P+G+VV+SY  LE+ L  LGWERY
Sbjct  1    MSGVWVFRNGVVRLVENPTSGNAAAAPGKRKALLHTPSGEVVTSYASLERKLAALGWERY  60

Query  274  YSGDPD-----LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y+G  D     L Q+HK++S+DLISLP+D+  F S++MYDIV+KN + F+V D 
Sbjct  61   YAGGGDGGGAGLLQYHKRTSVDLISLPKDFAHFGSVHMYDIVIKNRDAFRVIDA  114



>ref|NP_001045304.1| Os01g0933500 [Oryza sativa Japonica Group]
 sp|Q8LR63.1|FLP2_ORYSJ RecName: Full=Flowering-promoting factor 1-like protein 2; AltName: 
Full=FPF1-like protein 2 [Oryza sativa Japonica Group]
 dbj|BAB93246.1| FPF1 protein-like [Oryza sativa Japonica Group]
 gb|AAP70021.1| gravity and root development protein [Oryza sativa Japonica Group]
 dbj|BAF07218.1| Os01g0933500 [Oryza sativa Japonica Group]
Length=127

 Score =   126 bits (316),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 85/126 (67%), Gaps = 20/126 (16%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS-------------RKKCLVYLPTGQVVSSYRCLE  240
            MSGVWVF+NGV +LVENP A   +               R+K L+++PTG+VV+SY  LE
Sbjct  1    MSGVWVFRNGVVKLVENPPASANSGGGGGGGGGGGGGGIRRKALLHMPTGEVVTSYASLE  60

Query  241  QILTGLGWERYYSGDPD-------LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPN  399
            + L  LGWERYYSG          + QFHK+SS+DLISLP+D+++F S++MYDIVVKN +
Sbjct  61   RKLAALGWERYYSGGGGAAAAAAMMLQFHKRSSVDLISLPKDFSQFGSVHMYDIVVKNRD  120

Query  400  LFQVRD  417
             F+V D
Sbjct  121  AFRVID  126



>ref|XP_003565015.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Brachypodium 
distachyon]
Length=119

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 83/118 (70%), Gaps = 12/118 (10%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP----AAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVF+NGV +LVENP    AA  G   R+K L++ PTG+VVSSY  LE+ L GLGWE
Sbjct  1    MSGVWVFRNGVVKLVENPSSASAAPGGGVVRRKALLHTPTGEVVSSYASLERRLLGLGWE  60

Query  268  RYY--------SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY        +    + +FHK+SS+DLIS+P+D+  F+S++MYD+V+KN   F+V D
Sbjct  61   RYYGGGSSGHGADGGGMLRFHKRSSVDLISVPKDFAHFSSVHMYDVVIKNRESFRVID  118



>ref|XP_004134486.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Cucumis 
sativus]
 ref|XP_004159843.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Cucumis 
sativus]
 gb|KGN57101.1| hypothetical protein Csa_3G153750 [Cucumis sativus]
Length=113

 Score =   125 bits (314),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEH----GAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVW+F NGV RLVE   A      G + ++K L+Y PT + ++SY  LE  L+ LGWE
Sbjct  1    MSGVWIFDNGVIRLVERAGAAETTTSGGSGKRKVLIYTPTNEAMTSYEVLENKLSMLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             YY  D ++ QFHK SS+DLISLP+D+NK  + ++YDIVV+N NLFQV+D
Sbjct  61   VYYE-DGEVMQFHKPSSVDLISLPKDFNKLKARHLYDIVVRNRNLFQVKD  109



>ref|XP_006349809.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Solanum 
tuberosum]
Length=107

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVW+FKNGV RL ENP   H +++   +K LV++P+ +V++ Y  LE+ L  LGWERY
Sbjct  1    MSGVWIFKNGVVRL-ENPGDCHVSSTTGHRKVLVHVPSNEVITCYANLERKLYSLGWERY  59

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DP L Q+HK+S+I LISLP D+N+F SI+MYDIVVKN N F+VRD
Sbjct  60   YD-DPQLLQYHKRSTIHLISLPIDFNRFKSIHMYDIVVKNRNEFEVRD  106



>ref|XP_009775363.1| PREDICTED: flowering-promoting factor 1-like [Nicotiana sylvestris]
Length=111

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFKN-GVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVW  KN GV RLVENP+ E  +  RK K LV+LPT ++VSSY  LE+ILT LGWE+Y
Sbjct  1    MSGVWFSKNTGVIRLVENPSEEEQSIGRKRKVLVHLPTQEIVSSYNSLEKILTDLGWEKY  60

Query  274  YSG-DPDLFQFHKQSSIDL-ISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
              G DPD +QFHK++  DL ISLP+D+ KFN++ MYDIV K  ++F VR
Sbjct  61   DCGDDPDFYQFHKKTPTDLSISLPKDFAKFNTVQMYDIVFKTRHIFHVR  109



>gb|KEH37270.1| flowering-promoting factor-like protein [Medicago truncatula]
Length=112

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 79/110 (72%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK----KCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV RLV+   A  G         K LV+  + ++++SY  LE+ L+ LGWE
Sbjct  1    MSGVWVFKNGVVRLVDGVEAMEGGRQGSGGRRKVLVHTASNEIITSYAVLERKLSSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY  DPDL QFHK+S++ LISLP D+N+F S++MYDIVVKN N F+VR+
Sbjct  61   RYYD-DPDLLQFHKRSTVHLISLPMDFNRFKSMHMYDIVVKNKNSFEVRE  109



>ref|XP_009592496.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Nicotiana 
tomentosiformis]
Length=102

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RL +      G++ R+K LV++P+ +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLEDC----QGSSGRRKVLVHVPSNEVITSYAVLERKLHSLGWERYYD  56

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             D DL Q+HK+S++ LISLP+D+NK   ++MYDIVVKN N F+VRD
Sbjct  57   -DLDLLQYHKRSTVHLISLPKDFNKLKPMHMYDIVVKNRNEFEVRD  101



>gb|AAR97604.1| flowering promoting factor-like 1 [Nicotiana tabacum]
Length=102

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 5/106 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RL +      G++ R+K LV++P+ +V++SY  LE+ L  LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLEDC----QGSSGRRKVLVHVPSNEVITSYAVLERKLHSLGWERYYD  56

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             D DL Q+HK+S++ LISLP+D+NK   ++MYDIVVKN N F+VRD
Sbjct  57   -DLDLLQYHKRSTVHLISLPKDFNKLKPMHMYDIVVKNRNEFEVRD  101



