BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78747_g1_i1 len=1054 path=[1:0-1053]

Length=1054
                                                                      Score     E

ref|XP_011071393.1|  PREDICTED: outer envelope pore protein 16-2,...    238   8e-74   
emb|CDO98781.1|  unnamed protein product                                228   3e-69   
ref|XP_011100784.1|  PREDICTED: outer envelope pore protein 16-2,...    226   5e-69   
gb|EYU45503.1|  hypothetical protein MIMGU_mgv1a015003mg                223   6e-68   
ref|XP_009789603.1|  PREDICTED: outer envelope pore protein 16-2,...    222   8e-68   
ref|XP_009601372.1|  PREDICTED: outer envelope pore protein 16-2,...    222   9e-68   
ref|XP_004229002.1|  PREDICTED: outer envelope pore protein 16-2,...    219   9e-67   
gb|EYU44015.1|  hypothetical protein MIMGU_mgv1a014750mg                219   1e-66   
ref|XP_006355389.1|  PREDICTED: outer envelope pore protein 16-2,...    219   2e-66   
ref|XP_002519203.1|  protein translocase, putative                      218   8e-66   Ricinus communis
ref|XP_010063276.1|  PREDICTED: outer envelope pore protein 16-2,...    217   1e-65   
ref|XP_002276934.1|  PREDICTED: outer envelope pore protein 16-2,...    213   3e-64   Vitis vinifera
ref|XP_007227528.1|  hypothetical protein PRUPE_ppa012201mg             211   2e-63   
ref|XP_003533195.1|  PREDICTED: outer envelope pore protein 16-2,...    211   2e-63   
ref|XP_006419410.1|  hypothetical protein CICLE_v10006030mg             211   2e-63   
gb|KDP27896.1|  hypothetical protein JCGZ_18976                         211   3e-63   
ref|XP_011010062.1|  PREDICTED: outer envelope pore protein 16-2,...    210   7e-63   
ref|XP_009369946.1|  PREDICTED: outer envelope pore protein 16-2,...    209   9e-63   
ref|XP_008390546.1|  PREDICTED: outer envelope pore protein 16-2,...    209   1e-62   
ref|XP_008223316.1|  PREDICTED: outer envelope pore protein 16-2,...    209   1e-62   
ref|XP_002314929.1|  mitochondrial import inner membrane transloc...    208   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_004487776.1|  PREDICTED: outer envelope pore protein 16-2,...    208   2e-62   
ref|XP_010094311.1|  hypothetical protein L484_007726                   208   3e-62   
gb|KDO71888.1|  hypothetical protein CISIN_1g036913mg                   208   3e-62   
ref|XP_002312339.1|  hypothetical protein POPTR_0008s10670g             207   4e-62   Populus trichocarpa [western balsam poplar]
gb|AES91953.2|  outer envelope pore protein                             207   6e-62   
ref|XP_008786243.1|  PREDICTED: outer envelope pore protein 16-2,...    206   1e-61   
ref|XP_010921504.1|  PREDICTED: outer envelope pore protein 16-2,...    206   2e-61   
ref|XP_008781093.1|  PREDICTED: outer envelope pore protein 16-2,...    204   6e-61   
ref|XP_010259322.1|  PREDICTED: outer envelope pore protein 16-2,...    204   1e-60   
ref|XP_011020263.1|  PREDICTED: outer envelope pore protein 16-2,...    203   3e-60   
ref|XP_004295096.1|  PREDICTED: outer envelope pore protein 16-2,...    203   4e-60   
ref|NP_001237610.1|  uncharacterized protein LOC100305849               202   5e-60   
ref|XP_008340618.1|  PREDICTED: outer envelope pore protein 16-2,...    202   7e-60   
ref|XP_003529533.1|  PREDICTED: outer envelope pore protein 16-2,...    201   2e-59   
ref|XP_003594780.1|  hypothetical protein MTR_2g034550                  201   2e-59   
ref|XP_009416248.1|  PREDICTED: outer envelope pore protein 16-2,...    200   3e-59   
ref|XP_007138986.1|  hypothetical protein PHAVU_009G255100g             200   5e-59   
ref|XP_010548992.1|  PREDICTED: outer envelope pore protein 16-2,...    200   5e-59   
ref|XP_010548993.1|  PREDICTED: outer envelope pore protein 16-2,...    198   2e-58   
ref|XP_004508261.1|  PREDICTED: outer envelope pore protein 16-2,...    198   2e-58   
ref|XP_003609756.1|  hypothetical protein MTR_4g121900                  198   4e-58   
gb|AFK34430.1|  unknown                                                 194   6e-57   
ref|XP_011010074.1|  PREDICTED: outer envelope pore protein 16-2,...    192   1e-56   
gb|KFK23123.1|  hypothetical protein AALP_AAs72355U000300               193   2e-56   
gb|KHG27138.1|  Outer envelope pore 16-2, chloroplastic -like pro...    193   3e-56   
ref|XP_009146383.1|  PREDICTED: outer envelope pore protein 16-2,...    191   1e-55   
emb|CDY34437.1|  BnaC01g21960D                                          191   1e-55   
ref|XP_007035757.1|  Mitochondrial import inner membrane transloc...    189   4e-55   
gb|KFK23122.1|  hypothetical protein AALP_AAs72355U000300               189   4e-55   
ref|XP_006419409.1|  hypothetical protein CICLE_v10006030mg             189   4e-55   
ref|XP_010524578.1|  PREDICTED: outer envelope pore protein 16-2,...    189   9e-55   
ref|XP_002870177.1|  ATOEP16-2/ATOEP16-S                                189   1e-54   
ref|XP_008458360.1|  PREDICTED: outer envelope pore protein 16-2,...    187   3e-54   
gb|AAV84280.1|  dehydration up-regulated putative membrane pore p...    187   4e-54   Xerophyta humilis
ref|XP_004172663.1|  PREDICTED: outer envelope pore protein 16-2,...    188   7e-54   
gb|KGN47380.1|  hypothetical protein Csa_6G307410                       188   9e-54   
ref|NP_849394.1|  outer envelope pore protein 16-2                      186   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107889.1|  PREDICTED: outer envelope pore protein 16-2,...    185   2e-53   
ref|XP_010434869.1|  PREDICTED: outer envelope pore protein 16-2,...    185   2e-53   
ref|XP_010440195.1|  PREDICTED: outer envelope pore protein 16-2,...    184   3e-53   
gb|AEV46836.1|  plastid OEP16.2                                         185   3e-53   
ref|XP_004148230.1|  PREDICTED: outer envelope pore protein 16-2,...    187   4e-53   
emb|CDY09710.1|  BnaC07g33510D                                          182   2e-52   
ref|XP_009136748.1|  PREDICTED: outer envelope pore protein 16-2,...    182   2e-52   
ref|NP_567488.1|  outer envelope pore protein 16-2                      182   3e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90540.1|  BnaA03g42410D                                          182   3e-52   
ref|XP_010434870.1|  PREDICTED: outer envelope pore protein 16-2,...    182   4e-52   
ref|XP_010440196.1|  PREDICTED: outer envelope pore protein 16-2,...    181   5e-52   
ref|XP_006414382.1|  hypothetical protein EUTSA_v10026380mg             181   5e-52   
ref|NP_001049884.1|  Os03g0305600                                       181   1e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984632.1|  PREDICTED: outer envelope pore protein 16-2,...    180   3e-51   
ref|XP_006282840.1|  hypothetical protein CARUB_v10006765mg             179   3e-51   
gb|EAY89687.1|  hypothetical protein OsI_11222                          179   7e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006651306.1|  PREDICTED: outer envelope pore protein 16-2,...    176   1e-49   
gb|EPS72464.1|  hypothetical protein M569_02294                         174   4e-49   
ref|XP_007035758.1|  Mitochondrial import inner membrane transloc...    175   5e-49   
gb|ACG48163.1|  hypothetical protein                                    173   7e-49   Zea mays [maize]
gb|EPS58527.1|  hypothetical protein M569_16286                         173   7e-49   
ref|XP_010671676.1|  PREDICTED: outer envelope pore protein 16-2,...    171   1e-47   
ref|XP_003558089.1|  PREDICTED: outer envelope pore protein 16-2,...    168   8e-47   
ref|XP_010228715.1|  PREDICTED: outer envelope pore protein 16-2,...    167   1e-46   
ref|XP_003567585.1|  PREDICTED: outer envelope pore protein 16-2,...    166   4e-46   
ref|NP_001142523.1|  uncharacterized protein LOC100274762               166   7e-46   Zea mays [maize]
dbj|BAJ86836.1|  predicted protein                                      164   2e-45   
gb|ACG25972.1|  hypothetical protein                                    163   6e-45   Zea mays [maize]
gb|EMS68749.1|  hypothetical protein TRIUR3_14005                       162   3e-44   
ref|XP_006839205.1|  hypothetical protein AMTR_s02234p00007680          156   1e-42   
emb|CAB10395.1|  pore protein homolog                                   150   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EMS47409.1|  hypothetical protein TRIUR3_06756                       149   3e-39   
gb|EAZ26649.1|  hypothetical protein OsJ_10553                          147   3e-39   Oryza sativa Japonica Group [Japonica rice]
gb|ADK88900.1|  outer membrane channel protein OEP16-2                  147   1e-38   
gb|AAL23749.1|  stress-inducible membrane pore protein                  143   1e-37   Bromus inermis [awnless brome grass]
ref|NP_001152606.1|  LOC100286246                                       141   1e-36   Zea mays [maize]
ref|XP_006645799.1|  PREDICTED: outer envelope pore protein 16-2,...    132   4e-33   
gb|EEC70487.1|  hypothetical protein OsI_01558                          130   8e-33   Oryza sativa Indica Group [Indian rice]
emb|CAK26794.1|  hypothetical protein                                   129   9e-33   Sporobolus stapfianus [resurrection grass]
gb|EMT25997.1|  hypothetical protein F775_27388                         131   7e-32   
ref|XP_004967558.1|  PREDICTED: outer envelope pore protein 16-2,...    128   9e-32   
dbj|BAB20636.1|  putative stress-inducible membrane pore protein        129   4e-31   Oryza sativa Japonica Group [Japonica rice]
gb|AAT45008.1|  stress-inducible membrane pore-like protein             119   5e-29   Xerophyta humilis
ref|XP_001761140.1|  predicted protein                                  116   1e-27   
ref|XP_001774786.1|  predicted protein                                  112   4e-26   
ref|XP_001772989.1|  predicted protein                                  112   5e-26   
ref|XP_002963833.1|  hypothetical protein SELMODRAFT_438581             110   1e-25   
ref|XP_002984416.1|  hypothetical protein SELMODRAFT_423634             106   3e-24   
ref|XP_002972844.1|  hypothetical protein SELMODRAFT_413476             105   6e-24   
emb|CDY22776.1|  BnaA08g06060D                                          104   3e-23   
ref|XP_001764509.1|  predicted protein                                90.1    2e-18   
ref|XP_002971785.1|  hypothetical protein SELMODRAFT_441602           90.5    6e-18   
gb|ABK21269.1|  unknown                                               87.0    4e-17   Picea sitchensis
ref|XP_001779980.1|  predicted protein                                84.7    2e-16   
ref|XP_002972971.1|  hypothetical protein SELMODRAFT_413325           80.9    7e-15   
gb|EEC72263.1|  hypothetical protein OsI_05414                        80.5    7e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_002457029.1|  hypothetical protein SORBIDRAFT_03g047420        79.7    1e-14   Sorghum bicolor [broomcorn]
ref|XP_006846173.1|  hypothetical protein AMTR_s00012p00202200        80.1    1e-14   
tpg|DAA54342.1|  TPA: putative mitochondrial import inner membran...  78.6    1e-14   
ref|XP_006645400.1|  PREDICTED: outer envelope pore protein 16, c...  79.0    2e-14   
ref|XP_009345977.1|  PREDICTED: outer envelope pore protein 16, c...  79.0    4e-14   
gb|ABR16919.1|  unknown                                               78.6    4e-14   Picea sitchensis
ref|XP_002532855.1|  conserved hypothetical protein                   77.8    6e-14   Ricinus communis
ref|NP_001054446.1|  Os05g0111200                                     77.8    7e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971437.1|  PREDICTED: outer envelope pore protein 16, c...  77.8    1e-13   
gb|KFK32251.1|  hypothetical protein AALP_AA6G217900                  77.4    1e-13   
gb|EMT26097.1|  hypothetical protein F775_31817                       77.0    1e-13   
ref|XP_006653965.1|  PREDICTED: outer envelope pore protein 16, c...  77.0    1e-13   
gb|KDP34497.1|  hypothetical protein JCGZ_11047                       76.6    2e-13   
gb|KFK32252.1|  hypothetical protein AALP_AA6G218100                  76.3    2e-13   
dbj|BAJ89521.1|  predicted protein                                    76.3    3e-13   
ref|XP_010252115.1|  PREDICTED: outer envelope pore protein 16, c...  75.5    4e-13   
ref|XP_003569082.1|  PREDICTED: outer envelope pore protein 16, c...  75.5    5e-13   
gb|EMT04893.1|  hypothetical protein F775_26935                       75.1    6e-13   
ref|XP_009345978.1|  PREDICTED: outer envelope pore protein 16, c...  75.1    7e-13   
emb|CAA09867.1|  amino acid selective channel protein                 74.7    8e-13   Hordeum vulgare [barley]
ref|XP_006295178.1|  hypothetical protein CARUB_v10024257mg           74.7    1e-12   
ref|XP_010521840.1|  PREDICTED: outer envelope pore protein 16, c...  74.7    1e-12   
gb|EMS53533.1|  hypothetical protein TRIUR3_34729                     75.1    1e-12   
ref|XP_009380643.1|  PREDICTED: outer envelope pore protein 16, c...  74.3    1e-12   
ref|XP_001777747.1|  predicted protein                                74.3    2e-12   
ref|XP_010676722.1|  PREDICTED: outer envelope pore protein 16, c...  73.9    2e-12   
ref|XP_001784797.1|  predicted protein                                73.9    2e-12   
ref|XP_010470028.1|  PREDICTED: outer envelope pore protein 16-1,...  74.3    2e-12   
ref|XP_004960518.1|  PREDICTED: outer envelope pore protein 16, c...  73.2    4e-12   
ref|XP_006409925.1|  hypothetical protein EUTSA_v10017379mg           72.8    5e-12   
ref|XP_009353670.1|  PREDICTED: outer envelope pore protein 16, c...  72.4    6e-12   
ref|XP_010510565.1|  PREDICTED: outer envelope pore protein 16-1,...  72.4    6e-12   
ref|XP_002439146.1|  hypothetical protein SORBIDRAFT_09g001310        71.6    1e-11   Sorghum bicolor [broomcorn]
ref|XP_009588682.1|  PREDICTED: outer envelope pore protein 16, c...  71.6    1e-11   
ref|XP_010414466.1|  PREDICTED: outer envelope pore protein 16-1,...  71.2    2e-11   
ref|XP_010470029.1|  PREDICTED: outer envelope pore protein 16-1,...  70.9    2e-11   
ref|XP_010033127.1|  PREDICTED: outer envelope pore protein 16, c...  70.9    2e-11   
gb|KDO72851.1|  hypothetical protein CISIN_1g036056mg                 70.5    4e-11   
ref|XP_006424826.1|  hypothetical protein CICLE_v10029517mg           70.1    5e-11   
ref|XP_009124363.1|  PREDICTED: outer envelope pore protein 16-1,...  69.7    7e-11   
gb|AAM60853.1|  putative membrane channel protein                     68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180456.1|  outer plastid envelope protein 16-1                 68.6    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881019.1|  hypothetical protein ARALYDRAFT_481805           68.6    2e-10   
ref|NP_001275376.1|  uncharacterized protein LOC102589399             68.2    2e-10   
ref|NP_001151965.1|  amino acid selective channel protein             68.2    2e-10   Zea mays [maize]
emb|CDY39514.1|  BnaC04g15130D                                        68.2    2e-10   
ref|XP_009353668.1|  PREDICTED: outer envelope pore protein 16, c...  67.0    6e-10   
ref|XP_004294566.1|  PREDICTED: outer envelope pore protein 16, c...  67.0    6e-10   
ref|XP_002963437.1|  hypothetical protein SELMODRAFT_141946           66.6    8e-10   
ref|XP_009353669.1|  PREDICTED: outer envelope pore protein 16, c...  66.6    9e-10   
ref|XP_002283749.1|  PREDICTED: outer envelope pore protein 16, c...  65.1    2e-09   Vitis vinifera
ref|XP_002298357.1|  mitochondrial import inner membrane transloc...  65.1    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009364401.1|  PREDICTED: outer envelope pore protein 16, c...  64.7    3e-09   
ref|XP_008357200.1|  PREDICTED: outer envelope pore protein 16, c...  64.7    3e-09   
gb|ACG31308.1|  amino acid selective channel protein                  64.7    4e-09   Zea mays [maize]
ref|XP_007016421.1|  Outer plastid envelope protein 16-1              64.7    4e-09   
emb|CDP09055.1|  unnamed protein product                              64.7    4e-09   
gb|EMT26096.1|  hypothetical protein F775_31816                       65.9    5e-09   
ref|XP_004297040.1|  PREDICTED: outer envelope pore protein 16-1,...  63.9    6e-09   
gb|AFK39847.1|  unknown                                               63.9    6e-09   
ref|XP_004297039.1|  PREDICTED: outer envelope pore protein 16-1,...  63.9    7e-09   
gb|KEH39435.1|  outer envelope pore protein                           63.9    7e-09   
ref|XP_009341406.1|  PREDICTED: outer envelope pore protein 16, c...  63.5    1e-08   
gb|AGC51779.1|  plastid 16-KDa outer membrane protein                 63.2    1e-08   
ref|XP_011035319.1|  PREDICTED: outer envelope pore protein 16, c...  63.2    1e-08   
gb|ACJ83919.1|  unknown                                               62.8    2e-08   Medicago truncatula
ref|XP_004167617.1|  PREDICTED: outer envelope pore protein 16, c...  62.4    2e-08   
ref|XP_007206105.1|  hypothetical protein PRUPE_ppa012989mg           62.4    2e-08   
ref|XP_010937628.1|  PREDICTED: outer envelope pore protein 16, c...  62.0    2e-08   
ref|XP_008223554.1|  PREDICTED: outer envelope pore protein 16, c...  62.4    2e-08   
emb|CBI16133.3|  unnamed protein product                              61.2    5e-08   
ref|XP_010937629.1|  PREDICTED: outer envelope pore protein 16, c...  60.1    1e-07   
ref|XP_004487008.1|  PREDICTED: outer envelope pore protein 16, c...  60.1    1e-07   
ref|NP_001235311.1|  uncharacterized protein LOC100499736             59.7    2e-07   
ref|NP_001042833.2|  Os01g0303300                                     58.9    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHN30171.1|  Outer envelope pore protein 16, chloroplastic         59.3    3e-07   
ref|NP_001238155.1|  uncharacterized protein LOC100499674             59.3    3e-07   
gb|KHN43721.1|  Outer envelope pore protein 16, chloroplastic         58.9    3e-07   
gb|EYU18967.1|  hypothetical protein MIMGU_mgv1a015773mg              58.9    3e-07   
ref|NP_001241534.1|  uncharacterized protein LOC100796140             58.9    4e-07   
sp|Q41050.1|OEP16_PEA  RecName: Full=Outer envelope pore protein ...  58.9    4e-07   Pisum sativum [garden pea]
ref|XP_006596957.1|  PREDICTED: uncharacterized protein LOC100499...  58.5    6e-07   
ref|XP_009783659.1|  PREDICTED: outer envelope pore protein 16, c...  57.4    9e-07   
gb|EPS67531.1|  hypothetical protein M569_07245                       57.4    1e-06   
gb|KHG02971.1|  Outer envelope pore 16, chloroplastic                 57.0    2e-06   
ref|XP_008457483.1|  PREDICTED: outer envelope pore protein 16, c...  57.0    2e-06   
ref|XP_006361206.1|  PREDICTED: outer envelope pore protein 16, c...  56.2    2e-06   
ref|XP_009399869.1|  PREDICTED: outer envelope pore protein 16, c...  56.2    2e-06   
gb|AFK43169.1|  unknown                                               55.5    4e-06   
gb|KHG03976.1|  smek1                                                 58.5    5e-06   
emb|CDO98780.1|  unnamed protein product                              53.1    1e-05   
ref|XP_008784573.1|  PREDICTED: outer envelope pore protein 16, c...  53.5    2e-05   
ref|XP_010920590.1|  PREDICTED: outer envelope pore protein 16, c...  53.1    3e-05   
ref|XP_010252116.1|  PREDICTED: outer envelope pore protein 16, c...  53.5    3e-05   
gb|KEH39438.1|  outer envelope pore protein                           51.6    7e-05   
gb|KGN65718.1|  hypothetical protein Csa_1G515470                     51.2    1e-04   
ref|XP_010253167.1|  PREDICTED: outer envelope pore protein 16, c...  50.4    2e-04   
ref|XP_004960520.1|  PREDICTED: outer envelope pore protein 16, c...  51.6    2e-04   
ref|XP_008656555.1|  PREDICTED: outer envelope pore protein 16, c...  50.4    3e-04   
ref|XP_007150324.1|  hypothetical protein PHAVU_005G144000g           50.4    3e-04   
ref|XP_004151033.1|  PREDICTED: LOW QUALITY PROTEIN: outer envelo...  50.4    4e-04   
ref|XP_008784575.1|  PREDICTED: outer envelope pore protein 16, c...  49.7    6e-04   



>ref|XP_011071393.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Sesamum indicum]
Length=181

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 155/184 (84%), Gaps = 8/184 (4%)
 Frame = -3

Query  809  RMSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYF  630
            RMS +NLE R +L DE+RS D G  G FDLGHPLLNR+A+SF+KAAGIGAVQAV+R AYF
Sbjct  2    RMSGSNLETR-SLIDELRSFDSG--GFFDLGHPLLNRVAESFIKAAGIGAVQAVSRHAYF  58

Query  629  TAVEGASRDTP----PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGV  462
            TAVE A  D      PE+GG+K HH  P  L+G N++ SVEAL+K+TGKESMQWG AAGV
Sbjct  59   TAVESAGGDVGGSILPEVGGSKKHHRIPD-LRGENSQKSVEALVKSTGKESMQWGLAAGV  117

Query  461  YSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            YSGLTYGL+EARGVHDW+NSALAGAITGAALA+TT DHSH+ V+QCAITGAAISTAANLL
Sbjct  118  YSGLTYGLKEARGVHDWKNSALAGAITGAALALTTDDHSHEQVVQCAITGAAISTAANLL  177

Query  281  TGIF  270
            TGIF
Sbjct  178  TGIF  181



>emb|CDO98781.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 8/181 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S++NLE R  + DE+R+ D    GLFDLGHPLLNRIA+SFVKAAGIGAVQAVAREAY TA
Sbjct  49   SSSNLETRSII-DELRNFDKS--GLFDLGHPLLNRIAESFVKAAGIGAVQAVAREAYLTA  105

Query  623  VEGASRDT---PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            VEGA  DT   PPEI  AK H  FP  L+G  N  +VEAL+K TGKES+QWG AAG+YSG
Sbjct  106  VEGAGADTSGIPPEISAAKRHR-FPD-LRGETNAKTVEALVKGTGKESLQWGLAAGMYSG  163

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL+EARGVHDW+NSALAGA+TGAALA+T+  HSH+ ++QCAITGAAISTAANLLTGI
Sbjct  164  LTYGLKEARGVHDWKNSALAGAVTGAALALTSDGHSHEQIVQCAITGAAISTAANLLTGI  223

Query  272  F  270
            F
Sbjct  224  F  224



>ref|XP_011100784.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Sesamum 
indicum]
Length=181

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 151/185 (82%), Gaps = 10/185 (5%)
 Frame = -3

Query  806  MSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            MS +NLE R  L DE+R  + G+   FDLGHPLLNRIA+SFV+AAGIGAVQAV+REAYFT
Sbjct  1    MSGSNLETRSLL-DELRHFEKGF--FFDLGHPLLNRIAESFVRAAGIGAVQAVSREAYFT  57

Query  626  AVEGASRDT----PPE--IGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAG  465
            AVE    DT    PPE  +G  K  + FP  LKG NN+ S+EAL+K+TGKES+QWG AAG
Sbjct  58   AVESVGGDTASGLPPELGVGAPKKSNRFPD-LKGANNRKSLEALVKSTGKESLQWGIAAG  116

Query  464  VYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANL  285
            +YSGLTYGL+EARGVHDW++SALAGAITGAALA+ T DHSH+ V+QCA+TGAAISTAANL
Sbjct  117  MYSGLTYGLKEARGVHDWKSSALAGAITGAALALMTDDHSHEQVVQCAVTGAAISTAANL  176

Query  284  LTGIF  270
            LTGIF
Sbjct  177  LTGIF  181



>gb|EYU45503.1| hypothetical protein MIMGU_mgv1a015003mg [Erythranthe guttata]
Length=171

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 148/175 (85%), Gaps = 5/175 (3%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            +LE R +L DE+ S D G  G  DLGHPLLNR+A+SF KAAGIGA+QAV+REAYFTAVE 
Sbjct  2    SLEKR-SLIDELSSFDSG--GFLDLGHPLLNRMAESFTKAAGIGAIQAVSREAYFTAVES  58

Query  614  ASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLR  435
             S  T  E G +K HH FP  L+G NN+ SVEAL+K+TGKESMQWG AAGVYSGLTYGL+
Sbjct  59   GSGSTS-ENGASKKHHHFPD-LRGENNRKSVEALVKSTGKESMQWGLAAGVYSGLTYGLK  116

Query  434  EARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            EARGVHDW+NSALAGAITGAALA+T++DHSH+ V+QCA+TGAAISTAANLLTGIF
Sbjct  117  EARGVHDWKNSALAGAITGAALALTSEDHSHEQVVQCAMTGAAISTAANLLTGIF  171



>ref|XP_009789603.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Nicotiana 
sylvestris]
Length=173

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 7/170 (4%)
 Frame = -3

Query  764  EIRSLDHGY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT---  600
            E RSL HG+  GG FDLGHPLLNRIA+SFVKAAGIGAVQAVAREAYFTA EGAS D+   
Sbjct  6    ETRSLLHGFDKGGFFDLGHPLLNRIAESFVKAAGIGAVQAVAREAYFTASEGASGDSTSI  65

