BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78722_g1_i1 len=1032 path=[1:0-1031]

Length=1032
                                                                      Score     E

ref|XP_004242911.1|  PREDICTED: peroxidase 16                           516   0.0      
ref|XP_009600643.1|  PREDICTED: peroxidase 16-like                      515   2e-180   
ref|XP_009783800.1|  PREDICTED: peroxidase 16-like                      515   2e-180   
ref|XP_006344534.1|  PREDICTED: peroxidase 45-like                      508   7e-178   
ref|XP_010048668.1|  PREDICTED: peroxidase 16                           504   3e-176   
ref|XP_010048567.1|  PREDICTED: peroxidase 16-like                      500   1e-174   
gb|KDP35389.1|  hypothetical protein JCGZ_10373                         493   5e-172   
gb|EYU37318.1|  hypothetical protein MIMGU_mgv1a009838mg                492   3e-171   
emb|CDP02994.1|  unnamed protein product                                490   9e-171   
ref|XP_011069927.1|  PREDICTED: peroxidase 16                           485   1e-168   
ref|XP_002532803.1|  Peroxidase 16 precursor, putative                  485   1e-168   Ricinus communis
ref|XP_008223742.1|  PREDICTED: peroxidase 16-like                      484   2e-168   
ref|XP_004296463.1|  PREDICTED: peroxidase 45-like                      484   2e-168   
ref|XP_010526357.1|  PREDICTED: peroxidase 16                           483   6e-168   
ref|XP_007222667.1|  hypothetical protein PRUPE_ppa008569mg             483   1e-167   
gb|KDO61842.1|  hypothetical protein CISIN_1g046044mg                   481   5e-167   
gb|ACU23164.1|  unknown                                                 480   8e-167   Glycine max [soybeans]
ref|XP_006453319.1|  hypothetical protein CICLE_v10010461mg             480   8e-167   
ref|XP_011043934.1|  PREDICTED: peroxidase 45-like                      480   1e-166   
ref|XP_010467737.1|  PREDICTED: peroxidase 16                           479   2e-166   
ref|XP_007014305.1|  Peroxidase family protein                          479   4e-166   
ref|XP_009347014.1|  PREDICTED: peroxidase 16-like                      478   9e-166   
ref|XP_003549343.1|  PREDICTED: peroxidase 16                           477   2e-165   
gb|EYU37317.1|  hypothetical protein MIMGU_mgv1a009833mg                477   2e-165   
ref|XP_010489449.1|  PREDICTED: peroxidase 16-like                      477   2e-165   
ref|XP_002324463.1|  Peroxidase 16 precursor family protein             476   3e-165   Populus trichocarpa [western balsam poplar]
ref|XP_008390952.1|  PREDICTED: peroxidase 16-like                      474   1e-164   
ref|XP_003533723.1|  PREDICTED: peroxidase 16-like                      474   1e-164   
ref|XP_006300101.1|  hypothetical protein CARUB_v10016330mg             474   2e-164   
ref|XP_009137893.1|  PREDICTED: peroxidase 45                           474   2e-164   
ref|XP_006412738.1|  hypothetical protein EUTSA_v10025699mg             474   2e-164   
gb|KHN22682.1|  Peroxidase 16                                           474   3e-164   
ref|NP_179488.1|  peroxidase 16                                         473   3e-164   Arabidopsis thaliana [mouse-ear cress]
emb|CAA70034.1|  peroxidase ATP22a                                      473   5e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008223743.1|  PREDICTED: peroxidase 16                           473   6e-164   
emb|CDX72214.1|  BnaC07g42360D                                          473   8e-164   
gb|ADD54643.1|  peroxidase                                              472   1e-163   Bruguiera gymnorhiza [Burma mangrove]
gb|AFK40484.1|  unknown                                                 471   4e-163   
ref|XP_002884180.1|  hypothetical protein ARALYDRAFT_900345             471   4e-163   
ref|XP_003546418.1|  PREDICTED: peroxidase 16                           471   5e-163   
emb|CDY28166.1|  BnaA01g06830D                                          470   1e-162   
gb|KHN15314.1|  Peroxidase 16                                           470   1e-162   
gb|KFK29573.1|  peroxidase atp8a                                        469   1e-162   
ref|XP_002268127.1|  PREDICTED: peroxidase 16                           469   1e-162   Vitis vinifera
ref|XP_003610076.1|  Peroxidase                                         468   7e-162   
ref|XP_009128021.1|  PREDICTED: peroxidase 45                           467   9e-162   
gb|AAX84669.1|  secretory peroxidase PX3                                468   3e-161   Manihot esculenta [manioc]
ref|XP_004507879.1|  PREDICTED: peroxidase 16-like                      464   2e-160   
ref|XP_010433020.1|  PREDICTED: peroxidase 45-like                      464   2e-160   
ref|XP_006284105.1|  hypothetical protein CARUB_v10005239mg             464   2e-160   
ref|XP_007154738.1|  hypothetical protein PHAVU_003G143400g             463   5e-160   
ref|XP_010094192.1|  Peroxidase 45                                      463   5e-160   
ref|XP_010525719.1|  PREDICTED: peroxidase 16-like                      462   8e-160   
ref|XP_007138800.1|  hypothetical protein PHAVU_009G238400g             462   1e-159   
ref|XP_004488001.1|  PREDICTED: peroxidase 16-like                      462   2e-159   
ref|XP_002869392.1|  predicted protein                                  461   3e-159   
ref|XP_010438209.1|  PREDICTED: peroxidase 45-like                      460   5e-159   
ref|XP_010447758.1|  PREDICTED: peroxidase 45                           460   6e-159   
ref|NP_194746.1|  peroxidase 45                                         459   2e-158   Arabidopsis thaliana [mouse-ear cress]
gb|AFF57838.1|  peroxidase                                              458   5e-158   
ref|XP_010246527.1|  PREDICTED: peroxidase 16-like                      454   2e-156   
emb|CDY66754.1|  BnaCnng52220D                                          454   2e-154   
emb|CAN64129.1|  hypothetical protein VITISV_039161                     447   7e-153   Vitis vinifera
ref|NP_001241556.1|  uncharacterized protein LOC100793327 precursor     436   1e-149   
ref|XP_009763998.1|  PREDICTED: peroxidase 51-like                      432   8e-148   
ref|XP_007011594.1|  Peroxidase superfamily protein                     432   8e-148   
ref|XP_009604475.1|  PREDICTED: peroxidase 51-like                      431   2e-147   
ref|XP_006600191.1|  PREDICTED: uncharacterized protein LOC100793...    430   5e-147   
ref|XP_010246526.1|  PREDICTED: peroxidase 16-like                      429   2e-146   
ref|XP_008219934.1|  PREDICTED: peroxidase 16-like                      428   2e-146   
gb|ACJ11764.1|  class III peroxidase                                    427   5e-146   Gossypium hirsutum [American cotton]
gb|KDP32054.1|  hypothetical protein JCGZ_12515                         427   1e-145   
ref|XP_010272213.1|  PREDICTED: peroxidase 73-like                      427   1e-145   
ref|XP_004231908.1|  PREDICTED: peroxidase 51                           426   2e-145   
ref|XP_004136312.1|  PREDICTED: peroxidase 45-like                      426   2e-145   
emb|CAA09881.1|  peroxidase                                             426   2e-145   Trifolium repens [creeping white clover]
ref|XP_006339817.1|  PREDICTED: peroxidase 51-like                      426   2e-145   
ref|XP_008466661.1|  PREDICTED: peroxidase 45-like                      426   3e-145   
ref|XP_002525252.1|  Peroxidase 73 precursor, putative                  425   6e-145   Ricinus communis
ref|XP_007227473.1|  hypothetical protein PRUPE_ppa008550mg             424   7e-145   
ref|XP_006845692.1|  hypothetical protein AMTR_s00019p00237230          420   4e-143   
ref|XP_007161310.1|  hypothetical protein PHAVU_001G059100g             420   6e-143   
ref|XP_006573655.1|  PREDICTED: peroxidase 51                           419   1e-142   
emb|CAA62228.1|  peroxidase2                                            419   1e-142   Medicago sativa [alfalfa]
ref|XP_004509077.1|  PREDICTED: peroxidase 73-like                      418   3e-142   
ref|XP_011099352.1|  PREDICTED: peroxidase 73                           418   3e-142   
emb|CAC38106.1|  peroxidase2                                            417   6e-142   Medicago sativa [alfalfa]
gb|KHG21770.1|  Peroxidase 51 -like protein                             417   8e-142   
ref|XP_007205527.1|  hypothetical protein PRUPE_ppa008489mg             416   1e-141   
gb|ACI42310.2|  peroxidase 5                                            416   3e-141   Litchi chinensis [litchi]
ref|NP_001275041.1|  peroxidase 51-like precursor                       415   3e-141   
ref|XP_003608471.1|  Peroxidase                                         415   5e-141   
ref|XP_009784349.1|  PREDICTED: peroxidase 51-like                      414   9e-141   
ref|XP_008457736.1|  PREDICTED: peroxidase 51-like                      414   1e-140   
ref|XP_010028113.1|  PREDICTED: peroxidase 73-like                      414   2e-140   
ref|XP_008238250.1|  PREDICTED: peroxidase 73-like                      413   3e-140   
ref|XP_004234654.1|  PREDICTED: peroxidase 51                           412   4e-140   
ref|XP_007156729.1|  hypothetical protein PHAVU_002G012300g             412   4e-140   
ref|XP_009342775.1|  PREDICTED: peroxidase 73-like                      412   5e-140   
ref|XP_007155845.1|  hypothetical protein PHAVU_003G236500g             412   6e-140   
ref|XP_003550018.1|  PREDICTED: peroxidase 50-like                      411   1e-139   
gb|KHN28333.1|  Peroxidase 73                                           411   1e-139   
gb|AAO45182.1|  peroxidase 1                                            411   1e-139   Artemisia annua [sweet Annie]
ref|XP_009363613.1|  PREDICTED: peroxidase 16-like                      411   1e-139   
ref|XP_009421098.1|  PREDICTED: peroxidase 51                           411   1e-139   
gb|ACJ11763.1|  class III peroxidase                                    411   2e-139   Gossypium hirsutum [American cotton]
gb|ACU19256.1|  unknown                                                 410   2e-139   Glycine max [soybeans]
ref|XP_008440361.1|  PREDICTED: peroxidase 73-like                      410   3e-139   
ref|NP_001241630.1|  uncharacterized protein LOC100804350 precursor     410   3e-139   
ref|XP_010444652.1|  PREDICTED: peroxidase 73                           410   3e-139   
ref|XP_010906276.1|  PREDICTED: peroxidase 51-like                      410   4e-139   
ref|XP_004141876.1|  PREDICTED: peroxidase 73-like                      410   4e-139   
ref|XP_003597105.1|  Peroxidase                                         410   4e-139   
ref|XP_010531296.1|  PREDICTED: peroxidase 50                           410   6e-139   
gb|KHN06005.1|  Peroxidase 73                                           409   8e-139   
gb|KHN12986.1|  Peroxidase 51                                           409   9e-139   
ref|XP_009620453.1|  PREDICTED: peroxidase 51-like                      409   1e-138   
ref|XP_008787159.1|  PREDICTED: peroxidase 50                           409   1e-138   
gb|AFY97684.1|  peroxidase 1                                            408   1e-138   
ref|XP_004291278.1|  PREDICTED: peroxidase 45-like                      408   2e-138   
ref|XP_004147080.1|  PREDICTED: peroxidase 51-like                      408   2e-138   
ref|XP_010277087.1|  PREDICTED: peroxidase 51-like                      407   5e-138   
ref|XP_006393941.1|  hypothetical protein EUTSA_v10004576mg             407   5e-138   
gb|EYU44477.1|  hypothetical protein MIMGU_mgv1a026768mg                407   6e-138   
gb|KGN61954.1|  hypothetical protein Csa_2G271470                       408   7e-138   
ref|XP_002284278.1|  PREDICTED: peroxidase 73                           407   7e-138   Vitis vinifera
ref|XP_010484504.1|  PREDICTED: peroxidase 73-like                      407   8e-138   
ref|XP_008340941.1|  PREDICTED: peroxidase 51-like                      407   8e-138   
ref|XP_010905285.1|  PREDICTED: peroxidase 35-like                      407   8e-138   
gb|KEH39756.1|  class III peroxidase                                    406   1e-137   
ref|XP_006290363.1|  hypothetical protein CARUB_v10017623mg             406   1e-137   
emb|CDP02582.1|  unnamed protein product                                406   1e-137   
gb|AAB41812.1|  peroxidase                                              406   2e-137   Medicago sativa [alfalfa]
ref|XP_008792666.1|  PREDICTED: peroxidase 51-like                      405   2e-137   
ref|XP_010515362.1|  PREDICTED: peroxidase 35                           405   2e-137   
ref|XP_002866704.1|  peroxidase 73                                      405   3e-137   
ref|XP_010426527.1|  PREDICTED: peroxidase 35-like                      405   4e-137   
ref|XP_008367710.1|  PREDICTED: peroxidase 16-like                      405   4e-137   
ref|XP_010111940.1|  Peroxidase 45                                      405   5e-137   
ref|XP_010503665.1|  PREDICTED: peroxidase 35-like                      404   6e-137   
ref|XP_010464099.1|  PREDICTED: peroxidase 73-like                      404   6e-137   
ref|NP_190565.1|  peroxidase 35                                         404   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242402.1|  uncharacterized protein LOC100817540 precursor     404   1e-136   
ref|XP_004498581.1|  PREDICTED: peroxidase 45-like                      403   1e-136   
ref|XP_006404085.1|  hypothetical protein EUTSA_v10010538mg             403   2e-136   
ref|XP_007047481.1|  Class III peroxidase                               403   2e-136   
ref|XP_002877713.1|  predicted protein                                  403   2e-136   
ref|XP_011013593.1|  PREDICTED: peroxidase 73-like                      403   3e-136   
ref|XP_004511856.1|  PREDICTED: peroxidase 51-like                      402   7e-136   
gb|AFK48158.1|  unknown                                                 401   8e-136   
ref|XP_009344467.1|  PREDICTED: peroxidase 50-like                      402   2e-135   
gb|AFK33671.1|  unknown                                                 400   2e-135   
gb|ACJ11759.1|  class III peroxidase                                    400   5e-135   Gossypium hirsutum [American cotton]
ref|NP_201541.1|  peroxidase 73                                         399   5e-135   Arabidopsis thaliana [mouse-ear cress]
gb|ACU20973.1|  unknown                                                 397   7e-135   Glycine max [soybeans]
ref|XP_006466484.1|  PREDICTED: peroxidase 51-like                      399   1e-134   
ref|XP_006380636.1|  Peroxidase 50 precursor family protein             399   2e-134   
ref|XP_006470079.1|  PREDICTED: peroxidase 55-like                      398   2e-134   
gb|KDO63914.1|  hypothetical protein CISIN_1g020449mg                   397   4e-134   
ref|XP_006279521.1|  hypothetical protein CARUB_v10027970mg             397   5e-134   
ref|XP_004288471.1|  PREDICTED: peroxidase 73-like                      397   5e-134   
gb|EPS60801.1|  hypothetical protein M569_13997                         397   5e-134   
ref|XP_009130545.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 73      397   6e-134   
ref|XP_006426061.1|  hypothetical protein CICLE_v10026050mg             397   7e-134   
ref|XP_008781029.1|  PREDICTED: peroxidase 51-like                      396   1e-133   
ref|XP_008368006.1|  PREDICTED: peroxidase 51-like                      395   2e-133   
ref|XP_004245302.1|  PREDICTED: peroxidase 45-like                      395   3e-133   
ref|NP_195469.1|  peroxidase 51                                         395   5e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447048.1|  hypothetical protein CICLE_v10016043mg             394   6e-133   
ref|XP_008350315.1|  PREDICTED: peroxidase 51-like                      394   7e-133   
ref|XP_010547542.1|  PREDICTED: peroxidase 35-like                      394   8e-133   
ref|XP_011097275.1|  PREDICTED: peroxidase 51                           392   3e-132   
gb|AAL49862.1|  putative peroxidase                                     392   3e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338701.1|  PREDICTED: peroxidase 51-like                      392   3e-132   
gb|ABK21900.1|  unknown                                                 392   8e-132   Picea sitchensis
ref|XP_008441332.1|  PREDICTED: peroxidase 51-like                      391   1e-131   
ref|XP_009606506.1|  PREDICTED: peroxidase 55                           392   1e-131   
emb|CDY37853.1|  BnaAnng05140D                                          390   2e-131   
ref|XP_009112219.1|  PREDICTED: peroxidase 73                           390   3e-131   
ref|XP_010033422.1|  PREDICTED: peroxidase 51-like                      389   5e-131   
ref|XP_010086957.1|  Peroxidase 51                                      389   6e-131   
emb|CDX81319.1|  BnaC09g07300D                                          389   1e-130   
ref|XP_010669285.1|  PREDICTED: peroxidase 16-like                      389   1e-130   
ref|XP_002274131.2|  PREDICTED: peroxidase 55-like                      389   1e-130   Vitis vinifera
ref|XP_010550341.1|  PREDICTED: peroxidase 35-like                      388   2e-130   
gb|KGN63167.1|  hypothetical protein Csa_2G406650                       387   3e-130   
ref|XP_004138794.1|  PREDICTED: peroxidase 51-like                      387   3e-130   
ref|XP_010315910.1|  PREDICTED: peroxidase 51                           385   1e-129   
ref|XP_009802952.1|  PREDICTED: peroxidase 55-like                      385   1e-129   
gb|EYU29641.1|  hypothetical protein MIMGU_mgv1a009564mg                386   2e-129   
ref|XP_004166423.1|  PREDICTED: peroxidase 51-like                      385   2e-129   
ref|XP_008441333.1|  PREDICTED: peroxidase 51-like                      385   2e-129   
ref|XP_006411878.1|  hypothetical protein EUTSA_v10025695mg             384   4e-129   
ref|XP_006841967.1|  hypothetical protein AMTR_s00144p00031900          384   5e-129   
ref|XP_007031900.1|  Peroxidase superfamily protein                     384   5e-129   
ref|XP_009135008.1|  PREDICTED: peroxidase 50                           384   7e-129   
ref|XP_011009184.1|  PREDICTED: peroxidase 55                           384   9e-129   
ref|XP_010432051.1|  PREDICTED: peroxidase 50-like                      384   1e-128   
gb|KDP46270.1|  hypothetical protein JCGZ_10110                         383   1e-128   
emb|CAA67362.1|  peroxidase ATP9a                                       382   2e-128   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29561.1|  BnaA03g54060D                                          383   2e-128   
emb|CAA71495.1|  peroxidase                                             382   2e-128   Spinacia oleracea
ref|XP_006373205.1|  hypothetical protein POPTR_0017s09640g             382   2e-128   
ref|XP_009607563.1|  PREDICTED: peroxidase 16-like                      382   2e-128   
ref|NP_195468.1|  peroxidase 50                                         382   4e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009772707.1|  PREDICTED: peroxidase 16-like                      382   4e-128   
ref|XP_006282666.1|  hypothetical protein CARUB_v10005222mg             381   8e-128   
emb|CDX69313.1|  BnaC01g01400D                                          380   1e-127   
gb|AAM63630.1|  peroxidase, prxr2                                       380   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437219.1|  PREDICTED: peroxidase 50                           380   2e-127   
ref|XP_002868984.1|  peroxidase ATP9a                                   380   2e-127   
gb|KHG27040.1|  Peroxidase 51 -like protein                             379   6e-127   
ref|XP_010249037.1|  PREDICTED: peroxidase 55-like                      378   1e-126   
ref|XP_004166427.1|  PREDICTED: peroxidase 51-like                      378   1e-126   
ref|XP_002298633.2|  hypothetical protein POPTR_0001s33680g             378   1e-126   Populus trichocarpa [western balsam poplar]
ref|XP_008441329.1|  PREDICTED: peroxidase 51-like                      378   1e-126   
ref|XP_007161721.1|  hypothetical protein PHAVU_001G092900g             378   2e-126   
emb|CDX72634.1|  BnaC07g46560D                                          377   2e-126   
ref|XP_004138796.1|  PREDICTED: peroxidase 51-like                      377   2e-126   
ref|XP_010250695.1|  PREDICTED: peroxidase 51                           377   3e-126   
gb|KFK30370.1|  hypothetical protein AALP_AA7G252300                    377   3e-126   
ref|XP_008790752.1|  PREDICTED: peroxidase 55                           376   5e-126   
ref|XP_009387950.1|  PREDICTED: peroxidase 51-like isoform X1           375   2e-125   
ref|XP_002509503.1|  Peroxidase 55 precursor, putative                  374   5e-125   Ricinus communis
ref|XP_010679610.1|  PREDICTED: peroxidase 51-like                      374   7e-125   
ref|XP_009402171.1|  PREDICTED: peroxidase 51-like                      373   8e-125   
gb|AHL39115.1|  class III peroxidase                                    374   8e-125   
ref|NP_001190944.1|  peroxidase 50                                      373   1e-124   
ref|XP_010112376.1|  Peroxidase 55                                      372   2e-124   
ref|XP_010927767.1|  PREDICTED: peroxidase 55-like                      372   5e-124   
ref|XP_010679607.1|  PREDICTED: peroxidase 50-like isoform X1           370   1e-123   
ref|XP_008379105.1|  PREDICTED: peroxidase 55-like                      370   1e-123   
ref|XP_003553930.1|  PREDICTED: peroxidase 55                           369   3e-123   
ref|XP_003548517.2|  PREDICTED: peroxidase 55-like                      369   4e-123   
ref|XP_004303962.1|  PREDICTED: peroxidase 55-like                      369   5e-123   
gb|KHN09929.1|  Peroxidase 55                                           368   8e-123   
ref|NP_001078508.1|  peroxidase 51                                      367   1e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28390.1|  hypothetical protein AALP_AA8G508800                    368   2e-122   
ref|XP_008441330.1|  PREDICTED: peroxidase 55-like                      368   2e-122   
ref|XP_009387951.1|  PREDICTED: peroxidase 51-like isoform X2           367   4e-122   
dbj|BAH56994.1|  AT4G37530                                              365   4e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KEH39755.1|  class III peroxidase                                    365   8e-122   
ref|XP_007031901.1|  Peroxidase superfamily protein                     374   2e-121   
gb|KGN63166.1|  hypothetical protein Csa_2G406640                       365   2e-121   