>ref|XP_004143087.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Cucumis 
sativus]
 ref|XP_004160198.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Cucumis 
sativus]
 gb|KGN47183.1| hypothetical protein Csa_6G194670 [Cucumis sativus]
Length=112

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE------HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLG  261
            MSGVWVF+NGV RLVEN            +  R+K LV+  T +V++SY  LE+ L  LG
Sbjct  1    MSGVWVFRNGVVRLVENGGGSAAEGGGQQSQLRRKALVFSQTAEVMTSYAALEKKLVPLG  60

Query  262  WERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            WERYY  DP+L QFHK+S++ LISLP+D+ KF S++MYDIVVKN N F+V D
Sbjct  61   WERYYD-DPNLLQFHKRSTVHLISLPKDFAKFKSMHMYDIVVKNRNHFEVID  111



>emb|CDP16310.1| unnamed protein product [Coffea canephora]
Length=108

 Score =   123 bits (309),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS-RKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF NGV RL ENPA E G      + LV++ + +V++SY  LE  L  LGWER+Y
Sbjct  1    MSGVWVFNNGVVRLEENPAGEPGRLEWPSRVLVHVESNEVMASYGVLESKLLSLGWERFY  60

Query  277  SGDPDLFQFHKQSS-IDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DPDL QFH++SS +DLI LP+D+ +F S++MYDIV+KNPN F+VR+
Sbjct  61   D-DPDLLQFHRRSSPVDLICLPKDFKQFRSMHMYDIVIKNPNQFEVRE  107



>ref|XP_004979083.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Setaria 
italica]
Length=109

 Score =   123 bits (308),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAA--SRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVW FKNGV RL+E    + GAA    KK LV+ P+GQ V+S+  L++ L  LGWERY
Sbjct  1    MSGVWEFKNGVVRLLEKTTKQAGAAPCEGKKALVHTPSGQTVASHEALQRCLQQLGWERY  60

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y  DP L QFH++SS+DLISLP D+ +  +++MYDIVVKN + F V D 
Sbjct  61   YE-DPALVQFHRRSSVDLISLPADFARVGAVHMYDIVVKNRDYFTVVDA  108



>ref|XP_004252896.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Solanum 
lycopersicum]
Length=107

 Score =   123 bits (308),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS--RKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVW+FKNGV RL E P   H +++   +K LV++P+ +V++ Y  LE+ L  LGWERY
Sbjct  1    MSGVWIFKNGVVRL-ETPGDCHVSSTTGHRKVLVHVPSKEVITCYANLEKKLYSLGWERY  59

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  DP L Q+HK+S+I LISLP D+N+F SI+MYDIVVKN N F+VRD
Sbjct  60   YD-DPQLLQYHKRSTIHLISLPIDFNRFKSIHMYDIVVKNRNEFEVRD  106



>dbj|BAK05915.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CDM86034.1| unnamed protein product [Triticum aestivum]
Length=117

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVEN-PAAEHG----AASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF+NGV +LVEN PA+  G     A R+K L++ PTG+VV+SY  LE+ L  LGW
Sbjct  1    MSGVWVFRNGVVKLVENHPASAAGPPGGGAVRRKALLHTPTGEVVASYASLERKLVALGW  60

Query  265  ERYYSGDPD-----LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY+G        + +FHK+SS+DLISLP+D+ +F+S++MYD+V+KN + F+V D
Sbjct  61   ERYYAGGGGAAGDCMLRFHKRSSVDLISLPKDFGQFSSVHMYDVVIKNRDAFRVID  116



>gb|EMT29206.1| hypothetical protein F775_43014 [Aegilops tauschii]
Length=117

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 85/116 (73%), Gaps = 10/116 (9%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVEN-PAAEHG----AASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF+NGV +LVEN PA+  G     A R+K L++ PTG+VV+SY  LE+ L  LGW
Sbjct  1    MSGVWVFRNGVVKLVENHPASAAGPPGGGAVRRKALLHTPTGEVVASYASLERKLVALGW  60

Query  265  ERYYSGDPD-----LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY G        + +FHK+SS+DLISLP+D+ +F+S++MYD+V+KN + F+V D
Sbjct  61   ERYYVGGGGAAGDCMLRFHKRSSVDLISLPKDFGQFSSVHMYDVVIKNRDAFRVID  116



>gb|KHN26564.1| hypothetical protein glysoja_019803 [Glycine soja]
Length=105

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAA-EHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            M+ VWVFKNGV RL E P   EH     KK L +  + +V++SY  LE  L+ LGW RYY
Sbjct  1    MAEVWVFKNGVVRLEEKPCGYEHKVM--KKVLFHTASNEVITSYAVLEHKLSSLGWGRYY  58

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DPDL QFHK+S++ LISLPRD+NKF + + YDI+VKN N FQVRD
Sbjct  59   D-DPDLLQFHKRSTVHLISLPRDFNKFRATHRYDIIVKNQNCFQVRD  104



>gb|EMS50985.1| hypothetical protein TRIUR3_02177 [Triticum urartu]
Length=117

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 86/116 (74%), Gaps = 10/116 (9%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVEN-PAAEHG----AASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVF+NGV +LVEN PA+  G     A R+K L++ PTG+VV+SY  LE+ L  LGW
Sbjct  1    MSGVWVFRNGVVKLVENHPASAAGPPGGGAVRRKALLHTPTGEVVASYASLERKLLALGW  60

Query  265  ERYYSGDPD-----LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            ERYY+G        + +FHK+SS+DLISLP+D+ +F+S++MYD+V+KN + F+V D
Sbjct  61   ERYYAGGGGAAGDCMLRFHKRSSVDLISLPKDFGQFSSVHMYDVVIKNRDAFRVID  116



>gb|AFK44942.1| unknown [Medicago truncatula]
Length=112

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 81/110 (74%), Gaps = 5/110 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAA----EHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWE  267
            MSGVWVFKNGV RLV+   A      G+  R+K LV+  + ++++SY  LE+ L+ LGWE
Sbjct  1    MSGVWVFKNGVVRLVDGVEAMDGGRQGSGGRRKVLVHTASNEIITSYAVLERKLSSLGWE  60

Query  268  RYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            RYY  DPDL QFHK+S++ LISLP D+N+F S++MYDIVVK  N F+VR+
Sbjct  61   RYYD-DPDLLQFHKRSTVHLISLPMDFNRFKSMHMYDIVVKTKNSFEVRE  109



>ref|XP_009403049.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Musa 
acuminata subsp. malaccensis]
Length=106