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
            PPEI G K +  FP  L+G  N+ S+EAL+K+TGKES+QWG AAG+YSGLTYGL+EARGV
Sbjct  66   PPEITGPKKNR-FPD-LRGETNRKSIEALVKSTGKESVQWGLAAGMYSGLTYGLKEARGV  123

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDW+NSALAGAITGAALA+T +D SH+ V+QCAITGAAIS+AANLLTGIF
Sbjct  124  HDWKNSALAGAITGAALALTLEDRSHEQVVQCAITGAAISSAANLLTGIF  173



>ref|XP_009601372.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Nicotiana 
tomentosiformis]
Length=173

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 7/170 (4%)
 Frame = -3

Query  764  EIRSLDHGY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT---  600
            E RSL HG+  GG FDLGHPLLNRIA+SFVKAAGIGAVQAVAREAYFTA EGAS D+   
Sbjct  6    ETRSLLHGFDKGGFFDLGHPLLNRIAESFVKAAGIGAVQAVAREAYFTASEGASGDSTSI  65

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
            PPEI G K +  FP  L+G  N+ S+EAL+K+TGKES+QWG AAG+YSGLTYGL+EARGV
Sbjct  66   PPEITGPKRNR-FPD-LRGETNRKSIEALVKSTGKESVQWGLAAGMYSGLTYGLKEARGV  123

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDW+NSALAGAITGAALA+T +D SH+ V+QCAITGAAIS+AANLLTGIF
Sbjct  124  HDWKNSALAGAITGAALALTLEDRSHEQVVQCAITGAAISSAANLLTGIF  173



>ref|XP_004229002.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Solanum 
lycopersicum]
Length=173

 Score =   219 bits (559),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 7/170 (4%)
 Frame = -3

Query  764  EIRSLDHGY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT---  600
            E RSL HG+  GGLFDLGHPLLNRI++SFVKAAGIGAVQAVAREAYFTA E    DT   
Sbjct  6    ECRSLLHGFDKGGLFDLGHPLLNRISESFVKAAGIGAVQAVAREAYFTASESTGGDTSSI  65

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
            PPEI G K +  FP  L+G  N+ SVEAL+K+TGKES+QWG AAG+YSGLTYGL+EARGV
Sbjct  66   PPEITGPKKNR-FPD-LRGETNRKSVEALVKSTGKESVQWGLAAGMYSGLTYGLKEARGV  123

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDW+NSALAGAITGAALA+T ++ SH+ V+QCAITGAAISTAANLLTGIF
Sbjct  124  HDWKNSALAGAITGAALALTLEERSHEQVVQCAITGAAISTAANLLTGIF  173



>gb|EYU44015.1| hypothetical protein MIMGU_mgv1a014750mg [Erythranthe guttata]
Length=179

 Score =   219 bits (559),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 148/183 (81%), Gaps = 8/183 (4%)
 Frame = -3

Query  806  MSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            MS +NLE R  L DE+++ + G    FDLGHPLLNR+A++FV+AAGIGAV AV+REAY T
Sbjct  1    MSGSNLETRSLL-DELKNFEKGL--FFDLGHPLLNRVAETFVRAAGIGAVHAVSREAYLT  57

Query  626  AVEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVY  459
            AVE  S D     P EIG  K  H FP  L+G NN+ SVEAL+K+TGKES+QWG AAG+Y
Sbjct  58   AVESVSGDATGGLPREIGAPKKRHVFPD-LRGENNRKSVEALVKSTGKESLQWGVAAGMY  116

Query  458  SGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLT  279
            SGLTYGL+EARGVHDW++SALAGA+TGAA+A+T  +HSH+ V+QCAITGAA+STAANLLT
Sbjct  117  SGLTYGLKEARGVHDWKSSALAGAVTGAAMALTLDNHSHEQVVQCAITGAAVSTAANLLT  176

Query  278  GIF  270
            GIF
Sbjct  177  GIF  179



>ref|XP_006355389.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Solanum tuberosum]
Length=173

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 7/170 (4%)
 Frame = -3

Query  764  EIRSLDHGY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT---  600
            E RSL HG+  GGLFDLGHPLLNRI++SFVKAAGIGAVQAVAREAYFTA E    DT   
Sbjct  6    ESRSLLHGFDKGGLFDLGHPLLNRISESFVKAAGIGAVQAVAREAYFTASESTGGDTSSI  65

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
            PPEI G K +  FP  L+G  N+ SVEAL+K+TGKES+QWG AAG+YSGLTYGL+EARGV
Sbjct  66   PPEITGPKKNR-FPD-LRGETNRKSVEALVKSTGKESVQWGLAAGMYSGLTYGLKEARGV  123

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDW+NSALAGAITGAAL++T ++ SH+ V+QCAITGAAISTAANLLTGIF
Sbjct  124  HDWKNSALAGAITGAALSLTLEERSHEQVVQCAITGAAISTAANLLTGIF  173



>ref|XP_002519203.1| protein translocase, putative [Ricinus communis]
 gb|EEF43067.1| protein translocase, putative [Ricinus communis]
Length=181

 Score =   218 bits (554),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 147/184 (80%), Gaps = 11/184 (6%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            +  L+ R T  DE+R  + G+  +FDLGHPLLNRIA+SFVKAAGIGA+QAV+REAYFTA+
Sbjct  2    SNKLQTR-TFMDELRGFEKGW--MFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAI  58

Query  620  EGASRDT----PPEI---GGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGV  462
            EG+  D+    PPE+   G AK  + FP  L+G  N  S+EAL+K+TGKESMQWG AAGV
Sbjct  59   EGSGLDSSSSVPPELSPAGAAKKRNRFPD-LRGETNGKSLEALVKSTGKESMQWGLAAGV  117

Query  461  YSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            YSGLTYGLREARG HDW+NSA+AGA+TG ALA+T  D SH+ ++QCAITGAAISTAANLL
Sbjct  118  YSGLTYGLREARGAHDWKNSAVAGAVTGMALALTADDVSHEQIVQCAITGAAISTAANLL  177

Query  281  TGIF  270
            TGIF
Sbjct  178  TGIF  181



>ref|XP_010063276.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Eucalyptus 
grandis]
 gb|KCW87948.1| hypothetical protein EUGRSUZ_A00350 [Eucalyptus grandis]
Length=178

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 146/182 (80%), Gaps = 7/182 (4%)
 Frame = -3

Query  806  MSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            M+ +N+E R      +  L+   GG FDLGHPLLNRIA+SF+KAAGIGA+QAV+REAYFT
Sbjct  1    MTTSNMEARTQ--SLLSELNFDKGGFFDLGHPLLNRIAESFIKAAGIGAIQAVSREAYFT  58

Query  626  AVEGASRDTP---PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            AVEGA  D+    PEI GAK H  FP  L+G  N++S+EA++K+TGKES+QWG AAGVYS
Sbjct  59   AVEGAGLDSSNGVPEIPGAKKHR-FPE-LRGETNRNSLEAMVKSTGKESLQWGLAAGVYS  116

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+E RG HDW+NSA+AGAITG ALA+T  D SH+ ++QCAITGAAISTAANLL+G
Sbjct  117  GLTYGLKETRGAHDWKNSAVAGAITGVALALTADDTSHEQIVQCAITGAAISTAANLLSG  176

Query  275  IF  270
            IF
Sbjct  177  IF  178



>ref|XP_002276934.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Vitis 
vinifera]
 emb|CBI22901.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   213 bits (543),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 147/182 (81%), Gaps = 11/182 (6%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            ++NLE R  L DE+R  D G  G FDLGHPLLNR A+SFVKAAGIGA+QAV+REAYFTA+
Sbjct  2    SSNLETRSLL-DELRDFDKG--GFFDLGHPLLNRFAESFVKAAGIGAIQAVSREAYFTAI  58

Query  620  EGASRDTP-----PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            EG+  ++P       +GG K    FP  LKG +++ S+EAL+K+TGKES+QWG AAG+YS
Sbjct  59   EGSGLESPGGVTEVTVGGKKQR--FPD-LKGESSRKSLEALVKSTGKESLQWGLAAGMYS  115

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG HDW+NSA+AGA+TG ALA+T+ D SH+ ++QCAITGAAISTAANLLTG
Sbjct  116  GLTYGLKEARGAHDWKNSAVAGAVTGVALALTSNDTSHEQIVQCAITGAAISTAANLLTG  175

Query  275  IF  270
            IF
Sbjct  176  IF  177



>ref|XP_007227528.1| hypothetical protein PRUPE_ppa012201mg [Prunus persica]
 gb|EMJ28727.1| hypothetical protein PRUPE_ppa012201mg [Prunus persica]
Length=180

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 144/181 (80%), Gaps = 7/181 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S++NLE R +L  E+RS + G  G FD GHPLLNRIA+SF+KAAGIGA+QAV+REAYFTA
Sbjct  4    SSSNLETRPSLLQELRSFEKG--GFFDFGHPLLNRIAESFLKAAGIGAIQAVSREAYFTA  61

Query  623  VEGASRD---TPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
             EG        PPEI G K H  FP  L+G NN  S+EA++K+TGKES+QWG AAGVYSG
Sbjct  62   TEGLDSSGGGIPPEISGNKKHR-FPD-LRGENNTKSLEAMVKHTGKESLQWGLAAGVYSG  119

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL EARG HDW+NSA+AGAITG ALA+T++  SH+ ++Q AITGAAISTAANLL+GI
Sbjct  120  LTYGLTEARGAHDWKNSAVAGAITGVALALTSEGSSHEQIVQGAITGAAISTAANLLSGI  179

Query  272  F  270
            F
Sbjct  180  F  180



>ref|XP_003533195.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Glycine max]
 gb|KHN12892.1| Outer envelope pore protein 16-2, chloroplastic [Glycine soja]
Length=181

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 145/182 (80%), Gaps = 9/182 (5%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            +++NLE R  L DE+ +      GLFDLGHPLLNRI ++FVKAAGIGAVQAV+REAYFTA
Sbjct  5    TSSNLETRSLL-DELCNFHKK--GLFDLGHPLLNRILETFVKAAGIGAVQAVSREAYFTA  61

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            +EG   D     PPEI  AK +   PS LKG  N  S+EA++KNTGKES+QWG AAG+Y+
Sbjct  62   IEGTGTDNSGGLPPEISSAKKNR-LPS-LKGETNNKSLEAMVKNTGKESLQWGVAAGLYA  119

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG HDW+NSA+AGAITGA LA+T +D +H+ ++QCAITGAAISTAANLLTG
Sbjct  120  GLTYGLKEARGAHDWKNSAVAGAITGATLALTLEDSTHEQIVQCAITGAAISTAANLLTG  179

Query  275  IF  270
            IF
Sbjct  180  IF  181



>ref|XP_006419410.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
 ref|XP_006488859.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Citrus sinensis]
 gb|ESR32650.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
Length=176

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 142/173 (82%), Gaps = 10/173 (6%)
 Frame = -3

Query  764  EIRSLDH---GY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT  600
            E RSL H   G+  GG FDLGHPLLNRI +SFVKAAGIGA+QAV REAYFTAVEG+  D+
Sbjct  6    ENRSLFHELPGFEKGGFFDLGHPLLNRITESFVKAAGIGAIQAVTREAYFTAVEGSGFDS  65

Query  599  P---PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREA  429
                 ++GGAK H  FP+ LKG  N+ S+EA++KNTGKES+QWG  AG+YSGLTYGLREA
Sbjct  66   SNNVSDMGGAKKHQ-FPN-LKGETNRKSLEAMVKNTGKESLQWGVVAGIYSGLTYGLREA  123

Query  428  RGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            RG HDW+NSA+AGAITG ALA+TT D SH+ V+QCAITGAAISTAANLLTGIF
Sbjct  124  RGAHDWKNSAVAGAITGVALALTTDDSSHEQVVQCAITGAAISTAANLLTGIF  176



>gb|KDP27896.1| hypothetical protein JCGZ_18976 [Jatropha curcas]
Length=178

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 144/181 (80%), Gaps = 8/181 (4%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            ++NLE R +L DE R+L+ G+   FDLGHPLLNRIA+SFVKAAGIGA+QAV+REAY TA 
Sbjct  2    SSNLETR-SLMDEFRNLEKGWS--FDLGHPLLNRIAESFVKAAGIGAIQAVSREAYLTAS  58

Query  620  EGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            +G   D+    PPE+ GA     FP+ LKG  +  S+EAL+K TG+ES+QWG AAGVYSG
Sbjct  59   QGNGLDSSSGLPPELSGAAKKRRFPN-LKGETSVKSLEALVKRTGEESLQWGLAAGVYSG  117

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGLREARG HDW+NSA+AGA+TG AL +TT D SH+ ++QCAITGAAIS AANLLTGI
Sbjct  118  LTYGLREARGAHDWKNSAVAGALTGLALGLTTDDVSHEQLVQCAITGAAISAAANLLTGI  177

Query  272  F  270
            F
Sbjct  178  F  178



>ref|XP_011010062.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Populus euphratica]
 ref|XP_011010068.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=179

 Score =   210 bits (534),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 9/180 (5%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            NLE R  + DEIR  D      FD GHPLLNRIA+SFVKAAGIGA+QAV+REAYFTA+EG
Sbjct  4    NLETRSFV-DEIRHFDKS--SFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  614  ASRDT----PPEIG-GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
            A  ++    P EI    K  H FP  L G  N+ S+EAL++NTGKES+QWG AAGVYSGL
Sbjct  61   AGLESSGGLPAEISVDGKKRHRFPD-LGGETNRKSLEALVRNTGKESLQWGLAAGVYSGL  119

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGLRE+RGVHDW+NSA+AGAITG ALA+T  D SH+ ++QCAITGAAISTAANLL+GIF
Sbjct  120  TYGLRESRGVHDWKNSAVAGAITGVALALTADDRSHEQIVQCAITGAAISTAANLLSGIF  179



>ref|XP_009369946.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Pyrus 
x bretschneideri]
Length=184

 Score =   209 bits (533),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 144/182 (79%), Gaps = 7/182 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S+T+LE + +L  E+RS D    G+FDLGHPLLNRIA+SFVKAAGIGA+QAV+REAYF A
Sbjct  6    SSTSLETKPSLLQELRSFDKS--GIFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYFIA  63

Query  623  VEGASRDT---PPEIGGAKN-HHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
             EG    T   PPEI    N    FP  L+G NN+ S+EA++KNTGKES+QWG AAGVYS
Sbjct  64   TEGFDSSTNGIPPEISVPGNKRQCFPD-LRGENNRKSLEAMVKNTGKESLQWGLAAGVYS  122

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL EARG HDW+NSA+AGAITG ALA+T++  SH+ ++Q AITGAAISTAANLL+G
Sbjct  123  GLTYGLAEARGAHDWKNSAVAGAITGVALALTSEGSSHEQIVQGAITGAAISTAANLLSG  182

Query  275  IF  270
            IF
Sbjct  183  IF  184



>ref|XP_008390546.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Malus 
domestica]
Length=184

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 144/182 (79%), Gaps = 7/182 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S+T+LE + +L  E+RS D    G FDLGHPLLNRIA+SFVKAAGIGA+QAV+REAYF A
Sbjct  6    SSTSLETKPSLLXELRSFDKS--GFFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYFIA  63

Query  623  VEGASRDT---PPEIGGAKN-HHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            +EG    T   PPEI    N    FP  L+G NN+ S+EA++KNTGKES+QWG AAGVYS
Sbjct  64   IEGFDSSTNGIPPEISVPGNKRQRFPD-LRGENNRKSLEAMVKNTGKESLQWGLAAGVYS  122

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL EARG HDW+NSA+AGAITG ALA+T++  SH+ ++Q AITGAAISTAANLL+G
Sbjct  123  GLTYGLAEARGAHDWKNSAVAGAITGVALALTSEGSSHEQIVQGAITGAAISTAANLLSG  182

Query  275  IF  270
            IF
Sbjct  183  IF  184



>ref|XP_008223316.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Prunus 
mume]
Length=181

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 7/181 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S++NLE R +L  E+RS + G  G FD GHPLLNRIA+SF+KAAGIGA+QAV+RE YFTA
Sbjct  5    SSSNLETRPSLLQELRSFEKG--GFFDFGHPLLNRIAESFLKAAGIGAIQAVSRETYFTA  62

Query  623  VEGA-SRD--TPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
             EG  SR    PPEI G K H  FP  L+G NN  S+EA++K+TGKES+QWG AAGVYSG
Sbjct  63   TEGLDSRGGGIPPEISGNKKHR-FPD-LRGENNTKSLEAMVKHTGKESLQWGLAAGVYSG  120

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL EARG HDW+NSA+AGAITG ALA+T++  SH+ ++Q AITGAAISTAANLL+GI
Sbjct  121  LTYGLTEARGAHDWKNSAVAGAITGVALALTSEGSSHEQIVQGAITGAAISTAANLLSGI  180

Query  272  F  270
            F
Sbjct  181  F  181



>ref|XP_002314929.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|EEF01100.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=179

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 140/180 (78%), Gaps = 9/180 (5%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            NLE R  + DEIR  D      FD GHPLLNRIA+SFVKAAGIGA+QAV+REAYFTA+EG
Sbjct  4    NLETRSFV-DEIRHFDKS--SFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  614  ASRDT----PPEIG-GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
            A  ++    P EI    K  H FP  L+G  N+ S+EAL+ NTGKES+QWG AAGVYSGL
Sbjct  61   AGLESSGGLPAEISVDGKKPHRFPD-LRGETNRKSLEALVMNTGKESLQWGLAAGVYSGL  119

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGLRE+RGVHDW+NSA+AGAITG ALA+T  D SH+ ++QCAITGAAISTAANLL GIF
Sbjct  120  TYGLRESRGVHDWKNSAVAGAITGVALALTADDKSHEQIVQCAITGAAISTAANLLKGIF  179



>ref|XP_004487776.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Cicer arietinum]
Length=176

 Score =   208 bits (530),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 141/178 (79%), Gaps = 6/178 (3%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            +++ +E RC L DEI + D    GLFDLGHPLLNRIA+SFVKAAGIGAVQ+++R+AYFTA
Sbjct  5    TSSEVETRCLL-DEICNFDRK--GLFDLGHPLLNRIAESFVKAAGIGAVQSLSRQAYFTA  61

Query  623  VEGASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTY  444
            ++G     PP    A      P+ L+G  N  S+EA++ NTGKES+QWG AAG+YSGLTY
Sbjct  62   IQGG---LPPSDVSATRKSRLPAALRGETNDKSLEAMVINTGKESLQWGVAAGIYSGLTY  118

Query  443  GLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            GL+EARG HDW+NSA+AGAITGA LA+T +D +H+HV+QCAITGAAISTAA LLTGIF
Sbjct  119  GLKEARGAHDWKNSAVAGAITGATLALTLEDSTHEHVVQCAITGAAISTAAKLLTGIF  176



>ref|XP_010094311.1| hypothetical protein L484_007726 [Morus notabilis]
 gb|EXB55731.1| hypothetical protein L484_007726 [Morus notabilis]
Length=177

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 146/182 (80%), Gaps = 8/182 (4%)
 Frame = -3

Query  806  MSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            MS+  LE +  + +E+RS D G  G F+LGHPLLNR+A+SF+KAAGIGA+QAV+REAYFT
Sbjct  1    MSSGKLENKSFM-EELRSFDKG--GFFELGHPLLNRVAESFIKAAGIGAIQAVSREAYFT  57

Query  626  AVEGASRDTP---PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            A EG +  +     EI GAK H  FP  L+G  N+ S+EA++KNTGKES+QWG AAGVYS
Sbjct  58   AFEGENSSSSVGATEIPGAKKHR-FPD-LRGETNRKSLEAMVKNTGKESLQWGLAAGVYS  115

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG HDW+NSA+AGA+TG ALA+T+ D +H+ V+ CAITGAAISTAANLL+G
Sbjct  116  GLTYGLKEARGAHDWKNSAVAGALTGVALALTSDDTTHEQVVHCAITGAAISTAANLLSG  175

Query  275  IF  270
            IF
Sbjct  176  IF  177



>gb|KDO71888.1| hypothetical protein CISIN_1g036913mg [Citrus sinensis]
Length=176

 Score =   208 bits (529),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 140/173 (81%), Gaps = 10/173 (6%)
 Frame = -3

Query  764  EIRSLDH---GY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT  600
            E RSL H   G+  GG FDLGHPLLNRI +SFVKAAGIGA+QAV REAYFTAVEG+  D+
Sbjct  6    ENRSLFHELPGFEKGGFFDLGHPLLNRITESFVKAAGIGAIQAVTREAYFTAVEGSGFDS  65

Query  599  P---PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREA  429
                 ++G AK H  FP+ LKG  N+ S+EA++KNTGKES+QWG  AG+YSGLTYGLREA
Sbjct  66   SNNVSDMGDAKKHQ-FPN-LKGETNRKSLEAMVKNTGKESLQWGVVAGIYSGLTYGLREA  123

Query  428  RGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            RG HDW+NSA+AGAITG ALA+T  D SH+ V+QCAITGAAISTAANLLTGIF
Sbjct  124  RGAHDWKNSAVAGAITGVALALTIDDSSHEQVVQCAITGAAISTAANLLTGIF  176



>ref|XP_002312339.1| hypothetical protein POPTR_0008s10670g [Populus trichocarpa]
 gb|EEE89706.1| hypothetical protein POPTR_0008s10670g [Populus trichocarpa]
Length=179

 Score =   207 bits (528),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 144/181 (80%), Gaps = 11/181 (6%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            NLE R  +G EIR  D      FD GHPLLNRIA+SFVKAAGIGA+QAV+REAYFTA+EG
Sbjct  4    NLETRSLMG-EIRRFDKCC--FFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  614  ASRDT----PPEIG--GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            +  ++    PPEI   G K H A P  L+G  N+ S+EAL++NTGKES+QWG AAGVYSG
Sbjct  61   SGFESSGGVPPEISVDGKKRHRA-PD-LRGETNRKSLEALVRNTGKESLQWGLAAGVYSG  118

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL EARGVHDW+N+A+AGAITG ALA+TT D SH+ ++QCAITGAAISTAANLLTGI
Sbjct  119  LTYGLSEARGVHDWKNTAVAGAITGVALALTTADISHEQIVQCAITGAAISTAANLLTGI  178

Query  272  F  270
            F
Sbjct  179  F  179



>gb|AES91953.2| outer envelope pore protein [Medicago truncatula]
Length=179

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 142/182 (78%), Gaps = 9/182 (5%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S +NLE R TL DE+   D   GGLFD GHPL+NRIA+SFVKAAGIGAVQAV+REAYFT 
Sbjct  3    SNSNLETR-TLLDELS--DFNKGGLFDFGHPLVNRIAESFVKAAGIGAVQAVSREAYFTV  59

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            +EG   D     PPEI GAK +      L+G  +  S+EA++KNTGKES QWG AAG+YS
Sbjct  60   IEGTGIDNAGGMPPEISGAKKNRFHG--LRGETSSKSIEAMVKNTGKESFQWGLAAGLYS  117

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYG++EARG HDW+NSA+AGAITGAALA T+ + SH+ + QCAITGAAISTAANLLTG
Sbjct  118  GLTYGMKEARGTHDWKNSAVAGAITGAALACTSDNTSHEQIAQCAITGAAISTAANLLTG  177

Query  275  IF  270
            IF
Sbjct  178  IF  179



>ref|XP_008786243.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Phoenix dactylifera]
Length=173

 Score =   206 bits (525),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 138/168 (82%), Gaps = 7/168 (4%)
 Frame = -3

Query  764  EIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRD---TPP  594
            EIRSL+ G+   FDLGHPLLNR+A+SFVKAAGIGA+QAV+REAYFTAVEGA  D    PP
Sbjct  10   EIRSLEKGW--FFDLGHPLLNRVAESFVKAAGIGAIQAVSREAYFTAVEGAGVDPGAMPP  67

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHD  414
            ++   K H    S L+G N   S+EA++KNTGKES QWG AAG+YSG+TYGLRE RG HD
Sbjct  68   DMTSGKRHRL--SDLRGENCNKSLEAMVKNTGKESFQWGMAAGLYSGVTYGLREVRGSHD  125

Query  413  WRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            W+NSA+AGAITGAALA+T+ D SH+ ++QCAITGAA+STAANLLTGIF
Sbjct  126  WKNSAVAGAITGAALALTSDDTSHEQIVQCAITGAALSTAANLLTGIF  173



>ref|XP_010921504.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Elaeis 
guineensis]
Length=177

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 146/180 (81%), Gaps = 7/180 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S +NLE R TL DEIRSL+ G+  LFD GHPLLNRIA+SFVKAAGIGA+QAV+REAY TA
Sbjct  3    SNSNLETR-TLLDEIRSLEKGW--LFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYLTA  59

Query  623  VEGASRD--TPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
            VEGA  D    P++  +K H  FP  L+G N   S+EA +K+TGKE+ QWG AAG+YSGL
Sbjct  60   VEGAGADPGAIPDMTSSKRHR-FPD-LRGENCTKSLEATVKSTGKEAFQWGMAAGMYSGL  117

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGLREARG HDW+NSA+AGAITGAA+A+T+ D SH+ ++Q AITGAA+STAANLL+GIF
Sbjct  118  TYGLREARGSHDWKNSAVAGAITGAAVALTSDDTSHEQIVQFAITGAALSTAANLLSGIF  177



>ref|XP_008781093.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Phoenix dactylifera]
Length=177

 Score =   204 bits (520),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 7/180 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S +NLE   TL DEIRSL+ G+  LFDLGHPLLNRIA+SFVKAAGIGA+QAV+REAY TA
Sbjct  3    SNSNLET-MTLLDEIRSLEKGW--LFDLGHPLLNRIAESFVKAAGIGAIQAVSREAYLTA  59

Query  623  VEGASRDTP--PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
            VEGA  D    P++  +K H    S L G N K S+EA++K+TGKES QWG AAG+YSGL
Sbjct  60   VEGAGADPAAMPDLTSSKKHRF--SDLGGENCKKSLEAMVKSTGKESFQWGMAAGMYSGL  117