ref|XP_009408351.1|  PREDICTED: peroxidase 55-like                      364   3e-121   
emb|CDP16702.1|  unnamed protein product                                364   3e-121   
ref|XP_006658226.1|  PREDICTED: peroxidase 51-like                      364   3e-121   
ref|NP_001058755.1|  Os07g0115300                                       364   5e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004138795.1|  PREDICTED: peroxidase 55-like                      362   1e-120   
ref|XP_006848256.1|  hypothetical protein AMTR_s00013p00052590          360   2e-119   
ref|XP_004955343.1|  PREDICTED: peroxidase 51-like                      358   7e-119   
ref|XP_010550209.1|  PREDICTED: peroxidase 55                           358   7e-119   
gb|ACN60160.1|  peroxidase                                              357   1e-118   Tamarix hispida
ref|XP_007216155.1|  hypothetical protein PRUPE_ppa015245mg             357   2e-118   
ref|NP_001051360.1|  Os03g0762400                                       357   3e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008670022.1|  PREDICTED: peroxidase 50-like                      357   3e-118   
gb|EPS73647.1|  hypothetical protein M569_01108                         355   1e-117   
ref|XP_010680021.1|  PREDICTED: peroxidase 16-like                      355   1e-117   
ref|XP_006650636.1|  PREDICTED: peroxidase 51-like                      353   6e-117   
ref|XP_006284112.1|  hypothetical protein CARUB_v10005246mg             353   7e-117   
ref|XP_006399923.1|  hypothetical protein EUTSA_v10014070mg             353   1e-116   
ref|XP_009125965.1|  PREDICTED: peroxidase 55-like                      352   2e-116   
emb|CBI21341.3|  unnamed protein product                                350   4e-116   
gb|KEH22009.1|  peroxidase family protein                               350   7e-116   
ref|XP_008231106.1|  PREDICTED: peroxidase 55                           350   8e-116   
ref|XP_009396783.1|  PREDICTED: peroxidase 55-like                      350   2e-115   
gb|AFK49058.1|  unknown                                                 349   2e-115   
ref|XP_006411877.1|  hypothetical protein EUTSA_v10025717mg             349   3e-115   
emb|CDX91081.1|  BnaC02g05160D                                          347   3e-114   
ref|XP_004304524.1|  PREDICTED: peroxidase 55-like                      346   7e-114   
ref|XP_003559061.1|  PREDICTED: peroxidase 35-like                      344   2e-113   
emb|CDY58408.1|  BnaC09g54550D                                          344   2e-113   
ref|XP_008644003.1|  PREDICTED: hypothetical protein isoform X1         343   7e-113   
ref|XP_006656422.1|  PREDICTED: peroxidase 16-like                      342   4e-112   
ref|XP_002448675.1|  hypothetical protein SORBIDRAFT_06g031300          341   5e-112   Sorghum bicolor [broomcorn]
gb|EYU34812.1|  hypothetical protein MIMGU_mgv1a025312mg                338   5e-112   
ref|NP_001054120.1|  Os04g0656800                                       340   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002459238.1|  hypothetical protein SORBIDRAFT_02g001140          340   1e-111   Sorghum bicolor [broomcorn]
emb|CDX85612.1|  BnaA02g02010D                                          341   4e-111   
ref|XP_004981668.1|  PREDICTED: peroxidase 51-like                      338   4e-111   
ref|XP_009121694.1|  PREDICTED: peroxidase 55                           338   4e-111   
dbj|BAJ85420.1|  predicted protein                                      338   4e-111   
ref|XP_003557666.1|  PREDICTED: peroxidase 50-like                      338   6e-111   
ref|XP_004513315.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...    338   6e-111   
gb|ACF84302.1|  unknown                                                 338   1e-110   
emb|CAE03412.3|  OSJNBa0071I13.13                                       338   1e-110   
gb|ABV44812.1|  peroxidase                                              334   2e-110   
ref|XP_004960136.1|  PREDICTED: peroxidase 16-like                      337   3e-110   
ref|XP_010492211.1|  PREDICTED: peroxidase 55-like                      336   5e-110   
gb|EMT04725.1|  Peroxidase 35                                           335   9e-110   
gb|AFK39314.1|  unknown                                                 335   9e-110   
gb|KFK25644.1|  hypothetical protein AALP_AA8G141400                    335   1e-109   
ref|XP_002466407.1|  hypothetical protein SORBIDRAFT_01g007230          335   1e-109   
ref|NP_001058450.1|  Os06g0695500                                       335   1e-109   
dbj|BAK07855.1|  predicted protein                                      334   2e-109   
ref|NP_001142258.1|  uncharacterized protein LOC100274427 precursor     333   5e-109   
ref|XP_003579412.1|  PREDICTED: peroxidase 16-like                      332   2e-108   
gb|ABS86778.1|  peroxidase 16 precursor protein                         332   2e-108   
gb|EMS57821.1|  Peroxidase 51                                           332   2e-108   
ref|XP_008667326.1|  PREDICTED: hypothetical protein isoform X2         332   3e-108   
ref|XP_004957292.1|  PREDICTED: peroxidase 73-like                      331   7e-108   
ref|XP_006288149.1|  hypothetical protein CARUB_v10001386mg             328   1e-106   
ref|XP_002437516.1|  hypothetical protein SORBIDRAFT_10g028500          327   2e-106   
ref|XP_006652942.1|  PREDICTED: peroxidase 16-like                      327   2e-106   
ref|XP_010478566.1|  PREDICTED: peroxidase 73-like                      325   2e-106   
ref|XP_004966145.1|  PREDICTED: peroxidase 16-like                      327   3e-106   
ref|NP_001168671.1|  hypothetical protein precursor                     327   3e-106   
ref|XP_008667325.1|  PREDICTED: hypothetical protein isoform X1         325   2e-105   
ref|NP_001152697.1|  LOC100286338 precursor                             324   2e-105   
dbj|BAJ85219.1|  predicted protein                                      324   2e-105   
gb|ACF86227.1|  unknown                                                 324   3e-105   
ref|NP_001062342.1|  Os08g0532700                                       323   4e-105   
dbj|BAD11654.1|  putative peroxidase                                    323   4e-105   
ref|NP_001063616.1|  Os09g0507500                                       323   7e-105   
ref|NP_196917.1|  peroxidase 55                                         322   1e-104   
emb|CDY43573.1|  BnaC02g16700D                                          321   1e-104   
dbj|BAJ86125.1|  predicted protein                                      322   1e-104   
ref|XP_003563477.2|  PREDICTED: peroxidase 16-like                      322   2e-104   
ref|XP_006659625.1|  PREDICTED: peroxidase 16-like                      321   3e-104   
gb|EEE66467.1|  hypothetical protein OsJ_22874                          320   4e-104   
ref|XP_002873650.1|  predicted protein                                  320   1e-103   
gb|ACG42971.1|  peroxidase 73 precursor                                 320   1e-103   
ref|XP_002462635.1|  hypothetical protein SORBIDRAFT_02g029340          319   2e-103   
ref|XP_010453527.1|  PREDICTED: peroxidase 55                           320   3e-103   
ref|NP_001130210.1|  uncharacterized protein LOC100191304 precursor     318   3e-103   
ref|XP_003633781.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 55      320   1e-102   
ref|XP_002976403.1|  hypothetical protein SELMODRAFT_104905             316   4e-102   
gb|EMT21900.1|  Peroxidase 55                                           315   6e-102   
gb|EMS60412.1|  Peroxidase 55                                           318   7e-102   
ref|XP_002987236.1|  hypothetical protein SELMODRAFT_125631             314   1e-101   
ref|XP_003574829.1|  PREDICTED: peroxidase 51-like                      314   2e-101   
gb|EMS50398.1|  Peroxidase 35                                           313   4e-101   
ref|XP_006285849.1|  hypothetical protein CARUB_v10007328mg             312   8e-101   
tpg|DAA48228.1|  TPA: hypothetical protein ZEAMMB73_235803              312   1e-100   
ref|XP_010420034.1|  PREDICTED: peroxidase 55-like                      312   1e-100   
emb|CDX69314.1|  BnaC01g01390D                                          310   4e-100   
gb|ADE76645.1|  unknown                                                 310   8e-100   
ref|XP_003563475.1|  PREDICTED: peroxidase 45-like                      306   2e-98    
ref|XP_004974008.1|  PREDICTED: peroxidase 51-like                      305   5e-98    
ref|XP_002444695.1|  hypothetical protein SORBIDRAFT_07g026130          305   7e-98    
gb|EAZ02213.1|  hypothetical protein OsI_24307                          302   3e-97    
ref|XP_004966147.1|  PREDICTED: peroxidase 45-like                      302   4e-97    
dbj|BAD53899.1|  putative peroxidase                                    300   2e-96    
gb|EAZ32259.1|  hypothetical protein OsJ_16463                          300   7e-96    
ref|NP_001058447.1|  Os06g0695200                                       298   2e-95    
tpg|DAA51529.1|  TPA: hypothetical protein ZEAMMB73_619996              297   2e-95    
ref|XP_002985280.1|  hypothetical protein SELMODRAFT_122015             297   4e-95    
dbj|BAJ99589.1|  predicted protein                                      297   5e-95    
ref|XP_006656420.1|  PREDICTED: peroxidase 45-like                      297   5e-95    
ref|NP_001058449.1|  Os06g0695400                                       296   9e-95    
gb|EMT07199.1|  Peroxidase 45                                           296   9e-95    
gb|EAZ02212.1|  hypothetical protein OsI_24306                          296   9e-95    
dbj|BAD53897.1|  putative peroxidase                                    295   2e-94    
gb|EEC81242.1|  hypothetical protein OsI_24308                          296   2e-94    
ref|XP_002970089.1|  hypothetical protein SELMODRAFT_231472             296   2e-94    
ref|XP_006656421.1|  PREDICTED: peroxidase 16-like                      295   3e-94    
dbj|BAJ98260.1|  predicted protein                                      295   3e-94    
gb|KHG11549.1|  Peroxidase 16 -like protein                             290   5e-94    
ref|XP_002437513.1|  hypothetical protein SORBIDRAFT_10g028470          294   6e-94    
gb|EMS49814.1|  Peroxidase 45                                           295   1e-93    
ref|XP_004966146.1|  PREDICTED: peroxidase 45-like                      292   3e-93    
ref|XP_008644997.1|  PREDICTED: peroxidase 45-like                      292   4e-93    
gb|AFW69259.1|  peroxidase 16                                           292   4e-93    
ref|XP_002466408.1|  hypothetical protein SORBIDRAFT_01g007240          292   6e-93    
ref|XP_010249421.1|  PREDICTED: peroxidase 41-like                      292   8e-93    
ref|XP_002438930.1|  hypothetical protein SORBIDRAFT_10g028460          290   4e-92    
gb|ACF87131.1|  unknown                                                 290   6e-92    
ref|NP_001151822.1|  peroxidase 16 precursor                            289   8e-92    
gb|AAL34125.1|AC090713_12  putative peroxidase                          289   8e-92    
ref|NP_001051358.1|  Os03g0762300                                       289   1e-91    
tpg|DAA51528.1|  TPA: hypothetical protein ZEAMMB73_497140              288   2e-91    
ref|XP_002972219.1|  hypothetical protein SELMODRAFT_97331              288   2e-91    
ref|XP_002437514.1|  hypothetical protein SORBIDRAFT_10g028480          288   2e-91    
ref|XP_002960519.1|  hypothetical protein SELMODRAFT_164271             287   4e-91    
gb|KHN40966.1|  Peroxidase 55                                           284   5e-91    
emb|CDX69601.1|  BnaA10g19500D                                          284   8e-91    
ref|XP_002965084.1|  hypothetical protein SELMODRAFT_230472             286   1e-90    
ref|XP_002962173.1|  hypothetical protein SELMODRAFT_403769             286   2e-90    
ref|XP_004966148.1|  PREDICTED: peroxidase 45-like                      285   2e-90    
ref|XP_002984133.1|  hypothetical protein SELMODRAFT_119731             285   4e-90    
ref|NP_001152260.1|  peroxidase 51 precursor                            285   6e-90    
ref|XP_004981669.1|  PREDICTED: peroxidase 51-like                      283   1e-89    
ref|XP_006847800.1|  hypothetical protein AMTR_s00029p00030990          283   2e-89    
emb|CBI33713.3|  unnamed protein product                                280   2e-89    
dbj|BAK03977.1|  predicted protein                                      281   5e-89    
ref|XP_006836747.1|  hypothetical protein AMTR_s00088p00148870          282   5e-89    
ref|XP_002310058.2|  hypothetical protein POPTR_0007s07330g             282   7e-89    
tpe|CAH69333.1|  TPA: class III peroxidase 91 precursor                 281   2e-88    
ref|XP_006437634.1|  hypothetical protein CICLE_v10032081mg             280   3e-88    
gb|KDO69882.1|  hypothetical protein CISIN_1g039410mg                   279   4e-88    
ref|XP_006484500.1|  PREDICTED: peroxidase 65-like                      279   6e-88    
ref|XP_002991689.1|  hypothetical protein SELMODRAFT_133931             279   6e-88    
ref|XP_002991044.1|  hypothetical protein SELMODRAFT_132875             278   2e-87    
gb|EEE66278.1|  hypothetical protein OsJ_22482                          276   5e-87    
ref|XP_008643820.1|  PREDICTED: peroxidase 16 isoform X1                276   1e-86    
ref|XP_003571918.1|  PREDICTED: peroxidase 16-like                      276   1e-86    
ref|XP_009335766.1|  PREDICTED: peroxidase 63                           275   3e-86    
ref|XP_007036111.1|  Peroxidase superfamily protein                     274   8e-86    
dbj|BAJ85566.1|  predicted protein                                      274   8e-86    
gb|EMS67394.1|  Peroxidase 45                                           273   9e-86    
ref|XP_008379292.1|  PREDICTED: peroxidase 63-like                      272   4e-85    
ref|XP_002992995.1|  hypothetical protein SELMODRAFT_236645             272   5e-85    
ref|XP_006852531.1|  hypothetical protein AMTR_s00021p00179670          272   6e-85    
ref|XP_009418046.1|  PREDICTED: peroxidase 65                           270   2e-84    
ref|XP_002280547.1|  PREDICTED: peroxidase 31-like                      270   2e-84    
emb|CDP02154.1|  unnamed protein product                                270   4e-84    
gb|EEE66279.1|  hypothetical protein OsJ_22484                          269   4e-84    
ref|NP_001147676.1|  peroxidase 45 precursor                            268   7e-84    
ref|XP_010229476.1|  PREDICTED: peroxidase 73-like                      268   1e-83    
gb|AFW69262.1|  peroxidase 45                                           268   1e-83    
ref|XP_010655890.1|  PREDICTED: peroxidase 51-like                      268   2e-83    
gb|KDP21043.1|  hypothetical protein JCGZ_21514                         268   4e-83    
ref|XP_009419880.1|  PREDICTED: peroxidase 31-like                      267   6e-83    
ref|XP_010260397.1|  PREDICTED: peroxidase 19                           266   8e-83    
ref|XP_002991835.1|  hypothetical protein SELMODRAFT_269862             266   9e-83    
ref|XP_009143810.1|  PREDICTED: peroxidase 19-like                      266   1e-82    
gb|EAY91949.1|  hypothetical protein OsI_13636                          265   1e-82    
ref|XP_002280359.1|  PREDICTED: peroxidase 65                           265   2e-82    
ref|XP_008341490.1|  PREDICTED: peroxidase 63-like                      265   2e-82    
ref|XP_007215667.1|  hypothetical protein PRUPE_ppa008577mg             265   2e-82    
ref|XP_006650635.1|  PREDICTED: peroxidase 51-like                      265   3e-82    
ref|XP_010057321.1|  PREDICTED: peroxidase 19-like                      265   3e-82    
ref|XP_004232273.1|  PREDICTED: peroxidase 63                           264   4e-82    
emb|CAA07352.1|  peroxidase                                             259   4e-82    
ref|XP_010540501.1|  PREDICTED: peroxidase 19-like                      265   5e-82    
ref|XP_009782084.1|  PREDICTED: peroxidase 63-like                      264   5e-82    
ref|XP_006338526.1|  PREDICTED: peroxidase 63-like                      264   6e-82    
emb|CAN81266.1|  hypothetical protein VITISV_006141                     268   8e-82    
ref|XP_004296567.1|  PREDICTED: peroxidase 63-like                      263   9e-82    
ref|XP_009350776.1|  PREDICTED: peroxidase 41-like                      263   1e-81    
ref|XP_003608472.1|  Peroxidase                                         258   2e-81    
ref|XP_011096394.1|  PREDICTED: peroxidase 19                           263   2e-81    
gb|KEH30935.1|  peroxidase family protein                               263   2e-81    
ref|XP_009419471.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 3...    264   2e-81    
ref|XP_010918952.1|  PREDICTED: peroxidase 19                           263   2e-81    
ref|XP_008239713.1|  PREDICTED: peroxidase 41-like                      261   6e-81    
ref|XP_007214109.1|  hypothetical protein PRUPE_ppa017084mg             262   8e-81    
ref|XP_006367201.1|  PREDICTED: peroxidase 19-like                      261   9e-81    
ref|XP_009599947.1|  PREDICTED: peroxidase 63-like                      261   9e-81    
ref|XP_009793056.1|  PREDICTED: peroxidase 19                           261   1e-80    
ref|XP_008811548.1|  PREDICTED: peroxidase 19                           261   1e-80    
ref|XP_007153695.1|  hypothetical protein PHAVU_003G057000g             261   1e-80    
ref|NP_001131174.1|  uncharacterized protein LOC100192482               258   1e-80    
ref|XP_010279193.1|  PREDICTED: peroxidase 19-like isoform X1           263   1e-80    
gb|EMT14536.1|  Peroxidase 51                                           258   1e-80    
ref|XP_010272054.1|  PREDICTED: peroxidase 41-like                      260   1e-80    
ref|XP_002965371.1|  hypothetical protein SELMODRAFT_143155             260   1e-80    
ref|XP_008225182.1|  PREDICTED: peroxidase 19                           261   2e-80    
ref|XP_008371438.1|  PREDICTED: peroxidase 19                           261   2e-80    
ref|NP_001136527.1|  hypothetical protein                               257   2e-80    
ref|XP_002522523.1|  Peroxidase 19 precursor, putative                  261   2e-80    
ref|XP_010549389.1|  PREDICTED: peroxidase 19-like isoform X1           260   3e-80    
ref|XP_009615522.1|  PREDICTED: peroxidase 19                           260   3e-80    
ref|XP_010058964.1|  PREDICTED: peroxidase 19-like                      260   3e-80    
ref|XP_002977217.1|  hypothetical protein SELMODRAFT_268057             259   4e-80    
ref|XP_004232949.1|  PREDICTED: peroxidase 19                           259   5e-80    
ref|XP_010024692.1|  PREDICTED: peroxidase 5-like                       258   6e-80    
ref|XP_009346467.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 19      259   6e-80    
gb|EYU28044.1|  hypothetical protein MIMGU_mgv1a009228mg                259   7e-80    
ref|XP_010100929.1|  Peroxidase 63                                      258   9e-80    
ref|XP_009415702.1|  PREDICTED: peroxidase 31-like                      258   1e-79    
gb|KDO77766.1|  hypothetical protein CISIN_1g036989mg                   257   1e-79    
ref|XP_009391733.1|  PREDICTED: peroxidase 65                           258   2e-79    
ref|XP_010928551.1|  PREDICTED: peroxidase 31-like                      258   2e-79    
ref|XP_002272881.1|  PREDICTED: peroxidase 19                           258   3e-79    
emb|CBI30642.3|  unnamed protein product                                258   4e-79    
gb|KCW61137.1|  hypothetical protein EUGRSUZ_H03910                     256   4e-79    
ref|XP_006294511.1|  hypothetical protein CARUB_v10023544mg             257   4e-79    
ref|XP_010919027.1|  PREDICTED: peroxidase 5-like                       256   4e-79    
ref|XP_003597106.1|  Peroxidase                                         253   5e-79    
ref|XP_002305096.1|  hypothetical protein POPTR_0004s05140g             257   5e-79    
ref|XP_010101536.1|  Peroxidase 19                                      257   6e-79    
ref|XP_010254924.1|  PREDICTED: peroxidase 31-like                      256   6e-79    
ref|XP_010528275.1|  PREDICTED: peroxidase 63-like                      256   6e-79    
ref|NP_193504.1|  peroxidase 41                                         255   1e-78    
ref|XP_011027738.1|  PREDICTED: peroxidase 19                           256   1e-78    
ref|XP_003541513.1|  PREDICTED: peroxidase 19-like                      256   1e-78    
ref|XP_006281584.1|  hypothetical protein CARUB_v10027696mg             255   2e-78    
ref|XP_010671317.1|  PREDICTED: peroxidase 5-like                       255   2e-78    
ref|XP_010669884.1|  PREDICTED: peroxidase 63                           255   2e-78    
ref|XP_008793811.1|  PREDICTED: peroxidase 31                           255   2e-78    
gb|AAL86286.1|  putative peroxidase                                     255   2e-78    
ref|XP_010045225.1|  PREDICTED: peroxidase 5-like                       254   3e-78    
ref|XP_006468207.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 1...    257   3e-78    
ref|XP_010530006.1|  PREDICTED: peroxidase 65-like                      254   3e-78    
ref|NP_180953.1|  peroxidase 19                                         255   3e-78    
gb|AAN60320.1|  unknown                                                 250   3e-78    
ref|XP_011075883.1|  PREDICTED: peroxidase 5-like                       254   3e-78    
gb|AHL39183.1|  class III peroxidase                                    254   3e-78    
ref|XP_006398394.1|  hypothetical protein EUTSA_v10000958mg             254   3e-78    
ref|XP_006449451.1|  hypothetical protein CICLE_v10017786mg             255   3e-78    
ref|XP_002980766.1|  hypothetical protein SELMODRAFT_178409             254   4e-78    
ref|XP_004292438.1|  PREDICTED: peroxidase 19-like                      254   4e-78    
ref|XP_002977027.1|  hypothetical protein SELMODRAFT_106106             254   4e-78    
gb|EAZ09687.1|  hypothetical protein OsI_31969                          253   5e-78    
ref|XP_010046652.1|  PREDICTED: peroxidase 31-like                      254   5e-78    
ref|XP_011003280.1|  PREDICTED: peroxidase 5-like                       253   6e-78    
gb|KEH43331.1|  peroxidase family protein                               253   7e-78    
ref|XP_006282925.1|  hypothetical protein CARUB_v10007381mg             253   8e-78    
gb|KDP27791.1|  hypothetical protein JCGZ_18871                         253   1e-77    