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVFKNGV R  ENP       SR+ K LVYLPT +V++S   L   L  LGWE Y 
Sbjct  1    MSGVWVFKNGVVRR-ENPGGGDSIGSRRRKILVYLPTNEVITSNEMLATKLAELGWELYP  59

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            S  PDL QFHK+SS+ LIS+PRD+++F S++MYDIVVK  N+F+VRD 
Sbjct  60   S-TPDLVQFHKRSSVHLISVPRDFSRFTSVHMYDIVVKCRNVFEVRDA  106



>ref|XP_003533410.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Glycine 
max]
Length=105

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAA-EHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            M+ VWVFK GV RL E P   EH     KK L +  + +V++SY  LE  L+ LGW RYY
Sbjct  1    MAEVWVFKTGVVRLEEKPCGYEHKVM--KKVLFHTASNEVITSYAVLEHKLSSLGWGRYY  58

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              DPDL QFHK+S++ LISLPRD+NKF + + YDI+VKN N FQVRD
Sbjct  59   D-DPDLLQFHKRSTVHLISLPRDFNKFRATHRYDIIVKNQNCFQVRD  104



>ref|XP_008392931.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Malus 
domestica]
Length=101

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASR-KKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF NGV RLV+   +  G+ +R +K LV+ PT +V+SSY  LE  L+ LGWERYY
Sbjct  1    MSGVWVFNNGVVRLVDGANSLQGSNARARKVLVHTPTDEVISSYAVLECKLSTLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKN  393
              DPDL QFHK+S++ LISLP+D++KF S++MYDIVV +
Sbjct  61   D-DPDLLQFHKRSTVHLISLPKDFSKFKSMHMYDIVVNS  98



>emb|CDX85386.1| BnaC07g26970D [Brassica napus]
Length=102

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 9/108 (8%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHG--AASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVFKNG      NP A+      +++K LVY P+ +V++SY  L++ L  LGWERY
Sbjct  1    MSGVWVFKNG------NPGADETNIVKAKRKVLVYTPSNEVITSYSHLQRHLYALGWERY  54

Query  274  YSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y  +  L QFHK S++ LISLP D++KF S++MYDIVVKN N+FQVRD
Sbjct  55   YE-NAHLLQFHKASTVHLISLPTDFSKFKSMHMYDIVVKNRNMFQVRD  101



>ref|XP_004971177.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Setaria 
italica]
Length=111

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 81/110 (74%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKC--LVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVWVF+NGV RLVENP +   AA+  K   L++ P+G+VV+SY  LE+ L  LGWERY
Sbjct  1    MSGVWVFRNGVVRLVENPTSGAAAAASGKRKALLHTPSGEVVASYASLERKLAALGWERY  60

Query  274  YSGDP--DLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            Y G     + Q+HK++S+DLISLP+D+  F S++MYDIV+KN + F+V D
Sbjct  61   YGGGDGGSMLQYHKRTSVDLISLPKDFAHFGSVHMYDIVIKNRDAFRVID  110



>gb|EMT27717.1| hypothetical protein F775_43168 [Aegilops tauschii]
Length=107

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF+ G+ R  ++ A   G A+R  K LV++P+G+VV+SY  LE+ L  LGWERY 
Sbjct  1    MSGVWVFEGGMVRRADSEAPGTGGAARPGKVLVHVPSGEVVTSYEVLERRLRELGWERYL  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            + DP L QFH++S++ LIS+PRD+ +   ++M+D+VVK  N+FQVRD 
Sbjct  61   N-DPCLLQFHQRSTVHLISVPRDFARLKLVHMHDVVVKTRNVFQVRDA  107



>ref|XP_009608254.1| PREDICTED: flowering-promoting factor 1-like [Nicotiana tomentosiformis]
Length=111

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 4/109 (4%)
 Frame = +1

Query  100  MSGVWVFK-NGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERY  273
            MSGVW+ K   V RLVENP+ E  +  RK K L++LPT ++VSSY+ LE+ILT LGWE+Y
Sbjct  1    MSGVWLSKITEVIRLVENPSEEEQSNGRKRKVLIHLPTQEIVSSYKSLEKILTDLGWEKY  60

Query  274  YSG-DPDLFQFHKQSSIDL-ISLPRDYNKFNSIYMYDIVVKNPNLFQVR  414
                D D +QFHK++  DL ISLP+D+ KFN++ MYDIV K  ++F VR
Sbjct  61   IDECDTDSYQFHKKTPADLSISLPKDFAKFNTVQMYDIVFKTRHIFHVR  109



>ref|XP_004952424.1| PREDICTED: flowering-promoting factor 1-like protein 3-like [Setaria 
italica]
Length=112

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFK+G+ R VE+P  E      G   R+K LV++P+G+VV+SY  LE+ L  LGW
Sbjct  1    MSGVWVFKDGLVRRVEHPGQEDEGSLSGGGGRRKVLVHVPSGEVVTSYEVLERRLRELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            ERY + DP L  FH++S++ LIS+PRD+ +F  ++MYDIVVK  N+F+VRD 
Sbjct  61   ERYVN-DPCLLLFHQRSTVHLISVPRDFARFRLVHMYDIVVKTRNVFEVRDA  111



>gb|EMS56626.1| hypothetical protein TRIUR3_28721 [Triticum urartu]
Length=110

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 73/123 (59%), Gaps = 29/123 (24%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVFKNGV RLVENP +E              T  VVSSY  LE  LT LGWERYY 
Sbjct  1    MSGVWVFKNGVVRLVENPGSER-------------TSTVVSSYATLEAKLTALGWERYYE  47

Query  280  G----------------DPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
                             DP L+QFHK+  +DLISLPRD+N F+S++MYD+V+KN   F+V
Sbjct  48   DPALYQLTALGWERYYEDPALYQFHKRGCLDLISLPRDFNHFSSVHMYDVVIKNRESFRV  107

Query  412  RDG  420
             D 
Sbjct  108  VDA  110



>ref|XP_003573212.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Brachypodium 
distachyon]
Length=111

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 80/112 (71%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVE--NPAAEHGAAS---RKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            MSGVWVFK+G+ R VE  NP      +    R K LV++P+G+VV SY  LE+ L  LGW
Sbjct  1    MSGVWVFKDGIVRRVEKDNPGGSSSNSGSMGRPKVLVHVPSGEVVLSYDILERRLQELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            ERY + DP L QFH++S++ LIS+PRD+++F  ++MYDIVVK  N+F+VRD 
Sbjct  61   ERYLN-DPCLLQFHQRSTVHLISVPRDFSRFKLVHMYDIVVKTRNVFEVRDA  111