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGLREARG HDW+NSA+AGA+TGAALA+T+++ SH+ ++Q A+TGAA+STAANLL+GIF
Sbjct  118  TYGLREARGSHDWKNSAVAGAVTGAALALTSENTSHEQIVQFAVTGAALSTAANLLSGIF  177



>ref|XP_010259322.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Nelumbo 
nucifera]
Length=175

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 142/177 (80%), Gaps = 7/177 (4%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            NLE R +L DEIR        LFDLGHPLLNRIA+SFVKAAGIGAVQAV+RE YF A+EG
Sbjct  4    NLETR-SLFDEIRGFHKEC--LFDLGHPLLNRIAESFVKAAGIGAVQAVSREVYFIAIEG  60

Query  614  ASRDT--PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYG  441
            A  D+   P I G+K     P  LKG  N+ S+EA++K+TGKE +QWG AAG+YSGLTYG
Sbjct  61   AGTDSNGAPVITGSKKQR-LPE-LKGETNRKSLEAMVKSTGKECLQWGLAAGMYSGLTYG  118

Query  440  LREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            L+EARG HDW+NSA+AGAITGA+LA+T++D SH+ ++QCAITGAA+STAANLLTGIF
Sbjct  119  LKEARGAHDWKNSAVAGAITGASLALTSEDISHEQIVQCAITGAALSTAANLLTGIF  175



>ref|XP_011020263.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Populus euphratica]
Length=179

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 142/181 (78%), Gaps = 11/181 (6%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            NLE R  +G EIR  D      FD GHPLLN IA+SFVKAAGIGA+QAV+REAYFTA+EG
Sbjct  4    NLETRSLMG-EIRRFDKCC--FFDFGHPLLNCIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  614  ASRDT----PPEIG--GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            A  ++    PPEI   G K H A P  L+G  N  S+EAL++NTGKES+QWG AAGVYSG
Sbjct  61   AGIESSGGVPPEISVDGKKRHRA-PH-LRGETNIKSLEALVRNTGKESLQWGLAAGVYSG  118

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL EARGVHDW+N+A+AGAITG ALA+TT D SH+ ++QCAITGAAISTAANLLTGI
Sbjct  119  LTYGLSEARGVHDWKNTAVAGAITGVALALTTADISHEQIVQCAITGAAISTAANLLTGI  178

Query  272  F  270
            F
Sbjct  179  F  179



>ref|XP_004295096.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=185

 Score =   203 bits (516),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 136/160 (85%), Gaps = 6/160 (4%)
 Frame = -3

Query  737  GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE----GASRDTPPEIGGAKNH  570
            G +FDLGHPLLNRIA+SFVKAAGIGAVQAV+REAYFTA E    G+S  TPP+I G K +
Sbjct  28   GAMFDLGHPLLNRIAESFVKAAGIGAVQAVSREAYFTATEASGLGSSNGTPPDISGHKKN  87

Query  569  HAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalag  390
              FP  L+GGN+  S+EA++K+TGKES+QWG AAGVYSGLTYGL+EARG HDW+NSA+AG
Sbjct  88   R-FPD-LRGGNSSKSLEAMVKHTGKESLQWGLAAGVYSGLTYGLKEARGAHDWKNSAVAG  145

Query  389  aitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            AITG ALA+T+   SH+ ++QCAITGAAIS+AANLL+GIF
Sbjct  146  AITGVALALTSDCSSHEQIVQCAITGAAISSAANLLSGIF  185



>ref|NP_001237610.1| uncharacterized protein LOC100305849 [Glycine max]
 gb|ACU13727.1| unknown [Glycine max]
 gb|KHN14666.1| Outer envelope pore protein 16-2, chloroplastic [Glycine soja]
Length=181

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 144/182 (79%), Gaps = 9/182 (5%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            ++++LE R  L DE+ + +    GL DLGHPLLNRI +SFVKAAGIGAVQAV+REAYFTA
Sbjct  5    TSSDLETRSLL-DELCNFNKK--GLLDLGHPLLNRIFESFVKAAGIGAVQAVSREAYFTA  61

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            ++G   D     PPEI  AK +   P  LKG  +  S+EA++K+TGKES+QWG AAG+YS
Sbjct  62   IDGTGADNSGGLPPEISSAKKNR-LPG-LKGETSNKSLEAMVKSTGKESLQWGVAAGLYS  119

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG HDW+NSA+AGAITGA LA+T +D +H+ ++QCAITGAAISTAANLLTG
Sbjct  120  GLTYGLKEARGAHDWKNSAVAGAITGATLALTLEDSTHEQIVQCAITGAAISTAANLLTG  179

Query  275  IF  270
            IF
Sbjct  180  IF  181



>ref|XP_008340618.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Malus domestica]
Length=185

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 142/181 (78%), Gaps = 7/181 (4%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            +++LE + +L  E+RS D G  G  DLGHPLLNRIA+SFVKAA IGA+QAV+REAYFTA 
Sbjct  8    SSSLETKPSLLQELRSFDKG--GFSDLGHPLLNRIAESFVKAAXIGAIQAVSREAYFTAT  65

Query  620  EGASRDT---PPEIGGAKNH-HAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            EG    T   PPEI  + N    FP  L+G NN+ S+EA++KNTGKES+QWG AAGVYSG
Sbjct  66   EGFDSSTNGIPPEISVSGNKKQRFPD-LRGENNRKSLEAMVKNTGKESLQWGLAAGVYSG  124

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL EARG HDW+NSA+AGAITG ALA+T++  SH+ ++  AITGAAISTAANLL+GI
Sbjct  125  LTYGLAEARGAHDWKNSAVAGAITGVALALTSEGSSHEQIVHGAITGAAISTAANLLSGI  184

Query  272  F  270
            F
Sbjct  185  F  185



>ref|XP_003529533.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Glycine max]
 gb|KHN02907.1| Outer envelope pore protein 16-2, chloroplastic [Glycine soja]
Length=182

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 140/182 (77%), Gaps = 9/182 (5%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S  NLE R  L DE+   + G  GLFDLGHPLLNRIA+SFVKA+GIGAVQAV+REAYF+A
Sbjct  6    SNVNLETRSPL-DEVICFNKG--GLFDLGHPLLNRIAESFVKASGIGAVQAVSREAYFSA  62

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            V+G   D     P E+  AK H      L+G  +  S+EA++KNTGKES+QWG AAG+YS
Sbjct  63   VDGNRMDNTGGMPSEVSNAKKHRLHG--LRGETSSKSLEAMVKNTGKESLQWGLAAGIYS  120

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG +DW+NSA+AG ITGA LA+T+ D S +H++ CAITGAAISTAANLLTG
Sbjct  121  GLTYGLKEARGANDWKNSAMAGGITGATLALTSGDTSQEHMVHCAITGAAISTAANLLTG  180

Query  275  IF  270
            IF
Sbjct  181  IF  182



>ref|XP_003594780.1| hypothetical protein MTR_2g034550 [Medicago truncatula]
 gb|ABD32318.1| Mitochondrial import inner membrane translocase, subunit Tim17/22 
[Medicago truncatula]
 gb|AES65031.1| outer envelope pore protein [Medicago truncatula]
Length=182

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 140/181 (77%), Gaps = 6/181 (3%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            +++ +E R  L DEI S D    GLFDLGHPLLNRIA+SFVKAAGIGAVQAV+REAYFTA
Sbjct  5    TSSEVETRALL-DEICSFDRK--GLFDLGHPLLNRIAESFVKAAGIGAVQAVSREAYFTA  61

Query  623  VEGASRD---TPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            ++G   D     P+     N    P+ L+G  +  S++A++ NTGKES+QWG AAG+YSG
Sbjct  62   IDGHKVDKGGVIPQDVSPTNKRRLPAGLRGETSNKSLDAMVINTGKESLQWGVAAGIYSG  121

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL+EARG HDW+NSA+AGAITGA LA+T +D +H+HV+QCAITGAAIST ANLL GI
Sbjct  122  LTYGLKEARGAHDWKNSAVAGAITGATLALTLEDSTHEHVVQCAITGAAISTVANLLKGI  181

Query  272  F  270
            F
Sbjct  182  F  182



>ref|XP_009416248.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=176

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 143/181 (79%), Gaps = 7/181 (4%)
 Frame = -3

Query  806  MSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            MS+  LE R TL DEIR +D+G+  LFD GHPL+NR+A+ F KAAGIGAVQAV REAYFT
Sbjct  1    MSSGKLETR-TLLDEIRDMDNGW--LFDFGHPLINRVAECFFKAAGIGAVQAVTREAYFT  57

Query  626  AVEGASRDT--PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            AVEG+  DT    ++ G K      S L+G N K S+EA++K+TGKES QWG AAG+YSG
Sbjct  58   AVEGSGVDTGGVADVTGGKKRR--FSDLRGENCKKSLEAMVKSTGKESFQWGMAAGMYSG  115

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL+EARG HDW++SA+AGAITGAALA+T    SH+ ++QCAITGAA+STAANLL+GI
Sbjct  116  LTYGLKEARGSHDWKSSAVAGAITGAALALTADGTSHEQIVQCAITGAALSTAANLLSGI  175

Query  272  F  270
            F
Sbjct  176  F  176



>ref|XP_007138986.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
 ref|XP_007138987.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
 gb|ESW10980.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
 gb|ESW10981.1| hypothetical protein PHAVU_009G255100g [Phaseolus vulgaris]
Length=180

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 142/181 (78%), Gaps = 8/181 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            +++NLE R  L DE+ + D    GLFDLGHPLLNRI +SFVKA+GIGA+QAV+REAYFTA
Sbjct  5    TSSNLETRSLL-DELCNFDKK--GLFDLGHPLLNRILESFVKASGIGALQAVSREAYFTA  61

Query  623  VEGA---SRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
            VEG    S   P E+   K +   P  L+G  +  S+EA++K+TGKES+QWG AAG+YSG
Sbjct  62   VEGNGANSTGLPAEVSSTKKNQ-LPG-LRGETSNKSLEAMVKSTGKESLQWGVAAGLYSG  119

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL+EARG HDW+NSA+AGAITGA LA+T  D +H+ ++QCAITGAAISTAANLLTGI
Sbjct  120  LTYGLKEARGAHDWKNSAVAGAITGATLALTLDDSNHEQIVQCAITGAAISTAANLLTGI  179

Query  272  F  270
            F
Sbjct  180  F  180



>ref|XP_010548992.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=179

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 137/172 (80%), Gaps = 9/172 (5%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEI S +     LFDLGHPLLNR ADSFVKA GIGA+QAV+REAYFTAVE A  D+    
Sbjct  11   DEIISFEKL--PLFDLGHPLLNRFADSFVKATGIGALQAVSREAYFTAVEAAGLDSNNVL  68

Query  599  --PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR  426
              PP    A   H FP+ L+G ++  S+EAL+KNTGKES+QWG AAG+YSGLTYG+ EAR
Sbjct  69   SPPPSEVTASKKHRFPN-LRGESSSKSLEALVKNTGKESLQWGLAAGLYSGLTYGMTEAR  127

Query  425  GVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            GVHDW+NSA+AGA+TGAA+AMT++  SH+ V+QCA+TGAAISTAANLL+G+F
Sbjct  128  GVHDWKNSAVAGALTGAAMAMTSERTSHEQVVQCALTGAAISTAANLLSGVF  179



>ref|XP_010548993.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=177

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 136/170 (80%), Gaps = 7/170 (4%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEI S +     LFDLGHPLLNR ADSFVKA GIGA+QAV+REAYFTAVEG   +     
Sbjct  11   DEIISFEKL--PLFDLGHPLLNRFADSFVKATGIGALQAVSREAYFTAVEGLDSNNVLSP  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
            PP    A   H FP+ L+G ++  S+EAL+KNTGKES+QWG AAG+YSGLTYG+ EARGV
Sbjct  69   PPSEVTASKKHRFPN-LRGESSSKSLEALVKNTGKESLQWGLAAGLYSGLTYGMTEARGV  127

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDW+NSA+AGA+TGAA+AMT++  SH+ V+QCA+TGAAISTAANLL+G+F
Sbjct  128  HDWKNSAVAGALTGAAMAMTSERTSHEQVVQCALTGAAISTAANLLSGVF  177



>ref|XP_004508261.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Cicer arietinum]
Length=175

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 13/182 (7%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S++NLE R  L DE+ + + G  G+FD GHPL+NRIA+SFVKAAGIGAVQAV+REAYFTA
Sbjct  3    SSSNLETRSLL-DELSTFNKG--GIFDFGHPLVNRIAESFVKAAGIGAVQAVSREAYFTA  59

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            +EG   D     PPEI  AK H      L+G  +  S+EA++K+T     QWG AAG+YS
Sbjct  60   IEGTGIDNTSGMPPEISAAKKHRLHG--LRGETSSKSIEAMVKST----FQWGLAAGLYS  113

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG HDW+NSA+AGAITGA LA+T++D SH+ +++CAITGAAISTAANLLTG
Sbjct  114  GLTYGLKEARGAHDWKNSAVAGAITGATLALTSEDSSHEQIVECAITGAAISTAANLLTG  173

Query  275  IF  270
            IF
Sbjct  174  IF  175



>ref|XP_003609756.1| hypothetical protein MTR_4g121900 [Medicago truncatula]
Length=194

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 142/197 (72%), Gaps = 24/197 (12%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S +NLE R TL DE+   D   GGLFD GHPL+NRIA+SFVKAAGIGAVQAV+REAYFT 
Sbjct  3    SNSNLETR-TLLDELS--DFNKGGLFDFGHPLVNRIAESFVKAAGIGAVQAVSREAYFTV  59

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEAL---------------IKNT  501
            +EG   D     PPEI GAK +      L+G  +  S+EA+               +KNT
Sbjct  60   IEGTGIDNAGGMPPEISGAKKNRFHG--LRGETSSKSIEAMVSSCVQESCCLTVAYVKNT  117

Query  500  GKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCA  321
            GKES QWG AAG+YSGLTYG++EARG HDW+NSA+AGAITGAALA T+ + SH+ + QCA
Sbjct  118  GKESFQWGLAAGLYSGLTYGMKEARGTHDWKNSAVAGAITGAALACTSDNTSHEQIAQCA  177

Query  320  ITGAAISTAANLLTGIF  270
            ITGAAISTAANLLTGIF
Sbjct  178  ITGAAISTAANLLTGIF  194



>gb|AFK34430.1| unknown [Lotus japonicus]
Length=184

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 140/184 (76%), Gaps = 10/184 (5%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            +++ +E R  L D++ S D   G LF+LGHPLLNRIA+ FVKAAGIGAVQAV+RE Y   
Sbjct  5    TSSEVETRALL-DKVSSFDKNEG-LFNLGHPLLNRIAECFVKAAGIGAVQAVSREGYSIT  62

Query  623  VEGA------SRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGV  462
            ++G       +   PPE+ GAK +H  P  L+G  N  S EA++  +GKES+QWG AAG+
Sbjct  63   IQGTRGVDSNNGSIPPELSGAKKNH-LPG-LRGETNSKSFEAMVLKSGKESLQWGVAAGI  120

Query  461  YSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            YSGLTYGL+EARG HDW+NSA+AGAITGA+LA+T +D SHD ++QCAITGAAISTAANLL
Sbjct  121  YSGLTYGLKEARGAHDWKNSAVAGAITGASLALTLEDVSHDQIVQCAITGAAISTAANLL  180

Query  281  TGIF  270
            TGIF
Sbjct  181  TGIF  184



>ref|XP_011010074.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=151

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 130/175 (74%), Gaps = 27/175 (15%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG  615
            NLE R  + DEIR  D      FD GHPLLNRIA+SFVKAAGIGA+QAV+REAYFTA+EG
Sbjct  4    NLETRSFV-DEIRHFDKS--SFFDFGHPLLNRIAESFVKAAGIGAIQAVSREAYFTAIEG  60

Query  614  ASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLR  435
             +                        N+ S+EAL++NTGKES+QWG AAGVYSGLTYGLR
Sbjct  61   ET------------------------NRKSLEALVRNTGKESLQWGLAAGVYSGLTYGLR  96

Query  434  EARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            E+RGVHDW+NSA+AGAITG ALA+T  D SH+ ++QCAITGAAISTAANLL+GIF
Sbjct  97   ESRGVHDWKNSAVAGAITGVALALTADDRSHEQIVQCAITGAAISTAANLLSGIF  151



>gb|KFK23123.1| hypothetical protein AALP_AAs72355U000300 [Arabis alpina]
Length=178

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 135/171 (79%), Gaps = 8/171 (5%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEI+S +     LFDLGHPLLNRIADSFVKAAG+GA+QAV RE YFT VEGA  D+    
Sbjct  11   DEIKSFEKA--SLFDLGHPLLNRIADSFVKAAGVGALQAVTREGYFTVVEGAGYDSNNVG  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-G  423
            PP    +   H FP+ L+G ++  S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G
Sbjct  69   PPSENNSSKKHRFPN-LRGESSSKSLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGG  127

Query  422  VHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
             HDWRNSA+AGA+TG A+AMT++  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  128  AHDWRNSAVAGALTGIAMAMTSEGTSHEQVVQSALTGAAISTAANLLSSVF  178



>gb|KHG27138.1| Outer envelope pore 16-2, chloroplastic -like protein [Gossypium 
arboreum]
Length=187

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 139/189 (74%), Gaps = 17/189 (9%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            TNLE R  L DE+RS D G  G FDLGHPLLNRIA+SFVKAAGIGA++ VARE  + A+E
Sbjct  3    TNLETRSLL-DELRSFDKG--GFFDLGHPLLNRIAESFVKAAGIGAIKGVAREGCYLALE  59

Query  617  GA------------SRDTPPEIGGAKNH-HAFPSVLKGGNNKSSVEALIKNTGKESMQWG  477
            G             SR +  +I    N  + FP  L+G  N+ S+EA++K+TGKES+QWG
Sbjct  60   GKHKFNSNLVAGTKSRSSSTDISAKNNKKNPFP-YLRGETNRKSLEAMVKSTGKESLQWG  118

Query  476  FAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAIST  297
             AAG+YSG+TYGL+EARG HDW+NSA+AGA+TG  +A+T +    +HV+QCAITGAA+ST
Sbjct  119  LAAGLYSGITYGLQEARGAHDWKNSAVAGALTGMTVALTCEKPCQEHVLQCAITGAALST  178

Query  296  AANLLTGIF  270
            AANLLTG+F
Sbjct  179  AANLLTGVF  187



>ref|XP_009146383.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Brassica 
rapa]
 emb|CDY32222.1| BnaA01g17620D [Brassica napus]
Length=179

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 136/172 (79%), Gaps = 9/172 (5%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEIRS +     LFDLGHPLLNR+ADSFVKAAG+GA+QAV+REAYFT V+G   D+    
Sbjct  11   DEIRSFEKA--SLFDLGHPLLNRVADSFVKAAGVGALQAVSREAYFTVVDGTGFDSSSMG  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-G  423
            PP        H FP+ L+G N+  S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G
Sbjct  69   PPSEDTGSKKHRFPN-LRGENSSKSLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGG  127

Query  422  VHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
             HDWRNSA+AGA+TGAA+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  128  AHDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF  179



>emb|CDY34437.1| BnaC01g21960D [Brassica napus]
Length=179

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 9/172 (5%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEIRS +     LFDLGHPLLNR+ADSFVKAA +GA+QAV+REAYFT V+G   D+    
Sbjct  11   DEIRSFEKA--SLFDLGHPLLNRVADSFVKAAAVGALQAVSREAYFTVVDGTGFDSSSMG  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-G  423
            PP        H FP+ L+G NN  S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G
Sbjct  69   PPSEDTGSKKHRFPN-LRGENNSKSLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGG  127

Query  422  VHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
             HDWRNSA+AGA+TGAA+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  128  AHDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF  179



>ref|XP_007035757.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 1 [Theobroma cacao]
 gb|EOY06683.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 1 [Theobroma cacao]
Length=175

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 144/178 (81%), Gaps = 5/178 (3%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            +TNLE R  L D+ R+ D G    FDLGHPLLNRIA+SFVKAAGIGA+QA ARE+ F AV
Sbjct  2    STNLETRSLL-DDWRNFDKGC--FFDLGHPLLNRIAESFVKAAGIGAIQAAARESCFIAV  58

Query  620  EGASRDTPPEIGGAKN-HHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTY  444
            EG      P+I G+KN  + FP  L+G  N+ S+EA++K+TGKES+QWG AAG+YSGLTY
Sbjct  59   EGTESSNSPDITGSKNKKNRFPD-LRGETNRKSLEAMVKSTGKESLQWGLAAGLYSGLTY  117

Query  443  GLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            GL+EARG HDW+NSA+AGAITG ALA+T+++ SH+ V+QCAITGAAISTAANLLTGIF
Sbjct  118  GLKEARGAHDWKNSAMAGAITGMALALTSEEASHEQVVQCAITGAAISTAANLLTGIF  175



>gb|KFK23122.1| hypothetical protein AALP_AAs72355U000300 [Arabis alpina]
Length=176

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 133/169 (79%), Gaps = 6/169 (4%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            DEI+S +     LFDLGHPLLNRIADSFVKAAG+GA+QAV RE YFT VEG   +   PP
Sbjct  11   DEIKSFEKA--SLFDLGHPLLNRIADSFVKAAGVGALQAVTREGYFTVVEGYDSNNVGPP  68

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVH  417
                +   H FP+ L+G ++  S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G H
Sbjct  69   SENNSSKKHRFPN-LRGESSSKSLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGGAH  127

Query  416  DWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            DWRNSA+AGA+TG A+AMT++  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  128  DWRNSAVAGALTGIAMAMTSEGTSHEQVVQSALTGAAISTAANLLSSVF  176



>ref|XP_006419409.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
 gb|ESR32649.1| hypothetical protein CICLE_v10006030mg [Citrus clementina]
Length=151

 Score =   189 bits (479),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 127/170 (75%), Gaps = 29/170 (17%)
 Frame = -3

Query  764  EIRSLDH---GY--GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT  600
            E RSL H   G+  GG FDLGHPLLNRI +SFVKAAGIGA+QAV REAYFTAVEG +   
Sbjct  6    ENRSLFHELPGFEKGGFFDLGHPLLNRITESFVKAAGIGAIQAVTREAYFTAVEGET---  62

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
                                 N+ S+EA++KNTGKES+QWG  AG+YSGLTYGLREARG 
Sbjct  63   ---------------------NRKSLEAMVKNTGKESLQWGVVAGIYSGLTYGLREARGA  101

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDW+NSA+AGAITG ALA+TT D SH+ V+QCAITGAAISTAANLLTGIF
Sbjct  102  HDWKNSAVAGAITGVALALTTDDSSHEQVVQCAITGAAISTAANLLTGIF  151



>ref|XP_010524578.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Tarenaya 
hassleriana]
Length=177

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 7/170 (4%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT---P  597
            DEIR  +     LFDLGHPLL+RIADSFVKAAGIGA QAV+REAY T  EG   D+   P
Sbjct  11   DEIRRFEKL--PLFDLGHPLLDRIADSFVKAAGIGAAQAVSREAYSTVFEGTGLDSSVPP  68

Query  596  PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVH  417
            P    A   + FP+ L G ++  S+EAL+KNTGKESMQWG AAG+YSGLTYGL EARG H
Sbjct  69   PSEVSASKKNRFPN-LNGESSTKSLEALVKNTGKESMQWGLAAGLYSGLTYGLSEARGAH  127

Query  416  DWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            DW+NSA+AGA+TG A+AMT  +  +H+ V+QCA+TGAAISTAANLL+G+F
Sbjct  128  DWKNSAVAGALTGVAMAMTLSERTTHEQVVQCALTGAAISTAANLLSGVF  177



>ref|XP_002870177.1| ATOEP16-2/ATOEP16-S [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46436.1| ATOEP16-2/ATOEP16-S [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 141/173 (82%), Gaps = 12/173 (7%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT VEGA  D+    
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGAGFDSNNVG  68

Query  599  -PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-  426
             P EI G K H  FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG++E R 
Sbjct  69   PPSEITGNKKHR-FPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMKEVRG  125

Query  425  GVHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            G HDWRNSA+AGA+TGAA+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  126  GAHDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF  178



>ref|XP_008458360.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Cucumis 
melo]
Length=177

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 133/171 (78%), Gaps = 5/171 (3%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT-  600
            +L DEIR   H    L+DLGHPLLNR+ADSFVKAAGIGA+Q+V+REAYFT       ++ 
Sbjct  10   SLVDEIR-CTHSGPFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGSVDSNSV  68

Query  599  -PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARG  423
             PPE+   +    FP  LKG  NK S+EA++K+ GKES+QWG AAGVYSGLTYGL+EARG
Sbjct  69   PPPELSSIRKQR-FPG-LKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYGLKEARG  126

Query  422  VHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
             HDW+NSA+AGA+TG A+A+T+ + SH+H++Q AITGAA+STAAN+  GIF
Sbjct  127  AHDWKNSAIAGAVTGVAVALTSDESSHEHIVQYAITGAAMSTAANIFAGIF  177



>gb|AAV84280.1| dehydration up-regulated putative membrane pore protein [Xerophyta 
humilis]
Length=178

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 140/181 (77%), Gaps = 8/181 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRS-LDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            S T+L+ R T  DEI+   D G+  +FDLGHPLLNR+ +SFVKAAGIGA+QAV RE YF 
Sbjct  3    STTSLDTR-TFTDEIKGGWDKGW--MFDLGHPLLNRVTESFVKAAGIGAIQAVTREGYFI  59

Query  626  AVEGA--SRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSG  453
             VEG+  + D  P++   KN+  FP+ L+G N+  S+E ++K TGKE+ QWG AAGVYSG
Sbjct  60   TVEGSRSNNDGTPDMTAGKNNR-FPN-LRGENSSKSLEEMVKATGKEAFQWGLAAGVYSG  117

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL+EARG HDW+NSA+AGAITGAALA+TT+  + DHV+Q A+TGAAIST ANLL GI
Sbjct  118  LTYGLKEARGTHDWKNSAIAGAITGAALALTTEKSNSDHVVQSAVTGAAISTVANLLRGI  177