>ref|XP_004242911.1| PREDICTED: peroxidase 16 [Solanum lycopersicum]
Length=329

 Score =   516 bits (1328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/332 (79%), Positives = 295/332 (89%), Gaps = 4/332 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSS-AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFV  831
             ME+Q+K S +     ++ L+L VSS A  QL+T+FYKNTCPNVESLVRSAV+ KF+QTFV
Sbjct  1     MENQKKISNLF---FVMLLILSVSSIAFGQLKTDFYKNTCPNVESLVRSAVRLKFQQTFV  57

Query  830   TAPATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNP  651
             TAPATLRLFFHDCFVRGCDAS+LL+SPNGKAEKDHPDNLSLAGDGFDTV+KAKAAVDS+ 
Sbjct  58    TAPATLRLFFHDCFVRGCDASMLLSSPNGKAEKDHPDNLSLAGDGFDTVVKAKAAVDSDS  117

Query  650   QCRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLN  471
             +CRNKVSCADILALATR+VV++ GG FYPVELGRRDG++STL SVQ  LPG GF LDQLN
Sbjct  118   KCRNKVSCADILALATREVVAMTGGPFYPVELGRRDGKVSTLTSVQHQLPGEGFNLDQLN  177

Query  470   SMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCP  291
             +MF R GL+QTDMIALSGAHT+GFSHC +V+KR+Y F P+S +DPTLN  Y  QL+QMCP
Sbjct  178   TMFARRGLSQTDMIALSGAHTLGFSHCNRVSKRLYNFSPKSSVDPTLNKAYVAQLKQMCP  237

Query  290   LRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaaf  111
             LRVDPRIAINMDPTTPNTFDNAY+KNLQQGKGLFVSDQ+LFTD RSRNTVN FASNN AF
Sbjct  238   LRVDPRIAINMDPTTPNTFDNAYYKNLQQGKGLFVSDQILFTDSRSRNTVNLFASNNDAF  297

Query  110   qqafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             +QAFA AMTKLGR+GVLTGN GEIR DCTRPN
Sbjct  298   KQAFATAMTKLGRVGVLTGNQGEIRFDCTRPN  329



>ref|XP_009600643.1| PREDICTED: peroxidase 16-like [Nicotiana tomentosiformis]
Length=329

 Score =   515 bits (1327),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 261/331 (79%), Positives = 295/331 (89%), Gaps = 2/331 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME+QRK+  ++   ++V   LL ++A AQLR++FYKNTCPNVESLVR+AV+QKF+QTFVT
Sbjct  1     MENQRKS--LLFPLVIVLFFLLNATAFAQLRSDFYKNTCPNVESLVRAAVRQKFQQTFVT  58

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDAS+LL+SPN KAEKDHPDNLSLAGDGFDTV+KAKAAVD + +
Sbjct  59    APATLRLFFHDCFVRGCDASMLLSSPNRKAEKDHPDNLSLAGDGFDTVVKAKAAVDKDSK  118

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATR+VVS+ GG FY VELGRRDGR+STL  VQ  LPG GF LDQLN+
Sbjct  119   CRNKVSCADILALATREVVSMTGGPFYQVELGRRDGRVSTLAGVQHQLPGEGFNLDQLNT  178

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF RHGL+QTDMIALSGAHT+GFSHC + +KR+Y F P+S +DPTLN +YA QLRQMCP+
Sbjct  179   MFARHGLSQTDMIALSGAHTLGFSHCSKFSKRLYNFSPKSRVDPTLNRQYAAQLRQMCPI  238

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQ+LFTDPRSRNTVNFFASNN AF+
Sbjct  239   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQILFTDPRSRNTVNFFASNNNAFK  298

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAFA AM KLGR+GVLTGN GEIR DCTR N
Sbjct  299   QAFATAMIKLGRVGVLTGNQGEIRFDCTRQN  329



>ref|XP_009783800.1| PREDICTED: peroxidase 16-like [Nicotiana sylvestris]
Length=329

 Score =   515 bits (1326),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 261/331 (79%), Positives = 295/331 (89%), Gaps = 2/331 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME+QRK+  ++   ++V   LL ++A AQLR++FYKNTCPNVESLVR+AV+QKF+QTFVT
Sbjct  1     MENQRKS--LLFPLVIVLFFLLNATAFAQLRSDFYKNTCPNVESLVRAAVRQKFQQTFVT  58

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDAS+LL+SPN KAEKDHPDNLSLAGDGFDTV+KAKAAVD + +
Sbjct  59    APATLRLFFHDCFVRGCDASMLLSSPNRKAEKDHPDNLSLAGDGFDTVVKAKAAVDKDSK  118

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATR+VVS+ GG FY VELGRRDGR+STL  VQ  LPG GF LDQLN+
Sbjct  119   CRNKVSCADILALATREVVSMTGGPFYQVELGRRDGRVSTLAGVQHQLPGEGFNLDQLNT  178

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF RHGL+QTDMIALSGAHT+GFSHC + +KR+Y F P+S +DPTLN +YA QLRQMCP+
Sbjct  179   MFARHGLSQTDMIALSGAHTLGFSHCSKFSKRLYNFSPKSRVDPTLNRQYAAQLRQMCPI  238

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQ+LFTDPRSRNTVNFFASNN AF+
Sbjct  239   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQILFTDPRSRNTVNFFASNNDAFK  298

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAFA AM KLGR+GVLTGN GEIR DCTR N
Sbjct  299   QAFATAMIKLGRVGVLTGNQGEIRFDCTRQN  329



>ref|XP_006344534.1| PREDICTED: peroxidase 45-like [Solanum tuberosum]
Length=329

 Score =   508 bits (1309),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 260/331 (79%), Positives = 293/331 (89%), Gaps = 2/331 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME+++K+S+++    L   V  +  A  QL+T+FYKNTCPNVESLVRSAV+ KF+QTFVT
Sbjct  1     MENKKKSSILLFVLFLFLSVSSI--AFGQLKTDFYKNTCPNVESLVRSAVRLKFQQTFVT  58

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDAS+LLASPNGKAEKDHPDNLSLAGDGFDTV+KAKAAVDS+ +
Sbjct  59    APATLRLFFHDCFVRGCDASMLLASPNGKAEKDHPDNLSLAGDGFDTVVKAKAAVDSDSK  118

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATR+VV++ GG FYPVELGRRDG+ISTL SVQ  LPG GF LDQLN+
Sbjct  119   CRNKVSCADILALATREVVAMTGGPFYPVELGRRDGKISTLTSVQHQLPGEGFNLDQLNT  178

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF R GL+QTDMIALSGAHT+GFSHC +V+KR+Y F P+S +DPTLN  Y  QL+QMCPL
Sbjct  179   MFARRGLSQTDMIALSGAHTLGFSHCNRVSKRLYNFNPKSSVDPTLNKAYVAQLKQMCPL  238

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             RVDPRIAINMDPTTPNTFDNAY+KNLQQGKGLFVSDQ+LFTD RSRNTVNFFASNN AF+
Sbjct  239   RVDPRIAINMDPTTPNTFDNAYYKNLQQGKGLFVSDQILFTDSRSRNTVNFFASNNDAFK  298

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAFA AMT LGR+GVLTGN GEIR DCTRPN
Sbjct  299   QAFATAMTNLGRVGVLTGNQGEIRFDCTRPN  329



>ref|XP_010048668.1| PREDICTED: peroxidase 16 [Eucalyptus grandis]
 gb|KCW81015.1| hypothetical protein EUGRSUZ_C02389 [Eucalyptus grandis]
Length=325

 Score =   504 bits (1298),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 261/319 (82%), Positives = 279/319 (87%), Gaps = 2/319 (1%)
 Frame = -2

Query  965  ILVCL--VLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            ++ CL   LL+S+  AQLRT+FYKNTCPNVESLVRSAV +KF+QTFVTAPATLRL FHDC
Sbjct  7    LVSCLSFALLLSAVSAQLRTDFYKNTCPNVESLVRSAVTKKFQQTFVTAPATLRLLFHDC  66

Query  791  FVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILA  612
            FVRGCDASVL+ASP   AEKDHPD+LSLAGDGFDTVIKAKAAVDS PQC+NKVSCADILA
Sbjct  67   FVRGCDASVLIASPTNNAEKDHPDDLSLAGDGFDTVIKAKAAVDSVPQCKNKVSCADILA  126

Query  611  LATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDM  432
            LATRDVVSLAGG FY VELGRRDGRIST   VQ NLP  G KLDQLNSMF  HGL+QTDM
Sbjct  127  LATRDVVSLAGGPFYSVELGRRDGRISTKLGVQHNLPQPGSKLDQLNSMFSSHGLSQTDM  186

Query  431  IALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDP  252
            IALSGAHTIGFSHC + +KRIY F PRS IDPTLN RYA QLRQMCP+ VDPRIAINMDP
Sbjct  187  IALSGAHTIGFSHCGKFSKRIYNFSPRSSIDPTLNFRYALQLRQMCPINVDPRIAINMDP  246

Query  251  TTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGR  72
            TTP TFDNAY+KNLQQGKGLFVSDQ LF+DPRSR TVN FASNNAAFQQAF  A+TK+GR
Sbjct  247  TTPQTFDNAYYKNLQQGKGLFVSDQTLFSDPRSRATVNLFASNNAAFQQAFVTAITKMGR  306

Query  71   IGVLTGNLGEIRRDCTRPN  15
            IGV TGN GEIR DCTRPN
Sbjct  307  IGVKTGNQGEIRIDCTRPN  325



>ref|XP_010048567.1| PREDICTED: peroxidase 16-like [Eucalyptus grandis]
 gb|KCW80848.1| hypothetical protein EUGRSUZ_C02212 [Eucalyptus grandis]
Length=325

 Score =   500 bits (1288),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 256/319 (80%), Positives = 277/319 (87%), Gaps = 2/319 (1%)
 Frame = -2

Query  965  ILVCL--VLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            ++ CL   LL+S+  AQLRT+FYKNTCPNVESLVRSAV +KF+QTFVTAPATLRL FHDC
Sbjct  7    LVSCLSFALLLSAVSAQLRTDFYKNTCPNVESLVRSAVTKKFQQTFVTAPATLRLLFHDC  66

Query  791  FVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILA  612
            FVRGCD SVL+ASP   AEKDHPD+LSLAGDGFDTVIKAKAAVDS PQC+NKVSCADILA
Sbjct  67   FVRGCDGSVLIASPTNNAEKDHPDDLSLAGDGFDTVIKAKAAVDSVPQCKNKVSCADILA  126

Query  611  LATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDM  432
            LA RDVVSLAGG FY VELGRRDGRIST  SVQ NLP  G KLDQLNSMF  HGL+QTDM
Sbjct  127  LAARDVVSLAGGPFYSVELGRRDGRISTKLSVQHNLPQPGSKLDQLNSMFSSHGLSQTDM  186

Query  431  IALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDP  252
            IALSGAHTIGFSHC + +KRIY F PRS +DPTLN  YA QLRQMCP++VDPRIAINMDP
Sbjct  187  IALSGAHTIGFSHCGKFSKRIYNFSPRSSVDPTLNFGYALQLRQMCPIKVDPRIAINMDP  246

Query  251  TTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGR  72
            TTP TFDNAY+KNLQQGKGLFVSDQ LF+DPRSR TV  FASNNAAF+QAF  A+TK+GR
Sbjct  247  TTPQTFDNAYYKNLQQGKGLFVSDQTLFSDPRSRATVTLFASNNAAFRQAFVTAITKMGR  306

Query  71   IGVLTGNLGEIRRDCTRPN  15
            IGV TGN GEIR DCTRPN
Sbjct  307  IGVKTGNQGEIRIDCTRPN  325



>gb|KDP35389.1| hypothetical protein JCGZ_10373 [Jatropha curcas]
Length=324

 Score =   493 bits (1270),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 252/320 (79%), Positives = 275/320 (86%), Gaps = 0/320 (0%)
 Frame = -2

Query  974  SAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHD  795
            S  I++ L+ +    +AQL  NFY  TCPNVES+VRSAVQQKF+QTFVT PATLRLFFHD
Sbjct  5    SCFIVILLLSIFVLCNAQLSQNFYSKTCPNVESIVRSAVQQKFKQTFVTVPATLRLFFHD  64

Query  794  CFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADIL  615
            CFVRGCDASVLLASP+ KAEKDHPDNLSLAGDGFDTV+KAKAAVDS PQCRNKVSCADIL
Sbjct  65   CFVRGCDASVLLASPSNKAEKDHPDNLSLAGDGFDTVVKAKAAVDSVPQCRNKVSCADIL  124

Query  614  ALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTD  435
            ALATRDVV+LAGG FY VELGRRDGRIST+ SVQ  LP   F LDQLNSMF  HGLTQTD
Sbjct  125  ALATRDVVNLAGGPFYNVELGRRDGRISTIASVQHKLPSPNFNLDQLNSMFASHGLTQTD  184

Query  434  MIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMD  255
            MIALSGAHT+GFSHC + +KRIY F P   IDPTLNL+YA QLRQMCP++VDPRIAINMD
Sbjct  185  MIALSGAHTLGFSHCGRFSKRIYNFSPLKKIDPTLNLQYAMQLRQMCPVKVDPRIAINMD  244

Query  254  PTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLG  75
            PTTP TFDNAY++NLQQGKGLF SDQ+LFTD RS+ TVN FASNN AFQ AF +A+TKLG
Sbjct  245  PTTPQTFDNAYYRNLQQGKGLFSSDQILFTDSRSKATVNLFASNNGAFQNAFVSAITKLG  304

Query  74   RIGVLTGNLGEIRRDCTRPN  15
            RIGVLTGN GEIR DCTR N
Sbjct  305  RIGVLTGNQGEIRTDCTRIN  324



>gb|EYU37318.1| hypothetical protein MIMGU_mgv1a009838mg [Erythranthe guttata]
Length=330

 Score =   492 bits (1266),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 252/324 (78%), Positives = 279/324 (86%), Gaps = 2/324 (1%)
 Frame = -2

Query  980  VVSAGILVCLVLLV--SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            ++S  IL  +++LV  ++A+AQLRTNFY  TCPNVE+LVR+AVQ KFRQTFVTAPATLRL
Sbjct  7    IISMTILPLVIILVISNTANAQLRTNFYSATCPNVEALVRAAVQTKFRQTFVTAPATLRL  66

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFVRGCDAS+++ASPNG AEKDHPDNLSLAGDGFDTVIKAKAAVD N QCRNKVSC
Sbjct  67   FFHDCFVRGCDASIMIASPNGNAEKDHPDNLSLAGDGFDTVIKAKAAVDRNSQCRNKVSC  126

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDVV LAGGA YPVELGRRDGRIST  SVQ  LPG GF L+QLN+MF  HGL
Sbjct  127  ADILALATRDVVVLAGGASYPVELGRRDGRISTSASVQGRLPGPGFSLNQLNTMFASHGL  186

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
             QTD+IALSGAHTIGFSHC + + RIY F P   +DP+LN +YA QLRQMCP+ VDPRIA
Sbjct  187  DQTDLIALSGAHTIGFSHCNRFSNRIYNFSPSRRVDPSLNPQYATQLRQMCPINVDPRIA  246

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPT+ NTFDNAYF+NLQ G+GLF SDQVLFTD RSR TVN FASNNAAF +AF  AM
Sbjct  247  INMDPTSANTFDNAYFRNLQGGRGLFTSDQVLFTDTRSRATVNQFASNNAAFGRAFGLAM  306

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
            TKLGR+GVLTGN GEIR DCTRPN
Sbjct  307  TKLGRVGVLTGNQGEIRIDCTRPN  330



>emb|CDP02994.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   490 bits (1262),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 276/313 (88%), Gaps = 0/313 (0%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
             V+++++A AQL  NFY++TCPNVE+LVR+AVQ KF QTFVTAPATLRL+FHDCFVRGCD
Sbjct  14   FVIIITTASAQLTANFYRSTCPNVETLVRNAVQTKFSQTFVTAPATLRLYFHDCFVRGCD  73

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            AS+++A P+  AEKDHPDNLSLAGDGFDTV+KAKAAVDS+P+C+N+VSCADILALATR+V
Sbjct  74   ASIMIAKPDNSAEKDHPDNLSLAGDGFDTVVKAKAAVDSDPRCKNRVSCADILALATREV  133

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            VSLAGG FYPVELGRRDGRIST+ SVQ  LP   F LDQLN++F  HGL QTDMIALSGA
Sbjct  134  VSLAGGPFYPVELGRRDGRISTIASVQHRLPSPNFNLDQLNALFSSHGLDQTDMIALSGA  193

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HTIGFSHC++ +KRIY F P++ IDPTLNL+YA QLRQMCP  VD RIAI+MDPTTPNTF
Sbjct  194  HTIGFSHCRRFSKRIYSFTPQTRIDPTLNLQYAMQLRQMCPTNVDSRIAIDMDPTTPNTF  253