>ref|XP_007207669.1| hypothetical protein PRUPE_ppa023040mg [Prunus persica]
 gb|EMJ08868.1| hypothetical protein PRUPE_ppa023040mg [Prunus persica]
Length=126

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 77/122 (63%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F KNGV RL+ NP  E                 +R + LVYLP  QV+ SY  L
Sbjct  1    MSGVWIFDKNGVARLITNPTRESFEQKEPPYPGTATAPGARPRVLVYLPANQVIRSYSEL  60

Query  238  EQILTGLGWERY-YSGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW RY  S  PDL QFH+ +SS DLISLP ++  F S++MYDIVVKN + F+V
Sbjct  61   EQRLTELGWTRYPNSLRPDLLQFHRSESSADLISLPTNFANFKSLHMYDIVVKNRSFFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_003579379.1| PREDICTED: flowering-promoting factor 1-like protein 4 [Brachypodium 
distachyon]
Length=107

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            M+GVWVF++G+ R  E+ A     A+R  K LV++P+ +VV+SY  LE+ L  LGWERY 
Sbjct  1    MTGVWVFEDGILRRAESEAPGSSRAARPGKVLVHVPSSEVVTSYDVLERRLGELGWERYL  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            + DP L QFH++S++ LIS+PRD+ +   ++MYDIVVK  N+FQVRD 
Sbjct  61   N-DPCLLQFHQRSTVHLISVPRDFARIKLVHMYDIVVKTRNIFQVRDA  107



>dbj|BAJ90847.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=107

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF++G+ R  ++ A     A   K LV++P+G+VV+SY  LE+ L  LGWERY +
Sbjct  1    MSGVWVFEDGMVRRADSEAPGGAGARPGKVLVHVPSGEVVTSYDVLERRLRELGWERYLN  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
             DP L QFH++S++ LIS+PRD+ +   ++M+D+VVK  N+FQVRD 
Sbjct  61   -DPCLIQFHQRSTVHLISVPRDFARLKLVHMHDVVVKTRNVFQVRDA  106



>ref|XP_004143120.1| PREDICTED: flowering-promoting factor 1-like [Cucumis sativus]
 ref|XP_004166198.1| PREDICTED: flowering-promoting factor 1-like [Cucumis sativus]
 gb|KGN47144.1| hypothetical protein Csa_6G190350 [Cucumis sativus]
Length=131

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 75/122 (61%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVWVF KNGV RL+ NP  E                 +R + LVYLPT QV+ SY  L
Sbjct  1    MSGVWVFDKNGVARLISNPTRESFECKDPPHPGTATAPGARPRVLVYLPTNQVIRSYAEL  60

Query  238  EQILTGLGWERYYS-GDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ L  LGW RY +  +PDL QFH+   S  LISLP+ + KF  ++MYDIVVKN + FQV
Sbjct  61   EQRLAELGWTRYPNLAEPDLLQFHRSHDSAHLISLPKSFAKFKPMHMYDIVVKNRHFFQV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_002314177.2| hypothetical protein POPTR_0009s03690g [Populus trichocarpa]
 gb|EEE88132.2| hypothetical protein POPTR_0009s03690g [Populus trichocarpa]
Length=126

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 75/122 (61%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F KNGV RL+ NP  E                 +R + LVYLP   V+ SY  L
Sbjct  1    MSGVWIFDKNGVARLITNPTRESFEQKEPLHPGTATAPGARPRVLVYLPANHVIRSYTEL  60

Query  238  EQILTGLGWERYY-SGDPDLFQFHKQ-SSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ L  LGW RYY S  P+L QFHK  +S  LISLPRD++ F  ++MYDIVVKN + F+V
Sbjct  61   EQRLAELGWTRYYNSNQPNLLQFHKSDNSAHLISLPRDFDSFKPLHMYDIVVKNRSFFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_006645285.1| PREDICTED: flowering-promoting factor 1-like protein 2-like [Oryza 
brachyantha]
Length=119

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 12/118 (10%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS---RKKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVF+NGV +LVENP A    A+   R+K L++ P+G+VV+SY  LE+ L  LGWER
Sbjct  1    MSGVWVFRNGVVKLVENPPAAASNAAGGIRRKALLHTPSGEVVASYASLERKLAALGWER  60

Query  271  YYSGDPD---------LFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
            YYSG            + QFHK+SS DLISLP+D+ +F S++MYDIVVKN + F+V D
Sbjct  61   YYSGAAAAAGGAMAAPMLQFHKRSSGDLISLPKDFAQFGSVHMYDIVVKNRDAFRVID  118



>dbj|BAJ94687.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=107

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYS  279
            MSGVWVF++G+ R  ++ A     A   K LV++P+G+VV+SY  LE+ L  LGWERY +
Sbjct  1    MSGVWVFEDGMVRRADSEAPGGAGARPGKVLVHVPSGEVVTSYDVLERRLRELGWERYLN  60

Query  280  GDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
             DP L QFH++S++ LI +PRD+ +   ++M+D+VVK  N+FQVRD 
Sbjct  61   -DPCLIQFHQRSTVHLIPVPRDFARLKLVHMHDVVVKTRNVFQVRDA  106



>ref|NP_001148034.1| flowering promoting factor-like 1 [Zea mays]
 gb|ACG29528.1| flowering promoting factor-like 1 [Zea mays]
 tpg|DAA38420.1| TPA: flowering promoting factor-like 1 [Zea mays]
Length=112

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLV--ENPAAEHGAASR-KKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVF++G+ R    E P+      SR  K LV++P+G+VV+SY  LE+ L  LGWER
Sbjct  1    MSGVWVFEDGIVRRADSEPPSGAGAGGSRPNKVLVHVPSGEVVTSYEVLERRLRELGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y   DP L QFH++S++ LI++PRD+ +   ++MYD+VVK  N+F+VRD 
Sbjct  61   YLY-DPCLLQFHQRSTVHLITVPRDFARLKLVHMYDVVVKTRNVFEVRDA  109



>ref|XP_004975093.1| PREDICTED: flowering-promoting factor 1-like protein 4-like [Setaria 
italica]
Length=112

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 79/110 (72%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVE-NPAAEHGAASRK--KCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVF++G+ R  + +P +  GA   +  K LV++P+G+VV+SY  LE+ L  LGWER
Sbjct  1    MSGVWVFEDGIVRRADSDPPSGAGAGGSRPNKVLVHVPSGEVVTSYDVLERRLRELGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y   DP L QFHK+S++ LI++PRD+ +   ++MYD+VVK  N+F+VRD 
Sbjct  61   YLY-DPCLLQFHKRSTVHLITVPRDFARLKLVHMYDVVVKTRNVFEVRDA  109