Query  272  F  270
            F
Sbjct  178  F  178



>ref|XP_004172663.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like, 
partial [Cucumis sativus]
Length=222

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT-  600
            ++ DEIR   HG   L+DLGHPLLNR+ADSFVKAAGIGA+Q+V+REAYFT       +  
Sbjct  55   SMVDEIRC-SHGGTFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGSVDSNIA  113

Query  599  -PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARG  423
             PPE+   +    FP  LKG  NK S+EA++K+ GKES+QWG AAGVYSGLTYGL+EARG
Sbjct  114  PPPELSSMRKQR-FPG-LKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYGLKEARG  171

Query  422  VHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
             HDW+NSA+AGA+TG A+A+T    SH+H++Q AITGAA+STAAN+  GIF
Sbjct  172  AHDWKNSAIAGAVTGVAVALTADKSSHEHIVQYAITGAAMSTAANIFAGIF  222



>gb|KGN47380.1| hypothetical protein Csa_6G307410 [Cucumis sativus]
Length=226

 Score =   188 bits (477),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT-  600
            ++ DEIR   HG   L+DLGHPLLNR+ADSFVKAAGIGA+Q+V+REAYFT       +  
Sbjct  59   SMVDEIRC-SHGGTFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGSVDSNIA  117

Query  599  -PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARG  423
             PPE+   +    FP  LKG  NK S+EA++K+ GKES+QWG AAGVYSGLTYGL+EARG
Sbjct  118  PPPELSSMRKQR-FPG-LKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYGLKEARG  175

Query  422  VHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
             HDW+NSA+AGA+TG A+A+T    SH+H++Q AITGAA+STAAN+  GIF
Sbjct  176  AHDWKNSAIAGAVTGVAVALTADKSSHEHIVQYAITGAAMSTAANIFAGIF  226



>ref|NP_849394.1| outer envelope pore protein 16-2 [Arabidopsis thaliana]
 sp|Q0WMZ5.1|OP162_ARATH RecName: Full=Outer envelope pore protein 16-2, chloroplastic; 
AltName: Full=Chloroplastic outer envelope pore protein of 
16 kDa 2; Short=AtOEP16-2; Short=OEP16-2; AltName: Full=Outer 
plastid envelope protein 16-S; Short=AtOEP16-S; Short=Seeds 
outer plastid envelope protein 16 [Arabidopsis thaliana]
 dbj|BAF01505.1| pore protein homolog [Arabidopsis thaliana]
 gb|AEE83706.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=178

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 140/173 (81%), Gaps = 12/173 (7%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT V+GA  D+    
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGAGFDSNNVG  68

Query  599  -PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-  426
             P EI G K H  FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG+ E R 
Sbjct  69   PPSEITGNKKHR-FPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMTEVRG  125

Query  425  GVHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            G HDWRNSA+AGA+TGAA+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  126  GAHDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF  178



>ref|XP_009107889.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Brassica rapa]
Length=178

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 133/172 (77%), Gaps = 10/172 (6%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG----ASRDT  600
            DEIRS +     LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT V+G    AS   
Sbjct  11   DEIRSFEKA--SLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGAGFEASNMG  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-G  423
            PP        H FP++   G +  S++AL+KNTGKES+QWG AAG+YSG+TYG++EAR G
Sbjct  69   PPSENAGSKKHRFPNL--SGESSKSLDALVKNTGKESLQWGLAAGLYSGITYGMKEARGG  126

Query  422  VHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
             HDWRNSA+AGA+TG A+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  127  AHDWRNSAVAGALTGGAMAMTTSESTSHEQVVQSALTGAAISTAANLLSSVF  178



>ref|XP_010434869.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010449838.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X1 [Camelina sativa]
Length=175

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 13/172 (8%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT VEGA  D+    
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGAGFDSNNVG  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-G  423
            PP        H FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG++E R G
Sbjct  69   PPS---ENKKHRFPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMKEVRGG  123

Query  422  VHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
             HDWRNSA+AGA+TGAA+AMTT D  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  124  AHDWRNSAVAGALTGAAMAMTTSDRTSHEQVVQSALTGAAISTAANLLSSVF  175



>ref|XP_010440195.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=175

 Score =   184 bits (468),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 136/172 (79%), Gaps = 13/172 (8%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT----  600
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT VEGA  D+    
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGAGFDSNNVG  68

Query  599  PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-G  423
            PP        H FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG++E R G
Sbjct  69   PPS---ENKKHRFPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMKEVRGG  123

Query  422  VHDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
             HDWRNSA+AG +TGAA+AMT  D  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  124  AHDWRNSAVAGVLTGAAMAMTISDRTSHEQVVQSALTGAAISTAANLLSSVF  175



>gb|AEV46836.1| plastid OEP16.2 [Pisum sativum]
Length=182

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 137/182 (75%), Gaps = 8/182 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            +++ +E R  L D++ + D    GLFDLGHPL+NRIA+SFVKAAGIGA QAV+R+AYF+A
Sbjct  5    TSSEVETRTML-DDLCNFDRK--GLFDLGHPLVNRIAESFVKAAGIGAAQAVSRDAYFSA  61

Query  623  VEGASRDT----PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYS  456
            ++G   D           A      P  L+G  +  S+EA++ + GKES+QWG AAG+YS
Sbjct  62   IDGTRTDNNGVKASSDVSATGKRRLPG-LRGETSNKSLEAMVIDAGKESLQWGVAAGLYS  120

Query  455  GLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTG  276
            GLTYGL+EARG HDW+NSA+AGAITGA LA+T +D +H+HV+QCAITGAAISTAANLLTG
Sbjct  121  GLTYGLKEARGAHDWKNSAVAGAITGATLALTMEDTTHEHVVQCAITGAAISTAANLLTG  180

Query  275  IF  270
            IF
Sbjct  181  IF  182



>ref|XP_004148230.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Cucumis sativus]
Length=272

 Score =   187 bits (476),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT-  600
            ++ DEIR   HG   L+DLGHPLLNR+ADSFVKAAGIGA+Q+V+REAYFT       +  
Sbjct  105  SMVDEIRC-SHGGTFLYDLGHPLLNRVADSFVKAAGIGALQSVSREAYFTVAGSVDSNIA  163

Query  599  -PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARG  423
             PPE+   +    FP  LKG  NK S+EA++K+ GKES+QWG AAGVYSGLTYGL+EARG
Sbjct  164  PPPELSSMRKQR-FPG-LKGETNKESLEAMVKSVGKESIQWGLAAGVYSGLTYGLKEARG  221

Query  422  VHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
             HDW+NSA+AGA+TG A+A+T    SH+H++Q AITGAA+STAAN+  GIF
Sbjct  222  AHDWKNSAIAGAVTGVAVALTADKSSHEHIVQYAITGAAMSTAANIFAGIF  272



>emb|CDY09710.1| BnaC07g33510D [Brassica napus]
Length=183

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 133/167 (80%), Gaps = 6/167 (4%)
 Frame = -3

Query  764  EIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIG  585
            EI+  ++    LFDLGHPLLN IADS VKAAG+GA+QAV+REAYFT V+GA  D+    G
Sbjct  21   EIKRFENEKASLFDLGHPLLNSIADSVVKAAGVGALQAVSREAYFTVVDGAGSDSSENNG  80

Query  584  GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVHDWR  408
               N H FP+ L+G ++K S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G HDWR
Sbjct  81   --SNKHRFPN-LRGESSK-SLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGGTHDWR  136

Query  407  NSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            NS +AGA+TGAA+A+TT +  SHD V+Q A+TGAAIS AANLL+ +F
Sbjct  137  NSVVAGALTGAAMAVTTSERTSHDQVVQSALTGAAISAAANLLSSVF  183



>ref|XP_009136748.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Brassica rapa]
Length=183

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 135/167 (81%), Gaps = 6/167 (4%)
 Frame = -3

Query  764  EIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIG  585
            EI+  ++    LFDLGHPLLN IADSFVKAAG+GA+QAV+REAYFT  +GA  D+  E  
Sbjct  21   EIKRFENEKASLFDLGHPLLNSIADSFVKAAGVGALQAVSREAYFTVADGAGSDS-SENN  79

Query  584  GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVHDWR  408
            G+K H  FP+ L+G ++K S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G HDWR
Sbjct  80   GSKQHR-FPN-LRGESSK-SLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGGSHDWR  136

Query  407  NSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            NS +AGA+TGAA+AMTT +  SHD V+Q A+TGAAIS AANLL+ IF
Sbjct  137  NSVVAGALTGAAMAMTTSERTSHDQVVQSALTGAAISAAANLLSSIF  183



>ref|NP_567488.1| outer envelope pore protein 16-2 [Arabidopsis thaliana]
 gb|AAM65873.1| pore protein homolog [Arabidopsis thaliana]
 gb|AEE83705.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Arabidopsis thaliana]
Length=176

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 138/171 (81%), Gaps = 10/171 (6%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT---P  597
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT V+G   +    P
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGFDSNNVGPP  68

Query  596  PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GV  420
             EI G K H  FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG+ E R G 
Sbjct  69   SEITGNKKHR-FPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMTEVRGGA  125

Query  419  HDWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            HDWRNSA+AGA+TGAA+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  126  HDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF  176



>emb|CDX90540.1| BnaA03g42410D [Brassica napus]
Length=174

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 6/167 (4%)
 Frame = -3

Query  764  EIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIG  585
            EI+  ++    LFDLGHPLLN IADSFVKAAG+GA+QAV+REAYFT  +GA  D+  E  
Sbjct  12   EIKRFENEKASLFDLGHPLLNSIADSFVKAAGVGALQAVSREAYFTVADGAGSDS-SENN  70

Query  584  GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVHDWR  408
            G+K H  FP+ L+G ++K S+EAL+KNTGKES+QWG AAG+YSG+TYG++EAR G HDWR
Sbjct  71   GSKQHR-FPN-LRGESSK-SLEALVKNTGKESLQWGLAAGLYSGITYGMKEARGGAHDWR  127

Query  407  NSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            NS +AGA+TGAA+A+TT +  SHD V+Q A+TGAAIS AANLL+ IF
Sbjct  128  NSVVAGALTGAAMAVTTSERTSHDQVVQSALTGAAISAAANLLSSIF  174



>ref|XP_010434870.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X2 [Camelina sativa]
 ref|XP_010449839.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic isoform 
X2 [Camelina sativa]
Length=173

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 136/170 (80%), Gaps = 11/170 (6%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT VEG   +   PP
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGFDSNNVGPP  68

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVH  417
                    H FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG++E R G H
Sbjct  69   S---ENKKHRFPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMKEVRGGAH  123

Query  416  DWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            DWRNSA+AGA+TGAA+AMTT D  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  124  DWRNSAVAGALTGAAMAMTTSDRTSHEQVVQSALTGAAISTAANLLSSVF  173



>ref|XP_010440196.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=173

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 134/170 (79%), Gaps = 11/170 (6%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT VEG   +   PP
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVEGFDSNNVGPP  68

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVH  417
                    H FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG++E R G H
Sbjct  69   S---ENKKHRFPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMKEVRGGAH  123

Query  416  DWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            DWRNSA+AG +TGAA+AMT  D  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  124  DWRNSAVAGVLTGAAMAMTISDRTSHEQVVQSALTGAAISTAANLLSSVF  173



>ref|XP_006414382.1| hypothetical protein EUTSA_v10026380mg [Eutrema salsugineum]
 gb|ESQ55835.1| hypothetical protein EUTSA_v10026380mg [Eutrema salsugineum]
Length=175

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 136/170 (80%), Gaps = 8/170 (5%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG--ASRDTPP  594
            DEIRS +     LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT V+G  +S   PP
Sbjct  10   DEIRSFEKA--SLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGFDSSNLGPP  67

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVH  417
                    H FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+ YG++EAR G H
Sbjct  68   SENNGSKKHRFPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGIAYGMKEARGGAH  125

Query  416  DWRNSalagaitgaalamtTKDHS-HDHVIQCAITGAAISTAANLLTGIF  270
            DWRNSA+AGA+TGAA+AMTT + + H+ V+Q A+TGAAISTAANLL+ +F
Sbjct  126  DWRNSAVAGALTGAAMAMTTSERTNHEQVVQSALTGAAISTAANLLSNVF  175



>ref|NP_001049884.1| Os03g0305600 [Oryza sativa Japonica Group]
 gb|ABF95523.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11798.1| Os03g0305600 [Oryza sativa Japonica Group]
 dbj|BAG88837.1| unnamed protein product [Oryza sativa Japonica Group]
Length=179

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 137/180 (76%), Gaps = 7/180 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S ++LE R  L DE+R L+  +  + DLGHPLLNR+A+SFVKAAGIGAVQAVARE+YF A
Sbjct  5    SNSSLETRTFL-DEVRGLEKNW--MVDLGHPLLNRVAESFVKAAGIGAVQAVARESYFMA  61

Query  623  VEGASRDT--PPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
            +EG    T    +  GA+   +FP  L GGN+  S EA++K+  KES+QWG AAG++SGL
Sbjct  62   MEGEGGGTGAVSDSTGARKR-SFPD-LNGGNSSKSAEAMVKSVSKESLQWGLAAGLHSGL  119

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGL EARG HDW+NS +AGA+TGAA+A+T+   SH+ V+QCAI GAA+STAAN+L+GI 
Sbjct  120  TYGLTEARGTHDWKNSVVAGALTGAAVALTSDRASHERVVQCAIAGAALSTAANVLSGIL  179



>ref|XP_004984632.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Setaria italica]
Length=177

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 4/167 (2%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEI  588
            DE+R    G   + DLGHPLLNRIA+SFVKAAGIGAVQAVARE+YF A+EG         
Sbjct  14   DEVRGGLEGKSWMLDLGHPLLNRIAESFVKAAGIGAVQAVARESYFMAIEGEGGSVSGAT  73

Query  587  GGAKNHHAFPSVLKGGNNKS-SVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDW  411
            G  K   +FP  L G N+ S S EA++KN  KES+QWG AAGV+SGLTYGL E RG HDW
Sbjct  74   GSRK--RSFPE-LNGTNSGSKSAEAMVKNVSKESLQWGLAAGVHSGLTYGLTEVRGTHDW  130

Query  410  RNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            RNSA+AGAITGAA+A+T+   SH+ V+QCAI GAA+STAAN+L+GIF
Sbjct  131  RNSAVAGAITGAAVALTSDRASHEQVVQCAIAGAALSTAANVLSGIF  177



>ref|XP_006282840.1| hypothetical protein CARUB_v10006765mg [Capsella rubella]
 gb|EOA15738.1| hypothetical protein CARUB_v10006765mg [Capsella rubella]
Length=173

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 136/170 (80%), Gaps = 11/170 (6%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+GA+QAV+REAYFT V+G   +   PP
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGFDSNNVGPP  68

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVH  417
                    H FP+ L+G ++K S++AL+KNTGKES+QWG AAG+YSG+TYG++E R G H
Sbjct  69   S---ESKKHRFPN-LRGESSK-SLDALVKNTGKESLQWGLAAGLYSGITYGMKEVRGGAH  123

Query  416  DWRNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            DW+NSA+AGA+TGAA+AMTT D  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  124  DWKNSAVAGALTGAAMAMTTSDRTSHEQVVQSALTGAAISTAANLLSSVF  173



>gb|EAY89687.1| hypothetical protein OsI_11222 [Oryza sativa Indica Group]
 gb|EAY89693.1| hypothetical protein OsI_11229 [Oryza sativa Indica Group]
Length=188

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 137/189 (72%), Gaps = 16/189 (8%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S ++LE R  L DE+R L+  +  + DLGHPLLNR+A+SFVKAAGIGAVQAVARE+YF A
Sbjct  5    SNSSLETRTFL-DEVRGLEKNW--MVDLGHPLLNRVAESFVKAAGIGAVQAVARESYFMA  61

Query  623  VEGA-----------SRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWG  477
            +EG                  +  GA+   +FP  L GGN+  S EA++K+  KES+QWG
Sbjct  62   MEGTCLVAAATGEGGGTGAVSDSTGARKR-SFPD-LNGGNSSKSAEAMVKSVSKESLQWG  119

Query  476  FAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAIST  297
             AAG++SGLTYGL EARG HDW+NS +AGA+TGAA+A+T+   SH+ V+QCAI GAA+ST
Sbjct  120  LAAGLHSGLTYGLTEARGTHDWKNSVVAGALTGAAVALTSDRASHERVVQCAIAGAALST  179

Query  296  AANLLTGIF  270
            AAN+L+GIF
Sbjct  180  AANVLSGIF  188



>ref|XP_006651306.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Oryza brachyantha]
Length=179

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 137/180 (76%), Gaps = 7/180 (4%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA  624
            S ++LE R  L DE+R L+  +  + DLGHPLLNR+A+SFVKAAGIGAVQAVARE+YF A
Sbjct  5    SNSSLETRTFL-DEVRGLEKNW--MLDLGHPLLNRVAESFVKAAGIGAVQAVARESYFMA  61

Query  623  VEGASRDTP--PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
            +EG         +  GA+   +FP  L GGN+  S EA++K+  KES+QWG AAG++SGL
Sbjct  62   MEGEGGGAGAVSDSTGARKR-SFPD-LNGGNSSKSAEAMVKSVSKESLQWGLAAGLHSGL  119

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGL EARG HDW+NS +AGA+TGAA+A+T+   SH+ V+QCAI GAA+STAAN+L+GIF
Sbjct  120  TYGLTEARGTHDWKNSVVAGALTGAAVALTSDRASHERVVQCAIAGAALSTAANVLSGIF  179



>gb|EPS72464.1| hypothetical protein M569_02294, partial [Genlisea aurea]
Length=167

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 5/172 (3%)
 Frame = -3

Query  788  EVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGAS  609
            E R  L D+IR+ D G    FDLGHP+LNR+ADSFV+AA I +VQAV REAYFTA+E   
Sbjct  1    ETRSFL-DDIRNFDRGC--FFDLGHPILNRMADSFVRAAVISSVQAVTREAYFTAIETGG  57

Query  608  RDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREA  429
                 E G  K +H FP  L+G +++ SVEAL+K+TGKES+QWG AAG+YSGLTYGL+EA
Sbjct  58   -IVKSETGPQKKNHPFPE-LRGEDSRKSVEALVKSTGKESLQWGMAAGLYSGLTYGLKEA  115

Query  428  RGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            RG HDW+NSA+AGAITGA +A+TT D SH+ V+QCAITGAA+S AANLL+GI
Sbjct  116  RGTHDWKNSAVAGAITGAVVALTTDDRSHERVVQCAITGAALSAAANLLSGI  167



>ref|XP_007035758.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 2 [Theobroma cacao]
 gb|EOY06684.1| Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein isoform 2 [Theobroma cacao]
Length=201

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 145/204 (71%), Gaps = 31/204 (15%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            +TNLE R +L D+ R+ D G    FDLGHPLLNRIA+SFVKAAGIGA+QA ARE+ F AV
Sbjct  2    STNLETR-SLLDDWRNFDKGC--FFDLGHPLLNRIAESFVKAAGIGAIQAAARESCFIAV  58

Query  620  EGASRDTPPEIGGAKNH-HAFPSVLKGGNNKSSVEALI----------------------  510
            EG      P+I G+KN  + FP  L+G  N+ S+EA++                      
Sbjct  59   EGTESSNSPDITGSKNKKNRFPD-LRGETNRKSLEAMVPAIPEDILLIYFFCFIQVIFNN  117

Query  509  ----KNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSH  342
                K+TGKES+QWG AAG+YSGLTYGL+EARG HDW+NSA+AGAITG ALA+T+++ SH
Sbjct  118  ILQVKSTGKESLQWGLAAGLYSGLTYGLKEARGAHDWKNSAMAGAITGMALALTSEEASH  177

Query  341  DHVIQCAITGAAISTAANLLTGIF  270
            + V+QCAITGAAISTAANLLTGIF
Sbjct  178  EQVVQCAITGAAISTAANLLTGIF  201



>gb|ACG48163.1| hypothetical protein [Zea mays]
 tpg|DAA45003.1| TPA: putative mitochondrial import inner membrane translocase 
subunit Tim17 family protein [Zea mays]
Length=178

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 125/170 (74%), Gaps = 5/170 (3%)
 Frame = -3

Query  773  LGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPP  594
            L DE+R        + DLGHPLLNR+A+SF KAAGIGAVQAVARE+YF A EG       
Sbjct  12   LADEVRGSLETKNWMLDLGHPLLNRVAESFAKAAGIGAVQAVARESYFMATEGEGGSVSG  71

Query  593  EIGGAKNHHAFPSVLKGGNNKS--SVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGV  420
              G  K   +FP  L G N+ S  S EA++K+  KES+QWG AAGV+SGLTYGL   RG 
Sbjct  72   ATGARK--RSFPE-LNGTNSSSIKSAEAMVKSVSKESLQWGLAAGVHSGLTYGLAGVRGT  128

Query  419  HDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            HDWRNSA+AGAITGAA+A+T++  SH+ V+QCAITGAA+STAAN+L+GIF
Sbjct  129  HDWRNSAVAGAITGAAVALTSEHASHEQVVQCAITGAALSTAANVLSGIF  178



>gb|EPS58527.1| hypothetical protein M569_16286, partial [Genlisea aurea]
Length=175

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 135/178 (76%), Gaps = 8/178 (4%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTA--V  621
            NL+ R +  DE++  D     LFDLGHPLLNRI +SF+KAAG+GAVQA++R+       V
Sbjct  3    NLQTR-SFFDELKGFDGD--DLFDLGHPLLNRIGESFIKAAGVGAVQALSRQTVLKIHDV  59

Query  620  EGA-SRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTY  444
             G  S D P E GG+K +  F  +  G NN  SVEAL+K++GKES++WG AAG+YSG++Y
Sbjct  60   SGQNSSDNPHETGGSKRYRCFLGL--GENNSKSVEALVKSSGKESLKWGLAAGIYSGVSY  117

Query  443  GLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            GL+EA GVHDW+NSA AGA+TGAALA+T+ DHS + V+QCAI+GAAISTAA+LL+GI 
Sbjct  118  GLKEATGVHDWKNSAFAGAVTGAALALTSDDHSGEEVMQCAISGAAISTAAHLLSGIL  175



>ref|XP_010671676.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=189

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 136/172 (79%), Gaps = 4/172 (2%)
 Frame = -3

Query  782  RCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRD  603
            + ++ DEIRS +    G FDLGHPLLNRI  SF+K AGIGA+QAV+REAYFTA++G   D
Sbjct  21   KRSMMDEIRSFEKD--GFFDLGHPLLNRITHSFIKVAGIGAIQAVSREAYFTAIDGVGID  78

Query  602  TPPEIG-GAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR  426
            +    G GAK  + F S L+G  ++ SVEAL+K+TGKES QWG AAGV+SGLTYGL+EAR
Sbjct  79   SGSANGNGAKRRNTF-SDLRGETSRKSVEALVKHTGKESFQWGLAAGVFSGLTYGLKEAR  137

Query  425  GVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            G HDW+NSA+AGA+TG  LA+T++D +H+ V+Q AITGAAI+TAAN+LTG F
Sbjct  138  GYHDWKNSAVAGALTGMTLALTSEDTTHEQVVQSAITGAAIATAANMLTGTF  189



>ref|XP_003558089.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X2 [Brachypodium distachyon]
Length=174

 Score =   168 bits (425),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 2/166 (1%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEI  588
            DE+R L+  +  + DLGHPLLNR+ADSF KAAGIGA+QAV R++YF AVEG S  T    
Sbjct  11   DEVRGLEKNW--MLDLGHPLLNRVADSFAKAAGIGAIQAVTRDSYFMAVEGESGGTGAVS  68

Query  587  GGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWR  408
                        +KG NN  S E ++K+  KES QWG AAG++SGLTYGL+E RG HDW+
Sbjct  69   DATGTRKRTFGDIKGTNNSKSAEDMVKSVSKESFQWGLAAGMHSGLTYGLKEVRGTHDWK  128

Query  407  NSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            NSA+AGA+TGAA+A+T+++ SH+ ++QCAITGAA+S AAN+L+ I 
Sbjct  129  NSAVAGAVTGAAVALTSENASHEQIVQCAITGAALSAAANVLSDIL  174



>ref|XP_010228715.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
isoform X1 [Brachypodium distachyon]
Length=175

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            DE+R L+  +  + DLGHPLLNR+ADSF KAAGIGA+QAV R++YF AVEG S  T    
Sbjct  11   DEVRGLEKNW--MLDLGHPLLNRVADSFAKAAGIGAIQAVTRDSYFMAVEGESGGTGAVS  68

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHD  414
            +  G +    F  +  G NN  S E ++K+  KES QWG AAG++SGLTYGL+E RG HD
Sbjct  69   DATGTRKR-TFGDIKAGTNNSKSAEDMVKSVSKESFQWGLAAGMHSGLTYGLKEVRGTHD  127

Query  413  WRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            W+NSA+AGA+TGAA+A+T+++ SH+ ++QCAITGAA+S AAN+L+ I 
Sbjct  128  WKNSAVAGAVTGAAVALTSENASHEQIVQCAITGAALSAAANVLSDIL  175



>ref|XP_003567585.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Brachypodium distachyon]
Length=174

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 133/178 (75%), Gaps = 6/178 (3%)
 Frame = -3

Query  800  ATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAV  621
            +T L+ R TL DE+ ++D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAYF  V
Sbjct  2    STRLDTR-TLKDEVANMDKR--PLLDLGHPLLNRVADSFIRAAGVGATRAVSREAYFVTV  58

Query  620  EG-ASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTY  444
            EG  S D       AK +H F S+ +G + + S++A++K+ GKE+ QWG AAGVYSG+TY
Sbjct  59   EGLGSGDAAALDSNAKRNH-FSSI-RGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGITY  116

Query  443  GLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            GLREARG HDW+NSA+AGAI GAA+A+T      DHV+  AITGAA+S+AA +L+GIF
Sbjct  117  GLREARGCHDWKNSAIAGAIAGAAVALTGDTGHADHVVHFAITGAALSSAATMLSGIF  174



>ref|NP_001142523.1| uncharacterized protein LOC100274762 [Zea mays]
 gb|ACG24745.1| hypothetical protein [Zea mays]
Length=179