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DNAYF+NLQQGKGLF SDQ LFTD RS+ TVN FASN AAFQQAF  A+TKLGR+GVLTG
Sbjct  254  DNAYFQNLQQGKGLFTSDQALFTDNRSKTTVNQFASNKAAFQQAFITAITKLGRVGVLTG  313

Query  53   NLGEIRRDCTRPN  15
            N GEIRRDCTRPN
Sbjct  314  NQGEIRRDCTRPN  326



>ref|XP_011069927.1| PREDICTED: peroxidase 16 [Sesamum indicum]
Length=336

 Score =   485 bits (1249),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 243/303 (80%), Positives = 268/303 (88%), Gaps = 0/303 (0%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPNG  744
            QL T+FY+ TCPNVESLVRSAVQ KFRQTFVTAPATLRLFFHDCFVRGCDAS++LAS NG
Sbjct  34   QLTTDFYRTTCPNVESLVRSAVQAKFRQTFVTAPATLRLFFHDCFVRGCDASIMLASSNG  93

Query  743  KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFYP  564
            +AEKDHPDNLSLAGDGFDTV++AKAAVDSNPQCRNKVSCADILALATRDVV+LAGG FY 
Sbjct  94   QAEKDHPDNLSLAGDGFDTVVRAKAAVDSNPQCRNKVSCADILALATRDVVNLAGGPFYQ  153

Query  563  VELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQ  384
            VELGRRDGR ST+ SVQR+LPG  F LDQL ++F +HGL  TD++ALSGAHTIGFSHC +
Sbjct  154  VELGRRDGRFSTIASVQRSLPGPDFNLDQLITIFAKHGLNITDVVALSGAHTIGFSHCSR  213

Query  383  VAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQ  204
             +KRIY F PRS IDPTLN +YA QLRQMCP++VDPRIAINMDP TPNTFDNAYF+NLQ 
Sbjct  214  FSKRIYNFSPRSRIDPTLNPQYALQLRQMCPIKVDPRIAINMDPATPNTFDNAYFRNLQG  273

Query  203  GKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDCT  24
            G+GLF SDQVLFTD RSR  VN FAS+N AF QAF  A+TKLGR+GVLTGN GEIR DCT
Sbjct  274  GRGLFSSDQVLFTDSRSRAAVNLFASSNVAFSQAFVQAITKLGRVGVLTGNRGEIRVDCT  333

Query  23   RPN  15
            RPN
Sbjct  334  RPN  336



>ref|XP_002532803.1| Peroxidase 16 precursor, putative [Ricinus communis]
 gb|EEF29581.1| Peroxidase 16 precursor, putative [Ricinus communis]
Length=329

 Score =   485 bits (1248),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/331 (76%), Positives = 281/331 (85%), Gaps = 2/331 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME +R  + +V +  ++ L+L      AQL  NFY  TCP+VES+VRSAVQ+KF+QTFVT
Sbjct  1     MESRRSYAFIVLS--MLLLLLPPPLLSAQLTQNFYSKTCPSVESIVRSAVQKKFQQTFVT  58

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDASVLLASP   AEKDHPDNLSLAGDGFDTVIKAKAAVDS PQ
Sbjct  59    APATLRLFFHDCFVRGCDASVLLASPTNNAEKDHPDNLSLAGDGFDTVIKAKAAVDSVPQ  118

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATRDV++LAGG FY VELGRRDGRIST  SVQ  LPG  F LDQLNS
Sbjct  119   CRNKVSCADILALATRDVINLAGGPFYAVELGRRDGRISTKASVQHRLPGPNFNLDQLNS  178

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             +F  HGLTQTDMIALSGAHT+GFSHC + +KRIY F P++ IDPTLN++YAF+LR+MCP+
Sbjct  179   IFASHGLTQTDMIALSGAHTLGFSHCSRFSKRIYNFSPKNRIDPTLNMQYAFELRKMCPV  238

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             +VDPRIAI+MDPTTP  FDNAY++NLQQGKGLF SDQVLFTDPRS+ TVN FASNN AFQ
Sbjct  239   KVDPRIAIDMDPTTPQKFDNAYYRNLQQGKGLFTSDQVLFTDPRSKPTVNQFASNNLAFQ  298

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
              AF AA+ KLGR+GVLTGN GEIR DCTR N
Sbjct  299   NAFVAAIKKLGRVGVLTGNQGEIRNDCTRIN  329



>ref|XP_008223742.1| PREDICTED: peroxidase 16-like [Prunus mume]
Length=326

 Score =   484 bits (1247),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/328 (76%), Positives = 277/328 (84%), Gaps = 3/328 (1%)
 Frame = -2

Query  998  QRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPA  819
            + ++ +V+SA ++     L+ +A AQLRTNFY+ TCPNVESLV SAV+ KF+QTFVTAPA
Sbjct  2    EARSCIVLSAFLIP---FLLGTACAQLRTNFYQGTCPNVESLVTSAVKTKFQQTFVTAPA  58

Query  818  TLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRN  639
            TLRLFFHDCFVRGCDASVL+ SP  +AEKDHPDNLSLAGDGFDTVIKAKAAVDS+P CRN
Sbjct  59   TLRLFFHDCFVRGCDASVLVQSPTNQAEKDHPDNLSLAGDGFDTVIKAKAAVDSDPNCRN  118

Query  638  KVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFG  459
            KVSCADILALATRDVV+LAGG  Y VELGRRDGR+ST+ SVQR LP   F LDQLN+MF 
Sbjct  119  KVSCADILALATRDVVNLAGGPSYTVELGRRDGRVSTIASVQRRLPHPTFNLDQLNTMFS  178

Query  458  RHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVD  279
             HGLTQTDMIALSGAHT+GFSHC + + RIY F P   IDPTLN  YA QLRQMCP+ VD
Sbjct  179  SHGLTQTDMIALSGAHTLGFSHCNRFSNRIYNFSPAKRIDPTLNSAYALQLRQMCPINVD  238

Query  278  PRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqaf  99
            PRIAINMDPTTP TFDN YF+NLQQGKGLF SDQ+LFTD RS+ T+N FAS+NAAF QAF
Sbjct  239  PRIAINMDPTTPRTFDNVYFQNLQQGKGLFTSDQILFTDTRSQATINTFASSNAAFNQAF  298

Query  98   aaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
              AMTKLGR+GVLTGN GEIR DCTRPN
Sbjct  299  VQAMTKLGRVGVLTGNQGEIRSDCTRPN  326



>ref|XP_004296463.1| PREDICTED: peroxidase 45-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   484 bits (1246),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 268/313 (86%), Gaps = 0/313 (0%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            L LL  +  AQLRT+FYK TCPNVESLV SAV +KF+QTFVT PATLRLFFHDC VRGCD
Sbjct  14   LPLLFGTVSAQLRTDFYKGTCPNVESLVSSAVSKKFQQTFVTVPATLRLFFHDCVVRGCD  73

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            ASVL+ SP  KAEKDHPDNLSLAGDGFDTVIKAKAAVD++P CRNKVSCADILALATRDV
Sbjct  74   ASVLIQSPTNKAEKDHPDNLSLAGDGFDTVIKAKAAVDNDPNCRNKVSCADILALATRDV  133

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            V LAGG  Y VELGRRDGR+S++ SVQR LP   F LDQLN+MF  HGL+QTDMIALSGA
Sbjct  134  VRLAGGPSYSVELGRRDGRVSSIASVQRRLPQPTFNLDQLNTMFSTHGLSQTDMIALSGA  193

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HT+GFSHC + + RIY F PR+ IDPTLN  YA QLRQMCP++VDPRIAINMDPTTP  F
Sbjct  194  HTLGFSHCNRFSNRIYNFSPRTRIDPTLNSGYAMQLRQMCPVKVDPRIAINMDPTTPQKF  253

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DNAYF+NLQQGKGLF SDQ+LFTD RSR+TVN FAS+NAAF QAF  AMTKLGR+GVLTG
Sbjct  254  DNAYFQNLQQGKGLFTSDQILFTDSRSRSTVNTFASSNAAFNQAFVQAMTKLGRVGVLTG  313

Query  53   NLGEIRRDCTRPN  15
              GEIRRDCTRPN
Sbjct  314  TQGEIRRDCTRPN  326



>ref|XP_010526357.1| PREDICTED: peroxidase 16 [Tarenaya hassleriana]
Length=327

 Score =   483 bits (1244),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 243/303 (80%), Positives = 271/303 (89%), Gaps = 3/303 (1%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPNG  744
            QLRT+FY+N+CPNVE+LVR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+L+ASP  
Sbjct  28   QLRTDFYRNSCPNVETLVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASILIASP--  85

Query  743  KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFYP  564
             +EKDHPD LSLAGDGFDTV+KAK AVDSNP CRNKVSCAD+LALATR+VV L GG  YP
Sbjct  86   -SEKDHPDQLSLAGDGFDTVVKAKQAVDSNPNCRNKVSCADVLALATREVVLLTGGPNYP  144

Query  563  VELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQ  384
            VELGRRDGR+ST+ SVQ +LP  GF LDQLNSMF RHGL+QTDMIALSGAHTIGFSHC +
Sbjct  145  VELGRRDGRLSTVASVQHSLPQPGFNLDQLNSMFSRHGLSQTDMIALSGAHTIGFSHCGK  204

Query  383  VAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQ  204
             +KRIY F P++ IDPTLNLRYA QLRQMCP+RVDPRIAINMDPTTP TFDNAYFKNLQQ
Sbjct  205  FSKRIYNFSPKNRIDPTLNLRYALQLRQMCPVRVDPRIAINMDPTTPRTFDNAYFKNLQQ  264

Query  203  GKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDCT  24
            G GLF SDQ+LFTD RSR+TVN FASN  AF+QAF +A+TKLGR+GVLTGN GEIRRDCT
Sbjct  265  GMGLFSSDQILFTDQRSRSTVNLFASNEGAFRQAFVSAITKLGRVGVLTGNAGEIRRDCT  324

Query  23   RPN  15
            R N
Sbjct  325  RVN  327



>ref|XP_007222667.1| hypothetical protein PRUPE_ppa008569mg [Prunus persica]
 gb|EMJ23866.1| hypothetical protein PRUPE_ppa008569mg [Prunus persica]
Length=326

 Score =   483 bits (1242),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 246/324 (76%), Positives = 274/324 (85%), Gaps = 2/324 (1%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S +V + +L+    L+ +A AQLRT+FYK TCPNVESLV SAV+ KF+QTFVTAPATLRL
Sbjct  5    SCIVLSALLI--PFLLGTACAQLRTDFYKGTCPNVESLVTSAVKTKFQQTFVTAPATLRL  62

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFVRGCDASVL+ SP  +AEKDHPDNLSLAGDGFDTVIKAKAAVDS+P CRNKVSC
Sbjct  63   FFHDCFVRGCDASVLVQSPTNQAEKDHPDNLSLAGDGFDTVIKAKAAVDSDPNCRNKVSC  122

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDVV+LAGG  Y VELGRRDGR+ST+ SVQR LP   F LDQLN+MF  HGL
Sbjct  123  ADILALATRDVVNLAGGPSYTVELGRRDGRVSTIASVQRRLPHPTFNLDQLNTMFSSHGL  182

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQTDMIALSGAHT+GFSHC + + RIY F P   IDPTLN  YA QLRQMCP+ VDPRIA
Sbjct  183  TQTDMIALSGAHTLGFSHCNRFSNRIYNFSPAKRIDPTLNSAYALQLRQMCPINVDPRIA  242

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP TFDN YF+NLQQGKGLF SDQ+LFTD R++ T+N FAS+NAAF +AF  AM
Sbjct  243  INMDPTTPRTFDNVYFQNLQQGKGLFTSDQILFTDKRAQATINTFASSNAAFNRAFVQAM  302

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
            TKLGR+GVLTGN GEIR DCTRPN
Sbjct  303  TKLGRVGVLTGNQGEIRSDCTRPN  326



>gb|KDO61842.1| hypothetical protein CISIN_1g046044mg [Citrus sinensis]
Length=327

 Score =   481 bits (1237),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 268/315 (85%), Gaps = 0/315 (0%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            V   L+++ A AQLR +FY++TCPNVESLVRSAV +KF QTFVTAPATLRLFFHDCFVRG
Sbjct  13   VVFSLIMTGASAQLREDFYRSTCPNVESLVRSAVTKKFTQTFVTAPATLRLFFHDCFVRG  72

Query  779  CDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATR  600
            CDASVLL+SPN +AEKDHP+++SLAGDGFDTV+KAK AVDS+PQCRNKVSCADILALATR
Sbjct  73   CDASVLLSSPNNRAEKDHPEDISLAGDGFDTVVKAKEAVDSDPQCRNKVSCADILALATR  132

Query  599  DVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALS  420
            DVVSLAGG FY VELGRRDGRIST+ SVQ  LP   F LDQLN MF  HGL QTDMIALS
Sbjct  133  DVVSLAGGPFYKVELGRRDGRISTIASVQHKLPQPDFNLDQLNRMFSSHGLDQTDMIALS  192

Query  419  GAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPN  240
            GAHTIGFSHC + +KRIY F PR+ IDPTLN  YA QLR MCP+RVDPRIAI+MDPTTP 
Sbjct  193  GAHTIGFSHCSRFSKRIYNFSPRNRIDPTLNFNYAMQLRGMCPVRVDPRIAIDMDPTTPR  252

Query  239  TFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVL  60
             FDNAY+KNLQQGKGLF SDQ+LF+D RSR+TV  FASN  AF +AF +A+TKLGR+GV 
Sbjct  253  IFDNAYYKNLQQGKGLFTSDQILFSDGRSRDTVVRFASNKEAFNRAFISAITKLGRVGVK  312

Query  59   TGNLGEIRRDCTRPN  15
            TGN GEIRRDC   N
Sbjct  313  TGNQGEIRRDCALVN  327



>gb|ACU23164.1| unknown [Glycine max]
Length=324

 Score =   480 bits (1236),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 250/319 (78%), Positives = 273/319 (86%), Gaps = 5/319 (2%)
 Frame = -2

Query  962  LVCLVLLVSSA---HAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
             + L LL++SA    AQL + FYKNTCPNVE LVRSAV QKF+QTFVTAPATLRLFFHDC
Sbjct  8    FLSLPLLLTSATISSAQLSSGFYKNTCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDC  67

Query  791  FVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILA  612
            FVRGCDAS+LLA  NG+ EKDHPD +SLAGDGFDTVIKAKAAVD +P+CRNKVSCADILA
Sbjct  68   FVRGCDASILLA--NGRPEKDHPDQISLAGDGFDTVIKAKAAVDRDPKCRNKVSCADILA  125

Query  611  LATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDM  432
            LATRDVV+LAGG FY VELGRRDGRIST+ SVQR+LP   F LDQLNSMF  +GL+QTDM
Sbjct  126  LATRDVVNLAGGPFYNVELGRRDGRISTIASVQRHLPHPEFNLDQLNSMFNFNGLSQTDM  185

Query  431  IALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDP  252
            IALSGAHTIGFSHC + + RIY F PR+ IDPTLNL+YAFQLRQMCPLRVDPRIAINMDP
Sbjct  186  IALSGAHTIGFSHCNKFSNRIYNFSPRNRIDPTLNLQYAFQLRQMCPLRVDPRIAINMDP  245

Query  251  TTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGR  72
             TP  FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN FASN  AFQ+AF  A+TKLGR
Sbjct  246  VTPQKFDNQYFKNLQQGKGLFTSDQVLFTDARSKATVNLFASNEGAFQKAFVDAVTKLGR  305

Query  71   IGVLTGNLGEIRRDCTRPN  15
            +GV TGN GEIR DCTRPN
Sbjct  306  VGVKTGNQGEIRFDCTRPN  324



>ref|XP_006453319.1| hypothetical protein CICLE_v10010461mg [Citrus clementina]
 ref|XP_006474215.1| PREDICTED: peroxidase 16-like [Citrus sinensis]
 gb|ESR66559.1| hypothetical protein CICLE_v10010461mg [Citrus clementina]
Length=327

 Score =   480 bits (1236),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 240/315 (76%), Positives = 268/315 (85%), Gaps = 0/315 (0%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            V   L+++ A AQLR +FY++TCPNVESLVRSAV +KF QTFVTAPATLRLFFHDCFVRG
Sbjct  13   VVFSLIMTGASAQLREDFYRSTCPNVESLVRSAVTKKFTQTFVTAPATLRLFFHDCFVRG  72

Query  779  CDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATR  600
            CDASVLL+SPN +AEKDHP+++SLAGDGFDTV+KAK AVDS+PQCRNKVSCADILALATR
Sbjct  73   CDASVLLSSPNNRAEKDHPEDISLAGDGFDTVVKAKEAVDSDPQCRNKVSCADILALATR  132

Query  599  DVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALS  420
            DVVSLAGG FY VELGRRDGRIST+ SVQ  LP   F LDQLN MF  HGL QTDMIALS
Sbjct  133  DVVSLAGGPFYKVELGRRDGRISTIASVQHRLPQPDFNLDQLNRMFSSHGLDQTDMIALS  192

Query  419  GAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPN  240
            GAHTIGFSHC + +KRIY F PR+ IDPTLN  YA QLR MCP+RVDPRIAI+MDPTTP 
Sbjct  193  GAHTIGFSHCSRFSKRIYNFSPRNRIDPTLNFNYAMQLRGMCPVRVDPRIAIDMDPTTPR  252

Query  239  TFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVL  60
             FDNAY+KNLQQGKGLF SDQ+LF+D RSR+TV  FASN  AF +AF +A+TKLGR+GV 
Sbjct  253  IFDNAYYKNLQQGKGLFTSDQILFSDGRSRDTVVRFASNKEAFNRAFISAITKLGRVGVK  312

Query  59   TGNLGEIRRDCTRPN  15
            TGN GEIRRDC   N
Sbjct  313  TGNQGEIRRDCALVN  327



>ref|XP_011043934.1| PREDICTED: peroxidase 45-like [Populus euphratica]
Length=329

 Score =   480 bits (1235),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 244/310 (79%), Positives = 269/310 (87%), Gaps = 0/310 (0%)
 Frame = -2

Query  944  LVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASV  765
            + S+  +QLR NFY+N CPNVESLVRSAVQ+KF QTFVTAPA LRL FHDCFVRGCDASV
Sbjct  20   IASAQSSQLRRNFYQNICPNVESLVRSAVQKKFSQTFVTAPAVLRLLFHDCFVRGCDASV  79

Query  764  LLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            LL+SP+  AEKDHPD++SLAGDGFDTVIKAKAAVDSNP+CRNKVSCADILALATRDVV+L
Sbjct  80   LLSSPSNNAEKDHPDDISLAGDGFDTVIKAKAAVDSNPRCRNKVSCADILALATRDVVAL  139

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGRRDGRIST  SVQR LP   FKLDQLNSMF  HGL+QTDMIALSGAHT+
Sbjct  140  AGGPSYSVELGRRDGRISTKASVQRKLPHPTFKLDQLNSMFASHGLSQTDMIALSGAHTL  199

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GFSHC Q A RIY+F  R+ IDP+LNL+YA QLRQMCP+ VD RIAINMDPTTP  FDNA
Sbjct  200  GFSHCSQFANRIYKFNSRNRIDPSLNLQYAMQLRQMCPVNVDSRIAINMDPTTPRKFDNA  259

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y++NLQ GKGLF SDQ+LFTD RS+ TVN FASNNAAFQQAF  A+TKLGR+GVLTGN G
Sbjct  260  YYQNLQNGKGLFTSDQILFTDSRSKGTVNLFASNNAAFQQAFVTAITKLGRVGVLTGNRG  319

Query  44   EIRRDCTRPN  15
            EIRRDC+R N
Sbjct  320  EIRRDCSRVN  329



>ref|XP_010467737.1| PREDICTED: peroxidase 16 [Camelina sativa]
Length=323

 Score =   479 bits (1234),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 241/326 (74%), Positives = 280/326 (86%), Gaps = 4/326 (1%)
 Frame = -2

Query  992  KNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATL  813
            KN    S   L+ L+L  SS  AQL+TNFY+N+CPNVE++VR+AV+QKF+QTFVTAPATL
Sbjct  2    KNHRSFSIAALL-LILFSSSVSAQLQTNFYRNSCPNVETIVRNAVRQKFQQTFVTAPATL  60

Query  812  RLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKV  633
            RLFFHDCFVRGCDAS+LLASP   +EKDHPD++SLAGDGFDTV KAK AVD +P CRNKV
Sbjct  61   RLFFHDCFVRGCDASILLASP---SEKDHPDDVSLAGDGFDTVAKAKQAVDRDPNCRNKV  117