>ref|XP_008802715.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Phoenix 
dactylifera]
Length=126

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 11/117 (9%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENP---AAEHGAAS-------RKKCLVYLPTGQVVSSYRCLEQIL  249
            MSGVWVF+NGV R +ENP   + E   AS       R+  LVY+PTG+VV S+  LE+ L
Sbjct  1    MSGVWVFRNGVARRIENPTRESLESATASAGGGGGGRRSELVYVPTGEVVGSHEELERRL  60

Query  250  TGLGWERYYSGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              LGW  Y +G P+L Q+H+  +S DLISLPR +    SI+MYDI VKN + F VRD
Sbjct  61   GELGWVPYLAGRPELIQYHRGAASPDLISLPRRFADLRSIHMYDIAVKNRSFFLVRD  117



>gb|AFW57920.1| hypothetical protein ZEAMMB73_461064 [Zea mays]
Length=112

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVE-NPAAEHGAASRK--KCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVF++G+ R  + +P +  GA   +  K LV++P+G+VV+SY  LE+ L  LGWER
Sbjct  1    MSGVWVFEDGIVRRADSDPPSGAGAGGSRPNKVLVHVPSGEVVTSYDVLERRLRELGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y   DP L QFH++S++ LI++PRD+++   ++MYD+VVK  N+F+VRD 
Sbjct  61   YLY-DPCLLQFHQRSTVHLITVPRDFSRLKLVHMYDVVVKTRNVFEVRDA  109



>ref|XP_010922314.1| PREDICTED: flowering-promoting factor 1-like protein 3 [Elaeis 
guineensis]
Length=127

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 11/117 (9%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAAS----------RKKCLVYLPTGQVVSSYRCLEQIL  249
            MSGVWVFKNGV R +ENP  E   ++          R+  LVY PTG++V S+  LE+ L
Sbjct  1    MSGVWVFKNGVARRIENPTRESFESAPASAGGGGGGRRSELVYAPTGELVGSHEELERRL  60

Query  250  TGLGWERYYSGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              LGW RY +G P+L Q+H+  +S DLISLPR +    SI+MYDI  KN + F VRD
Sbjct  61   GELGWVRYQAGRPELIQYHRGAASPDLISLPRRFADLRSIHMYDIAFKNRSFFLVRD  117



>ref|XP_002446220.1| hypothetical protein SORBIDRAFT_06g005000 [Sorghum bicolor]
 gb|EES10548.1| hypothetical protein SORBIDRAFT_06g005000 [Sorghum bicolor]
Length=112

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVEN--PAAEHGAASR-KKCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            MSGVWVF++G+ R  ++  P+      SR  K LV++P+G+VV+SY  LE+ L  LGWER
Sbjct  1    MSGVWVFEDGIVRRADSDPPSGAAAGGSRPNKVLVHVPSGEVVTSYDVLERRLRELGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y   DP L QFH++S++ LI++PRD+ +   ++MYD+VVK  N+F+VRD 
Sbjct  61   YLY-DPCLLQFHQRSTVHLITVPRDFGRLKLVHMYDVVVKTRNVFEVRDA  109



>ref|XP_006424840.1| hypothetical protein CICLE_v10030377mg [Citrus clementina]
 gb|ESR38080.1| hypothetical protein CICLE_v10030377mg [Citrus clementina]
 gb|KDO72841.1| hypothetical protein CISIN_1g048445mg [Citrus sinensis]
Length=138

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 76/124 (61%), Gaps = 18/124 (15%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVWVF KNGV RL++NP  E                 +R + LV+LPT QV+ SY  L
Sbjct  1    MSGVWVFDKNGVARLIQNPTKESFERKEPVQPGTATAPGARPRVLVFLPTNQVIRSYAEL  60

Query  238  EQILTGLGWERYY---SGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLF  405
            EQ LT LGW RY+   S    L QFHK + S  LISLP ++  F SI+MYDIVVKN + F
Sbjct  61   EQRLTELGWSRYHDNSSSSNRLLQFHKSEDSAHLISLPTNFANFRSIHMYDIVVKNRSFF  120

Query  406  QVRD  417
            +VRD
Sbjct  121  EVRD  124



>ref|XP_008358574.1| PREDICTED: flowering-promoting factor 1-like [Malus domestica]
Length=128

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH---------GAAS----RKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F +NGV RLV NP  E          G A+    R + LVYLP  QV+ SY  L
Sbjct  1    MSGVWIFDRNGVVRLVTNPTRESFEQKEPPHPGTATSPGARPRVLVYLPANQVIQSYSEL  60

Query  238  EQILTGLGWERY-YSGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW RY  S  PDL QFH+ ++S+ LISLP ++    S +MYDIVVKN + F+V
Sbjct  61   EQRLTELGWTRYPNSNRPDLLQFHRSENSVHLISLPNNFANLKSFHMYDIVVKNRSFFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_010257117.1| PREDICTED: flowering-promoting factor 1-like protein 2 [Nelumbo 
nucifera]
Length=125

 Score =   110 bits (276),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F K GV RL+ NP  E                 +R++ LVY+P+ QV+ SY  L
Sbjct  1    MSGVWIFNKKGVARLISNPTKESFEHKEPTVRGIATAPGARRRILVYIPSNQVIKSYAEL  60

Query  238  EQILTGLGWERYYSG-DPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            E  L  LGW+RY +G +PDL Q+H+ ++S+ LISLPR++  F S +MYDIVVKN + F+V
Sbjct  61   EHSLRELGWKRYDNGQNPDLIQYHRSETSVHLISLPRNFANFKSTHMYDIVVKNRSYFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_007150327.1| hypothetical protein PHAVU_005G144300g [Phaseolus vulgaris]
 gb|ESW22321.1| hypothetical protein PHAVU_005G144300g [Phaseolus vulgaris]
Length=129

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 76/122 (62%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVWVF KNGV RL+ NP  E                 +R + LVYLP+ QV+ SY  L
Sbjct  1    MSGVWVFDKNGVARLISNPTKESFEQKDPKHPGTATAPGARPRVLVYLPSNQVIRSYTEL  60

Query  238  EQILTGLGWERYYSGD-PDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            E+ LT LGW RY+  D  DL QFH+  +S  LISLPR+++ F + ++YDIVVKN   FQV
Sbjct  61   EERLTELGWTRYHDSDCSDLIQFHRSDTSSHLISLPRNFSNFKNFHLYDIVVKNRAFFQV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>gb|KDP20448.1| hypothetical protein JCGZ_05293 [Jatropha curcas]
Length=134