 Score =   166 bits (419),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 4/167 (2%)
 Frame = -3

Query  764  EIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIG  585
            E+R        + DLGHPLLNR+A+SF KAAGIGAVQAVARE+YF A EG    +     
Sbjct  15   EVRGSLETKNWMLDLGHPLLNRVAESFAKAAGIGAVQAVARESYFMATEGEGGGSVSGAT  74

Query  584  GAKNHHAFPSVLKGGNNKS--SVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDW  411
            GA+   +FP  L G N+ S  S EA++K+  KES+QWG AAGV+SGLTYGL   RG HDW
Sbjct  75   GARKR-SFPE-LNGTNSSSIKSAEAMVKSVSKESLQWGLAAGVHSGLTYGLAGVRGTHDW  132

Query  410  RNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            RNSA+AGAITGAA+A+T++  SH+ V+QCAITGAA+STAAN+L+GIF
Sbjct  133  RNSAVAGAITGAAVALTSEHASHEQVVQCAITGAALSTAANVLSGIF  179



>dbj|BAJ86836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=180

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 127/167 (76%), Gaps = 5/167 (3%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            +E+R L+  +  + +LGHPLLNR+ADSFVKAAGIGA+QAVAR++YF A+EG S  T    
Sbjct  16   EEVRGLEKNW--MLELGHPLLNRVADSFVKAAGIGAMQAVARDSYFMAIEGESGGTGAVS  73

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHD  414
            +  G++    FP +  G +N  S E ++K+  KES QWG AAG++SGLTYGL E RG HD
Sbjct  74   DATGSRKR-TFPDLNGGTSNSKSAEDMVKSVSKESFQWGLAAGMHSGLTYGLTEVRGAHD  132

Query  413  WRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            W+NSALAGA+TGAA+A+T+ + SH+ ++QCAITGAA+S AAN+L+ I
Sbjct  133  WKNSALAGAVTGAAVALTSDNSSHERIVQCAITGAALSAAANVLSDI  179



>gb|ACG25972.1| hypothetical protein [Zea mays]
Length=179

 Score =   163 bits (413),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 4/167 (2%)
 Frame = -3

Query  764  EIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIG  585
            E+R        + DLGHPLLNR+A+SF KAAGIGAVQAVARE+YF A EG    +     
Sbjct  15   EVRGSLETKNWMLDLGHPLLNRVAESFAKAAGIGAVQAVARESYFMATEGEGGGSVSGTT  74

Query  584  GAKNHHAFPSVLKGGNNKS--SVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDW  411
            GA+   +FP  L G N+ S  S EA++K+  KES+QWG AAGV+SGLTYGL   RG HDW
Sbjct  75   GARKR-SFPE-LNGTNSSSIKSAEAMVKSVSKESLQWGLAAGVHSGLTYGLAGVRGTHDW  132

Query  410  RNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            RNSA+AGAITGAA+A+T++  SH+ V+QCAITGAA+STAAN+L+GIF
Sbjct  133  RNSAVAGAITGAAVALTSEHASHEQVVQCAITGAALSTAANVLSGIF  179



>gb|EMS68749.1| hypothetical protein TRIUR3_14005 [Triticum urartu]
Length=189

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 125/180 (69%), Gaps = 17/180 (9%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEI  588
            DE+R L+  +  + DLGHPLLNR+ADSFVKAAGIGA+QAV R++YF A+EG S  T    
Sbjct  11   DEVRGLEKNW--MLDLGHPLLNRVADSFVKAAGIGAIQAVTRDSYFMAIEGESGGTGAVS  68

Query  587  GGA-KNHHAFPSVLKGGNNKSSVEALIKNTGKESMQW--------------GFAAGVYSG  453
            G    +   FP +  G +N  S EA++K+  KES QW              G AAG++SG
Sbjct  69   GATGSSKRTFPDLNGGTSNSKSAEAMVKSVSKESFQWGKQCSPYNFVDVVAGLAAGMHSG  128

Query  452  LTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            LTYGL E RG HDW+NSALAGA+TGAA+A+T+ + SH+ V+QCAITGAA+S AAN+L+ I
Sbjct  129  LTYGLAEVRGTHDWKNSALAGAVTGAAVALTSDNASHEQVVQCAITGAALSAAANVLSDI  188



>ref|XP_006839205.1| hypothetical protein AMTR_s02234p00007680 [Amborella trichopoda]
 gb|ERN01774.1| hypothetical protein AMTR_s02234p00007680 [Amborella trichopoda]
Length=142

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = -3

Query  686  FVKAAGIGAVQAVAREAYFTAVEGASRDTP--PEIGGAKNHHAFPSVLKGGNNKSSVEAL  513
            FV    IGAVQAV REAYFTA+EGA  DT   P+          P  LKG     S+EA+
Sbjct  3    FVCGRQIGAVQAVCREAYFTALEGAGLDTSGVPDASKLARRQRLPD-LKGETCAKSLEAM  61

Query  512  IKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHV  333
            +K TGKES+QWG AAG+YSG+TYGL+EARG HDW+NSA+AGA+TGA LA+TT+D SH+ +
Sbjct  62   VKQTGKESIQWGLAAGMYSGITYGLKEARGSHDWKNSAIAGAVTGATLALTTEDPSHEQI  121

Query  332  IQCAITGAAISTAANLLTGIF  270
            +QCAITGAA+STAANLLTGIF
Sbjct  122  VQCAITGAALSTAANLLTGIF  142



>emb|CAB10395.1| pore protein homolog [Arabidopsis thaliana]
 emb|CAB78658.1| pore protein homolog [Arabidopsis thaliana]
Length=160

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 20/168 (12%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEI  588
            DEIRS +  +  LFDLGHPLLNRIADSFVKAAG+             + +  +   P EI
Sbjct  11   DEIRSFEKAH--LFDLGHPLLNRIADSFVKAAGV-------------SFDSNNVGPPSEI  55

Query  587  GGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVHDW  411
             G K H  FP+ L+G ++KS ++AL+KNTGKES+QWG AAG+YSG+TYG+ E R G HDW
Sbjct  56   TGNKKHR-FPN-LRGESSKS-LDALVKNTGKESLQWGLAAGLYSGITYGMTEVRGGAHDW  112

Query  410  RNSalagaitgaalamtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            RNSA+AGA+TGAA+AMTT +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  113  RNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF  160



>gb|EMS47409.1| hypothetical protein TRIUR3_06756 [Triticum urartu]
Length=187

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 133/176 (76%), Gaps = 5/176 (3%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            + L+ R TL DE+ S+D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAYF AVE
Sbjct  17   SRLDAR-TLKDEVASMDRRP--LLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVAVE  73

Query  617  GASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGL  438
            G   D+      AK +H F S  +G + + S++A++K+  KE++QWG AAGVYSG+TYGL
Sbjct  74   GMGGDSTGLDSTAKRNH-FSSA-RGDDGQKSLDAVVKSASKEAIQWGLAAGVYSGITYGL  131

Query  437  REARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            REARG HDW+NSA+AGAI GAA+A+T  +   DHV+  AITGAA+S+AA +L+GIF
Sbjct  132  REARGHHDWKNSAIAGAIAGAAVALTGDNGHSDHVVHFAITGAALSSAATMLSGIF  187



>gb|EAZ26649.1| hypothetical protein OsJ_10553 [Oryza sativa Japonica Group]
Length=162

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 125/180 (69%), Gaps = 24/180 (13%)
 Frame = -3

Query  803  SATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAG--IGAVQAVAREAYF  630
            S ++LE R  L DE+R L+  +  + DLGHPLLNR+A+SFVKAAG  +GA          
Sbjct  5    SNSSLETRTFL-DEVRGLEKNW--MVDLGHPLLNRVAESFVKAAGGRLGA----------  51

Query  629  TAVEGASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGL  450
                GA  D+     GA+   +FP  L GGN+  S EA++K+  KES+QWG AAG++SGL
Sbjct  52   ---RGAVSDST----GARKR-SFPD-LNGGNSSKSAEAMVKSVSKESLQWGLAAGLHSGL  102

Query  449  TYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            TYGL EARG HDW+NS +AGA+TGAA+A+T+   SH+ V+QCAI GAA+STAAN+L+GI 
Sbjct  103  TYGLTEARGTHDWKNSVVAGALTGAAVALTSDRASHERVVQCAIAGAALSTAANVLSGIL  162



>gb|ADK88900.1| outer membrane channel protein OEP16-2 [Triticum aestivum]
Length=173

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 128/169 (76%), Gaps = 4/169 (2%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTP  597
            TL DE+ S+D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAYF AVEG   D+ 
Sbjct  9    TLKDEVASMDRR--PLLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVAVEGMWGDST  66

Query  596  PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVH  417
                 AK  H F S  +G + + S++A++K+  KE++QWG AAGVYSG+TYGLREARG H
Sbjct  67   GLDSTAKRSH-FSSA-RGDDGQKSLDAVVKSASKEAIQWGLAAGVYSGITYGLREARGHH  124

Query  416  DWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            DW+NSA+AGAI GAA+A+T  +   DHV+  AITGAA+S+AA +L+GIF
Sbjct  125  DWKNSAIAGAIAGAAVALTGDNGHSDHVVHFAITGAALSSAATMLSGIF  173



>gb|AAL23749.1| stress-inducible membrane pore protein [Bromus inermis]
Length=157

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 117/154 (76%), Gaps = 2/154 (1%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            L DLGHPLLNR+ADSF++AAG+GA +AV+REAYF  VEG   D+      AK  H F S 
Sbjct  6    LLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVTVEGMGGDSTGLDSNAKRSH-FSSA  64

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G + + S E ++K+ GKE+ QWG AAGVYSGLTYGLREARG HDW+NSA+AGA+ GAA
Sbjct  65   -RGDDGQKSFEVVVKSAGKEAFQWGLAAGVYSGLTYGLREARGCHDWKNSAIAGALAGAA  123

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            +A+T  +   DHV+  AITGAA+S+AA +L+GIF
Sbjct  124  VALTGDNGHSDHVVHFAITGAALSSAATMLSGIF  157



>ref|NP_001152606.1| LOC100286246 [Zea mays]
 gb|ACG40477.1| stress-inducible membrane pore protein [Zea mays]
 gb|ACG48502.1| stress-inducible membrane pore protein [Zea mays]
 tpg|DAA54343.1| TPA: putative mitochondrial import inner membrane translocase 
subunit Tim17 family protein [Zea mays]
Length=174

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 131/179 (73%), Gaps = 9/179 (5%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            + L+ R TL DE+ S+D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAY   VE
Sbjct  2    STLDTR-TLKDELTSMDRKC--LVDLGHPLLNRVADSFIRAAGVGAARAVSREAYVVTVE  58

Query  617  GASRDTP--PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTY  444
            G S D+      GG ++H  F S+ +G + + S++A++K  GKE+ QWG AAGVYSGLTY
Sbjct  59   GLSGDSSGLDADGGKRSH--FSSI-RGDDGQRSLDAVVKTAGKEAFQWGLAAGVYSGLTY  115

Query  443  GLREARGVHDWRNSalagaitgaalamtTKDHSH-DHVIQCAITGAAISTAANLLTGIF  270
             LREARG HDW+NSA+AGAI GAA+A+T     H D ++  AITGAA+S+A +LL+GIF
Sbjct  116  ALREARGCHDWKNSAIAGAIAGAAVALTGDAGGHSDKLVNFAITGAALSSAGSLLSGIF  174



>ref|XP_006645799.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Oryza brachyantha]
Length=173

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 132/176 (75%), Gaps = 5/176 (3%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            + L+ R TL DE+ S+D  +  L DLGHPL+NR+ADSF++AAG+GA +AV+REAYF  VE
Sbjct  3    SRLDTR-TLKDEVASMDKRW--LVDLGHPLVNRVADSFIRAAGVGAARAVSREAYFVTVE  59

Query  617  GASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGL  438
            G   +T    G  K  + F SV +G + + S++A++K+ GKE+ QWG AAGVYSGLTYGL
Sbjct  60   GLGGETAGLDGNVKRSN-FSSV-RGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGLTYGL  117

Query  437  REARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            RE RG HDW+NSA+AGA+ G A+A+T    + DH++  AITGAA+S+AA+LL+GIF
Sbjct  118  REVRGCHDWKNSAVAGAVAGVAVALTGDTGNADHMVHFAITGAALSSAASLLSGIF  173



>gb|EEC70487.1| hypothetical protein OsI_01558 [Oryza sativa Indica Group]
 gb|EEE54412.1| hypothetical protein OsJ_01451 [Oryza sativa Japonica Group]
Length=172

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 132/179 (74%), Gaps = 7/179 (4%)
 Frame = -3

Query  806  MSATNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFT  627
            MS++ L+   TL +E+ S+D  +  L DLGHPL+NR+ADSF++AAG+GA +AV+REAYF 
Sbjct  1    MSSSRLDT-WTLKEEVASMDKRW--LVDLGHPLVNRVADSFIRAAGVGAARAVSREAYFV  57

Query  626  AVEGASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLT  447
             VEG   DT     G  N     +  +G + + S++A++K+ GKE+ QWG AAGVYSGLT
Sbjct  58   TVEGLGGDTA----GLDNAVKRSNFSRGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGLT  113

Query  446  YGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            YGLREARG HDW+NSA+AGAI G A+A+T    + DH++  AITGAA+S+AA+LL+GI+
Sbjct  114  YGLREARGCHDWKNSAVAGAIAGVAVALTGDTGNADHMVHFAITGAALSSAASLLSGIY  172



>emb|CAK26794.1| hypothetical protein [Sporobolus stapfianus]
Length=130

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = -3

Query  665  GAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESM  486
            GA QA+ARE+YF A++     +     G+K   +FP  L G N+  S EAL+KN  KES+
Sbjct  1    GAAQALARESYFMAIDAGEGGSVSGSTGSKKR-SFPD-LNGSNSSKSAEALVKNVSKESL  58

Query  485  QWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAA  306
            QWG AAGV+SGLTYGL E RG HDWRNS +AGA+TGAA+A+T+   SH+ V+QCAI GAA
Sbjct  59   QWGLAAGVHSGLTYGLTEVRGTHDWRNSVVAGAVTGAAVALTSDRASHEQVVQCAIVGAA  118

Query  305  ISTAANLLTGIF  270
            +STAAN+L+G+F
Sbjct  119  LSTAANVLSGVF  130



>gb|EMT25997.1| hypothetical protein F775_27388 [Aegilops tauschii]
Length=271

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 117/168 (70%), Gaps = 13/168 (8%)
 Frame = -3

Query  767  DEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDT--PP  594
            +E+R L+  +  + DLGHPLLNR+ADSFVKAAGIGA+QAV R++YF A+EG S  T    
Sbjct  115  EEVRGLEKKW--MLDLGHPLLNRVADSFVKAAGIGAIQAVTRDSYFMAMEGESGGTGAVS  172

Query  593  EIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHD  414
            +  G++    FP  L G   +  V  +        +  G AAG++SGLTYGL E RG HD
Sbjct  173  DATGSRK-RTFPD-LSGEKRQQGVVPV-------GLDAGLAAGMHSGLTYGLAEVRGTHD  223

Query  413  WRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            W++SA+AGA+TGAA+A+T+ + SH+ V+QCAITGAA+S AAN+L+ I 
Sbjct  224  WKSSAVAGAVTGAAVALTSDNASHERVVQCAITGAALSAAANVLSDIV  271



>ref|XP_004967558.1| PREDICTED: outer envelope pore protein 16-2, chloroplastic-like 
[Setaria italica]
Length=174

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 134/179 (75%), Gaps = 9/179 (5%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            + L+ R TL DE+ ++D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAYF  VE
Sbjct  2    SRLDTR-TLKDELTNMDRR--PLLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVTVE  58

Query  617  GASRDTP--PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTY  444
            G S D+      GG ++H    S ++G +++ S++A++K  GKE+ QWG AAGVYSGLTY
Sbjct  59   GLSGDSAGLDPNGGKRSHF---SSIRGDDSQKSLDAVVKTAGKEAFQWGLAAGVYSGLTY  115

Query  443  GLREARGVHDWRNSalagaitgaalamtTKDHSH-DHVIQCAITGAAISTAANLLTGIF  270
            GLREARG HDW+NSA+AGAI GAA+A+T     H D ++  AITGAA+S+AA+LL+G+F
Sbjct  116  GLREARGCHDWKNSAIAGAIAGAAVALTGDAGGHSDKLVHFAITGAALSSAASLLSGVF  174



>dbj|BAB20636.1| putative stress-inducible membrane pore protein [Oryza sativa 
Japonica Group]
 dbj|BAB93165.1| putative stress-inducible membrane pore protein [Oryza sativa 
Japonica Group]
Length=263

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 126/169 (75%), Gaps = 6/169 (4%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTP  597
            TL +E+ S+D  +  L DLGHPL+NR+ADSF++AAG+GA +AV+REAYF  VEG   DT 
Sbjct  101  TLKEEVASMDKRW--LVDLGHPLVNRVADSFIRAAGVGAARAVSREAYFVTVEGLGGDT-  157

Query  596  PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVH  417
                G  N     +  +G + + S++A++K+ GKE+ QWG AAGVYSGLTYGLREARG H
Sbjct  158  ---AGLDNAVKRSNFSRGDDGQKSLDAVVKSAGKEAFQWGLAAGVYSGLTYGLREARGCH  214

Query  416  DWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            DW+NSA+AGAI G A+A+T    + DH++  AITGAA+S+AA+LL+GI+
Sbjct  215  DWKNSAVAGAIAGVAVALTGDTGNADHMVHFAITGAALSSAASLLSGIY  263



>gb|AAT45008.1| stress-inducible membrane pore-like protein, partial [Xerophyta 
humilis]
Length=110

 Score =   119 bits (297),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = -3

Query  605  DTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR  426
            D  P++   KN+  FP+ L+G N+  S+E ++K TGKE+ QWG AAGVYSGLTYGL+EAR
Sbjct  1    DGTPDMTAGKNNR-FPN-LRGDNSSKSLEEMVKATGKEAFQWGLAAGVYSGLTYGLKEAR  58

Query  425  GVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            G HDW+NSA+AGAITGAALA+TT+  + DHV+Q A+TGAAIST ANLL GIF
Sbjct  59   GTHDWKNSAIAGAITGAALALTTEKSNSDHVVQSAVTGAAISTVANLLRGIF  110



>ref|XP_001761140.1| predicted protein [Physcomitrella patens]
 gb|EDQ74207.1| predicted protein [Physcomitrella patens]
Length=147

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 95/153 (62%), Gaps = 24/153 (16%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            L DLGHPLLNR+ D FVK  G+GA+ A +++ Y                          +
Sbjct  18   LVDLGHPLLNRVVDGFVKVGGVGALHAASQDTYL------------------------FL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            L+   NK S+E  ++  GKE++QWG  AGVY+G+TYG++EARGVHDW+N+ L GA+TGAA
Sbjct  54   LQEETNKKSLEKTVQRMGKEAVQWGLVAGVYTGMTYGMQEARGVHDWKNALLGGALTGAA  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            L++T  +   D V++ AITG AI+TAA  L  +
Sbjct  114  LSLTEPNPRSDRVVRGAITGGAIATAAEFLRSL  146



>ref|XP_001774786.1| predicted protein [Physcomitrella patens]
 gb|EDQ60457.1| predicted protein [Physcomitrella patens]
Length=139

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 96/150 (64%), Gaps = 16/150 (11%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLNR+ D F+K  GIGA+ A A+++Y   ++G +                 + 
Sbjct  1    MVDLGNPLLNRVVDGFIKVGGIGALHAAAQDSYRLTLQGTN----------------CTF  44

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            L    ++ S+E   +  GKE++QWG AAGVY+G+TY ++EARG+ DWRN  + GAITGAA
Sbjct  45   LYFTTSQRSLEKTARRLGKEALQWGLAAGVYTGVTYSMQEARGISDWRNPLVGGAITGAA  104

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            L++T  D   D V+Q A+TG+AI++AA  L
Sbjct  105  LSLTETDPRLDRVVQSAVTGSAIASAAEFL  134



>ref|XP_001772989.1| predicted protein [Physcomitrella patens]
 gb|EDQ62214.1| predicted protein [Physcomitrella patens]
Length=147

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 97/153 (63%), Gaps = 24/153 (16%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            L DLGHP+LNR+ D FVK  G+GA+ A +++A        SR                 +
Sbjct  18   LVDLGHPMLNRVVDGFVKVGGVGALHAASQDA--------SR----------------FL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            L+   NK S+E  ++  GKE++QWG  AGVY+G+TYG++EARGVHDW+N+ L GA+TGAA
Sbjct  54   LQEETNKKSLEMSVQRMGKEAVQWGLVAGVYTGMTYGMQEARGVHDWKNALLGGALTGAA  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            L++T  +   D +++ AITG AI+TAA  L  +
Sbjct  114  LSLTEANPRSDRIVRGAITGGAIATAAEFLRSL  146



>ref|XP_002963833.1| hypothetical protein SELMODRAFT_438581 [Selaginella moellendorffii]
 gb|EFJ35704.1| hypothetical protein SELMODRAFT_438581 [Selaginella moellendorffii]
Length=147

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 26/154 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAY-FTAVEGASRDTPPEIGGAKNHHAFPS  555
            L D+GHPLLNRI D F+K  G GA+ A A+E+  + + E A                   
Sbjct  18   LIDMGHPLLNRIVDGFIKVGGTGALHAAAQESMRYVSQESA-------------------  58

Query  554  VLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitga  375
                  +K S+E  +   GKE +QWG  AG+YSG+TY ++EARGVHDW+N+ L GA+TGA
Sbjct  59   ------DKRSLEKSVNQMGKECLQWGMVAGIYSGMTYTMQEARGVHDWKNALLGGALTGA  112

Query  374  alamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            AL++T  + +H+ VI  AITG AI+TAA  L  +
Sbjct  113  ALSLTDSNVTHERVISSAITGGAIATAAEFLRNL  146



>ref|XP_002984416.1| hypothetical protein SELMODRAFT_423634 [Selaginella moellendorffii]
 gb|EFJ14466.1| hypothetical protein SELMODRAFT_423634 [Selaginella moellendorffii]
Length=139

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 95/153 (62%), Gaps = 23/153 (15%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            +FD G+P+LN + D F+K  G+GA+QA ++E+Y   V     DT                
Sbjct  9    MFDTGNPMLNSVVDGFIKVGGVGAIQAASKESYRILVHD---DT----------------  49

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
                N++ SVE  ++  G++S+ WG AAG+Y+G++YG++EARGV+DW+N+ LAGA+TGAA
Sbjct  50   ----NSRRSVERAVQRMGRDSVNWGLAAGMYTGVSYGIQEARGVNDWKNAVLAGAVTGAA  105

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            + +       DHV+   ITG AI+TAA +L  +
Sbjct  106  ITLANPRPRQDHVVHNMITGGAIATAAEILRNL  138



>ref|XP_002972844.1| hypothetical protein SELMODRAFT_413476 [Selaginella moellendorffii]
 gb|EFJ26065.1| hypothetical protein SELMODRAFT_413476 [Selaginella moellendorffii]
Length=139

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 95/153 (62%), Gaps = 23/153 (15%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            +FD G+P+LN + D F+K  G+GA+QA ++E+Y   V     DT                
Sbjct  9    MFDTGNPMLNSVVDGFIKVGGVGAIQAASKESYRILVHD---DT----------------  49

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
                N++ SVE  ++  G++S+ WG AAG+Y+G++YG++EARGV+DW+N+ LAGA+TGAA
Sbjct  50   ----NSRRSVERAVQRMGRDSVNWGLAAGMYTGVSYGIQEARGVNDWKNAVLAGAVTGAA  105

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            + +       DHV+   ITG AI+TAA ++  +
Sbjct  106  ITLANPRPRQDHVVHNMITGGAIATAAEIIRNL  138



>emb|CDY22776.1| BnaA08g06060D [Brassica napus]
Length=148

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 2/93 (2%)
 Frame = -3

Query  542  GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREAR-GVHDWRNSalagaitgaala  366
            G +  S++AL+KNTGKES+QWG AAG+YSG+TYG++EAR G HDWRNSA+AGA+TG A+A
Sbjct  56   GESSKSLDALVKNTGKESLQWGLAAGLYSGITYGMKEARGGAHDWRNSAVAGALTGGAMA  115

Query  365  mtTKDH-SHDHVIQCAITGAAISTAANLLTGIF  270
            MT  +  SH+ V+Q A+TGAAISTAANLL+ +F
Sbjct  116  MTPSESTSHEQVVQSALTGAAISTAANLLSSVF  148



>ref|XP_001764509.1| predicted protein [Physcomitrella patens]
 gb|EDQ70776.1| predicted protein [Physcomitrella patens]
Length=147

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 86/151 (57%), Gaps = 26/151 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLGHPLLN   D F+K  G+GA  AV ++ +                          +
Sbjct  18   IVDLGHPLLNYSVDGFLKVGGVGAAHAVVQDTF-------------------------RI  52

Query  551  LKG-GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitga  375
            LK     K+ +E L+K  G+E +QWG  AGVY+G+ Y L ++RGV DW+N+A+ GA+TGA
Sbjct  53   LKSEALTKNDLEKLVKRAGREGLQWGTVAGVYAGVEYSLEKSRGVQDWKNAAIGGAVTGA  112

Query  374  alamtTKDHSHDHVIQCAITGAAISTAANLL  282
             L++T    + D ++Q AITG A++TA+  +
Sbjct  113  ILSLTESGFTKDKMLQQAITGGALATASEFI  143



>ref|XP_002971785.1| hypothetical protein SELMODRAFT_441602 [Selaginella moellendorffii]
 gb|EFJ27534.1| hypothetical protein SELMODRAFT_441602 [Selaginella moellendorffii]
Length=215

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 26/108 (24%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAY-FTAVEGASRDTPPEIGGAKNHHAFPS  555
            L D+GHPLLNRI D F+K  G GA+ A A+E+  + + E A                   
Sbjct  18   LIDMGHPLLNRIVDGFIKVGGTGALHAAAQESMRYVSQESA-------------------  58