Query  632  SCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRH  453
            SCADILALATRDVV L GG  YPVELGRRDGR+ST+ SVQ +LP  GF L+QLN+MF RH
Sbjct  118  SCADILALATRDVVVLTGGPNYPVELGRRDGRLSTVASVQHSLPQPGFNLNQLNTMFARH  177

Query  452  GLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPR  273
            GL+QTDMIALSGAHTIGF+HC + +KRIY F P+  IDPTLN+RYA QLR+MCP+++DPR
Sbjct  178  GLSQTDMIALSGAHTIGFAHCGKFSKRIYNFSPKRTIDPTLNIRYALQLRKMCPIKIDPR  237

Query  272  IAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaa  93
            IAINMDPTTPNTFDNAYFKNLQ+G GLF SDQVLF+D RSR+TVN FAS+  AF+QAF +
Sbjct  238  IAINMDPTTPNTFDNAYFKNLQKGMGLFTSDQVLFSDQRSRSTVNSFASSEVAFRQAFVS  297

Query  92   AMTKLGRIGVLTGNLGEIRRDCTRPN  15
            A+TKLGR+GV TGN GEIRRDC+R N
Sbjct  298  AITKLGRVGVKTGNAGEIRRDCSRIN  323



>ref|XP_007014305.1| Peroxidase family protein [Theobroma cacao]
 gb|EOY31924.1| Peroxidase family protein [Theobroma cacao]
Length=327

 Score =   479 bits (1232),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 247/324 (76%), Positives = 272/324 (84%), Gaps = 1/324 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S++V + IL+ L+  ++SA  +LR +FY+ TCPNVES+VRSAVQ KF+QTFVTAP TLRL
Sbjct  5    SIIVVSFILLPLLFTIASAQTRLRPDFYRTTCPNVESIVRSAVQTKFQQTFVTAPGTLRL  64

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFVRGCDASV+L   NG AEKDH D++SLAGDGFDTVIKAKAA+DSNPQCRNKVSC
Sbjct  65   FFHDCFVRGCDASVMLTG-NGNAEKDHADDISLAGDGFDTVIKAKAALDSNPQCRNKVSC  123

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDVV+L GG  Y VELGRRDGRIST  SV+  LP   F LDQLNSMF RHGL
Sbjct  124  ADILALATRDVVALTGGPNYRVELGRRDGRISTKASVENQLPHPDFNLDQLNSMFARHGL  183

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQTDMIALSGAHT+GFSHC + + RIY F PR  IDPTLN  YA QLRQMCP  VDPRIA
Sbjct  184  TQTDMIALSGAHTLGFSHCGRFSNRIYNFSPRRKIDPTLNFAYALQLRQMCPRNVDPRIA  243

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP TFDN Y+KNLQQGKGLF SDQ+LFTD RSRNTV  FASNN AFQ AF AA+
Sbjct  244  INMDPTTPRTFDNVYYKNLQQGKGLFTSDQILFTDRRSRNTVKLFASNNGAFQNAFVAAI  303

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
            TKLGR GVLTGN GEIRRDCT+PN
Sbjct  304  TKLGRAGVLTGNQGEIRRDCTQPN  327



>ref|XP_009347014.1| PREDICTED: peroxidase 16-like [Pyrus x bretschneideri]
Length=326

 Score =   478 bits (1229),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 266/311 (86%), Gaps = 0/311 (0%)
 Frame = -2

Query  947  LLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDAS  768
             L+ +A AQLRT+FYK TCPN+ES+V SAV+ KF+QTFVTAPATLRLFFHDCFVRGCDAS
Sbjct  16   FLLGTACAQLRTDFYKGTCPNLESIVSSAVKTKFQQTFVTAPATLRLFFHDCFVRGCDAS  75

Query  767  VLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVS  588
            VL+ SP  + EKDHPDNLSLAGDGFDTVIKAKAAVDS+P C NKVSCADILALATRDVV 
Sbjct  76   VLIQSPTNQGEKDHPDNLSLAGDGFDTVIKAKAAVDSDPNCENKVSCADILALATRDVVQ  135

Query  587  LAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHT  408
            LAGG  Y VELGRRDG++ST+ SVQR LP   F LDQLNSMF  HGL+QTDM+ALSGAHT
Sbjct  136  LAGGPSYTVELGRRDGKVSTMASVQRRLPSPTFNLDQLNSMFTSHGLSQTDMVALSGAHT  195

Query  407  IGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDN  228
            +GFSHC + +KRIY F  ++ IDPTL+  YA QLRQMCP RVDPRIAINMDPTTP  FDN
Sbjct  196  LGFSHCGRFSKRIYSFSSKTRIDPTLDPAYALQLRQMCPTRVDPRIAINMDPTTPRAFDN  255

Query  227  AYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNL  48
             YF+NLQQGKGLF SDQ+LFTD R+R TVN FAS+NAAF QAF  AMTKLGRIGVLTGN 
Sbjct  256  VYFQNLQQGKGLFTSDQILFTDTRTRATVNQFASSNAAFNQAFIQAMTKLGRIGVLTGNQ  315

Query  47   GEIRRDCTRPN  15
            GEIRRDCTRPN
Sbjct  316  GEIRRDCTRPN  326



>ref|XP_003549343.1| PREDICTED: peroxidase 16 [Glycine max]
 gb|KHN17613.1| Peroxidase 16 [Glycine soja]
Length=324

 Score =   477 bits (1227),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 245/306 (80%), Positives = 266/306 (87%), Gaps = 2/306 (1%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            + AQL + FYKNTCPNVE LVRSAV QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA 
Sbjct  21   SSAQLSSGFYKNTCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDCFVRGCDASILLA-  79

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
             NG+ EKDHPD +SLAGDGFDTVIKAKAAVD +P+CRNKVSCADILALATRDVV+LAGG 
Sbjct  80   -NGRPEKDHPDQISLAGDGFDTVIKAKAAVDRDPKCRNKVSCADILALATRDVVNLAGGP  138

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
            FY VELGRRDGRIST+ SVQR+LP   F LDQLNSMF  +GL+QTDMIALSGAHTIGFSH
Sbjct  139  FYNVELGRRDGRISTIASVQRHLPHPEFNLDQLNSMFNFNGLSQTDMIALSGAHTIGFSH  198

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C + + RIY F PR+ IDPTLNL+YAFQLRQMCPLRVDPRIAINMDP TP  FDN YFKN
Sbjct  199  CNKFSNRIYNFSPRNRIDPTLNLQYAFQLRQMCPLRVDPRIAINMDPVTPQKFDNQYFKN  258

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            LQQGKGLF SDQVLFTD RS+ TVN FASN  AFQ+AF  A+TKLGR+GV TGN GEIR 
Sbjct  259  LQQGKGLFTSDQVLFTDARSKATVNLFASNEGAFQKAFVDAVTKLGRVGVKTGNQGEIRF  318

Query  32   DCTRPN  15
            DCTRPN
Sbjct  319  DCTRPN  324



>gb|EYU37317.1| hypothetical protein MIMGU_mgv1a009833mg [Erythranthe guttata]
Length=330

 Score =   477 bits (1228),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 277/331 (84%), Gaps = 1/331 (0%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             M +Q+  S++    ++V LV+  ++A+AQLRTNFY  TCPNVE+LVR+AVQ KFRQTFVT
Sbjct  1     MMNQKSTSLMTLLPLIVVLVI-SNTANAQLRTNFYNATCPNVEALVRAAVQAKFRQTFVT  59

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDASV++ASP G AEKDHPDNLSLAGDGFDTVI+AKAAVD N  
Sbjct  60    APATLRLFFHDCFVRGCDASVMMASPTGNAEKDHPDNLSLAGDGFDTVIRAKAAVDRNTN  119

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             C NKVSCADILALATRDVV+L GG  Y VELGRRDGRIST  SVQ  LPG GF L+QLN+
Sbjct  120   CTNKVSCADILALATRDVVALVGGPSYSVELGRRDGRISTRASVQGRLPGPGFSLNQLNT  179

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             +F  HGL QTD++ALSGAHTIGFSHC + ++RIY F P + IDP+LNL+YA QLRQMCP+
Sbjct  180   LFASHGLDQTDVVALSGAHTIGFSHCNRFSRRIYNFSPANRIDPSLNLQYALQLRQMCPV  239

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
              VDP IA+NMDPT+PN FDNAYF+NLQ G+GLF SDQVLFTD RSR TVN FA NNAAF 
Sbjct  240   NVDPTIAVNMDPTSPNRFDNAYFRNLQGGRGLFTSDQVLFTDTRSRATVNQFALNNAAFG  299

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             +AF  AMTKLGR+GVLTGN GEIR DCT PN
Sbjct  300   RAFVLAMTKLGRVGVLTGNQGEIRIDCTTPN  330



>ref|XP_010489449.1| PREDICTED: peroxidase 16-like [Camelina sativa]
Length=323

 Score =   477 bits (1227),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 283/331 (85%), Gaps = 8/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             M++QR  S+   A +L  L+L  SS  AQL+TNFY+N+CPNVE++VR+AV+QKF+QTFVT
Sbjct  1     MKNQRSFSI---AALL--LILFSSSVSAQLQTNFYRNSCPNVETIVRNAVRQKFQQTFVT  55

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDAS+LLASP   +EKDHPD++SLAGDGFDTV KAK AVD +P 
Sbjct  56    APATLRLFFHDCFVRGCDASILLASP---SEKDHPDDVSLAGDGFDTVAKAKQAVDRDPN  112

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATRDVV L GG  YPVELGRRDGR+ST+ SVQ +LP  GF L+QLN+
Sbjct  113   CRNKVSCADILALATRDVVVLTGGPNYPVELGRRDGRLSTVASVQHSLPQPGFNLNQLNT  172

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF RHGL+QTDMIALSGAHTIGF+HC + +KRIY F P+  IDPTLN+RYA QLR+MCP+
Sbjct  173   MFARHGLSQTDMIALSGAHTIGFAHCGKFSKRIYNFSPKQTIDPTLNIRYALQLRKMCPI  232

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             + DPRIAINMDPT+PNTFDNAYFKNLQ+G GLF SDQVLF+D RSR+TVN FAS+  AF+
Sbjct  233   KNDPRIAINMDPTSPNTFDNAYFKNLQKGMGLFTSDQVLFSDQRSRSTVNSFASSEVAFR  292

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAF +A+ KLGR+GV TGN GEIRRDC+R N
Sbjct  293   QAFVSAIAKLGRVGVKTGNAGEIRRDCSRVN  323



>ref|XP_002324463.1| Peroxidase 16 precursor family protein [Populus trichocarpa]
 gb|EEF03028.1| Peroxidase 16 precursor family protein [Populus trichocarpa]
 gb|AHL39194.1| class III peroxidase [Populus trichocarpa]
Length=328

 Score =   476 bits (1226),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 244/310 (79%), Positives = 267/310 (86%), Gaps = 0/310 (0%)
 Frame = -2

Query  944  LVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASV  765
            + S+  +QLR NFY+N CPNVESLVRSAVQ KF QTFVTAPATLRL FHDCFVRGCDASV
Sbjct  19   IASAQSSQLRQNFYQNICPNVESLVRSAVQTKFSQTFVTAPATLRLLFHDCFVRGCDASV  78

Query  764  LLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            LL+SP+  AEKDHPD++SLAGDGFDTVIKAKAAVDSNP+CRNKVSCADILALATRDVV L
Sbjct  79   LLSSPSNNAEKDHPDDISLAGDGFDTVIKAKAAVDSNPRCRNKVSCADILALATRDVVVL  138

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGRRDGRIST  SVQR LP   F LDQLNSMF  HGL+QTDMIALSGAHT+
Sbjct  139  AGGPSYSVELGRRDGRISTKGSVQRKLPHPTFNLDQLNSMFASHGLSQTDMIALSGAHTL  198

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GFSHC + A RIYRF  R+ IDPTLNL+YA QLRQMCP+ VD RIAINMDPTTP  FDNA
Sbjct  199  GFSHCSRFADRIYRFNSRNRIDPTLNLQYAMQLRQMCPVNVDSRIAINMDPTTPRQFDNA  258

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y++NL+ GKGLF SDQ+LFTD RS+ TVN FASNNAAFQQAF  A+TKLGR+GVLTGN G
Sbjct  259  YYQNLKNGKGLFTSDQILFTDSRSKGTVNLFASNNAAFQQAFVTAITKLGRVGVLTGNQG  318

Query  44   EIRRDCTRPN  15
            EIRRDC+R N
Sbjct  319  EIRRDCSRIN  328



>ref|XP_008390952.1| PREDICTED: peroxidase 16-like [Malus domestica]
Length=326

 Score =   474 bits (1221),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 239/311 (77%), Positives = 265/311 (85%), Gaps = 0/311 (0%)
 Frame = -2

Query  947  LLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDAS  768
             L+ +A AQLRT+FYK TCPN+ES+V SAV+ KF+QTFVTAPATLRLFFHDCFVRGCDAS
Sbjct  16   FLLGTACAQLRTDFYKGTCPNLESIVSSAVKTKFQQTFVTAPATLRLFFHDCFVRGCDAS  75

Query  767  VLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVS  588
            VL+ SP  + EKDHPDNLSLAGDGFDTVIKAKAAVD +P C+NKVSCADILALATRDVV 
Sbjct  76   VLIQSPTNQGEKDHPDNLSLAGDGFDTVIKAKAAVDXDPNCKNKVSCADILALATRDVVQ  135

Query  587  LAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHT  408
            LAGG  Y VELGRRDGR+ST+ SVQR LP   F LDQLN+MF  HGL+QTDM+ALSGAHT
Sbjct  136  LAGGPSYTVELGRRDGRVSTMASVQRRLPSPTFNLDQLNTMFTSHGLSQTDMVALSGAHT  195

Query  407  IGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDN  228
            +GFSHC + +KRIY F  ++ IDPTL+  YA QLRQMCP RVDPRIAINMDPTTP  FDN
Sbjct  196  LGFSHCSRFSKRIYSFSSKTRIDPTLDPAYALQLRQMCPTRVDPRIAINMDPTTPRAFDN  255

Query  227  AYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNL  48
             YF+NLQQGKGLF SDQ+LFTD R+R TVN FAS+NAAF QAF  AMTKLGRIGVLTGN 
Sbjct  256  VYFQNLQQGKGLFTSDQILFTDTRTRATVNQFASSNAAFNQAFIQAMTKLGRIGVLTGNQ  315

Query  47   GEIRRDCTRPN  15
            GEIR DCTRPN
Sbjct  316  GEIRXDCTRPN  326



>ref|XP_003533723.1| PREDICTED: peroxidase 16-like [Glycine max]
 gb|KHN35785.1| Peroxidase 16 [Glycine soja]
Length=328

 Score =   474 bits (1221),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 240/324 (74%), Positives = 267/324 (82%), Gaps = 0/324 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S  V     + L++   ++ AQL   FY+NTCPNVE LVRSAV+QKF+QTFVTAPATLRL
Sbjct  5    SFFVILSSFLLLIVSTQTSSAQLTRGFYRNTCPNVEQLVRSAVEQKFQQTFVTAPATLRL  64

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFVRGCDAS+LLASPN KAEK+HPD++SLAGDGFDTV+KAKAAVDS+PQCRNKVSC
Sbjct  65   FFHDCFVRGCDASILLASPNNKAEKNHPDDISLAGDGFDTVVKAKAAVDSDPQCRNKVSC  124

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV++LAGG FY VELGR DGRIST+ SVQR LP   F LD+LNSMF  HGL
Sbjct  125  ADILALATRDVINLAGGPFYEVELGRLDGRISTIASVQRQLPHPDFNLDKLNSMFSFHGL  184

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            T+TDMIALSGAHTIGFSHC   ++RIY F P+  IDPTLNL+YAFQLRQ CPLRVD RIA
Sbjct  185  TKTDMIALSGAHTIGFSHCNHFSRRIYNFSPQKLIDPTLNLQYAFQLRQACPLRVDSRIA  244

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP  FDN YFKNLQQG GLF SDQVL TD RSR TVN FASN  AF +AF  A+
Sbjct  245  INMDPVTPEKFDNQYFKNLQQGMGLFTSDQVLATDERSRGTVNLFASNEQAFNKAFIEAI  304

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
            TK+GRIGV TG  GEIR DC+R N
Sbjct  305  TKMGRIGVKTGRQGEIRFDCSRVN  328



>ref|XP_006300101.1| hypothetical protein CARUB_v10016330mg [Capsella rubella]
 gb|EOA32999.1| hypothetical protein CARUB_v10016330mg [Capsella rubella]
Length=323

 Score =   474 bits (1221),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 234/308 (76%), Positives = 271/308 (88%), Gaps = 3/308 (1%)
 Frame = -2

Query  938  SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLL  759
            SS  AQLR NFY+N+CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LL
Sbjct  19   SSVSAQLRANFYRNSCPNVETVVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASILL  78

Query  758  ASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAG  579
            ASP   +EK+HPD++SLAGDGFDTV+KAK AVD +P CRNKVSCADILALATRDVV L G
Sbjct  79   ASP---SEKNHPDDVSLAGDGFDTVVKAKQAVDRDPNCRNKVSCADILALATRDVVVLTG  135

Query  578  GAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGF  399
            G  YPVELGRRDGR+ST+ SVQ +LP  GF L+QLN+MF RHGL+QTDMIALSGAHTIGF
Sbjct  136  GPNYPVELGRRDGRLSTVASVQHSLPQPGFNLNQLNTMFARHGLSQTDMIALSGAHTIGF  195

Query  398  SHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYF  219
            +HC + +KRIY F P+  IDPTLN+RYA QLRQMCP+ +DPRIAINMDPT+PNTFDNAYF
Sbjct  196  AHCGKFSKRIYNFSPKRTIDPTLNIRYALQLRQMCPIEIDPRIAINMDPTSPNTFDNAYF  255

Query  218  KNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEI  39
            KNLQ+G GLF SDQVLF+D RSR+TVN FAS+  AF+QAF +A+TKLGR+GV TGN GEI
Sbjct  256  KNLQKGMGLFSSDQVLFSDQRSRSTVNSFASSEVAFRQAFVSAITKLGRVGVKTGNAGEI  315

Query  38   RRDCTRPN  15
            RRDC+R N
Sbjct  316  RRDCSRVN  323



>ref|XP_009137893.1| PREDICTED: peroxidase 45 [Brassica rapa]
Length=325

 Score =   474 bits (1221),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/329 (73%), Positives = 276/329 (84%), Gaps = 5/329 (2%)
 Frame = -2

Query  1001  HQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAP  822
              ++ N  + S  I   L+L  S   AQLRT FY+N+CPNVES+VR+AV+QKF+QTFVTAP
Sbjct  2     EKKTNQTIFS--IFSLLLLFSSCVSAQLRTGFYQNSCPNVESIVRNAVRQKFQQTFVTAP  59

Query  821   ATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCR  642
             ATLRLFFHDCFVRGCDAS+L+ASP   +EKDHPD++SLAGDGFDTV+KAK AVD +P+CR
Sbjct  60    ATLRLFFHDCFVRGCDASILIASP---SEKDHPDDMSLAGDGFDTVVKAKQAVDRDPKCR  116

Query  641   NKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMF  462
             NKVSCADILALATR+VV L GG  YPVELGRRDGR+ST  SVQ NLP  GF L+QLN+MF
Sbjct  117   NKVSCADILALATREVVVLTGGPSYPVELGRRDGRLSTKASVQNNLPQPGFNLNQLNAMF  176

Query  461   GRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRV  282
              RHGL+QTDMIALSGAHT+GF+HC + + RIY F PR+ IDP+LN  YA QLRQMCP RV
Sbjct  177   NRHGLSQTDMIALSGAHTLGFAHCGKFSNRIYNFSPRTRIDPSLNSGYALQLRQMCPQRV  236

Query  281   DPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqa  102
             DPRIAINMDPTTP TFDNAYFKNLQQGKGLF SDQVLFTD RSR TVN FA++  AF+QA
Sbjct  237   DPRIAINMDPTTPRTFDNAYFKNLQQGKGLFTSDQVLFTDQRSRATVNSFANSETAFRQA  296

Query  101   faaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             F +A+TKLGR+GV TGN GEIRRDC+R N
Sbjct  297   FVSAITKLGRVGVKTGNAGEIRRDCSRFN  325



>ref|XP_006412738.1| hypothetical protein EUTSA_v10025699mg [Eutrema salsugineum]
 gb|ESQ54191.1| hypothetical protein EUTSA_v10025699mg [Eutrema salsugineum]
Length=327

 Score =   474 bits (1221),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 241/333 (72%), Positives = 279/333 (84%), Gaps = 6/333 (2%)
 Frame = -2