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 76/122 (62%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAE---------HGAAS----RKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F K GV RL  NP  E         HG A+    R + LVYLP  QV+ SY  L
Sbjct  1    MSGVWIFDKKGVARLRSNPTRESFEQKEPPPHGTATAPGARPRVLVYLPANQVIHSYTEL  60

Query  238  EQILTGLGWERYYS-GDPDLFQFHKQS-SIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ L  LGW RYY+   P+L QFHK   S DLISLP +++ F S +MYDIVVKN + F+V
Sbjct  61   EQRLLELGWTRYYNCSQPNLLQFHKSDHSADLISLPINFSNFKSFHMYDIVVKNRSFFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_007016400.1| FPF1-like protein 1 [Theobroma cacao]
 gb|EOY34019.1| FPF1-like protein 1 [Theobroma cacao]
Length=161

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 74/122 (61%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVWVF K GV RL+ NP  E                 +R + LVYLPT QV+SSY  L
Sbjct  38   MSGVWVFDKKGVARLITNPTKESFEQKDPIYPGTSTAPGARPRVLVYLPTNQVISSYAEL  97

Query  238  EQILTGLGWERYYS-GDPDLFQFHKQ-SSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ L  LGW RY +   PDL QFHK  +S  LISLPR++     ++MYDIVVKN + F+V
Sbjct  98   EQCLAELGWTRYNNISQPDLLQFHKSDASAHLISLPRNFANLRPMHMYDIVVKNRSFFEV  157

Query  412  RD  417
            RD
Sbjct  158  RD  159



>gb|KEH39443.1| flowering-promoting factor-like protein [Medicago truncatula]
Length=125

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 75/122 (61%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVWVF K GV RL+ NP  E                 +R + LVYLPT QV+ S+  L
Sbjct  1    MSGVWVFDKKGVVRLITNPTRESFEHKTEPGTGTATAPGARPRVLVYLPTNQVIHSFSQL  60

Query  238  EQILTGLGWERY-YSGDPDLFQFHKQ-SSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW RY +S  PD  QFH+  +S  L+SLPR++N F   +MYDIV++N + FQV
Sbjct  61   EQRLTELGWTRYSHSHLPDHIQFHRSDTSPHLLSLPRNFNSFKHFHMYDIVIQNRSFFQV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_008353230.1| PREDICTED: flowering-promoting factor 1-like protein 1 [Malus 
domestica]
Length=91

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 2/92 (2%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASR-KKCLVYLPTGQVVSSYRCLEQILTGLGWERYY  276
            MSGVWVF NGV RLV+   +  G+ +R +K LV+ PT +V+SSY  LE  L+ LGWERYY
Sbjct  1    MSGVWVFNNGVVRLVDGANSLQGSNARARKVLVHTPTDEVISSYAVLECKLSTLGWERYY  60

Query  277  SGDPDLFQFHKQSSIDLISLPRDYNKFNSIYM  372
              DPDL QFHK+S++ LISLP+D++KF S+++
Sbjct  61   D-DPDLLQFHKRSTVHLISLPKDFSKFKSMHI  91



>gb|EMT27194.1| hypothetical protein F775_17275 [Aegilops tauschii]
Length=109

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK---KCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            M+GVWVF++G  R  +N A   G  S     K LV++P+G+VV++Y  LE+ L  LGWER
Sbjct  1    MTGVWVFEDGSVRRADNEAPGRGGGSGARPGKVLVHVPSGEVVTTYDVLERRLRELGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y + D  L QFH++S++ LIS+PRD+ +   ++MYD+VVK  N+F+VRD 
Sbjct  61   YLN-DSCLLQFHQRSTVHLISVPRDFARLKLVHMYDVVVKTRNVFEVRDA  109



>ref|XP_008366315.1| PREDICTED: flowering-promoting factor 1-like [Malus domestica]
Length=125

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 76/123 (62%), Gaps = 16/123 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F ++GV RL+ NP  E                 +R + LVYLPT QV+ SY  L
Sbjct  1    MSGVWIFDEHGVVRLITNPTRESFEQKEPQNPGTATAPGARPRVLVYLPTNQVIRSYPEL  60

Query  238  EQILTGLGWERY-YSGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW RY  S  PDL QFH+ ++S+ LISLP+++    S  MYDIVVKN + F+V
Sbjct  61   EQRLTELGWTRYPNSCRPDLLQFHRSENSVHLISLPKNFANLKSFQMYDIVVKNRSFFEV  120

Query  412  RDG  420
            RD 
Sbjct  121  RDA  123



>ref|XP_004295909.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Fragaria 
vesca subsp. vesca]
Length=128

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 75/124 (60%), Gaps = 18/124 (15%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F KNGV RL+ NP  E                 +R + L+YLP  QV+ SY  L
Sbjct  1    MSGVWIFYKNGVTRLIPNPTRESFEQMEPPYPGTATAPGARPRVLIYLPANQVIRSYTEL  60

Query  238  EQILTGLGWERYYSGD---PDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLF  405
            EQ LT +GW RY       PDL QFH+ + S  LISLP ++++F S +MYDIVVKN + F
Sbjct  61   EQRLTEVGWTRYRPNSFCQPDLVQFHRSEHSAHLISLPANFDQFKSFHMYDIVVKNKSFF  120

Query  406  QVRD  417
            +VRD
Sbjct  121  EVRD  124



>ref|XP_009364435.1| PREDICTED: flowering-promoting factor 1-like [Pyrus x bretschneideri]
Length=128

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 74/122 (61%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F +NGV RLV NP  E                 +R + LVYLP  QV+ SY  L
Sbjct  1    MSGVWIFDRNGVVRLVTNPTRESFEQKEPPHPGTATAPGARPRVLVYLPANQVIQSYSEL  60

Query  238  EQILTGLGWERYY-SGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW  Y  S  PDL QFH+ ++S+ LISLP ++    S +MYDIVVKN + F+V
Sbjct  61   EQRLTELGWTPYRNSNRPDLLQFHRSENSVHLISLPNNFANMKSFHMYDIVVKNRSFFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>ref|XP_001773789.1| predicted protein [Physcomitrella patens]
 gb|EDQ61406.1| predicted protein [Physcomitrella patens]
Length=113

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 73/112 (65%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            M GVW+FK+G  +LVENP AE     +    R+K LV++ T + + +Y  LEQ L   GW
Sbjct  1    MGGVWIFKDGFTQLVENPLAEPLDGRNMTGVRRKVLVHVATNESIINYDQLEQKLREKGW  60