Query  554  VLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDW  411
                  NK S+E  +   GKE +QWG  AG+YSG+TY ++EARGVHDW
Sbjct  59   ------NKRSLEKSVNQMGKECLQWGMVAGIYSGMTYTMQEARGVHDW  100



>gb|ABK21269.1| unknown [Picea sitchensis]
 gb|ABK23889.1| unknown [Picea sitchensis]
 gb|ABK25773.1| unknown [Picea sitchensis]
 gb|ABR17160.1| unknown [Picea sitchensis]
 gb|ACN40778.1| unknown [Picea sitchensis]
 gb|ACN41066.1| unknown [Picea sitchensis]
Length=147

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 82/152 (54%), Gaps = 24/152 (16%)
 Frame = -3

Query  737  GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFP  558
            G + D+G+PLLNR  D F+K   +GA + +  E Y                         
Sbjct  16   GVVIDMGNPLLNRTVDGFLKIGTVGASRVLVEETY------------------------S  51

Query  557  SVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitg  378
            S+ KG   K  +E  IK  G E ++WG  AGVY+G+ YG+   RG  DW+N+ ++GA+TG
Sbjct  52   SLSKGSVTKHDLEHTIKKMGIEGLKWGAVAGVYTGVEYGVERIRGRRDWKNALISGAVTG  111

Query  377  aalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            AA++     ++ D +I+ AITG AI+TAA  +
Sbjct  112  AAMSFGDNKYTRDKMIKDAITGGAIATAAEFI  143



>ref|XP_001779980.1| predicted protein [Physcomitrella patens]
 gb|EDQ55189.1| predicted protein [Physcomitrella patens]
Length=146

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 80/152 (53%), Gaps = 28/152 (18%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAY--FTAVEGASRDTPPEIGGAKNHHAFP  558
            + D+G+P+LN   + F+K A +GA  AV +EA+  F       RD               
Sbjct  18   VVDIGNPILNSTVNGFLKVAPVGASHAVTQEAFRMFQDERVTKRD---------------  62

Query  557  SVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitg  378
                       +E ++K  GK+ +QWG  AGVYSG+ YG+   RG  DW+N+A+ GAITG
Sbjct  63   -----------LERMVKRAGKDGLQWGVVAGVYSGVQYGIERMRGRRDWKNAAIGGAITG  111

Query  377  aalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            A L M  K +    +IQ AITG AI+TA   L
Sbjct  112  AILTMGDKQYDRQRMIQTAITGGAIATANEFL  143



>ref|XP_002972971.1| hypothetical protein SELMODRAFT_413325 [Selaginella moellendorffii]
 ref|XP_002993391.1| hypothetical protein SELMODRAFT_431462 [Selaginella moellendorffii]
 gb|EFJ05576.1| hypothetical protein SELMODRAFT_431462 [Selaginella moellendorffii]
 gb|EFJ26192.1| hypothetical protein SELMODRAFT_413325 [Selaginella moellendorffii]
Length=152

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 85/155 (55%), Gaps = 23/155 (15%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
              DLGHP++NR  ++F+KA  +G V A ++ A                  A+    F S 
Sbjct  12   FLDLGHPVVNRSVEAFLKAGAVGLVHATSQIA------------------AREAADFVST  53

Query  551  LKGGNNKSS-----VEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalaga  387
                + KSS     +E      GK+++QWG A+G+YS  T  L+EARGVHDW+N+   GA
Sbjct  54   SLNSDKKSSKCPLQLEEAAFTVGKQAVQWGLASGIYSSATISLKEARGVHDWKNAMFGGA  113

Query  386  itgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            + GAA+++T  +   + V+  A+TG A++ AA+ +
Sbjct  114  LAGAAVSLTEPNPRAEAVVSGALTGGAVAIAADFI  148



>gb|EEC72263.1| hypothetical protein OsI_05414 [Oryza sativa Indica Group]
Length=146

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 75/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+GHP LNR  D F+K   +GA +  A E                         F  + +
Sbjct  20   DMGHPFLNRTVDGFLKIGAVGACKVAAEET------------------------FECLHR  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +K  VE+ +K   KE   WG  AGVY G+ YG+   RG  DW+N+ + GA+TGA ++
Sbjct  56   GDVSKHKVESALKKMCKEGAYWGTIAGVYVGMEYGIERIRGHRDWKNAMVGGAVTGALVS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
              +  H  + V++ AITG AI+TAA  L
Sbjct  116  AASNSHRQN-VVKNAITGGAIATAAEFL  142



>ref|XP_002457029.1| hypothetical protein SORBIDRAFT_03g047420 [Sorghum bicolor]
 gb|EES02149.1| hypothetical protein SORBIDRAFT_03g047420 [Sorghum bicolor]
Length=128

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 75/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  722  LGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKG  543
            +GHP LNR  D F++   +G  +  A E                         F  + +G
Sbjct  1    MGHPFLNRTVDGFIRIGAVGGCKVAAEET------------------------FECLQRG  36

Query  542  GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalam  363
              +K  VE  +K   KE   WG  AGVY G+ YG+++ RG  DW+N+ + GA+TGA ++ 
Sbjct  37   DVSKHKVEHALKKMCKEGAYWGTVAGVYVGVEYGIQKIRGHRDWKNAMVGGALTGALVSA  96

Query  362  tTKDHSHDHVIQCAITGAAISTAANLLT  279
                H H+ V++ AITG AI+TAA  LT
Sbjct  97   VNNHHRHN-VVKNAITGGAIATAAEFLT  123



>ref|XP_006846173.1| hypothetical protein AMTR_s00012p00202200 [Amborella trichopoda]
 gb|ERN07848.1| hypothetical protein AMTR_s00012p00202200 [Amborella trichopoda]
Length=146

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 73/153 (48%), Gaps = 25/153 (16%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
              DLGHP LNR  D F+K   +GA +  A EAY+                        S+
Sbjct  18   FVDLGHPFLNRTFDGFLKIGAVGASRVAAEEAYY------------------------SI  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +K  +E  +K   KE   WG  AG+Y G+ YG+   RG  DW+N+ + G     A
Sbjct  54   SKGTVSKHRLEHTLKKMCKEGALWGTVAGLYVGMEYGIERVRGTRDWKNA-MIGGAMTGA  112

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            L     +++ D ++  AITG A++TAA  +  I
Sbjct  113  LISAASNNNRDRIMVDAITGGAVATAAVFINYI  145



>tpg|DAA54342.1| TPA: putative mitochondrial import inner membrane translocase 
subunit Tim17 family protein [Zea mays]
Length=104

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 74/109 (68%), Gaps = 8/109 (7%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            + L+ R TL DE+ S+D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAY   VE
Sbjct  2    STLDTR-TLKDELTSMDRKC--LVDLGHPLLNRVADSFIRAAGVGAARAVSREAYVVTVE  58

Query  617  GASRDTP--PEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWG  477
            G S D+      GG ++H    S ++G + + S++A++K  GKE+ QWG
Sbjct  59   GLSGDSSGLDADGGKRSHF---SSIRGDDGQRSLDAVVKTAGKEAFQWG  104



>ref|XP_006645400.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Oryza brachyantha]
Length=146

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 74/148 (50%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+GHP LNR  D F+K   +GA +  A E                         F  + +
Sbjct  20   DMGHPFLNRTVDGFIKIGAVGACKVAAEET------------------------FDCLQR  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  ++  VE  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ L GA+TGA ++
Sbjct  56   GDVSQHKVERALKKMCKEGAYWGTIAGVYVGMEYGIERIRGHRDWKNAMLGGAVTGALVS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
              +  H  + V++ AITG AI+TAA  L
Sbjct  116  AASNSHRQN-VVKNAITGGAIATAAEFL  142



>ref|XP_009345977.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345990.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=158

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 79/150 (53%), Gaps = 13/150 (9%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   + A +AVA +A+  A + A            +H    S 
Sbjct  18   VIDLGNPLLNHTVDGFLKIGTVAATRAVAEDAFSAAKKDA------------DHIVLRSD  65

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
              G  +    E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ L GA+TGA 
Sbjct  66   DDGAISTKDFEHTLKKMCKEGAYWGTVAGVYVGAEYGIERVRGCRDWKNAMLGGALTGAL  125

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +K++  D V+  AITG AI+TAA  +
Sbjct  126  VSAASKEN-KDKVLVDAITGGAIATAAEFI  154



>gb|ABR16919.1| unknown [Picea sitchensis]
Length=145

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 80/152 (53%), Gaps = 26/152 (17%)
 Frame = -3

Query  737  GGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFP  558
            G + D+G+PLLNR  D F+K   +GA + +  E Y                         
Sbjct  16   GVVIDMGNPLLNRTVDGFLKIGTVGASRVLVEETY------------------------S  51

Query  557  SVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitg  378
            S+ KG   K  +E      G E ++WG  AGVY+G+ YG+   RG  DW+N+ ++GA+TG
Sbjct  52   SLSKGSVTKHDLEH--TKMGIEGLKWGAVAGVYTGVEYGVERIRGRRDWKNALISGAVTG  109

Query  377  aalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            AA++     ++ D +I+ AITG AI+TAA  +
Sbjct  110  AAMSFGDNKYTRDKMIKDAITGGAIATAAEFI  141



>ref|XP_002532855.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29533.1| conserved hypothetical protein [Ricinus communis]
Length=146

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 71/150 (47%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+GHP LN   D F+K   +GA + +A +AY+                        +V
Sbjct  18   VIDMGHPFLNLTVDGFLKIGTVGATRVLAEDAYY------------------------AV  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  +  S E  +K   KE   WG  AG+Y G+ YG+   RG  DW+N+ + G     A
Sbjct  54   KRGSLSGRSFEHTLKKMCKEGAYWGTVAGLYVGMEYGMERIRGSRDWKNA-MLGGALTGA  112

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            L     + S D ++  AITG AI+TAA  L
Sbjct  113  LISAASNKSKDKIVTDAITGGAIATAATFL  142



>ref|NP_001054446.1| Os05g0111200 [Oryza sativa Japonica Group]
 gb|AAU44206.1| putative amino acid selective channel protein [Oryza sativa Japonica 
Group]
 dbj|BAF16360.1| Os05g0111200 [Oryza sativa Japonica Group]
 dbj|BAG95191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78389.1| hypothetical protein OsI_18168 [Oryza sativa Indica Group]
 gb|EEE62078.1| hypothetical protein OsJ_16862 [Oryza sativa Japonica Group]
Length=146

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 76/149 (51%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LNR  D F+K   +GA +  A +                         F  + 
Sbjct  19   IDMGNPFLNRTVDGFLKIGAVGACKVAAEDT------------------------FDCLH  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            +G  +K  +E ++K   KE   WG  AGVY G+ YG+   RG HDW+N+ + GA++GA +
Sbjct  55   RGDVSKHKLEHMLKKMCKEGAYWGTVAGVYVGMEYGVERIRGRHDWKNAMIGGALSGALI  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +  + +H  D +I+ AITG A++TA   +
Sbjct  115  SAASNNHK-DKIIKDAITGGAVATAVEFI  142



>ref|XP_004971437.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Setaria italica]
Length=174

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 83/175 (47%), Gaps = 35/175 (20%)
 Frame = -3

Query  767  DEIRSLDHG----------YGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            D  R++ HG           G   D+GHP LN   D F+K   + A +  A E+      
Sbjct  23   DRRRAMPHGGFSGRLTSPKLGLAVDMGHPFLNHAVDGFIKIGAVSACKVAAEES------  76

Query  617  GASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGL  438
                              F  + +G  +K  VE  +K   KE   WG  AGVY G+ YG+
Sbjct  77   ------------------FECLHRGDVSKHKVEHALKKMCKEGAYWGTIAGVYVGVEYGI  118

Query  437  REARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
             + RG  DW+N+ L GA+TGA ++    +  H  V++ AITG AI+TAA LLT +
Sbjct  119  DKIRGHRDWKNAMLGGAVTGALVSAVNNNQRHK-VVKNAITGGAIATAAELLTNL  172



>gb|KFK32251.1| hypothetical protein AALP_AA6G217900 [Arabis alpina]
Length=148

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 79/149 (53%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D+F+K   +G  +++A + Y                         ++ 
Sbjct  19   IDMGNPFLNLTVDAFLKIGAVGVTKSLAEDTY------------------------KAID  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +KSS+E  +KN  KE + WG AAGVY G  YG+   RG  DW+N+ LAGA+TGA +
Sbjct  55   KGSLSKSSLEDGLKNMCKEGVYWGSAAGVYVGTEYGIERIRGTRDWKNAMLAGAVTGAVI  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +  +     D V+  AITG A++TA+  L
Sbjct  115  SAVS-SKGKDKVVIDAITGGALATASKFL  142



>gb|EMT26097.1| hypothetical protein F775_31817 [Aegilops tauschii]
Length=144

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 72/149 (48%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             DLG+PLLNR  D F+K   +GA + VA +A                        F  + 
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVVAEDA------------------------FDCIH  52

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            +G  +K  +E  +K   KE   WG  AGVY G+ YG+  ARG  DW+N+ L G I   AL
Sbjct  53   RGDISKRQLEETLKKMCKEGAYWGAVAGVYVGMEYGVERARGDRDWKNA-LIGGIATGAL  111

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
                 ++  + + Q AITG AI+TA   +
Sbjct  112  VSAASNNKGNKIAQDAITGGAIATAVEFI  140



>ref|XP_006653965.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Oryza brachyantha]
Length=146

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 76/149 (51%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LNR  D F+K   +GA +  A E                         F  + 
Sbjct  19   IDMGNPFLNRTVDGFLKIGAVGACKVAAEET------------------------FDCLH  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            +G  +K  +E ++K   KE   WG  AGVY G+ YG+   RG HDW+N+ + GA++GA +
Sbjct  55   RGDVSKHRLEHMLKKMCKEGAYWGTIAGVYVGMEYGVERIRGRHDWKNAMIGGALSGALI  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +  + +H  + +I+ AITG A++TA   +
Sbjct  115  SAASNNH-REKIIKDAITGGAVATAVEFI  142



>gb|KDP34497.1| hypothetical protein JCGZ_11047 [Jatropha curcas]
Length=146

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 78/150 (52%), Gaps = 27/150 (18%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A +A+A +AY+                         V+
Sbjct  19   IDMGNPFLNLTVDGFLKIGTVAATRALAEDAYY-------------------------VV  53

Query  548  KGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            K GN ++ ++E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ L GA+TGA 
Sbjct  54   KRGNISRRNLEQTLKKMCKEGAYWGTVAGVYVGMEYGMERIRGTRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  + +   D ++  AITG AI+TAA  L
Sbjct  114  ISAAS-NKGKDKIVTDAITGGAIATAATFL  142



>gb|KFK32252.1| hypothetical protein AALP_AA6G218100 [Arabis alpina]
Length=148

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 76/149 (51%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+GHP LN   D F+K   +G  +++A + Y                         ++ 
Sbjct  19   IDMGHPFLNLTVDGFLKIGAVGVTKSLAEDTY------------------------KAID  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +KS++E  +K   KE + WG  AGVY G  YG+   RG  DW+N+ LAGA+TGA +
Sbjct  55   KGSLSKSNIEHALKKMCKEGVYWGSVAGVYVGTEYGIERIRGTRDWKNAMLAGAVTGAVV  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +  +     D V+  AITG AI+TA+  L
Sbjct  115  SAVS-SKGKDKVVVDAITGGAIATASKFL  142



>dbj|BAJ89521.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=144

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 70/149 (47%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             DLG+PLLNR  D F+K   +GA +  A +A                        F  + 
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVAAEDA------------------------FDCLQ  52

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
             G  +K  +E  +K   KE   WG  AGVY G+ YG+   RG +DW+N+ L G I   AL
Sbjct  53   SGSVSKRKLEQTLKKMCKEGAYWGAVAGVYVGMEYGVERVRGQYDWKNA-LIGGIASGAL  111

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
                 D+  + + Q AITG AI+TA   +
Sbjct  112  ISAASDNKGNKIAQDAITGGAIATAVEFI  140



>ref|XP_010252115.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Nelumbo nucifera]
Length=146

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 68/151 (45%), Gaps = 25/151 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D FVK   +GA +  A E                         F  +
Sbjct  18   VIDMGNPFLNHTVDGFVKIGTVGAARVTAEET------------------------FHCL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +K  +E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+         A
Sbjct  54   KKGEFSKHILEHTLKKMCKEGAYWGTVAGVYVGMEYGIERIRGTRDWKNA-TLSGALSGA  112

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLT  279
            L     ++S D ++  AITG AI+TAA  L+
Sbjct  113  LISAASNNSRDKIVADAITGGAIATAAEFLS  143



>ref|XP_003569082.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Brachypodium 
distachyon]
Length=144

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 74/148 (50%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D G+PLLNR  D F+K   +GA +  A +A                        F  + K
Sbjct  18   DTGNPLLNRTLDGFIKIGAVGACKVAAEDA------------------------FECLHK  53

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  + + +E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ + G ++GA ++
Sbjct  54   GNVSTNKLEHTLKKMCKEGAYWGTVAGVYVGMEYGVERIRGRSDWKNALIGGVVSGALIS  113

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
              +  H  D +++ AITG AI+TAA  +
Sbjct  114  AASNSH-RDKIVKDAITGGAIATAAEFI  140



>gb|EMT04893.1| hypothetical protein F775_26935 [Aegilops tauschii]
Length=139

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 95/177 (54%), Gaps = 41/177 (23%)
 Frame = -3

Query  797  TNLEVRCTLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVE  618
            + L+ R TL DE+ S+D     L DLGHPLLNR+ADSF++AAG+GA +AV+REAYF AVE
Sbjct  3    SRLDAR-TLKDEVASMDRRP--LLDLGHPLLNRVADSFIRAAGVGAARAVSREAYFVAVE  59

Query  617  GASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGL  438
            G   D+      AK  H F S  +G + + S++A+     K S   G  AG    LT   
Sbjct  60   GMGGDSTGLDSTAKRSH-FSSA-RGDDGQKSLDAV-----KNSAIAGAIAGAAVALT---  109

Query  437  REARGVHDWRNSalagaitgaalamtTKDHSH-DHVIQCAITGAAISTAANLLTGIF  270
                                        D+ H DHV+  AITGAA+S+AA +L+GIF
Sbjct  110  ---------------------------GDNGHSDHVVHFAITGAALSSAATMLSGIF  139



>ref|XP_009345978.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009345991.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=146

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 75/150 (50%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   + A +AVA +A                        F + 
Sbjct  18   VIDLGNPLLNHTVDGFLKIGTVAATRAVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ L GA+TGA 
Sbjct  54   KKGAISTKDFEHTLKKMCKEGAYWGTVAGVYVGAEYGIERVRGCRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +K++  D V+  AITG AI+TAA  +
Sbjct  114  VSAASKEN-KDKVLVDAITGGAIATAAEFI  142



>emb|CAA09867.1| amino acid selective channel protein [Hordeum vulgare subsp. 
vulgare]
Length=144

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 71/149 (48%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             DLG+PLLNR  D F+K   +GA + VA +A                        F  + 
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVVAEDA------------------------FDCLH  52

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            +G  +K  +E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ L G I   AL
Sbjct  53   RGDISKRQLEETLKKMCKEGAYWGAVAGVYVGMEYGVERVRGDRDWKNA-LIGGIATGAL  111

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
                 ++  + + Q AITG AI+TA   +
Sbjct  112  VSAASNNKGNKIAQDAITGGAIATAVEFI  140



>ref|XP_006295178.1| hypothetical protein CARUB_v10024257mg [Capsella rubella]
 gb|EOA28076.1| hypothetical protein CARUB_v10024257mg [Capsella rubella]
Length=148

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 76/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A + Y                         ++ K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSIAEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE + WG AAGVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKSTLENALKKLCKEGVYWGAAAGVYVGTEYGIERVRGTRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D V+  AI G A++TA+  L
Sbjct  116  AAGK-KGKDTVVIDAILGGALATASQFL  142



>ref|XP_010521840.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Tarenaya 
hassleriana]
Length=146

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 70/149 (47%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+PLLN   D F+K   +GA +A+A +AY                          V 
Sbjct  19   IDMGNPLLNLSVDGFLKIGAVGATRALAEDAYHV------------------------VK  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  ++++VE   KN  KE   WG  AGVY G  YG+   RG  DW+N+ +       A+
Sbjct  55   KGSISRNNVEHAFKNMCKEGAYWGSIAGVYMGTEYGVECIRGTRDWKNA-MIAGALTGAI  113

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
                 +   D V+  AITG A++TA+  L
Sbjct  114  VTAASNKGKDKVVVNAITGGALATASQFL  142



>gb|EMS53533.1| hypothetical protein TRIUR3_34729 [Triticum urartu]
Length=184

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 81/165 (49%), Gaps = 17/165 (10%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEG---ASRDTPPEIGG--------  582
             DLG+PLLNR  D F+K   +GA + VA +A+     G   ASR +   I          
Sbjct  17   IDLGNPLLNRTVDGFLKIGAVGACRVVAEDAFDCIHRGNHNASRLSYSSIETVLLATGSG  76

Query  581  --AKNHHAFPSVL---KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVH  417
                + +  P+ L    G  +K  +E  +K   KE   WG  AGVY G+ YG+  ARG  
Sbjct  77   FICVDTNVTPNYLGFFAGDISKRQLEETLKKMCKEGAYWGAVAGVYVGMEYGVERARGDR  136

Query  416  DWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
            DW+N+ L G I   AL     ++  + + Q AITG AI+TA   +
Sbjct  137  DWKNA-LIGGIATGALVSAATNNKGNKIAQDAITGGAIATAVEFI  180



>ref|XP_009380643.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380644.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380645.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=146

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 75/150 (50%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D G+P LNR  D F+K   + A +    E Y                     H     
Sbjct  18   VIDTGNPFLNRTVDGFLKIGTVAASKVAVEETY---------------------HCMD--  54

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +K  +EA +K   KE + WG AAGVY+G+ YG+   RG  DW+N+ L GAI+G  
Sbjct  55   -KGSISKGKLEAALKKMCKEGVYWGTAAGVYAGMEYGVERIRGKRDWKNATLGGAISGLL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  + ++  D VI+ AIT  A++TAA  +
Sbjct  114  ISAAS-NNGRDKVIKDAITAGAVATAAEFI  142



>ref|XP_001777747.1| predicted protein [Physcomitrella patens]
 gb|EDQ57409.1| predicted protein [Physcomitrella patens]
Length=148

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 82/155 (53%), Gaps = 27/155 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLGHPLLN   D F+K  G+G   A  ++ +                          +
Sbjct  18   IVDLGHPLLNSSVDGFLKVGGVGVAHAAVQDTF-------------------------RI  52

Query  551  LKGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARG-VHDWRNSalagaitg  378
            L+     K+ +E L++  G E +QWG  AGVY+G+ Y L++A     DWRN+A+ GA+TG
Sbjct  53   LRSDQVTKNDLEKLVRRAGFEGLQWGAVAGVYAGVEYSLKKACAKKQDWRNAAIGGAVTG  112

Query  377  aalamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            A L++     S D ++Q A+TGA I+TA+ ++  +
Sbjct  113  ALLSVGDGSFSRDKMLQHALTGAGIATASEIIRNL  147



>ref|XP_010676722.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=141

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 79/151 (52%), Gaps = 25/151 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D G+PLL+R  D F K   + A +A A + Y  A                        
Sbjct  12   VVDTGNPLLDRTVDGFFKIGTVAATRAAAEDVYHIA------------------------  47

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +  +VE  +K   KE   WG  AGVY+GL YG+   RG +DW+N+ + GA+TGA 
Sbjct  48   KKGSLSTKNVEESLKKMCKEGAYWGTIAGVYTGLEYGVARVRGTNDWKNAMIGGALTGAL  107

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLT  279
            +++ TK  S+D ++   +TGAA++TAA  ++
Sbjct  108  VSVVTK-GSNDKIVMDTLTGAAVATAAEFIS  137



>ref|XP_001784797.1| predicted protein [Physcomitrella patens]
 gb|EDQ50385.1| predicted protein [Physcomitrella patens]
Length=147

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 26/161 (16%)
 Frame = -3

Query  749  DHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNH  570
            D     + DLGHPL N   D F+K   +GA  A  ++ +                     
Sbjct  12   DPSLNVIVDLGHPLANTSVDGFLKVGAVGAAHAALQDTF---------------------  50

Query  569  HAFPSVLKGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSala  393
                 +LK     K+ VE L+K TG E +QWG  AGVY+G+ Y L +AR   DW+N+A+ 
Sbjct  51   ----RILKSEQVTKTDVEKLVKRTGFEGLQWGAVAGVYAGVEYSLEKARSKQDWKNAAIG  106

Query  392  gaitgaalamtTKDHSHDHVIQCAITGAAISTAANLLTGIF  270
            GA+TGA L+++    + D ++Q A+TGA I+TA+ ++  + 
Sbjct  107  GAVTGALLSVSDCSFARDKMVQHALTGAGIATASEIIRNLM  147



>ref|XP_010470028.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=162

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 78/150 (52%), Gaps = 15/150 (10%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFP--SV  552
            D+G+P LN   D+F+K   +G  +++A             DT   I  A  +H     S 
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSIAE------------DTYKAIDKAAKYHLLLHGSF  67

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            + G  +KS++E  +K    E + WG AAGVY G  YG+   RG  DW+N+ LAGA TGA 
Sbjct  68   IVGSLSKSTLENGLKKLCAEGVYWGAAAGVYVGAEYGIERVRGTRDWKNAMLAGAATGAV  127

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            L+   K    D V+  AI G A++TA+  L
Sbjct  128  LSAVGK-KGKDTVVIDAILGGALATASQFL  156



>ref|XP_004960518.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Setaria italica]
Length=146

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LNR  D F+K   +GA +  A E                         F  +
Sbjct  18   VIDMGNPFLNRTVDGFLKIGAVGACKVAAEET------------------------FECL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  +K  +E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ + GA++GA 
Sbjct  54   HRGDVSKHKLEHALKKMCKEGAYWGTVAGVYVGMVYGVERVRGRSDWKNAMIGGALSGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  T +H  D +I+ AIT  A++TA   +
Sbjct  114  ISGATNNHK-DKIIKDAITAGAVATAVEFI  142