Query  1013  ITMEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTF  834
             + ME +   S+     I   L+L  S   AQLRT FY+N+CPNVE++VR+AV+QKF+QTF
Sbjct  1     MAMEKKTNQSIFY---IFSLLLLFSSCVSAQLRTGFYRNSCPNVENIVRNAVRQKFQQTF  57

Query  833   VTAPATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSN  654
             VTAPATLRLFFHDCFVRGCDAS+L+ASP   +EKDHPD++SLAGDGFDTV KAK AVDS+
Sbjct  58    VTAPATLRLFFHDCFVRGCDASILIASP---SEKDHPDDVSLAGDGFDTVAKAKQAVDSD  114

Query  653   PQCRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQL  474
             P CRNKVSCADILALATR+VV L GG  YPVELGRRDGR+ST  SVQ +LP  GF L+QL
Sbjct  115   PNCRNKVSCADILALATREVVVLTGGPSYPVELGRRDGRLSTKASVQHSLPQPGFNLNQL  174

Query  473   NSMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMC  294
             N+MF RHGL+QTDMIALSGAHTIGF+HC + +KRIY F PR+ IDP+LN  YA QLRQMC
Sbjct  175   NTMFNRHGLSQTDMIALSGAHTIGFAHCGKFSKRIYNFSPRTRIDPSLNRGYALQLRQMC  234

Query  293   PLRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaa  114
             P+RVDPRIAINMDPTTP TFDNAYFKNLQQG+GLF SDQVLFTD RSR+TVN FA++  A
Sbjct  235   PVRVDPRIAINMDPTTPRTFDNAYFKNLQQGRGLFTSDQVLFTDQRSRSTVNLFANSEGA  294

Query  113   fqqafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             F+QAF +A+TKLGR+GV TGN GEIRRDC+R N
Sbjct  295   FRQAFISAITKLGRVGVKTGNAGEIRRDCSRVN  327



>gb|KHN22682.1| Peroxidase 16 [Glycine soja]
Length=324

 Score =   474 bits (1219),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 265/306 (87%), Gaps = 2/306 (1%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            + AQL   FY+NTCPNVE LVRS+V QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA 
Sbjct  21   SSAQLSRVFYRNTCPNVEQLVRSSVAQKFQQTFVTAPATLRLFFHDCFVRGCDASILLA-  79

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
             NGK EKDHPD +SLAGDGFDTVIKAK AVD +P+CRNKVSCADILALATRDVV+LAGG 
Sbjct  80   -NGKPEKDHPDQISLAGDGFDTVIKAKEAVDRDPKCRNKVSCADILALATRDVVNLAGGP  138

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
            FY VELGRRDGRIST+ SVQR+LP   F LDQLNSMF  +GL+QTDMIALSGAHTIGFSH
Sbjct  139  FYNVELGRRDGRISTIASVQRHLPHPDFNLDQLNSMFNFNGLSQTDMIALSGAHTIGFSH  198

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C + + RIY+F PR+ IDPTLNL+YAFQLRQMCPLRVDPRIAINMDP TP  FDN YFKN
Sbjct  199  CNKFSNRIYKFSPRNRIDPTLNLQYAFQLRQMCPLRVDPRIAINMDPVTPQKFDNQYFKN  258

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            LQQGKGLF SDQVLFTD RS+ TVN FASN  AFQ+AF  A+TKLGR+GV TGN GEIR 
Sbjct  259  LQQGKGLFTSDQVLFTDARSKATVNLFASNEGAFQKAFVDAITKLGRVGVKTGNQGEIRF  318

Query  32   DCTRPN  15
            DCTRPN
Sbjct  319  DCTRPN  324



>ref|NP_179488.1| peroxidase 16 [Arabidopsis thaliana]
 sp|Q96518.2|PER16_ARATH RecName: Full=Peroxidase 16; Short=Atperox P16; AltName: Full=ATP22a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC09031.1| peroxidase (ATP22a) [Arabidopsis thaliana]
 gb|AAO23647.1| At2g18980 [Arabidopsis thaliana]
 dbj|BAE99626.1| peroxidase [Arabidopsis thaliana]
 gb|AEC06835.1| peroxidase 16 [Arabidopsis thaliana]
Length=323

 Score =   473 bits (1218),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 240/331 (73%), Positives = 279/331 (84%), Gaps = 8/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             M++Q   S+V      + L+   SS  AQL+TNFY+ +CPNVE++VR+AV+QKF+QTFVT
Sbjct  1     MKNQSSFSIVA-----LLLIFFSSSVFAQLQTNFYRKSCPNVETIVRNAVRQKFQQTFVT  55

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDAS+LLASP   +EKDHPD+ SLAGDGFDTV KAK A+D +P 
Sbjct  56    APATLRLFFHDCFVRGCDASILLASP---SEKDHPDDKSLAGDGFDTVAKAKQALDRDPN  112

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATRDVV L GG  YPVELGRRDGR+ST+ SVQ +LP   FKLDQLN+
Sbjct  113   CRNKVSCADILALATRDVVVLTGGPNYPVELGRRDGRLSTVASVQHSLPQPSFKLDQLNT  172

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF RHGL+QTDMIALSGAHTIGF+HC + +KRIY F P+  IDPTLN+RYA QLRQMCP+
Sbjct  173   MFARHGLSQTDMIALSGAHTIGFAHCGKFSKRIYNFSPKRPIDPTLNIRYALQLRQMCPI  232

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             RVD RIAINMDPT+PNTFDNAYFKNLQ+G GLF SDQVLF+D RSR+TVN FAS+ A F+
Sbjct  233   RVDLRIAINMDPTSPNTFDNAYFKNLQKGMGLFTSDQVLFSDERSRSTVNSFASSEATFR  292

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAF +A+TKLGR+GV TGN GEIRRDC+R N
Sbjct  293   QAFISAITKLGRVGVKTGNAGEIRRDCSRVN  323



>emb|CAA70034.1| peroxidase ATP22a [Arabidopsis thaliana]
Length=322

 Score =   473 bits (1217),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 236/317 (74%), Positives = 273/317 (86%), Gaps = 3/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            + + L+   SS  AQL+TNFY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFV
Sbjct  9    VALLLIFFSSSVFAQLQTNFYRKSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDCFV  68

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
            RGCDAS+LLASP   +EKDHPD+ SLAGDGFDTV KAK A+D +P CRNKVSCADILALA
Sbjct  69   RGCDASILLASP---SEKDHPDDKSLAGDGFDTVAKAKQALDRDPNCRNKVSCADILALA  125

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
            TRDVV L GG  YPVELGRRDGR+ST+ SVQ +LP   FKLDQLN+MF RHGL+QTDMIA
Sbjct  126  TRDVVVLTGGPNYPVELGRRDGRLSTVASVQHSLPQPSFKLDQLNTMFARHGLSQTDMIA  185

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHTIGF+HC + +KRIY F P+  IDPTLN+RYA QLRQMCP+RVD RIAINMDPT+
Sbjct  186  LSGAHTIGFAHCGKFSKRIYNFSPKRPIDPTLNIRYALQLRQMCPIRVDLRIAINMDPTS  245

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            PNTFDNAYFKNLQ+G GLF SDQVLF+D RSR+TVN FAS+ A F+QAF +A+TKLGR+G
Sbjct  246  PNTFDNAYFKNLQKGMGLFTSDQVLFSDERSRSTVNSFASSEATFRQAFISAITKLGRVG  305

Query  65   VLTGNLGEIRRDCTRPN  15
            V TGN GEIRRDC+R N
Sbjct  306  VKTGNAGEIRRDCSRVN  322



>ref|XP_008223743.1| PREDICTED: peroxidase 16 [Prunus mume]
Length=326

 Score =   473 bits (1217),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 272/328 (83%), Gaps = 3/328 (1%)
 Frame = -2

Query  998  QRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPA  819
            + ++ +V+SA ++     L+ +A AQLRTNFY+ TCPNVESLV SAV+ KF+QTFVTAPA
Sbjct  2    EARSCIVLSAFLIP---FLLGTACAQLRTNFYQGTCPNVESLVTSAVKTKFQQTFVTAPA  58

Query  818  TLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRN  639
            TLRLFFHDCFVRGCDASVL+ SP  +AEKDHPDNLSLAGDGFDTVIKAKAAVDS+P CRN
Sbjct  59   TLRLFFHDCFVRGCDASVLVQSPTNQAEKDHPDNLSLAGDGFDTVIKAKAAVDSDPNCRN  118

Query  638  KVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFG  459
            KVSCADILALATRDV+       Y VELGRRDGR+ST+ SVQR LP   F LDQLN+MF 
Sbjct  119  KVSCADILALATRDVLLTVQSPSYTVELGRRDGRVSTIASVQRRLPHPTFNLDQLNTMFS  178

Query  458  RHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVD  279
             HGLTQTDMIALSGAHT+GFSHC + + RIY F P   IDPTLN  YA QLRQMCP+ VD
Sbjct  179  SHGLTQTDMIALSGAHTLGFSHCNRFSNRIYNFSPAKRIDPTLNSAYALQLRQMCPINVD  238

Query  278  PRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqaf  99
            PRIAINMDPTTP TFDN YF+NLQQGKGLF SDQ+LFTD RS+ T+N FAS+NAAF QAF
Sbjct  239  PRIAINMDPTTPRTFDNVYFQNLQQGKGLFTSDQILFTDTRSQATINTFASSNAAFNQAF  298

Query  98   aaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
              AMTKLGR+GVLTGN GEIR DCTRPN
Sbjct  299  VQAMTKLGRVGVLTGNQGEIRSDCTRPN  326



>emb|CDX72214.1| BnaC07g42360D [Brassica napus]
Length=325

 Score =   473 bits (1216),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 239/329 (73%), Positives = 276/329 (84%), Gaps = 5/329 (2%)
 Frame = -2

Query  1001  HQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAP  822
              ++ N  + S  I   L+L  S   AQLRT FY+N+CPNVES+VR+AV+QKF+QTFVTAP
Sbjct  2     EKKTNQTIFS--IFSLLLLFSSCVSAQLRTGFYQNSCPNVESIVRNAVRQKFQQTFVTAP  59

Query  821   ATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCR  642
             ATLRLFFHDCFV+GCDAS+L+ASP   +EKDHPD++SLAGDGFDTV+KAK AVD +P+CR
Sbjct  60    ATLRLFFHDCFVQGCDASILIASP---SEKDHPDDMSLAGDGFDTVVKAKQAVDRDPKCR  116

Query  641   NKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMF  462
             NKVSCADILALATR+VV L GG  YPVELGRRDGR+ST  SVQ NLP  GF L+QLN+MF
Sbjct  117   NKVSCADILALATREVVVLTGGPSYPVELGRRDGRLSTKASVQNNLPQPGFNLNQLNTMF  176

Query  461   GRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRV  282
              RHGL+QTDMIALSGAHT+GF+HC + + RIY F PR+ IDP+LN  YA QLRQMCP RV
Sbjct  177   NRHGLSQTDMIALSGAHTLGFAHCGKFSNRIYNFSPRTRIDPSLNSGYALQLRQMCPQRV  236

Query  281   DPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqa  102
             DPRIAINMDPTTP TFDNAYFKNLQQGKGLF SDQVLFTD RSR TVN FA++  AF+QA
Sbjct  237   DPRIAINMDPTTPRTFDNAYFKNLQQGKGLFTSDQVLFTDQRSRATVNSFANSETAFRQA  296

Query  101   faaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             F +A+TKLGR+GV TGN GEIRRDC+R N
Sbjct  297   FVSAITKLGRVGVKTGNAGEIRRDCSRFN  325



>gb|ADD54643.1| peroxidase [Bruguiera gymnorhiza]
Length=328

 Score =   472 bits (1215),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/303 (80%), Positives = 265/303 (87%), Gaps = 0/303 (0%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPNG  744
            +L  NFY+NTCPNVESLVRSAVQ+KF+QT VTAP TLRLFFHDC VRGCDASVLL SP  
Sbjct  26   KLSRNFYRNTCPNVESLVRSAVQKKFQQTIVTAPGTLRLFFHDCIVRGCDASVLLVSPTH  85

Query  743  KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFYP  564
            KAE+DHPD+LSLAGDGFDTVIKAKAAVD +P+CRNKVSCADILALA RDVVSL GG FY 
Sbjct  86   KAERDHPDDLSLAGDGFDTVIKAKAAVDRDPRCRNKVSCADILALAARDVVSLTGGPFYQ  145

Query  563  VELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQ  384
            VELGRRDGRIST+ SVQ ++P  GF LDQLNS+F RHGL+QTDMIALSGAHTIGFSHC +
Sbjct  146  VELGRRDGRISTIASVQHSIPEPGFNLDQLNSLFRRHGLSQTDMIALSGAHTIGFSHCGR  205

Query  383  VAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQ  204
             +KRIY F PRS IDPTL+ +YA QLRQMCP+ VDPRIAINMDP+TP  FDNAY+KNLQQ
Sbjct  206  FSKRIYNFSPRSRIDPTLSRQYAMQLRQMCPINVDPRIAINMDPSTPQRFDNAYYKNLQQ  265

Query  203  GKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDCT  24
            GKGLF SDQVLF+D RSR TVN FASNNAAFQ AF AAMTKLGR+GVLTG  GEIRRDC+
Sbjct  266  GKGLFSSDQVLFSDRRSRATVNLFASNNAAFQNAFVAAMTKLGRVGVLTGRRGEIRRDCS  325

Query  23   RPN  15
            R N
Sbjct  326  RIN  328



>gb|AFK40484.1| unknown [Lotus japonicus]
Length=327

 Score =   471 bits (1212),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 235/310 (76%), Positives = 265/310 (85%), Gaps = 0/310 (0%)
 Frame = -2

Query  944  LVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASV  765
            + +++ AQL   FY N CPNVE LVRSAVQQKF+QTFVTAPATLRLFFHDC VRGCDASV
Sbjct  18   ITTTSSAQLTRGFYNNICPNVEQLVRSAVQQKFQQTFVTAPATLRLFFHDCLVRGCDASV  77

Query  764  LLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            LL+SPN  AEKDHPD++SLAGDGFDTV+KAKAAVD + +CRNKVSCADILALATRDVV+L
Sbjct  78   LLSSPNNNAEKDHPDDISLAGDGFDTVVKAKAAVDRDARCRNKVSCADILALATRDVVNL  137

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGGAFY VELGRRDGR+ST  SVQR LPG  F  +QLN++  + GL+Q DM+ALSGAHTI
Sbjct  138  AGGAFYNVELGRRDGRVSTKASVQRQLPGPDFNFNQLNAIVSKIGLSQKDMVALSGAHTI  197

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GFSHC + +KRIYRF PR+ +DPTLNL+YAFQLRQMCPL+VDPRIAINMDP TP  FDN 
Sbjct  198  GFSHCSRFSKRIYRFSPRNTVDPTLNLQYAFQLRQMCPLKVDPRIAINMDPVTPRKFDNQ  257

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y+KNLQQGKGLF SDQVLFTD R++ TVN FAS+  AFQ AFA AMTKLGR GV TGN G
Sbjct  258  YYKNLQQGKGLFTSDQVLFTDARTKPTVNLFASSEQAFQSAFADAMTKLGRFGVKTGNQG  317

Query  44   EIRRDCTRPN  15
            EIR DC+RPN
Sbjct  318  EIRIDCSRPN  327



>ref|XP_002884180.1| hypothetical protein ARALYDRAFT_900345 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60439.1| hypothetical protein ARALYDRAFT_900345 [Arabidopsis lyrata subsp. 
lyrata]
Length=323

 Score =   471 bits (1211),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 277/331 (84%), Gaps = 8/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             M++Q   S+V      + L+L  SS  AQL+TNFY+ +CPNVE++VR+ V+QKF+QTFVT
Sbjct  1     MKYQGSFSIVA-----LFLILFSSSVFAQLQTNFYRKSCPNVETIVRNPVRQKFQQTFVT  55

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APA LRLFFHDCFVRGCDAS+LLASP   +EKDHPD+ SLAGDGFDTV KAK AVD +P 
Sbjct  56    APAILRLFFHDCFVRGCDASILLASP---SEKDHPDDKSLAGDGFDTVAKAKQAVDRDPN  112

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATRDVV L GG  YPVELGRRDGR+ST+ SVQ +LP   FKLDQLN+
Sbjct  113   CRNKVSCADILALATRDVVVLTGGPNYPVELGRRDGRLSTIASVQHSLPQPSFKLDQLNT  172

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF RHGL+QTDMIALSGAHTIGF+HC + +KRIY F P+  IDPTLN +YA QLRQMCP+
Sbjct  173   MFARHGLSQTDMIALSGAHTIGFAHCGRFSKRIYNFSPKRPIDPTLNTQYALQLRQMCPI  232

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             RVDPRIAINMDPT+PNTFDNAYFKNLQ+G GLF SDQVLF+D RSR+TVN FASN A F+
Sbjct  233   RVDPRIAINMDPTSPNTFDNAYFKNLQKGMGLFTSDQVLFSDQRSRSTVNSFASNEATFR  292

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAF  A+TKLGR+GV TGN GEIRRDC+R N
Sbjct  293   QAFILAITKLGRVGVKTGNAGEIRRDCSRVN  323



>ref|XP_003546418.1| PREDICTED: peroxidase 16 [Glycine max]
Length=328

 Score =   471 bits (1211),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 239/307 (78%), Positives = 258/307 (84%), Gaps = 0/307 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            ++ AQL   FY NTCPNVE LVRSAV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA
Sbjct  22   TSSAQLTRGFYLNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDCFVRGCDASILLA  81

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
            SPN KAEKDHPD++SLAGDGFDTV KAKAAVDS+PQCRNKVSCADILALATRDV++LAGG
Sbjct  82   SPNNKAEKDHPDDISLAGDGFDTVAKAKAAVDSDPQCRNKVSCADILALATRDVINLAGG  141

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
             FY VELGRRDGRIST+ SVQR LP   F LD+LNSMF  HGLTQTDMIALSGAHTIGFS
Sbjct  142  PFYKVELGRRDGRISTIASVQRQLPHPDFNLDKLNSMFSFHGLTQTDMIALSGAHTIGFS  201

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC   ++RIY F P+  IDPTLNL YAFQLRQ CPLRVD RIAINMDP TP  FDN YFK
Sbjct  202  HCNHFSRRIYNFSPKKLIDPTLNLHYAFQLRQSCPLRVDSRIAINMDPVTPQKFDNQYFK  261

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQG GLF SDQVL TD RSR T+N FASN  AF  AF  A+TK+GRIGV TG  GEIR
Sbjct  262  NLQQGMGLFTSDQVLATDERSRGTINLFASNEQAFYNAFIEAITKMGRIGVKTGRQGEIR  321

Query  35   RDCTRPN  15
             DC+R N
Sbjct  322  FDCSRVN  328



>emb|CDY28166.1| BnaA01g06830D [Brassica napus]
Length=324

 Score =   470 bits (1209),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 236/316 (75%), Positives = 273/316 (86%), Gaps = 3/316 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            +  L+L  S   AQLRT FY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVR
Sbjct  12   IFSLLLFSSCVSAQLRTGFYQRSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVR  71

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDAS+LLASP   +E+DHPD++SLAGDGFDTV+KAK AVD +P CRNKVSCADILALAT
Sbjct  72   GCDASILLASP---SERDHPDDMSLAGDGFDTVVKAKQAVDRDPNCRNKVSCADILALAT  128

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            R+VV L GG  YPVELGRRDGR+ST  SVQ +LP  GF L+QLN+MF RHGL+QTDMIAL
Sbjct  129  REVVVLTGGPSYPVELGRRDGRLSTKASVQHSLPQPGFNLNQLNTMFNRHGLSQTDMIAL  188

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHTIGF+HC + +KRIY F PR+ IDP+LN  YAFQLRQMCP+RVDPRIAINMDPT+P
Sbjct  189  SGAHTIGFAHCGKFSKRIYNFSPRTPIDPSLNRGYAFQLRQMCPIRVDPRIAINMDPTSP  248

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDNAYFKNLQQG+GLF SDQVLFTD RSR TVN FA++ AAF+QAF +A+TKLGR+GV
Sbjct  249  RTFDNAYFKNLQQGRGLFTSDQVLFTDRRSRATVNMFANSEAAFRQAFISAITKLGRVGV  308

Query  62   LTGNLGEIRRDCTRPN  15
             TGN GEIRRDC+R N
Sbjct  309  KTGNAGEIRRDCSRVN  324



>gb|KHN15314.1| Peroxidase 16 [Glycine soja]
Length=328

 Score =   470 bits (1209),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 239/307 (78%), Positives = 257/307 (84%), Gaps = 0/307 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            ++  QL   FY NTCPNVE LVRSAV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA
Sbjct  22   TSSGQLTRGFYLNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDCFVRGCDASILLA  81