Query  265  ERYYSGDPDLFQFHKQSSI-DLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             RYY+GDP+L Q+HK     DLISLP+ +    +++MYDIVVK PN F VRD
Sbjct  61   TRYYAGDPNLRQYHKSDCTNDLISLPKSFAYIRTMHMYDIVVKVPNTFVVRD  112



>dbj|BAJ90965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=109

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 78/110 (71%), Gaps = 4/110 (4%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK---KCLVYLPTGQVVSSYRCLEQILTGLGWER  270
            M+GVWVF++G+ R  ++ A   G  S     K L+++P+G+VV+SY  LE+ L  LGWER
Sbjct  1    MTGVWVFEDGIVRRADSEAPSRGGGSGGRPGKVLMHVPSGEVVTSYDVLERRLGELGWER  60

Query  271  YYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            Y + DP L QFH++S++ LIS+PRD+ +   ++MYD+VVK  N+F+VRD 
Sbjct  61   YLN-DPCLLQFHQRSTVHLISVPRDFARLKLVHMYDVVVKTRNVFEVRDA  109



>emb|CAH66051.1| OSIGBa0131F24.5 [Oryza sativa Indica Group]
 gb|EAY93400.1| hypothetical protein OsI_15197 [Oryza sativa Indica Group]
Length=118

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 77/112 (69%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-----KCLVYLPTGQVVSSYRCLEQILTGLGW  264
            M+GVWVF++G+ R  ++ A   G          K LV++P+ +VV+SY  LE+ L  LGW
Sbjct  1    MAGVWVFEDGMVRRADSEAPSRGRGVGGGGGGGKVLVHVPSSEVVTSYEVLERRLRELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            ERY + DP L QFH++S++ LIS+PRD+++   ++MYD+VVK  N+F+VRD 
Sbjct  61   ERYLN-DPCLLQFHQRSTVHLISVPRDFSRLKLVHMYDVVVKTRNVFEVRDA  111



>ref|NP_001052368.1| Os04g0282400 [Oryza sativa Japonica Group]
 sp|Q0JEF5.1|FLP4_ORYSJ RecName: Full=Flowering-promoting factor 1-like protein 4; AltName: 
Full=FPF1-like protein 4 [Oryza sativa Japonica Group]
 dbj|BAF14282.1| Os04g0282400 [Oryza sativa Japonica Group]
 dbj|BAG99910.1| unnamed protein product [Oryza sativa Japonica Group]
Length=118

 Score =   106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 76/112 (68%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAEHGAASRK-----KCLVYLPTGQVVSSYRCLEQILTGLGW  264
            M+GVWVF++G+ R  ++ A   G          K LV++P+ +VV+SY  LE+ L  LGW
Sbjct  1    MAGVWVFEDGMVRRADSEAPSRGRGVGGGGGGGKVLVHVPSSEVVTSYEVLERRLRELGW  60

Query  265  ERYYSGDPDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            ERY   DP L QFH++S++ LIS+PRD+++   ++MYD+VVK  N+F+VRD 
Sbjct  61   ERYL-NDPCLLQFHQRSTVHLISVPRDFSRLKLVHMYDVVVKTRNVFEVRDA  111



>ref|XP_009619711.1| PREDICTED: flowering-promoting factor 1-like [Nicotiana tomentosiformis]
Length=127

 Score =   106 bits (265),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 75/126 (60%), Gaps = 22/126 (17%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH---------------GAASRKKCLVYLPTGQVVSSYR  231
            MSGVW+F K GV  L+ NP  E                   +R K LVYLP  QV+SSY 
Sbjct  1    MSGVWIFDKKGVAHLITNPTRESFELREPTYPGTGTATAPGARPKVLVYLPENQVISSYA  60

Query  232  CLEQILTGLGWERYYSGDP---DLFQFHKQS-SIDLISLPRDYNKFNSIYMYDIVVKNPN  399
             LE+IL  LGW RY   +P   D  QFHK   S  LISLP+ ++ F S++MYDIVVKNP+
Sbjct  61   GLEKILIELGWSRY--NNPIRSDFMQFHKSDDSAHLISLPKKFSNFKSLHMYDIVVKNPS  118

Query  400  LFQVRD  417
            LF+VR+
Sbjct  119  LFEVRE  124



>ref|XP_009353807.1| PREDICTED: flowering-promoting factor 1-like [Pyrus x bretschneideri]
Length=125

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 75/122 (61%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F ++GV RL+ NP  E                 +R + LVYLP  QV+ SY  L
Sbjct  1    MSGVWIFDEHGVVRLITNPTRESFEQKEPPNPGTATAPGARPRVLVYLPANQVIRSYPEL  60

Query  238  EQILTGLGWERY-YSGDPDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW RY  S  PDL QFH+ ++S+ LISLP+++    S  MYDIVVKN + F+V
Sbjct  61   EQRLTELGWTRYPNSCRPDLLQFHRSENSVHLISLPKNFANLKSFQMYDIVVKNRSFFEV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>gb|EMT26987.1| hypothetical protein F775_32604 [Aegilops tauschii]
Length=101

 Score =   105 bits (261),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 67/104 (64%), Gaps = 8/104 (8%)
 Frame = +1

Query  106  GVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYSGD  285
            GVWVFKNGV  L      E  A SRK  LVY+P  + + S   LEQ L  LGWERYY  D
Sbjct  5    GVWVFKNGVMEL------EQEATSRK-ALVYMPANETMRSLEALEQRLGSLGWERYYE-D  56

Query  286  PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
              + Q HK+  +DLISLPRD+++  S +MYD+VVKN + F+V D
Sbjct  57   RAIVQLHKRGGVDLISLPRDFSRLRSTHMYDVVVKNRDHFKVVD  100



>ref|XP_003542029.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Glycine 
max]
 gb|KHN30168.1| hypothetical protein glysoja_010546 [Glycine soja]
Length=137

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 73/122 (60%), Gaps = 16/122 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVWVF K GV RL+ NP  E                 +R + LVYLP+ QV+ SY  L
Sbjct  1    MSGVWVFDKKGVARLITNPTRESFEQKEPRQPGTATAPGARPRVLVYLPSNQVIRSYAEL  60

Query  238  EQILTGLGWERYYSGD-PDLFQFHK-QSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ LT LGW RY   D  DL QFH+  +S  LISLP++++ F   + YDIVVKN + FQV
Sbjct  61   EQRLTELGWTRYRDSDRSDLIQFHRSDTSSHLISLPKNFSNFKHFHFYDIVVKNRSFFQV  120