>ref|XP_006409925.1| hypothetical protein EUTSA_v10017379mg [Eutrema salsugineum]
 gb|ESQ51378.1| hypothetical protein EUTSA_v10017379mg [Eutrema salsugineum]
Length=148

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 69/148 (47%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+GHP LN   DSF+K   +G  +++A + Y                         ++ K
Sbjct  20   DMGHPFLNLTVDSFLKIGAVGVTKSLAEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE + WG  AGVY G  YG+   RG  DW+N+ +       A+ 
Sbjct  56   GSLSKSTLEHALKKMCKEGVYWGSVAGVYVGTEYGIERIRGTRDWKNA-MLAGAATGAVI  114

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
                +   D ++  AI G  ++TA++ L
Sbjct  115  SAASNKGKDTIVVDAIMGGGLATASHFL  142



>ref|XP_009353670.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=146

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 74/150 (49%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   + A +AVA +A                        F + 
Sbjct  18   VIDLGNPLLNHTVDGFLKIGTVAATRAVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ L GA+TGA 
Sbjct  54   KKGAISTKDFEHTLKKMCKEGAYWGTVAGVYVGAEYGIERVRGRRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +K +  D V+  AITG AI+TAA  +
Sbjct  114  VSAASKGN-KDKVLVDAITGGAIATAAEFI  142



>ref|XP_010510565.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic-like 
[Camelina sativa]
Length=148

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A +AY                         ++ K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSIAEDAY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +K+++E  +K    E + WG AAGVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKNTLENALKKLCAEGVYWGAAAGVYVGTEYGIERVRGTRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D V+  AI G A++TA+  L
Sbjct  116  AAGK-KGKDTVVIDAILGGALATASQFL  142



>ref|XP_002439146.1| hypothetical protein SORBIDRAFT_09g001310 [Sorghum bicolor]
 gb|ACE86395.1| amino acid selective channel protein [Sorghum bicolor]
 gb|EES17576.1| hypothetical protein SORBIDRAFT_09g001310 [Sorghum bicolor]
Length=146

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 75/150 (50%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LNR  D F+K   +GA +  A E                         F  +
Sbjct  18   VIDMGNPFLNRTVDGFLKIGAVGACKVAAEET------------------------FDCL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  +K  V+  +K   +E   WG  AGVY G+ YG+   RG +DW+N+ + GA++GA 
Sbjct  54   HRGDVSKHKVKHALKKMCQEGAYWGTVAGVYVGMVYGVERVRGRNDWKNAMIGGALSGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  + +H  D +I+ AIT  A++TA   +
Sbjct  114  ISGASNNHK-DKIIKDAITAGAVATAVEFI  142



>ref|XP_009588682.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Nicotiana 
tomentosiformis]
Length=146

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 76/150 (51%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+PLLN+  D+F+K   +   +  A E Y                          V
Sbjct  18   VIDMGNPLLNQSVDAFLKIGTVAVAKTAAEETYHI------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +K + E  +K   KE   WG  AGVY+G+ YG    RG  DW+N+ + GA+TGA 
Sbjct  54   KKGSVSKHNFEHSLKKMCKEGAYWGTVAGVYAGMEYGAERIRGTRDWKNAMIGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  + +++ D ++  AITG A++TAA  L
Sbjct  114  ISAAS-NNNRDKIVMDAITGGAVATAAEFL  142



>ref|XP_010414466.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic [Camelina 
sativa]
Length=148

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 75/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A + Y                         ++ K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSIAEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +K+++E  +K    E + WG AAGVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKNTLENALKKLCAEGIYWGAAAGVYVGTEYGIERVRGTRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D V+  AI G A++TA+  L
Sbjct  116  AAGK-KGKDTVVIDAILGGALATASQFL  142



>ref|XP_010470029.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=148

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 75/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A + Y                         ++ K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSIAEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K    E + WG AAGVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKSTLENGLKKLCAEGVYWGAAAGVYVGAEYGIERVRGTRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D V+  AI G A++TA+  L
Sbjct  116  AVGK-KGKDTVVIDAILGGALATASQFL  142



>ref|XP_010033127.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Eucalyptus 
grandis]
 gb|KCW52685.1| hypothetical protein EUGRSUZ_J02053 [Eucalyptus grandis]
Length=146

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 76/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            DLG+P LN   D F+K   + A +A A +AYFT   G             + H F     
Sbjct  20   DLGNPFLNVTVDGFLKIGTVAATRAAAEDAYFTVKSGKF-----------SGHKF-----  63

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
                    E  +K   KE   WG  AGVY+G+ YG+   RG  DW+N+ + GA+TG  ++
Sbjct  64   --------EDTLKKMCKEGAYWGTVAGVYAGMEYGVERIRGTRDWKNAMIGGALTGLTIS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
              +K++  D V+  AITG AI+TAA+ L
Sbjct  116  AASKNN-RDRVVMDAITGGAIATAADFL  142



>gb|KDO72851.1| hypothetical protein CISIN_1g036056mg [Citrus sinensis]
Length=146

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 27/151 (18%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+  LN   D F+K   + A +AVA + Y                         +++
Sbjct  19   IDTGNDFLNHTVDGFLKIGAVAATRAVAEDTY-------------------------NIV  53

Query  548  KGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            KGGN ++  +E  +K   KE   WG  AGVY G+ YG+ + RG  DW+N+ + GA TGA 
Sbjct  54   KGGNFSRHHLEHALKKMCKEGAYWGTVAGVYVGMEYGVEKVRGTKDWKNAMIGGAFTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLT  279
            ++   K++  D V+  A+TG AI+ AA  L+
Sbjct  114  VSAVGKNN-RDKVVMDALTGGAIAAAAEFLS  143



>ref|XP_006424826.1| hypothetical protein CICLE_v10029517mg [Citrus clementina]
 ref|XP_006488326.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Citrus sinensis]
 gb|ESR38066.1| hypothetical protein CICLE_v10029517mg [Citrus clementina]
Length=146

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (50%), Gaps = 27/151 (18%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+  LN   D F+K   + A +AVA + Y                         +++
Sbjct  19   IDTGNDFLNHTVDGFLKIGAVAATRAVAEDTY-------------------------NIV  53

Query  548  KGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            KGGN ++  +E  +K   KE   WG  AGVY G+ YG+ + RG  DW+N+ + GA TGA 
Sbjct  54   KGGNFSRHHLEHALKKMCKEGAYWGTVAGVYVGMEYGVEKVRGTKDWKNAMIGGAFTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLT  279
            ++   K+   D V+  A+TG AI+ AA  L+
Sbjct  114  VSAVGKN-KRDKVVMDALTGGAIAAAAEFLS  143



>ref|XP_009124363.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic [Brassica 
rapa]
 emb|CDY47887.1| BnaA07g14320D [Brassica napus]
Length=148

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 73/148 (49%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D F+K   +G  +++  + Y                         ++ K
Sbjct  20   DMGNPFLNLTVDGFLKIGAVGVTKSLVEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ LAGA TGA ++
Sbjct  56   GSVSKSTLEHALKKMCKEGFYWGSVAGVYVGTEYGIERIRGTRDWKNAMLAGAATGAVIS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
              T +   D V+  AI G A++TA+  L
Sbjct  116  AAT-NKGKDKVVIDAIMGGALATASQFL  142



>gb|AAM60853.1| putative membrane channel protein [Arabidopsis thaliana]
Length=148

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A + Y  A+E                       K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSLAEDTY-KAIE-----------------------K  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE + WG A GVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKSTLEHALKKLCKEGVYWGAAGGVYIGTEYGIERIRGSRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D ++  AI G A++TA+  +
Sbjct  116  AVGK-KGKDTIVIDAILGGALATASQFV  142



>ref|NP_180456.1| outer plastid envelope protein 16-1 [Arabidopsis thaliana]
 sp|Q9ZV24.1|OP161_ARATH RecName: Full=Outer envelope pore protein 16-1, chloroplastic; 
AltName: Full=Chloroplastic outer envelope pore protein of 
16 kDa 1; Short=AtOEP16-1; Short=OEP16-1; AltName: Full=Outer 
plastid envelope protein 16-L; Short=AtOEP16-L; Short=Leave 
outer plastid envelope protein 16; AltName: Full=Protochlorophyllide-dependent 
translocon protein 16; Short=Ptc16 [Arabidopsis 
thaliana]
 gb|AAC79594.1| putative membrane channel protein [Arabidopsis thaliana]
 gb|AAK73951.1| At2g28900/F8N16.19 [Arabidopsis thaliana]
 gb|AAM10398.1| At2g28900/F8N16.19 [Arabidopsis thaliana]
 gb|ABD48954.1| At2g28900 [Arabidopsis thaliana]
 gb|AEC08186.1| outer plastid envelope protein 16-1 [Arabidopsis thaliana]
Length=148

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A + Y                         ++ K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGVTKSLAEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE + WG A GVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKSTLEHALKKLCKEGVYWGAAGGVYIGTEYGIERIRGSRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D ++  AI G A++TA+  +
Sbjct  116  AVGK-KGKDTIVIDAILGGALATASQFV  142



>ref|XP_002881019.1| hypothetical protein ARALYDRAFT_481805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57278.1| hypothetical protein ARALYDRAFT_481805 [Arabidopsis lyrata subsp. 
lyrata]
Length=148

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 75/148 (51%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LN   D+F+K   +G  +++A + Y                         ++ K
Sbjct  20   DMGNPFLNLTVDAFLKIGAVGITKSLAEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE + WG A GVY G  YG+   RG  DW+N+ LAGA TGA L+
Sbjct  56   GSLSKSTLEHALKKLCKEGVYWGAAGGVYIGTEYGIERIRGSRDWKNAMLAGAATGAVLS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
               K    D ++  AI G A++TA+  +
Sbjct  116  AVGK-KGKDTIVIDAILGGALATASQFI  142



>ref|NP_001275376.1| uncharacterized protein LOC102589399 [Solanum tuberosum]
 emb|CAA63967.1| pom14 [Solanum tuberosum]
Length=146

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 73/149 (49%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D+F+    + A + VA E Y     G+            + H F    
Sbjct  19   IDMGNPFLNHTVDAFLNIGTVAATKTVAEETYGMVTRGSV-----------SSHNF----  63

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
                     E  +K   KE   WG  AGVY+G+ YG    RG +DW+N+ + GA+TGA +
Sbjct  64   ---------EKSLKKMCKEGAYWGTVAGVYAGMEYGAERIRGTNDWKNAMIGGALTGALI  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +    +++ D ++  AITG A++TA+  L
Sbjct  115  SAAC-NNNRDKIVMDAITGGAVATASEFL  142



>ref|NP_001151965.1| amino acid selective channel protein [Zea mays]
 gb|ACG36032.1| amino acid selective channel protein [Zea mays]
 gb|ACG36045.1| amino acid selective channel protein [Zea mays]
 gb|ACG45165.1| amino acid selective channel protein [Zea mays]
Length=146

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 67/153 (44%), Gaps = 25/153 (16%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LNR  D F+K   +GA +  A E                         F  +
Sbjct  18   VIDMGNPFLNRTVDGFLKIGAVGACKVAAEET------------------------FECL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  +K  VE  ++   KE   WG  AGVY G+ YG+   RG  DW+N+ + G     A
Sbjct  54   HRGDVSKHKVEHALRKMCKEGAYWGTVAGVYVGMVYGVERVRGRSDWKNA-MIGGALSGA  112

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            L     +     V++ AIT  A++TA   +  I
Sbjct  113  LISGASNSDRGKVVKDAITAGAVATAVEFINCI  145



>emb|CDY39514.1| BnaC04g15130D [Brassica napus]
Length=148

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 73/148 (49%), Gaps = 25/148 (17%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D G+P LN   D F+K   +G  +++  + Y                         ++ K
Sbjct  20   DTGNPFLNLTVDGFLKIGAVGVTKSLVEDTY------------------------KAIDK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +KS++E  +K   KE + WG  AGVY G  YG+   RG  DW+N+ LAGA TGA ++
Sbjct  56   GSVSKSTLEHALKKMCKEGVYWGSVAGVYVGTEYGIERIRGTRDWKNAMLAGAATGAVIS  115

Query  365  mtTKDHSHDHVIQCAITGAAISTAANLL  282
              T +   D V+  AI G A++TA+  L
Sbjct  116  AAT-NKGKDKVVIDAIMGGALATASQFL  142



>ref|XP_009353668.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=146

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 73/150 (49%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   + A +AVA +A                        F + 
Sbjct  18   IIDLGNPLLNHTVDGFLKIGTVAATRAVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  + S  +  +K   KE   WG  A VY G  YG+    G  DW+N+ L GA+TGA 
Sbjct  54   KKGSISTSDFKHTLKKMCKEGAYWGTVAAVYVGAEYGIERVSGHRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +K++  D V+  AITG AI+TA   +
Sbjct  114  VSAASKEN-KDKVLVDAITGGAIATAVEFI  142



>ref|XP_004294566.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=146

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+GHPLLN   D F+K   + A +A A +AY+                        +V 
Sbjct  19   IDMGHPLLNITVDGFLKIGTVAATRAAAEDAYY------------------------AVK  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +  S E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ + GA+TGA +
Sbjct  55   KGSISSHSFEQTLKKMCKEGAYWGTVAGVYVGAEYGVERIRGRRDWKNAMIGGAVTGAVI  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +  T ++  D ++  AITG AI+TAA +L
Sbjct  115  SAATSNN-KDRILVDAITGGAIATAAEIL  142



>ref|XP_002963437.1| hypothetical protein SELMODRAFT_141946 [Selaginella moellendorffii]
 ref|XP_002971570.1| hypothetical protein SELMODRAFT_95783 [Selaginella moellendorffii]
 gb|EFJ27319.1| hypothetical protein SELMODRAFT_95783 [Selaginella moellendorffii]
 gb|EFJ35308.1| hypothetical protein SELMODRAFT_141946 [Selaginella moellendorffii]
Length=147

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 66/136 (49%), Gaps = 26/136 (19%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LNR  D F K   + A  A  +EAY                          V
Sbjct  18   VIDMGNPFLNRTVDGFFKIGAVSAGHAAGQEAY-------------------------KV  52

Query  551  LKGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitga  375
            LK     K  +E  +K  GK+ + WG  AG+Y+G+ YG+   RG HDW+N+ L GA+TGA
Sbjct  53   LKKQTVTKHDLEYTLKRMGKDGLHWGAIAGLYTGMEYGIERVRGKHDWKNAMLGGAVTGA  112

Query  374  alamtTKDHSHDHVIQ  327
             ++     +S D ++Q
Sbjct  113  LVSFGEHRYSRDKMVQ  128



>ref|XP_009353669.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=146

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 73/150 (49%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   + A +AVA +A                        F + 
Sbjct  18   VIDLGNPLLNHTVDGFLKIGTVAATRAVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  + S  +  +K   KE   WG  A VY G  YG+    G  DW+N+ L GA+TGA 
Sbjct  54   KKGSISTSDFKHTLKKMCKEGAYWGTVAAVYVGAEYGIERVSGHRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +K++  D V+  AITG AI+TA   +
Sbjct  114  VSAASKEN-KDKVLVDAITGGAIATAVEFI  142



>ref|XP_002283749.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Vitis 
vinifera]
Length=146

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 75/150 (50%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A +A A EAY+                         V
Sbjct  18   MIDMGNPFLNLTVDGFLKIGTVAAARAAAEEAYYV------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  ++ +VE  +K   KE+  WG  AGVY G+ YG    RG  DW+N+ L GA+TGA 
Sbjct  54   KRGSISRHTVEHSLKKMCKEAAYWGTVAGVYVGMEYGAERIRGTRDWKNAMLGGALTGAI  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++    +   D ++  AITG AI+TAA  L
Sbjct  114  ISSAC-EKGRDKIVVGAITGGAIATAAEFL  142



>ref|XP_002298357.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
 gb|ABK95226.1| unknown [Populus trichocarpa]
 gb|EEE83162.1| mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 
family protein [Populus trichocarpa]
Length=146

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 64/148 (43%), Gaps = 48/148 (32%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+P LN   D F+K   + A +++A +AY+                         V+
Sbjct  19   IDTGNPFLNVTVDGFLKIGTVAAAKSLAEDAYY-------------------------VV  53

Query  548  KGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            KGGN +   +E  +K   KE   WG  AG+Y G+ YG+   RG HDW+N+          
Sbjct  54   KGGNFSGRKIEHSLKKMCKEGAYWGTVAGMYVGMEYGMERIRGTHDWKNA----------  103

Query  371  lamtTKDHSHDHVIQCAITGAAISTAAN  288
                        ++  A+TGA IS A+N
Sbjct  104  ------------MLGGALTGALISAASN  119



>ref|XP_009364401.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009364415.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Pyrus x bretschneideri]
Length=146

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 71/150 (47%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+P  N   D F+K   + A + VA +A                        F + 
Sbjct  18   MIDLGNPFFNHTVDGFLKIGTVAATRVVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ L GA+TGA 
Sbjct  54   KKGRISSHDFEHTLKKMCKEGAYWGTIAGVYVGAEYGIERVRGHRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +  ++ D V+  AITG AI+TAA  +
Sbjct  114  VSAASHKNT-DKVLVDAITGGAIATAAEFI  142



>ref|XP_008357200.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Malus 
domestica]
Length=146

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 71/150 (47%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+P  N   D F+K   + A + VA +A                        F + 
Sbjct  18   MIDLGNPFFNHTVDGFLKIGTVAATRVVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ L GA+TGA 
Sbjct  54   KKGRISSHDFEHTLKKMCKEGAYWGTIAGVYVGAEYGIERVRGHRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +  ++ D V+  AITG AI+TAA  +
Sbjct  114  VSAASHKNT-DKVLVDAITGGAIATAAEFI  142



>gb|ACG31308.1| amino acid selective channel protein [Zea mays]
Length=146

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 71/153 (46%), Gaps = 25/153 (16%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LNR  D F+K   +GA +  A E                         F  +
Sbjct  18   VIDMGNPFLNRTVDGFLKIGAVGACKVAAEET------------------------FECL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  +K  VE  +    KE   WG  AGVY  + YG+   RG  DW+N+ + GA++GA 
Sbjct  54   HRGDVSKHKVEHALSKMCKEGAYWGTVAGVYVSMVYGVERVRGRSDWKNAMIGGALSGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            ++  + +     V++ AIT  A++TA   +  I
Sbjct  114  ISGAS-NSDRGKVVKDAITAGAVATAVEFINCI  145



>ref|XP_007016421.1| Outer plastid envelope protein 16-1 [Theobroma cacao]
 gb|EOY34040.1| Outer plastid envelope protein 16-1 [Theobroma cacao]
Length=146

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 77/152 (51%), Gaps = 25/152 (16%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+P LN+  D F+K   + A +AVA E  FTA++                       
Sbjct  19   IDTGNPFLNQTVDGFLKIGTVAATRAVA-EDTFTAIK-----------------------  54

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            +G  ++  +E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ + GA+TGA +
Sbjct  55   RGKLSQECLEHALKRMCKEGAYWGSVAGVYVGMEYGVGRIRGSRDWKNAMIGGALTGALV  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLLTGI  273
            +    +++ D ++  A+TG AI+ A+  L  +
Sbjct  115  SAVG-NNNKDRIVTDALTGGAIAAASVFLNNL  145



>emb|CDP09055.1| unnamed protein product [Coffea canephora]
Length=146

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 76/150 (51%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D G+P LN   D F+K   + A +A A EAY+    G+            +HH F   
Sbjct  18   IIDTGNPFLNLTVDGFLKIGCVAATKAAAEEAYYIVKRGSI-----------SHHKF---  63

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
                      E  +K   KE   WG  AGVY GL YG+   RGV DW+N+ + GA+TGA 
Sbjct  64   ----------EDSLKKMCKEGAYWGTVAGVYVGLEYGVERIRGVRDWKNAMIGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  + + + D ++  AI G+AI+TAA  +
Sbjct  114  ISAAS-NKNKDKIVMDAIAGSAIATAAEFI  142



>gb|EMT26096.1| hypothetical protein F775_31816 [Aegilops tauschii]
Length=242

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 84/189 (44%), Gaps = 32/189 (17%)
 Frame = -3

Query  794  NLEVRCTLGDEIRSLDHGYGG------------------LFDLGHPLLNRIADSFVKAAG  669
            N+  +C L +  R  D G  G                    DLG+PLLNR  D F+K   
Sbjct  64   NVTPKCMLDERERGRDIGREGSGRMPRAGLSAGSSKVDVAIDLGNPLLNRTVDGFLKIGA  123

Query  668  IGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKGGNNKSSVEALIKNTGKES  489
            +GA +  A +A+     G+   +  ++     +  F S ++           ++   KE 
Sbjct  124  VGACRVAAEDAFDCLQSGSV--SKHKLEKTCTNMVFWSFMQ-----------LEKMCKEG  170

Query  488  MQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGA  309
              WG  AGVY G+ YG+   RG +DW+N+ L G I   AL     ++  + + + AITG 
Sbjct  171  AYWGAVAGVYVGMEYGVERVRGEYDWKNA-LIGGIASGALISAASNNKGNKIAKDAITGG  229

Query  308  AISTAANLL  282
            AI+TA   +
Sbjct  230  AIATAIEFI  238



>ref|XP_004297040.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic-like 
isoform 2 [Fragaria vesca subsp. vesca]
Length=136

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 75/146 (51%), Gaps = 25/146 (17%)
 Frame = -3

Query  719  GHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKGG  540
            G P++N I D+F+ +A IGA +A A   Y+                        ++ +G 
Sbjct  10   GSPVINDITDAFLWSATIGATKAAAEGTYY------------------------AIQRGS  45

Query  539  NNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamt  360
             +    E  +K  G+E + WG  AG++    YGL   RG  DW+N+ +AGA+TGA ++  
Sbjct  46   VSSHDFECTLKRMGEEGVYWGTTAGLFVTTEYGLESVRGRSDWKNTLIAGAVTGAVMSAV  105

Query  359  TKDHSHDHVIQCAITGAAISTAANLL  282
             K++  D ++  AI G A++TAA+ +
Sbjct  106  NKNN-KDKILTDAIVGGAVATAASFV  130



>gb|AFK39847.1| unknown [Medicago truncatula]
Length=147

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 50/110 (45%), Gaps = 24/110 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+PLLN   D F+K   + A +A+A + Y                          V
Sbjct  18   VIDMGNPLLNLTVDGFLKIGAVAATRALAEDTYHI------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
             KG  + S  E  +K T KE   WG  AGVY G  YG++  RG  DW+N+
Sbjct  54   RKGSVSSSDFEKTLKKTFKEGAYWGAIAGVYVGTEYGVQRIRGTRDWKNA  103



>ref|XP_004297039.1| PREDICTED: outer envelope pore protein 16-1, chloroplastic-like 
isoform 1 [Fragaria vesca subsp. vesca]
Length=137

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 75/146 (51%), Gaps = 25/146 (17%)
 Frame = -3

Query  719  GHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKGG  540
            G P++N I D+F+ +A IGA +A A   Y+                        ++ +G 
Sbjct  10   GSPVINDITDAFLWSATIGATKAAAEGTYY------------------------AIQRGS  45

Query  539  NNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamt  360
             +    E  +K  G+E + WG  AG++    YGL   RG  DW+N+ +AGA+TGA ++  
Sbjct  46   VSSHDFECTLKRMGEEGVYWGTTAGLFVTTEYGLESVRGRSDWKNTLIAGAVTGAVMSAV  105

Query  359  TKDHSHDHVIQCAITGAAISTAANLL  282
             K++  D ++  AI G A++TAA+ +
Sbjct  106  NKNN-KDKILTDAIVGGAVATAASFV  130



>gb|KEH39435.1| outer envelope pore protein [Medicago truncatula]
Length=147

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 50/110 (45%), Gaps = 24/110 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+PLLN   D F+K   + A +A+A + Y                          V
Sbjct  18   VIDMGNPLLNLTVDGFLKIGAVAATRALAEDTYHI------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
             KG  + S  E  +K T KE   WG  AGVY G  YG++  RG  DW+N+
Sbjct  54   RKGSVSSSDFEKTLKKTFKEGAYWGAIAGVYVGTEYGVQRIRGTRDWKNA  103



>ref|XP_009341406.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Pyrus x bretschneideri]
Length=146

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+P  N   D F+K   + A + VA +A                        F + 
Sbjct  18   MIDLGNPFFNHTVDGFLKIGTVAATRVVAEDA------------------------FSAA  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YG+   RG  DW+N+ L GA+TGA 
Sbjct  54   KKGRISSHDFEHTLKKMCKEGAYWGTIAGVYVGAEYGIERVRGHRDWKNAMLGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  +  ++ D V+  AITG AI+TA   +
Sbjct  114  VSAASHKNT-DKVLVDAITGGAIATAVEFI  142



>gb|AGC51779.1| plastid 16-KDa outer membrane protein [Manihot esculenta]
Length=146

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 71/150 (47%), Gaps = 27/150 (18%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+  LN   D F+K   + A + +A +AY                          V+
Sbjct  19   IDMGNHFLNLTVDGFLKIGTVAATRVLAEDAY-------------------------HVV  53

Query  548  KGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            K GN +  + +   K   KE   WG  AGVY G+ YG+   RG  DW+N+   GA+TGA 
Sbjct  54   KRGNISTRNFDQTFKKMCKEGAYWGTVAGVYVGMEYGMERVRGTRDWKNAMFGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++    + + D ++  A+TG AI+TAA  L
Sbjct  114  ISAAC-NKNKDKILTDALTGGAIATAATFL  142



>ref|XP_011035319.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Populus euphratica]
 ref|XP_011015293.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Populus euphratica]
Length=146

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 63/148 (43%), Gaps = 48/148 (32%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+P LN   D F+K   + A +++A +AY                          V+
Sbjct  19   IDTGNPFLNVTVDGFLKIGTVAATKSLAEDAY-------------------------HVV  53

Query  548  KGGN-NKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
            KGGN +   +E  +K   KE   WG  AG+Y G+ YG+   RG HDW+N+          
Sbjct  54   KGGNFSGRKIEHSLKKMCKEGAYWGTVAGMYVGMEYGMERIRGTHDWKNA----------  103