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
            SPN KAEKDHPD++SLAGDGFDTV KAKAAVDS+PQCRNKVSCADILALATRDV++LAGG
Sbjct  82   SPNNKAEKDHPDDISLAGDGFDTVAKAKAAVDSDPQCRNKVSCADILALATRDVINLAGG  141

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
             FY VELGRRDGRIST+ SVQR LP   F LD+LNSMF  HGLTQTDMIALSGAHTIGFS
Sbjct  142  PFYEVELGRRDGRISTIASVQRQLPHPDFNLDKLNSMFSFHGLTQTDMIALSGAHTIGFS  201

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC   ++RIY F P+  IDPTLNL YAFQLRQ CPLRVD RIAINMDP TP  FDN YFK
Sbjct  202  HCNHFSRRIYNFSPKKLIDPTLNLHYAFQLRQSCPLRVDSRIAINMDPVTPQKFDNQYFK  261

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQG GLF SDQVL TD RSR TVN FASN  AF  AF  A+TK+GRIGV TG  GEIR
Sbjct  262  NLQQGMGLFTSDQVLATDERSRGTVNLFASNEQAFYNAFIEAITKMGRIGVKTGRQGEIR  321

Query  35   RDCTRPN  15
             DC+R N
Sbjct  322  FDCSRVN  328



>gb|KFK29573.1| peroxidase atp8a [Arabis alpina]
Length=326

 Score =   469 bits (1208),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/331 (73%), Positives = 274/331 (83%), Gaps = 5/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME    N  + S  I    +L  S   AQLRT FY N+CPNVE++VR AV+QKF+QTFVT
Sbjct  1     MEKMTNNQTIFS--IFSLFLLFSSCVTAQLRTGFYGNSCPNVETIVRDAVRQKFQQTFVT  58

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFVRGCDAS+L+ASP   AEKDHPD++SLAGDGFDTV+KAK AVD  P 
Sbjct  59    APATLRLFFHDCFVRGCDASILIASP---AEKDHPDDISLAGDGFDTVVKAKQAVDRIPN  115

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             CRNKVSCADILALATR+VV L GG  YPVELGR+DGR+ST  SVQ NLP  GF L+QLN+
Sbjct  116   CRNKVSCADILALATREVVVLTGGPSYPVELGRKDGRVSTQASVQNNLPQPGFNLNQLNT  175

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF RHGL+QTDMIALSGAHT+GF+HC + +KRIY F P + IDP+LN +YA QLRQMCP+
Sbjct  176   MFNRHGLSQTDMIALSGAHTLGFAHCGKFSKRIYSFSPTTRIDPSLNGQYALQLRQMCPI  235

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
              VDPRIAINMDPT+P TFDNAYFKNLQQGKGLF SDQVLFTD RSR+TVN FA+N  AF+
Sbjct  236   GVDPRIAINMDPTSPRTFDNAYFKNLQQGKGLFTSDQVLFTDQRSRSTVNLFANNEGAFR  295

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             QAF +A+TKLGR+GVLTGN GEIRRDC+R N
Sbjct  296   QAFISAITKLGRVGVLTGNAGEIRRDCSRFN  326



>ref|XP_002268127.1| PREDICTED: peroxidase 16 [Vitis vinifera]
 emb|CBI17859.3| unnamed protein product [Vitis vinifera]
Length=326

 Score =   469 bits (1208),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/306 (78%), Positives = 263/306 (86%), Gaps = 0/306 (0%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            A AQLR +FYK+TCPNVESLVRSAVQ+KF QTFVTAPATLRLFFHDCFVRGCDASV+LAS
Sbjct  21   ASAQLRQDFYKDTCPNVESLVRSAVQKKFLQTFVTAPATLRLFFHDCFVRGCDASVMLAS  80

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
            PNG+AEKDH D++SLAGDGFDTVIKAKAAVDS+P+C NKVSCADILALATRDVV+LAGG 
Sbjct  81   PNGRAEKDHGDDISLAGDGFDTVIKAKAAVDSDPKCTNKVSCADILALATRDVVALAGGP  140

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
             Y VELGRRDGRIST  SVQ  LP   F LDQLN+MF  HGLTQ DMIALSGAHTIGFSH
Sbjct  141  SYKVELGRRDGRISTKASVQHKLPHPDFSLDQLNTMFSSHGLTQKDMIALSGAHTIGFSH  200

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C +  KRIYRF  ++ IDPTLN  YA QLRQMCP RVDPR+AINMDPTTP TFDNAYF+N
Sbjct  201  CSRFFKRIYRFSNQNRIDPTLNATYALQLRQMCPTRVDPRVAINMDPTTPQTFDNAYFQN  260

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            LQ+G GLF SDQ LFTD RSR TVN FA++NAAF +AF +A+TKLGR+GV TGN GEIR 
Sbjct  261  LQKGMGLFTSDQALFTDTRSRPTVNQFAASNAAFGRAFVSAITKLGRVGVKTGNQGEIRH  320

Query  32   DCTRPN  15
            DCT  N
Sbjct  321  DCTSVN  326



>ref|XP_003610076.1| Peroxidase [Medicago truncatula]
 gb|AES92273.1| class III peroxidase [Medicago truncatula]
 gb|AFK49625.1| unknown [Medicago truncatula]
Length=323

 Score =   468 bits (1203),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 235/303 (78%), Positives = 263/303 (87%), Gaps = 2/303 (1%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPNG  744
            QL   FY N CPNVE LVRSAV QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA+P  
Sbjct  23   QLTRGFYNNVCPNVEQLVRSAVNQKFQQTFVTAPATLRLFFHDCFVRGCDASILLATP--  80

Query  743  KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFYP  564
            KAE++HPD++SLAGDGFDTV+KAKAAVD +P+CRNKVSCADILALATRDVV+LAGG FY 
Sbjct  81   KAEREHPDDISLAGDGFDTVVKAKAAVDRDPKCRNKVSCADILALATRDVVNLAGGPFYN  140

Query  563  VELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQ  384
            VELGRRDGR+ST+ SVQR+LPG  F L+QLN+MF  HGL+QTDM+ALSGAHTIGFSHC +
Sbjct  141  VELGRRDGRVSTIASVQRSLPGPHFNLNQLNNMFNLHGLSQTDMVALSGAHTIGFSHCNR  200

Query  383  VAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQ  204
             + RIY F PRS IDP+LNL+YAFQLRQMCP+RVDPRIAINMDP +P  FDN YFKNLQQ
Sbjct  201  FSNRIYGFSPRSRIDPSLNLQYAFQLRQMCPIRVDPRIAINMDPVSPQKFDNQYFKNLQQ  260

Query  203  GKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDCT  24
            GKGLF SDQVLFTD RS+ TVN FASN  AF+ AF  A+TKLGR+GV TGN GEIR DCT
Sbjct  261  GKGLFTSDQVLFTDSRSKATVNLFASNPKAFESAFINAITKLGRVGVKTGNQGEIRFDCT  320

Query  23   RPN  15
            RPN
Sbjct  321  RPN  323



>ref|XP_009128021.1| PREDICTED: peroxidase 45 [Brassica rapa]
Length=324

 Score =   467 bits (1202),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 235/316 (74%), Positives = 272/316 (86%), Gaps = 3/316 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            +  L+L  S   AQLRT FY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVR
Sbjct  12   IFSLLLFSSCVSAQLRTGFYQRSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVR  71

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDAS+LLASP   +E+DHPD++SLAGDGFDTV+KAK AVD +P CR KVSCADILALAT
Sbjct  72   GCDASILLASP---SERDHPDDMSLAGDGFDTVVKAKQAVDRDPNCRKKVSCADILALAT  128

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            R+VV L GG  YPVELGRRDGR+ST  SVQ +LP  GF L+QLN+MF RHGL+QTDMIAL
Sbjct  129  REVVVLTGGPSYPVELGRRDGRLSTKASVQHSLPQPGFNLNQLNTMFNRHGLSQTDMIAL  188

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHTIGF+HC + +KRIY F PR+ IDP+LN  YAFQLRQMCP+RVDPRIAINMDPT+P
Sbjct  189  SGAHTIGFAHCGKFSKRIYNFSPRTPIDPSLNRGYAFQLRQMCPIRVDPRIAINMDPTSP  248

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDNAYFKNLQQG+GLF SDQVLFTD RSR TVN FA++ AAF+QAF +A+TKLGR+GV
Sbjct  249  RTFDNAYFKNLQQGRGLFTSDQVLFTDRRSRATVNMFANSEAAFRQAFISAITKLGRVGV  308

Query  62   LTGNLGEIRRDCTRPN  15
             TGN GEIRRDC+R N
Sbjct  309  KTGNAGEIRRDCSRVN  324



>gb|AAX84669.1| secretory peroxidase PX3 [Manihot esculenta]
Length=355

 Score =   468 bits (1203),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 239/302 (79%), Positives = 260/302 (86%), Gaps = 0/302 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL  NFY  TCPNVES+VRS VQ+KF+QTFVT PATLRLF HDCFVRGCDAS+LL+SP+
Sbjct  25   AQLSKNFYSGTCPNVESIVRSEVQKKFQQTFVTVPATLRLFAHDCFVRGCDASLLLSSPS  84

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              AEKDHPDNLSLAGDGFDTVIKAKAAVDS  QCRNKVSCADILALATRDVVSLAGG FY
Sbjct  85   NNAEKDHPDNLSLAGDGFDTVIKAKAAVDSVSQCRNKVSCADILALATRDVVSLAGGPFY  144

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDGRIST  SVQ  LP A F LDQLNSMF   GLTQTDMIALSGAHT+GFSHC 
Sbjct  145  EVELGRRDGRISTKASVQHKLPSADFNLDQLNSMFASLGLTQTDMIALSGAHTLGFSHCN  204

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR+ IDPTLNL+YA QLR+MCP++VDPRIAI+MDPTTP  FDNAY+ NL 
Sbjct  205  RFSKRIYNFSPRNKIDPTLNLQYALQLREMCPVKVDPRIAIDMDPTTPQKFDNAYYGNLI  264

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF +DQ+LF+D RSR TVN FASNNAAFQ AF +AMT LGR+GVLTGN GEIR DC
Sbjct  265  QGKGLFTADQILFSDSRSRPTVNLFASNNAAFQNAFVSAMTNLGRVGVLTGNKGEIRTDC  324

Query  26   TR  21
            TR
Sbjct  325  TR  326



>ref|XP_004507879.1| PREDICTED: peroxidase 16-like [Cicer arietinum]
Length=326

 Score =   464 bits (1194),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/304 (77%), Positives = 260/304 (86%), Gaps = 2/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL   FY N CPNVE LVRSAV QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA  N
Sbjct  25   AQLTRGFYNNICPNVEQLVRSAVNQKFQQTFVTAPATLRLFFHDCFVRGCDASILLA--N  82

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
             KAEKDHPD+++LAGDGFDTVIKAKAAVD + +CRNKVSCADILALATRDVV+LAGG FY
Sbjct  83   NKAEKDHPDDITLAGDGFDTVIKAKAAVDRDSRCRNKVSCADILALATRDVVNLAGGPFY  142

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDGRIST+ SVQR+LP   F L+QLNSMF  HGL+QTD++ALSGAHTIGFSHC 
Sbjct  143  NVELGRRDGRISTMASVQRSLPAPHFNLNQLNSMFSIHGLSQTDLVALSGAHTIGFSHCN  202

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + + RIY+F  RS IDP+LNL+YAFQLRQMCPL+VDPRIAINMDP TP  FDN YFKNL 
Sbjct  203  RFSNRIYKFSQRSRIDPSLNLQYAFQLRQMCPLKVDPRIAINMDPITPQKFDNQYFKNLL  262

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF SDQVLFTD RSR+TV  FASN  AF+ AF  A+TKLG++GV TGN GEIR DC
Sbjct  263  QGKGLFTSDQVLFTDSRSRDTVKLFASNEKAFESAFIDAITKLGKVGVKTGNQGEIRIDC  322

Query  26   TRPN  15
            TRPN
Sbjct  323  TRPN  326



>ref|XP_010433020.1| PREDICTED: peroxidase 45-like [Camelina sativa]
Length=325

 Score =   464 bits (1194),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 229/304 (75%), Positives = 267/304 (88%), Gaps = 3/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLRT FY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS++LASP 
Sbjct  25   AQLRTGFYQRSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMLASP-  83

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +E+DHPD++SLAGDGFDTVIKAK AV+ +P CRNKVSCADILALATR+VV L GG  Y
Sbjct  84   --SERDHPDDMSLAGDGFDTVIKAKQAVERDPNCRNKVSCADILALATREVVVLTGGPSY  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
            PVELGRRDGR+ST+ SVQ+ LP  GF L+QLNSMF RHGL+QTDMIALSGAHTIGF+HC 
Sbjct  142  PVELGRRDGRLSTVASVQKQLPQPGFNLNQLNSMFSRHGLSQTDMIALSGAHTIGFAHCG  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR+ IDP++N +YA QLRQMCP+ VDPRIAINMDP +P TFDNAYFKNLQ
Sbjct  202  KFSKRIYNFSPRTRIDPSINGQYALQLRQMCPIGVDPRIAINMDPVSPRTFDNAYFKNLQ  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QG+GLF SDQVLFTD RSR TVN FA++  AF+QAF +A+TKLGR+GV+TGN GEIRRDC
Sbjct  262  QGRGLFTSDQVLFTDQRSRATVNSFANSEGAFRQAFISAITKLGRVGVMTGNAGEIRRDC  321

Query  26   TRPN  15
            TR N
Sbjct  322  TRVN  325



>ref|XP_006284105.1| hypothetical protein CARUB_v10005239mg [Capsella rubella]
 gb|EOA17003.1| hypothetical protein CARUB_v10005239mg [Capsella rubella]
Length=325

 Score =   464 bits (1194),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 229/304 (75%), Positives = 266/304 (88%), Gaps = 3/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLRT FY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+++ASP 
Sbjct  25   AQLRTGFYQRSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMIASP-  83

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +E+DHPD++SLAGDGFDTVIKAK AV+ +P CRNKVSCADILALATR+VV L GG  Y
Sbjct  84   --SERDHPDDMSLAGDGFDTVIKAKQAVERDPNCRNKVSCADILALATREVVVLTGGPSY  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
            PVELGRRDGR+S+  SVQ  LP  GF L+QLNSMF RHGL+QTDMIALSGAHTIGF+HC 
Sbjct  142  PVELGRRDGRLSSQASVQNQLPQPGFNLNQLNSMFSRHGLSQTDMIALSGAHTIGFAHCG  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR+ IDP++N RYA QLRQMCP+RVDPRIAINMDP +P TFDNAYFKNLQ
Sbjct  202  KFSKRIYNFSPRTRIDPSINSRYALQLRQMCPIRVDPRIAINMDPVSPRTFDNAYFKNLQ  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QG GLF SDQVLFTD RSR+TVN FA++  AF+QAF +A+TKLGR+GVLTGN GEIRRDC
Sbjct  262  QGMGLFTSDQVLFTDQRSRSTVNTFANSEGAFRQAFISAITKLGRVGVLTGNAGEIRRDC  321

Query  26   TRPN  15
            +R N
Sbjct  322  SRVN  325



>ref|XP_007154738.1| hypothetical protein PHAVU_003G143400g [Phaseolus vulgaris]
 gb|ESW26732.1| hypothetical protein PHAVU_003G143400g [Phaseolus vulgaris]
Length=324

 Score =   463 bits (1191),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 237/304 (78%), Positives = 261/304 (86%), Gaps = 2/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL  +FYKN CPNVE LVRSAV QKF+QTFVTAPATLRLFFHDCFVRGCD S++LA  N
Sbjct  23   AQLTRSFYKNVCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDCFVRGCDGSIMLA--N  80

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +EKDHPD++SLAGDGFDTVIKAKAAVD +P+CRNKVSCADILALATRDVV+LAGG  Y
Sbjct  81   SNSEKDHPDDISLAGDGFDTVIKAKAAVDKDPKCRNKVSCADILALATRDVVNLAGGPSY  140

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDGRIST+ SVQR+LP   F LDQLNSMF  +GL+Q DMIALSGAHTIGFSHC 
Sbjct  141  DVELGRRDGRISTIASVQRHLPHPEFNLDQLNSMFNVNGLSQIDMIALSGAHTIGFSHCN  200

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR  IDPTLNL+YAFQLRQMCPL+VDPRIAI+MDP +P  FDN YFKNLQ
Sbjct  201  RFSKRIYNFSPRGRIDPTLNLQYAFQLRQMCPLKVDPRIAIDMDPVSPQKFDNQYFKNLQ  260

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF SDQVLFTD RS+ TVN FASN  AFQ+AF  A+TKLGR+GV TGN GEIR DC
Sbjct  261  QGKGLFTSDQVLFTDARSKATVNLFASNEGAFQKAFVDAITKLGRVGVKTGNQGEIRFDC  320

Query  26   TRPN  15
            TRPN
Sbjct  321  TRPN  324



>ref|XP_010094192.1| Peroxidase 45 [Morus notabilis]
 gb|EXB55368.1| Peroxidase 45 [Morus notabilis]
Length=332

 Score =   463 bits (1192),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 238/329 (72%), Positives = 271/329 (82%), Gaps = 2/329 (1%)
 Frame = -2

Query  995  RKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPAT  816
            R  +++V A + V  VL ++   AQL T+FYKNTCPNVES+V   V  KF+QTFVTAPAT
Sbjct  4    RSFNILVLALLTVPFVLAMTGVQAQLSTDFYKNTCPNVESIVSQVVANKFQQTFVTAPAT  63

Query  815  LRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNK  636
            LRL FHDCFVRGCDASV+LASP+ KAEKDHPDNLSLAGDGFDTVIKAKAA+D + +C+N+
Sbjct  64   LRLLFHDCFVRGCDASVMLASPDSKAEKDHPDNLSLAGDGFDTVIKAKAALDQDARCKNQ  123

Query  635  VSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGR  456
            VSCADILALATRDVV L GG  Y VELGRRD RIST++SVQR+LP   F LDQLNSMF  
Sbjct  124  VSCADILALATRDVVVLTGGPNYTVELGRRDVRISTISSVQRHLPKPEFNLDQLNSMFAA  183

Query  455  HGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQP--RSWIDPTLNLRYAFQLRQMCPLRV  282
            +GLTQ DMIALSGAHT+GFSHC + +KRIY F P  ++ IDP LN +YA QLRQMCPL+V
Sbjct  184  NGLTQRDMIALSGAHTLGFSHCSKFSKRIYNFSPGTKTTIDPALNRKYALQLRQMCPLKV  243

Query  281  DPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqa  102
            DPRIAI+MDPTTP  FDNAYFKNLQQGKGL  SDQVLFTD RS+ TV+ FASN+ AF QA
Sbjct  244  DPRIAIDMDPTTPRIFDNAYFKNLQQGKGLLSSDQVLFTDQRSKATVDEFASNSTAFNQA  303

Query  101  faaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
            F  A+TKLGR+GVLTG  GEIR DCTRPN
Sbjct  304  FITAITKLGRVGVLTGRKGEIRIDCTRPN  332



>ref|XP_010525719.1| PREDICTED: peroxidase 16-like [Tarenaya hassleriana]
Length=325

 Score =   462 bits (1190),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 231/303 (76%), Positives = 264/303 (87%), Gaps = 3/303 (1%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPNG  744
            QLRT+FY+ +CPNVE+LVR+AV +KF QTFVTAPATLRLFFHDCFVRGCDAS+++ASP  
Sbjct  25   QLRTDFYRKSCPNVENLVRNAVHRKFEQTFVTAPATLRLFFHDCFVRGCDASIMIASP--  82

Query  743  KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFYP  564
             +E+DHPD LSLAGD FDTV+KAK AVDS+P CRNKVSCADILALA R+V+ L GG  YP
Sbjct  83   -SERDHPDQLSLAGDSFDTVVKAKHAVDSDPSCRNKVSCADILALAAREVIVLTGGPNYP  141

Query  563  VELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQ  384
            VELGRRDG +ST+ SVQ +LP  GF LD+LNSMF RHGL+QTDMIALSGAHTIGFSHC +
Sbjct  142  VELGRRDGTLSTVASVQHSLPQPGFNLDRLNSMFARHGLSQTDMIALSGAHTIGFSHCGK  201

Query  383  VAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQ  204
             +KRIY F PR+ IDPTLNLRYA QLRQMCP+RVDPRIAINMDPTTP TFDNAYFKNLQ+
Sbjct  202  FSKRIYDFSPRNRIDPTLNLRYALQLRQMCPVRVDPRIAINMDPTTPTTFDNAYFKNLQR  261