Query  412  RD  417
            RD
Sbjct  121  RD  122



>emb|CDP09062.1| unnamed protein product [Coffea canephora]
Length=139

 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 74/123 (60%), Gaps = 16/123 (13%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAEH-------------GAASRKKCLVYLPTGQVVSSYRCL  237
            MSGVW+F K GV RL+ NP  E                 +R K LVYLP+ QV+ SY  L
Sbjct  1    MSGVWIFDKKGVARLITNPTRESFEQLNPTYPGTPTSPGARPKVLVYLPSNQVIRSYTEL  60

Query  238  EQILTGLGWERYYSGD-PDLFQFHKQS-SIDLISLPRDYNKFNSIYMYDIVVKNPNLFQV  411
            EQ L  LGW RY++ +  DL QFH+   S  LISLP+ +  F S++MYDIVVKN + F+V
Sbjct  61   EQRLEELGWTRYHNPNRSDLLQFHRSDDSAHLISLPKSFANFKSLHMYDIVVKNRSFFEV  120

Query  412  RDG  420
            RD 
Sbjct  121  RDS  123



>gb|EMS49142.1| hypothetical protein TRIUR3_19497 [Triticum urartu]
Length=113

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 74/105 (70%), Gaps = 2/105 (2%)
 Frame = +1

Query  109  VWVFKNGVYRLVENPAAEHGAASRK-KCLVYLPTGQVVSSYRCLEQILTGLGWERYYSGD  285
            V V + G+ R  ++ A   G A+R  K LV++P+G+VVSSY  LE+ L  LGWERY + D
Sbjct  10   VVVAEGGMVRRADSEAPGAGGAARPGKVLVHVPSGEVVSSYEVLERRLRELGWERYLN-D  68

Query  286  PDLFQFHKQSSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            P L QFH++S++ LIS+PRD+ +   ++M+D+VVK  N+FQVRD 
Sbjct  69   PCLLQFHQRSTVHLISVPRDFARLKLVHMHDVVVKTRNVFQVRDA  113



>ref|XP_004487001.1| PREDICTED: flowering-promoting factor 1-like protein 1-like [Cicer 
arietinum]
Length=136

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 77/129 (60%), Gaps = 23/129 (18%)
 Frame = +1

Query  100  MSGVWVF-KNGVYRLVENPAAE----------HGAAS----RKKCLVYLPTGQVVSSYRC  234
            MSGVWVF K GV RL+ NP  E           G A+    R + LVYLPT QV+ S+  
Sbjct  1    MSGVWVFDKKGVARLISNPTRESFELKTEQTQQGTATAPGARPRLLVYLPTNQVIHSFSQ  60

Query  235  LEQILTGLGWERYYSG------DPDLFQFHKQ--SSIDLISLPRDYNKFNSIYMYDIVVK  390
            LEQIL  LGW RY +        PDL QFH+   S+  L+SLP++++ F   +MYDIV++
Sbjct  61   LEQILIQLGWTRYTNSLNQPPPPPDLIQFHRSDTSTHYLLSLPKNFSSFKHFHMYDIVIQ  120

Query  391  NPNLFQVRD  417
            N + FQVRD
Sbjct  121  NRSFFQVRD  129



>ref|XP_006846210.1| hypothetical protein AMTR_s00012p00223910 [Amborella trichopoda]
 gb|ERN07885.1| hypothetical protein AMTR_s00012p00223910 [Amborella trichopoda]
Length=131

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 77/128 (60%), Gaps = 22/128 (17%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-----------------HGAASRKKCLVYLPTGQVVSSY  228
            MSGVWVF+NGV +LV NP  E                     S+K+ L++LP+ QV+  Y
Sbjct  1    MSGVWVFRNGVAKLVSNPNVEPLDWPEPSSSSSSSSSHRLGGSKKRVLLHLPSNQVIGCY  60

Query  229  RCLEQILTGLGWERYYS----GDPDLFQFHKQS-SIDLISLPRDYNKFNSIYMYDIVVKN  393
              LE+ L   GWERYY        D+ QFH+ + S+DLI+LPRD++ F S +M+DIVVKN
Sbjct  61   AELEERLKQHGWERYYPLGQRARADVIQFHRSAASVDLITLPRDFSHFKSTHMFDIVVKN  120

Query  394  PNLFQVRD  417
             + F+V+D
Sbjct  121  RSFFEVQD  128



>ref|XP_008653451.1| PREDICTED: flowering-promoting factor 1-like protein 5 [Zea mays]
 tpg|DAA64070.1| TPA: hypothetical protein ZEAMMB73_986702 [Zea mays]
Length=107

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = +1

Query  103  SGVWVFKNGVYRLVENPAAEHGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGWERYYSG  282
            SGVWVFKNGV +L E PAA   AASRK  LVY+PT +VV S   LE+ L  LGWERYY  
Sbjct  7    SGVWVFKNGVMQL-EQPAA---AASRK-ALVYVPTNEVVRSVEALERRLGTLGWERYYE-  60

Query  283  DPDLFQFHKQ-SSIDLISLPRDYNKFNSIYMYDIVVKNPNLFQVRDG  420
            +  + Q HK+    DLI++PRD+    S +MYD+VVKN + F+V D 
Sbjct  61   NRSIVQLHKRDGGADLITIPRDFASLRSTHMYDVVVKNRDHFKVVDA  107



>ref|XP_001781285.1| predicted protein [Physcomitrella patens]
 gb|EDQ53901.1| predicted protein [Physcomitrella patens]
Length=113

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 71/112 (63%), Gaps = 6/112 (5%)
 Frame = +1

Query  100  MSGVWVFKNGVYRLVENPAAE-----HGAASRKKCLVYLPTGQVVSSYRCLEQILTGLGW  264
            M GVW+FK G  +LVENP AE     +    R+K LV++ T   +++Y  LE+ L   GW
Sbjct  1    MGGVWMFKEGFTQLVENPLAEPLDGRNMTGVRRKVLVHVATNGAITNYDQLEEKLREKGW  60

Query  265  ERYYSGDPDLFQFHKQSSI-DLISLPRDYNKFNSIYMYDIVVKNPNLFQVRD  417
             RYY+GD +L Q+HK     DLISLP+ +    +++MYDIVVK PN F VRD
Sbjct  61   TRYYAGDSNLRQYHKSDCTNDLISLPKSFAYIKTMHMYDIVVKVPNTFVVRD  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1009851894054