Query  371  lamtTKDHSHDHVIQCAITGAAISTAAN  288
                        ++  A+TGA IS A+N
Sbjct  104  ------------MLGGALTGALISAASN  119



>gb|ACJ83919.1| unknown [Medicago truncatula]
Length=147

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 49/110 (45%), Gaps = 24/110 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+PLLN   D F K   + A +A+A + Y                          V
Sbjct  18   VIDMGNPLLNLTVDGFSKIGAVAATRALAEDTYHI------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
             KG  + S  E  +K T KE   WG  AGVY G  YG++  RG  DW+N+
Sbjct  54   RKGSVSSSDFEKTLKKTFKEGAYWGAIAGVYVGTEYGVQRIRGTRDWKNA  103



>ref|XP_004167617.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Cucumis sativus]
Length=146

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 68/150 (45%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D G+P LN   D F+K   + A +A A +AYF    GA            + H F   
Sbjct  18   VIDTGYPFLNLTVDGFLKIGSVAATRAAAEDAYFVVKNGAI-----------SSHKF---  63

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
                      E  +K   KE   WG  AG Y G+ YG+   RG  DW+N+ + G     A
Sbjct  64   ----------ENTLKKMCKEGAYWGAVAGAYVGMEYGVERIRGTRDWKNA-MIGGALTGA  112

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            L     +++ D V+  AITG A++TAA  +
Sbjct  113  LVSAASNNNRDKVVIDAITGGAVATAAEFI  142



>ref|XP_007206105.1| hypothetical protein PRUPE_ppa012989mg [Prunus persica]
 gb|EMJ07304.1| hypothetical protein PRUPE_ppa012989mg [Prunus persica]
Length=146

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   IG V A                       A    A+  V
Sbjct  18   IIDLGNPLLNHTVDGFLK---IGTVAATR---------------------AAAEDAYSMV  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YGL   RG  DW+N+ + GA+TGA 
Sbjct  54   KKGSISTHDAEHTLKKMCKEGAYWGTVAGVYVGAEYGLERVRGTRDWKNAMMGGALTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  T +   D VI  AITG AI+TA   +
Sbjct  114  VSAAT-NKGKDKVIVDAITGGAIATAVEFI  142



>ref|XP_010937628.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=133

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 50/107 (47%), Gaps = 17/107 (16%)
 Frame = -3

Query  722  LGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKG  543
            +G+  LNR  D F+K   +GA +  A E Y    +G SR              FP     
Sbjct  1    MGNAFLNRTVDGFLKIGAVGASKVAAEETYDCLKKGPSR--------------FPFW---  43

Query  542  GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
              +K  +E  ++   KE + WG  AGVY G+ YG+   RG  DW+N+
Sbjct  44   KFSKDKLEDALRKICKEGVYWGTTAGVYVGMEYGVERMRGTKDWKNA  90



>ref|XP_008223554.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Prunus 
mume]
Length=146

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + DLG+PLLN   D F+K   IG V A    A                       A+  V
Sbjct  18   IIDLGNPLLNHTVDGFLK---IGTVAATRAAA---------------------EDAYSVV  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +    E  +K   KE   WG  AGVY G  YGL   RG  DW+N+ + GA+TGA 
Sbjct  54   KKGSISTHDAEHTLKKMCKEGAYWGTVAGVYVGAEYGLERVRGTRDWKNAMIGGAVTGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            ++  T +   D VI  AITG AI+TA   +
Sbjct  114  VSAAT-NKGKDKVIVDAITGGAIATAVEFI  142



>emb|CBI16133.3| unnamed protein product [Vitis vinifera]
Length=126

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 73/147 (50%), Gaps = 25/147 (17%)
 Frame = -3

Query  722  LGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKG  543
            +G+P LN   D F+K   + A +A A EAY+                         V +G
Sbjct  1    MGNPFLNLTVDGFLKIGTVAAARAAAEEAYYV------------------------VKRG  36

Query  542  GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalam  363
              ++ +VE  +K   KE+  WG  AGVY G+ YG    RG  DW+N+ L GA+TGA ++ 
Sbjct  37   SISRHTVEHSLKKMCKEAAYWGTVAGVYVGMEYGAERIRGTRDWKNAMLGGALTGAIISS  96

Query  362  tTKDHSHDHVIQCAITGAAISTAANLL  282
               +   D ++  AITG AI+TAA  L
Sbjct  97   AC-EKGRDKIVVGAITGGAIATAAEFL  122



>ref|XP_010937629.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=126

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 47/107 (44%), Gaps = 24/107 (22%)
 Frame = -3

Query  722  LGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKG  543
            +G+  LNR  D F+K   +GA +  A E Y                          + KG
Sbjct  1    MGNAFLNRTVDGFLKIGAVGASKVAAEETY------------------------DCLKKG  36

Query  542  GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
              +K  +E  ++   KE + WG  AGVY G+ YG+   RG  DW+N+
Sbjct  37   KFSKDKLEDALRKICKEGVYWGTTAGVYVGMEYGVERMRGTKDWKNA  83



>ref|XP_004487008.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Cicer arietinum]
Length=146

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 60/148 (41%), Gaps = 46/148 (31%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A ++VA + Y                          +
Sbjct  18   VIDMGNPFLNLTVDGFLKIGAVAATRSVAEDTYHI------------------------I  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  + +  E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+          
Sbjct  54   RKGSISSNDFEKTLKKMCKEGAYWGTIAGVYVGVEYGVERIRGTRDWKNA----------  103

Query  371  lamtTKDHSHDHVIQCAITGAAISTAAN  288
                        ++  A+TGA +S A+N
Sbjct  104  ------------MVGGAVTGALVSAASN  119



>ref|NP_001235311.1| uncharacterized protein LOC100499736 [Glycine max]
 gb|ACU13436.1| unknown [Glycine max]
 gb|KHN33383.1| Outer envelope pore protein 16, chloroplastic [Glycine soja]
Length=143

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 58/147 (39%), Gaps = 46/147 (31%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A ++ A + Y                          + 
Sbjct  16   IDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHI------------------------IQ  51

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +    E  +K   KE + WG  AGVY G+ YG+   RG  DW+N+           
Sbjct  52   KGNISSRDFEKTLKKMCKEGVYWGTIAGVYVGMEYGVERIRGTRDWKNA-----------  100

Query  368  amtTKDHSHDHVIQCAITGAAISTAAN  288
                       +I  A+TGA +S A+N
Sbjct  101  -----------MIGGAVTGALVSAASN  116



>ref|NP_001042833.2| Os01g0303300 [Oryza sativa Japonica Group]
 dbj|BAF04747.2| Os01g0303300, partial [Oryza sativa Japonica Group]
Length=95

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -3

Query  479  GFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAIS  300
            G AAGVYSGLTYGLREARG HDW+NSA+AGAI G A+A+T    + DH++  AITGAA+S
Sbjct  26   GLAAGVYSGLTYGLREARGCHDWKNSAVAGAIAGVAVALTGDTGNADHMVHFAITGAALS  85

Query  299  TAANLLTGIF  270
            +AA+LL+GI+
Sbjct  86   SAASLLSGIY  95



>gb|KHN30171.1| Outer envelope pore protein 16, chloroplastic [Glycine soja]
Length=143

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 58/147 (39%), Gaps = 46/147 (31%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A ++ A + Y                          + 
Sbjct  16   IDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHI------------------------IQ  51

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +    E  +K   KE + WG  AGVY G+ YG+   RG  DW+N+           
Sbjct  52   KGNISSHDFEKTLKKMCKEGVYWGTIAGVYVGMEYGVERIRGTRDWKNA-----------  100

Query  368  amtTKDHSHDHVIQCAITGAAISTAAN  288
                       +I  A+TGA +S A+N
Sbjct  101  -----------MIGGAVTGALVSAASN  116



>ref|NP_001238155.1| uncharacterized protein LOC100499674 [Glycine max]
 gb|ACU13192.1| unknown [Glycine max]
Length=143

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 58/147 (39%), Gaps = 46/147 (31%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A ++ A + Y                          + 
Sbjct  16   IDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHI------------------------IQ  51

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +    E  +K   KE + WG  AGVY G+ YG+   RG  DW+N+           
Sbjct  52   KGNISSHDFEKTLKKMCKEGVYWGTIAGVYVGMEYGVERIRGTRDWKNA-----------  100

Query  368  amtTKDHSHDHVIQCAITGAAISTAAN  288
                       +I  A+TGA +S A+N
Sbjct  101  -----------MIGGAVTGALVSAASN  116



>gb|KHN43721.1| Outer envelope pore protein 16, chloroplastic [Glycine soja]
Length=146

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 21/109 (19%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A ++ A + Y    +   R+         + H F    
Sbjct  16   IDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHIIQKETVRNI--------SSHDF----  63

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
                     E  +K   KE + WG  AGVY G+ YG+   RG  DW+N+
Sbjct  64   ---------EKTLKKMCKEGVYWGTLAGVYLGMEYGVERIRGTRDWKNA  103



>gb|EYU18967.1| hypothetical protein MIMGU_mgv1a015773mg [Erythranthe guttata]
Length=146

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 58/148 (39%), Gaps = 46/148 (31%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A + VA E Y                          V
Sbjct  18   IVDMGNPFLNATLDGFLKIGTVAAGKVVAEEVY------------------------GVV  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  + ++ E  +K   KE   WG  AGVY G  YG+   RG  DW+N+          
Sbjct  54   KRGSISSNNFEKSLKKMCKEGAYWGTVAGVYVGFEYGVERVRGTRDWKNA----------  103

Query  371  lamtTKDHSHDHVIQCAITGAAISTAAN  288
                        +I  A+TGA +S A N
Sbjct  104  ------------MIGGALTGAVVSAACN  119



>ref|NP_001241534.1| uncharacterized protein LOC100796140 [Glycine max]
 gb|ACU20596.1| unknown [Glycine max]
Length=143

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 48/110 (44%), Gaps = 26/110 (24%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A ++ A + Y                          ++
Sbjct  16   IDMGNPFLNLTVDGFLKIGAVAATRSAAEDTY-------------------------HII  50

Query  548  KGGNNKS-SVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
            + GN  S   E  +K   KE + WG  AGVY G+ YG+   RG  DW+N+
Sbjct  51   RNGNISSHDFEKTLKKMCKEGVYWGTLAGVYLGMEYGVERIRGTRDWKNA  100



>sp|Q41050.1|OEP16_PEA RecName: Full=Outer envelope pore protein 16, chloroplastic; 
AltName: Full=Chloroplastic outer envelope pore protein of 16 
kDa [Pisum sativum]
 emb|CAA97910.1| core protein [Pisum sativum]
Length=146

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 48/110 (44%), Gaps = 24/110 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A ++VA +                         F  +
Sbjct  18   VIDMGNPFLNLTVDGFLKIGAVAATRSVAEDT------------------------FHII  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
             KG  + +  E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+
Sbjct  54   RKGSISSNDFEKSLKKMCKEGAYWGAIAGVYVGMEYGVERIRGTRDWKNA  103



>ref|XP_006596957.1| PREDICTED: uncharacterized protein LOC100499736 isoform X1 [Glycine 
max]
Length=165

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 60/147 (41%), Gaps = 24/147 (16%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D F+K   + A ++ A + Y                          + 
Sbjct  16   IDMGNPFLNLTVDGFLKIGAVAATRSAAEDTYHI------------------------IQ  51

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +    E  +K   KE + WG  AGVY G+ YG+   RG  DW   +          
Sbjct  52   KGNISSRDFEKTLKKMCKEGVYWGTIAGVYVGMEYGVERIRGTRDWVILSRGWLDLHLPF  111

Query  368  amtTKDHSHDHVIQCAITGAAISTAAN  288
            A     ++ + +I  A+TGA +S A+N
Sbjct  112  AQLPAFYTKNAMIGGAVTGALVSAASN  138



>ref|XP_009783659.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Nicotiana 
sylvestris]
Length=116

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 31/107 (29%), Positives = 44/107 (41%), Gaps = 24/107 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+PLLN+  D+F+K   +   +    E Y                          V
Sbjct  18   VIDMGNPLLNQTVDAFLKIGTVAVTKTAVEETYHI------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDW  411
             KG  +  + E  +K   KE   WG  AGVY+G+ YG    RG  DW
Sbjct  54   KKGSVSSHNFENSLKKMCKEGAYWGTVAGVYAGMEYGAERIRGTRDW  100



>gb|EPS67531.1| hypothetical protein M569_07245 [Genlisea aurea]
Length=146

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 61/147 (41%), Gaps = 46/147 (31%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K  G+ A +A A E Y     G+                    
Sbjct  18   MVDMGNPFLNHTLDGFLKIGGVAAAKAAAEETYKMGKRGSV-------------------  58

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
                 +  S+E  ++   KE   WG  AGVY G+ +G+ + RG  DW+NS          
Sbjct  59   -----SGQSLEQSVRKMCKEGAYWGTVAGVYVGMEFGVEKVRGTRDWKNS----------  103

Query  371  lamtTKDHSHDHVIQCAITGAAISTAA  291
                        +I  A+TGA +STA+
Sbjct  104  ------------LIGGALTGAIVSTAS  118



>gb|KHG02971.1| Outer envelope pore 16, chloroplastic [Gossypium arboreum]
Length=146

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 75/149 (50%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+   N   + F+K   + A +++A ++ F A+ G                      
Sbjct  19   IDTGNLFFNHALEGFLKIGSVAATRSIAEDS-FKAING----------------------  55

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
             G  +K  +E  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ + GA+TGA +
Sbjct  56   -GKLSKHCLERSLKKMCKEGAYWGSVAGVYVGMEYGVGRIRGTWDWKNAMIGGALTGALV  114

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
            +  T +++ D ++  A+TG A++TA+ LL
Sbjct  115  SAVT-NNNKDQIVSDALTGGAVATASVLL  142



>ref|XP_008457483.1| PREDICTED: outer envelope pore protein 16, chloroplastic [Cucumis 
melo]
Length=146

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (45%), Gaps = 25/150 (17%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A +A A +AY                          V
Sbjct  18   VIDMGNPFLNLTVDGFLKIGSVAATRAAAEDAYHV------------------------V  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             KG  +  + E  +K    E   WG  AG Y G+ YG+   RG  DW+N+ + G     A
Sbjct  54   RKGTISTHNFENTLKKMCTEGAYWGAVAGAYVGMEYGVERVRGTRDWKNA-MIGGALTGA  112

Query  371  lamtTKDHSHDHVIQCAITGAAISTAANLL  282
            L     +++ D V+  AITG A++TAA  +
Sbjct  113  LVSAASNNNRDKVVIDAITGGAVATAAEFI  142



>ref|XP_006361206.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=122

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = -3

Query  596  PEIGGAKN--HHAFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARG  423
            P++   K      +  V +G  +  + E  +K   KE   WG  AGVY+G+ YG    RG
Sbjct  13   PKVAATKTVAEETYGIVTRGSVSSHNFEKSLKKMCKEGAYWGTVAGVYAGMEYGAERIRG  72

Query  422  VHDWRNSalagaitgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
             +DW+N+ + G     AL     +++ D ++  AITG A++TA+  L
Sbjct  73   TNDWKNA-MIGGALTGALISAASNNNRDKIVMDAITGGAVATASEFL  118



>ref|XP_009399869.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=146

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 63/152 (41%), Gaps = 28/152 (18%)
 Frame = -3

Query  725  DLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLK  546
            D+G+P LNR  D F++   + A +  A EAY                          V K
Sbjct  20   DMGNPFLNRTVDGFLRIGTVAASRVAAEEAY------------------------QCVRK  55

Query  545  GGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaala  366
            G  +K   E  +K   KE + WG    VY G+ + +    G   W+N+ + G      L 
Sbjct  56   GSISKRKFEDALKRMCKEGVYWGTVTSVYVGVEHNIERISGTRTWKNA-MLGGAITGFLI  114

Query  365  mtTKDHSHDHVIQCAITGAAISTA---ANLLT  279
                ++  D +I+  IT  A++TA    NLLT
Sbjct  115  SAASNNGTDKIIKDTITAGAVATAIEFINLLT  146



>gb|AFK43169.1| unknown [Medicago truncatula]
 gb|KEH39437.1| outer envelope pore protein [Medicago truncatula]
Length=146

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 46/110 (42%), Gaps = 24/110 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A +A+A +                         F  V
Sbjct  18   VIDMGNPFLNLAVDGFLKIGTVAATRALAEDT------------------------FHIV  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
             KG  + +  E  +K   KE   WG   GVY G  YG+   RG  DW+N+
Sbjct  54   RKGSVSSNDFEKTLKKMCKEGAYWGAIGGVYVGTEYGVERIRGTRDWKNA  103



>gb|KHG03976.1| smek1 [Gossypium arboreum]
Length=997

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = -3

Query  776  TLGDEIRSLDHGYGGLFDLGHPLLNRIADSFVKAAGIGAVQAVAREA  636
            +L DE+R      G  FDLGHPLLN  A SFVK AGIGA+QA+AREA
Sbjct  954  SLFDELR---FDKGDFFDLGHPLLNWTAQSFVKTAGIGALQAIAREA  997



>emb|CDO98780.1| unnamed protein product [Coffea canephora]
Length=52

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = -3

Query  350  HSHDHVIQCAITGAAISTAANLLTGIF  270
            HSH+ ++QCAITGAAISTAANLLTGIF
Sbjct  26   HSHEQIVQCAITGAAISTAANLLTGIF  52



>ref|XP_008784573.1| PREDICTED: outer envelope pore protein 16, chloroplastic isoform 
X1 [Phoenix dactylifera]
 ref|XP_008784574.1| PREDICTED: outer envelope pore protein 16, chloroplastic isoform 
X1 [Phoenix dactylifera]
Length=164

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 62/149 (42%), Gaps = 31/149 (21%)
 Frame = -3

Query  710  LLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKGGNNK  531
            +LNR  + F+K   +GA +    E Y                           LK G  K
Sbjct  18   VLNRTIEGFIKIGVVGASKVAVEETY-------------------------DCLKKG--K  50

Query  530  SSVEAL---IKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamt  360
             SVE L   ++   +    WG  AG Y G+ YG+   RG  DW+N+ + G     AL   
Sbjct  51   FSVEKLDDALRKVCRGGAYWGTTAGAYVGMEYGMERIRGTRDWKNA-MLGGAITGALISA  109

Query  359  TKDHSHDHVIQCAITGAAISTAANLLTGI  273
               H  D VI  AIT  A++TAA L+  +
Sbjct  110  AHGHGRDQVIANAITIGALATAAKLINNL  138



>ref|XP_010920590.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Elaeis guineensis]
Length=146

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 24/107 (22%)
 Frame = -3

Query  722  LGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKG  543
            LG+P   R  + F+K   + A +    E Y                          + KG
Sbjct  21   LGNPFFKRTVEGFLKIGAVAASKVAVEETY------------------------DCLKKG  56

Query  542  GNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
              +K++++  ++   +E   WG  AGVY G+ YG+   RG  DW+N+
Sbjct  57   QFSKATLDNALRKMCREGAYWGTTAGVYVGMEYGMESIRGTRDWKNA  103



>ref|XP_010252116.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=175

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 66/149 (44%), Gaps = 25/149 (17%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D G+P L+     F+K   + A++  A E Y+                         + 
Sbjct  44   IDTGNPFLHHTIHGFLKIGTVAAMRVAAEEIYY------------------------RLQ  79

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaal  369
            KG  +K   +  +K   KE   WG  AG Y G+ +G++   G  DWRN+ +       AL
Sbjct  80   KGKFSKHKFKHKLKKMYKEGTYWGTVAGAYVGMGHGIQRICGTRDWRNA-MLSGALSGAL  138

Query  368  amtTKDHSHDHVIQCAITGAAISTAANLL  282
               TK++S D ++  AITG AI+ AA LL
Sbjct  139  ISATKNNSRDRIMIDAITGGAIAIAAELL  167



>gb|KEH39438.1| outer envelope pore protein [Medicago truncatula]
Length=114

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 43/107 (40%), Gaps = 24/107 (22%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D+G+P LN   D F+K   + A +A+A +                         F  V
Sbjct  18   VIDMGNPFLNLAVDGFLKIGTVAATRALAEDT------------------------FHIV  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDW  411
             KG  + +  E  +K   KE   WG   GVY G  YG+   RG  DW
Sbjct  54   RKGSVSSNDFEKTLKKMCKEGAYWGAIGGVYVGTEYGVERIRGTRDW  100



>gb|KGN65718.1| hypothetical protein Csa_1G515470 [Cucumis sativus]
Length=118

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 42/77 (55%), Gaps = 1/77 (1%)
 Frame = -3

Query  512  IKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamtTKDHSHDHV  333
            +K   KE   WG  AG Y G+ YG+   RG  DW+N+ + G     AL     +++ D V
Sbjct  39   LKKMCKEGAYWGAVAGAYVGMEYGVERIRGTRDWKNA-MIGGALTGALVSAASNNNRDKV  97

Query  332  IQCAITGAAISTAANLL  282
            +  AITG A++TAA  +
Sbjct  98   VIDAITGGAVATAAEFI  114



>ref|XP_010253167.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Nelumbo nucifera]
Length=146

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 1/94 (1%)
 Frame = -3

Query  563  FPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagai  384
            F  + +G   K  +E  +K   +E   WG  AGVY G+  G+   RG  DW+ SA+    
Sbjct  50   FQCLGRGEFPKHKLEDTLKRMFREGACWGTVAGVYVGMERGIERIRGTRDWK-SAMLSGA  108

Query  383  tgaalamtTKDHSHDHVIQCAITGAAISTAANLL  282
               AL     ++  D V+   ITG AI+TAA  L
Sbjct  109  LSGALISAATNNGRDKVVMHTITGGAIATAAEFL  142



>ref|XP_004960520.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Setaria italica]
Length=222

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  566  AFPSVLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalaga  387
            AF  +  GG ++  V+  +KN  KE   WG AAG +  + YGL   RG  DW+N+ + GA
Sbjct  69   AFDCLTTGGVSRHKVKHSVKNMCKEGSYWGAAAGAFEAIEYGLELMRGRSDWKNAMIGGA  128

Query  386  itgaalamtTKDHSH-DHVIQCAITGAAISTAANLLT  279
            + GA ++     H     VI+ +I G AI TA   ++
Sbjct  129  LAGALISAANSSHRDTKQVIKHSIAGGAIGTAVEFIS  165



>ref|XP_008656555.1| PREDICTED: outer envelope pore protein 16, chloroplastic-like 
[Zea mays]
 gb|AFW82866.1| putative mitochondrial import inner membrane translocase subunit 
Tim17 family protein [Zea mays]
Length=146

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 76/154 (49%), Gaps = 28/154 (18%)
 Frame = -3

Query  731  LFDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSV  552
            + D G+P LNR  D F+K   +GA +  A E                         F  +
Sbjct  18   VIDTGNPFLNRTVDGFLKIGAVGACKVAAEET------------------------FDCL  53

Query  551  LKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaa  372
             +G  +K  VE  +K   KE   WG  AGVY G+ YG+   RG  DW+N+ + GA++GA 
Sbjct  54   HRGDVSKRKVEHALKKMCKEGAYWGTVAGVYVGVVYGVERVRGRSDWKNAMVGGALSGAL  113

Query  371  lamtTKDHSHDHVIQCAITGAAISTA---ANLLT  279
            ++  + +H  D +++ AIT  A++TA   AN LT
Sbjct  114  VSAASSNHG-DKIVKDAITAGAVATAVEFANYLT  146



>ref|XP_007150324.1| hypothetical protein PHAVU_005G144000g [Phaseolus vulgaris]
 gb|ESW22318.1| hypothetical protein PHAVU_005G144000g [Phaseolus vulgaris]
Length=143

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 44/109 (40%), Gaps = 24/109 (22%)
 Frame = -3

Query  728  FDLGHPLLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVL  549
             D+G+P LN   D+F++   I A ++   + Y                          + 
Sbjct  16   IDMGNPFLNLTVDAFLRIGTIAATRSGVEDTYHI------------------------IQ  51

Query  548  KGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNS  402
            K   +    E  +K   KE + WG  AG+Y G  YG+   RG  DW+N+
Sbjct  52   KRNISSHDFEKTLKKMCKEGVYWGTVAGLYVGTEYGVERIRGTRDWKNA  100



>ref|XP_004151033.1| PREDICTED: LOW QUALITY PROTEIN: outer envelope pore protein 16, 
chloroplastic-like [Cucumis sativus]
Length=197

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 46/91 (51%), Gaps = 1/91 (1%)
 Frame = -3

Query  554  VLKGGNNKSSVEALIKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitga  375
            V  G  +    E  +K   KE   WG  AG Y G+ YG+   RG  DW+N+ + G     
Sbjct  104  VKNGAISSHKFENTLKKMCKEGAYWGAVAGAYVGMEYGVERIRGTRDWKNA-MIGGALTG  162

Query  374  alamtTKDHSHDHVIQCAITGAAISTAANLL  282
            AL     +++ D V+  AITG A++TAA  +
Sbjct  163  ALVSAASNNNRDKVVIDAITGGAVATAAEFI  193



>ref|XP_008784575.1| PREDICTED: outer envelope pore protein 16, chloroplastic isoform 
X2 [Phoenix dactylifera]
Length=163

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 61/149 (41%), Gaps = 32/149 (21%)
 Frame = -3

Query  710  LLNRIADSFVKAAGIGAVQAVAREAYFTAVEGASRDTPPEIGGAKNHHAFPSVLKGGNNK  531
            +LNR  + F+K   +GA +    E Y                           LK G  K
Sbjct  18   VLNRTIEGFIKIGVVGASKVAVEETY-------------------------DCLKKG--K  50

Query  530  SSVEAL---IKNTGKESMQWGFAAGVYSGLTYGLREARGVHDWRNSalagaitgaalamt  360
             SVE L   ++   +    WG  AG Y G+ YG+   RG  DW  +A+ G     AL   
Sbjct  51   FSVEKLDDALRKVCRGGAYWGTTAGAYVGMEYGMERIRGTRDW--NAMLGGAITGALISA  108

Query  359  TKDHSHDHVIQCAITGAAISTAANLLTGI  273
               H  D VI  AIT  A++TAA L+  +
Sbjct  109  AHGHGRDQVIANAITIGALATAAKLINNL  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2424532346784