Query  203  GKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDCT  24
            G GLF+SDQ+LFTD RSR+TVN FASN  AF+QAF +A+TKLGR+G+ TGN GEIR DCT
Sbjct  262  GMGLFISDQILFTDRRSRSTVNLFASNEGAFRQAFVSAITKLGRVGIKTGNAGEIRSDCT  321

Query  23   RPN  15
            R N
Sbjct  322  RVN  324



>ref|XP_007138800.1| hypothetical protein PHAVU_009G238400g [Phaseolus vulgaris]
 gb|ESW10794.1| hypothetical protein PHAVU_009G238400g [Phaseolus vulgaris]
Length=328

 Score =   462 bits (1189),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 235/323 (73%), Positives = 265/323 (82%), Gaps = 1/323 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +++ +  LV  ++   ++ A+L  +FY+ TCPNVE LVRSAV+ KF+QTFVTAPATLRLF
Sbjct  7    LMIFSSFLV-FIICAETSLAELSPSFYRKTCPNVERLVRSAVELKFQQTFVTAPATLRLF  65

Query  803  FHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCA  624
            FHDCFVRGCD S+LLAS N KAEK+HPD++SLAGDGFDTV KAKAAVDS P CRNKVSCA
Sbjct  66   FHDCFVRGCDGSILLASANNKAEKNHPDDISLAGDGFDTVAKAKAAVDSEPHCRNKVSCA  125

Query  623  DILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLT  444
            DILALATRDV++LAGG FY VELGRRDGRIST+ SVQR+LP   F LD+LNSMF  +GL+
Sbjct  126  DILALATRDVINLAGGPFYRVELGRRDGRISTIASVQRHLPQTHFNLDKLNSMFASNGLS  185

Query  443  QTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAI  264
            QTDMIALSGAHTIGFSHC   +KRIY F P+  IDPTLNL+YAFQLRQ CPLRVD RIAI
Sbjct  186  QTDMIALSGAHTIGFSHCNHFSKRIYNFSPKRLIDPTLNLQYAFQLRQACPLRVDSRIAI  245

Query  263  NMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMT  84
            NMDP TP  FDN YFKNLQQGKGLF SDQVL TD RS+ TVN FASN  AF  AF  A+T
Sbjct  246  NMDPVTPQNFDNQYFKNLQQGKGLFTSDQVLATDERSKGTVNLFASNQLAFNNAFVQAIT  305

Query  83   KLGRIGVLTGNLGEIRRDCTRPN  15
            K+GRIGVLTG  GEIR DC R N
Sbjct  306  KMGRIGVLTGRQGEIRFDCFRVN  328



>ref|XP_004488001.1| PREDICTED: peroxidase 16-like [Cicer arietinum]
Length=329

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 260/313 (83%), Gaps = 0/313 (0%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            LV+    +  +L   FY NTCPNVE LVRSAV+ KF+QTFVTAPATLRLFFHDCFVRGCD
Sbjct  17   LVVCAQRSSTELTKGFYSNTCPNVEQLVRSAVELKFQQTFVTAPATLRLFFHDCFVRGCD  76

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            AS+LL SPN KAEKDHPD++SLAGDGFDTVIKAK A+DS+PQC NKVSCADILALATRDV
Sbjct  77   ASILLVSPNNKAEKDHPDDISLAGDGFDTVIKAKQAIDSDPQCTNKVSCADILALATRDV  136

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            V+L+GG FY VELGRRDGRIST+ SVQR+LP   F LDQLNSMF  +GL+Q DMIALSGA
Sbjct  137  VNLSGGPFYEVELGRRDGRISTIASVQRHLPHPQFNLDQLNSMFSFNGLSQIDMIALSGA  196

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HTIGFSHC + +KRIY F P S IDPTLNL+YAFQLRQ CPL+VDPRIAINMDP TP  F
Sbjct  197  HTIGFSHCNRFSKRIYNFSPTSRIDPTLNLQYAFQLRQACPLKVDPRIAINMDPITPQKF  256

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DN YFKNLQQG GLF SDQVL  D RS++T+N FASN  AF+ AF  A+TKLGRIGV +G
Sbjct  257  DNQYFKNLQQGMGLFTSDQVLAIDERSKDTINLFASNEVAFESAFVDAITKLGRIGVKSG  316

Query  53   NLGEIRRDCTRPN  15
            N GEIR DC+  N
Sbjct  317  NQGEIRFDCSSVN  329



>ref|XP_002869392.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45651.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score =   461 bits (1186),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 229/304 (75%), Positives = 261/304 (86%), Gaps = 3/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLRT FY+N+CPNVE +VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+++ASP 
Sbjct  25   AQLRTGFYQNSCPNVEGIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMIASP-  83

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +E+DHPD++SLAGDGFDTV+KAK AVDSNP CRNKVSCADILALATR+VV L GG  Y
Sbjct  84   --SERDHPDDMSLAGDGFDTVVKAKQAVDSNPNCRNKVSCADILALATREVVVLTGGPSY  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
            PVELGRRDGRIST +SVQ  LP  GF L+QLN MF RHGL+QTDMIALSGAHTIGF+HC 
Sbjct  142  PVELGRRDGRISTQSSVQNQLPQPGFNLNQLNGMFSRHGLSQTDMIALSGAHTIGFAHCG  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            +  KRIY F P   IDPT+N  Y  QL+QMCP+ VD RIAINMDPT+P TFDNAYFKNLQ
Sbjct  202  KFTKRIYNFSPSRRIDPTINSGYVIQLKQMCPIGVDVRIAINMDPTSPRTFDNAYFKNLQ  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF SDQ+LFTD RSR+TVN FA++  AF+QAF  A+TKLGR+GVLTGN GEIRRDC
Sbjct  262  QGKGLFSSDQILFTDQRSRSTVNTFANSEGAFRQAFITAITKLGRVGVLTGNAGEIRRDC  321

Query  26   TRPN  15
            +R N
Sbjct  322  SRAN  325



>ref|XP_010438209.1| PREDICTED: peroxidase 45-like [Camelina sativa]
Length=324

 Score =   460 bits (1184),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 228/304 (75%), Positives = 265/304 (87%), Gaps = 3/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLRT FY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS++LASP 
Sbjct  24   AQLRTGFYQRSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMLASP-  82

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +E+DHPD++SLAGDGFDTVIKAK AV+ +P CRNKVSCADILALATR+VV L GG  Y
Sbjct  83   --SERDHPDDMSLAGDGFDTVIKAKQAVERDPNCRNKVSCADILALATREVVVLTGGPSY  140

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
            PVELGRRDGR+ST  SVQ+ LP  GF L+QLNSMF RHGL+QTDMIALSGAHTIGF+HC 
Sbjct  141  PVELGRRDGRLSTKASVQKQLPQPGFNLNQLNSMFSRHGLSQTDMIALSGAHTIGFAHCG  200

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR+ IDP++N +YA QLRQMCP+ VDPRIAINMDP +P TFDNAYFKNLQ
Sbjct  201  KFSKRIYNFSPRTRIDPSINSQYALQLRQMCPIGVDPRIAINMDPVSPRTFDNAYFKNLQ  260

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QG+GLF SDQVLFTD RSR TVN FA++  AF+QAF +A+TKLGR+GV TGN GEIRRDC
Sbjct  261  QGRGLFTSDQVLFTDQRSRATVNSFANSEGAFRQAFISAITKLGRVGVKTGNAGEIRRDC  320

Query  26   TRPN  15
            +R N
Sbjct  321  SRVN  324



>ref|XP_010447758.1| PREDICTED: peroxidase 45 [Camelina sativa]
Length=325

 Score =   460 bits (1184),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 228/304 (75%), Positives = 265/304 (87%), Gaps = 3/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLRT FY+ +CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS++LASP 
Sbjct  25   AQLRTGFYQRSCPNVENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMLASP-  83

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +E+DHPD++SLAGDGFDTVIKAK AV+ +P CRNKVSCADILALATR+VV L GG  Y
Sbjct  84   --SERDHPDDMSLAGDGFDTVIKAKQAVERDPNCRNKVSCADILALATREVVVLTGGPSY  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
            PVELGRRDGR+ST+ SVQ+ LP  GF L+QLNSMF RHGL+QTDMIALSGAHTIGF+HC 
Sbjct  142  PVELGRRDGRLSTIASVQKQLPQPGFNLNQLNSMFSRHGLSQTDMIALSGAHTIGFAHCG  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR+ IDP++N  YA QLRQMCP+ VDPRIAINMDP +P TFDNAYFKNLQ
Sbjct  202  KFSKRIYNFSPRTRIDPSINSGYALQLRQMCPIGVDPRIAINMDPVSPRTFDNAYFKNLQ  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QG+GLF SDQVLFTD RSR TVN FA++  AF+QAF +A+TKLGR+GV TGN GEIRRDC
Sbjct  262  QGRGLFTSDQVLFTDQRSRATVNSFANSEGAFRQAFISAITKLGRVGVKTGNAGEIRRDC  321

Query  26   TRPN  15
            +R N
Sbjct  322  SRVN  325



>ref|NP_194746.1| peroxidase 45 [Arabidopsis thaliana]
 sp|Q96522.1|PER45_ARATH RecName: Full=Peroxidase 45; Short=Atperox P45; AltName: Full=ATP8a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK44099.1|AF370284_1 putative peroxidase ATP8a [Arabidopsis thaliana]
 emb|CAA67361.1| peroxidase ATP8a [Arabidopsis thaliana]
 emb|CAB52461.1| peroxidase ATP8a [Arabidopsis thaliana]
 emb|CAB81010.1| peroxidase ATP8a [Arabidopsis thaliana]
 gb|AAL34225.1| putative peroxidase ATP8a [Arabidopsis thaliana]
 gb|AAM62676.1| peroxidase ATP8a [Arabidopsis thaliana]
 gb|AEE85729.1| peroxidase 45 [Arabidopsis thaliana]
Length=325

 Score =   459 bits (1181),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 227/304 (75%), Positives = 263/304 (87%), Gaps = 3/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLRT FY+N+CPNVE++VR+AV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+++ASP 
Sbjct  25   AQLRTGFYQNSCPNVETIVRNAVRQKFQQTFVTAPATLRLFFHDCFVRGCDASIMIASP-  83

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +E+DHPD++SLAGDGFDTV+KAK AVDSNP CRNKVSCADILALATR+VV L GG  Y
Sbjct  84   --SERDHPDDMSLAGDGFDTVVKAKQAVDSNPNCRNKVSCADILALATREVVVLTGGPSY  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
            PVELGRRDGRIST  SVQ  LP   F L+QLN MF RHGL+QTDMIALSGAHTIGF+HC 
Sbjct  142  PVELGRRDGRISTKASVQSQLPQPEFNLNQLNGMFSRHGLSQTDMIALSGAHTIGFAHCG  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            +++KRIY F P + IDP++N  Y  QL+QMCP+ VD RIAINMDPT+P TFDNAYFKNLQ
Sbjct  202  KMSKRIYNFSPTTRIDPSINRGYVVQLKQMCPIGVDVRIAINMDPTSPRTFDNAYFKNLQ  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF SDQ+LFTD RSR+TVN FA++  AF+QAF  A+TKLGR+GVLTGN GEIRRDC
Sbjct  262  QGKGLFTSDQILFTDQRSRSTVNSFANSEGAFRQAFITAITKLGRVGVLTGNAGEIRRDC  321

Query  26   TRPN  15
            +R N
Sbjct  322  SRVN  325



>gb|AFF57838.1| peroxidase [Phaseolus vulgaris]
Length=324

 Score =   458 bits (1178),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/304 (77%), Positives = 260/304 (86%), Gaps = 2/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL  +FYKN CPNVE LVRSAV QKF+QTFVTAPATLRLFFHDCFVRGCD S++LA  N
Sbjct  23   AQLTRSFYKNVCPNVEQLVRSAVAQKFQQTFVTAPATLRLFFHDCFVRGCDGSIMLA--N  80

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +EKDHPD++SLAG GFDTVIKAKAAVD +P+CRNKVSCADILALATRDVV+LAGG  Y
Sbjct  81   SNSEKDHPDDISLAGGGFDTVIKAKAAVDKDPKCRNKVSCADILALATRDVVNLAGGPSY  140

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDGRIST+ SV+R+LP   F LDQLNSMF  +GL+Q DMIALSGAHTIGFSHC 
Sbjct  141  DVELGRRDGRISTIASVRRHLPHPEFNLDQLNSMFNVNGLSQIDMIALSGAHTIGFSHCN  200

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + +KRIY F PR  IDPTLNL+YAFQLRQMCPL+VDPRIAI+MDP +P  FDN YFKNLQ
Sbjct  201  RFSKRIYNFSPRGRIDPTLNLQYAFQLRQMCPLKVDPRIAIDMDPVSPQKFDNQYFKNLQ  260

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF SDQVLFTD RS+ TVN FASN  AFQ+AF  A+TKLGR+GV TGN GEIR DC
Sbjct  261  QGKGLFTSDQVLFTDARSKATVNLFASNEGAFQKAFVDAITKLGRVGVKTGNQGEIRFDC  320

Query  26   TRPN  15
            TRPN
Sbjct  321  TRPN  324



>ref|XP_010246527.1| PREDICTED: peroxidase 16-like [Nelumbo nucifera]
Length=326

 Score =   454 bits (1168),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 227/307 (74%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            +A AQLRT++YKN CPNVE  VR AV QKF+QTFVTAPATLRL+FHDCFVRGCDASVLLA
Sbjct  20   TASAQLRTDYYKNICPNVEQYVRDAVAQKFQQTFVTAPATLRLYFHDCFVRGCDASVLLA  79

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
            SPN KAEKDHPD+LSLAGDGFDTV+KAKAAVD +P+CR KVSCADILALA R+VV+L GG
Sbjct  80   SPNNKAEKDHPDDLSLAGDGFDTVVKAKAAVDLDPRCRFKVSCADILALAAREVVALTGG  139

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
              YPVELGR DGRIST+ SVQ +LP  GF LDQLN+MF  HGLTQTDMI+LSG HTIGFS
Sbjct  140  PRYPVELGRLDGRISTIASVQHSLPQPGFNLDQLNTMFSSHGLTQTDMISLSGGHTIGFS  199

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC + ++RIY+F P   IDPTLN  YA QLRQMCPL V+P +AI +DPT+P  FDNAYFK
Sbjct  200  HCGKFSRRIYKFSPTKRIDPTLNPAYALQLRQMCPLNVNPDVAIQLDPTSPQVFDNAYFK  259

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQ+G GL  SDQVLFTDPRS++TVN FASN  AF +AF   +TKLGR+GV TG  GEIR
Sbjct  260  NLQKGMGLLASDQVLFTDPRSKDTVNLFASNTTAFYEAFVTGITKLGRVGVKTGRQGEIR  319

Query  35   RDCTRPN  15
            RDCT  N
Sbjct  320  RDCTVVN  326



>emb|CDY66754.1| BnaCnng52220D [Brassica napus]
Length=471

 Score =   454 bits (1169),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 267/315 (85%), Gaps = 3/315 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            +  L+L  S   AQLRT FY+ +CPN+E++VR+AV+QKF+QTFVTAPATLRLFFHDCFVR
Sbjct  12   IFSLLLFSSCVSAQLRTGFYQRSCPNLENIVRNAVRQKFQQTFVTAPATLRLFFHDCFVR  71

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDAS+LLASP   +E+DHPD++SLAGDGFDTV+KAK AVD +P CRNKVSCADILALAT
Sbjct  72   GCDASILLASP---SERDHPDDMSLAGDGFDTVVKAKQAVDRDPNCRNKVSCADILALAT  128

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            R+VV L GG  YPVELGRRDGR+ST  SVQ +LP  GF L+QLN+MF RHGL+QTDMIAL
Sbjct  129  REVVVLTGGPSYPVELGRRDGRLSTKASVQHSLPQPGFNLNQLNTMFNRHGLSQTDMIAL  188

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHTIGF+HC + +KRIY F P++ IDP+LN  YAFQLRQMCP+RVDPRIAINMDPT+P
Sbjct  189  SGAHTIGFAHCGKFSKRIYSFSPKTRIDPSLNRGYAFQLRQMCPIRVDPRIAINMDPTSP  248

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDNAYFKNLQQG+GLF SDQVLFTD RSR TVN FA++  AF+QAF +A+TKLGR+GV
Sbjct  249  RTFDNAYFKNLQQGRGLFTSDQVLFTDRRSRATVNMFANSEGAFRQAFISAITKLGRVGV  308

Query  62   LTGNLGEIRRDCTRP  18
             TGN  EI +  T P
Sbjct  309  KTGNAEEIPKSKTSP  323



>emb|CAN64129.1| hypothetical protein VITISV_039161 [Vitis vinifera]
Length=379

 Score =   447 bits (1149),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 240/359 (67%), Positives = 263/359 (73%), Gaps = 53/359 (15%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            A AQLR +FYK+TCPNVESLVRSAVQ+KF QTFVTAPATLRLFFHDCFVRGCDASV+LAS
Sbjct  21   ASAQLRQDFYKDTCPNVESLVRSAVQKKFLQTFVTAPATLRLFFHDCFVRGCDASVMLAS  80

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL----  585
            PNG+AEKDH D++SLAGDGFDTVIKAKAAVDS+P+C NKVSCADILALATRDVV+L    
Sbjct  81   PNGRAEKDHGDDISLAGDGFDTVIKAKAAVDSDPKCTNKVSCADILALATRDVVALVHHL  140

Query  584  -------------------------------------------------AGGAFYPVELG  552
                                                             AGG  Y VELG
Sbjct  141  LSFISIESLIMLKAHNMVTTTIILSSPFVNDYYFYKLILVHFTLGSSLKAGGPSYKVELG  200

Query  551  RRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKR  372
            RRDGRIST  SVQ  LP   F LDQLN+MF  HGLTQ DMIALSGAHTIGFSHC +  KR
Sbjct  201  RRDGRISTKASVQHKLPHPDFSLDQLNTMFSSHGLTQKDMIALSGAHTIGFSHCSRFFKR  260

Query  371  IYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGL  192
            IYRF  ++ IDPTLN  YA QLRQMCP RVDPR+AINMDPTTP TFDNAYF+NLQ+G GL
Sbjct  261  IYRFSNQNRIDPTLNATYALQLRQMCPTRVDPRVAINMDPTTPQTFDNAYFQNLQKGMGL  320

Query  191  FVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
            F SDQ LFTD RSR TVN FA++NAAF +AF +A+TKLGR+GV TGN GEIR DCT  N
Sbjct  321  FTSDQALFTDTRSRPTVNQFAASNAAFGRAFVSAITKLGRVGVKTGNQGEIRHDCTSVN  379



>ref|NP_001241556.1| uncharacterized protein LOC100793327 precursor [Glycine max]
 gb|ACU21346.1| unknown [Glycine max]
 gb|KHN40189.1| Peroxidase 16 [Glycine soja]
Length=326

 Score =   436 bits (1122),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 263/325 (81%), Gaps = 2/325 (1%)
 Frame = -2

Query  989  NSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLR  810
            +S++  A +   L+LL+   HAQLR ++YKNTCPNVES+VRSAV++K +QTFVTAPATLR
Sbjct  4    HSLIFHANLF--LLLLIVGCHAQLRVDYYKNTCPNVESIVRSAVEKKLQQTFVTAPATLR  61

Query  809  LFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            LFFHDCFVRGCDASV+LA+ N  +EKD+P NLSLAGDGFDTVIKAKAAVDS P C+NKVS
Sbjct  62   LFFHDCFVRGCDASVMLATRNNTSEKDNPINLSLAGDGFDTVIKAKAAVDSVPGCQNKVS  121

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILALATRDV++LAGG  Y VELGR DGR+ST  SV+ +LP   FKL+QLN MF  HG
Sbjct  122  CADILALATRDVIALAGGPSYAVELGRLDGRVSTKASVRHHLPHPEFKLEQLNQMFASHG  181

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LT TD++ALSGAHTIGFSHC Q +KRIY F+ R  ID TLN  YA QL+Q+CP  VDPR+
Sbjct  182  LTLTDLVALSGAHTIGFSHCSQFSKRIYNFRRRKSIDHTLNPTYAKQLQQVCPKNVDPRL  241

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            AI+MDP TP TFDN Y+KNLQQG+GL  SDQ LFT  R+R+ VN FASNN AF+ +F +A
Sbjct  242  AIDMDPVTPRTFDNQYYKNLQQGRGLLASDQALFTHKRTRDLVNLFASNNTAFEASFVSA  301

Query  89   MTKLGRIGVLTGNLGEIRRDCTRPN  15
            M KLGRIGV TGN GEIR DCT  N
Sbjct  302  MMKLGRIGVKTGNQGEIRHDCTMIN  326



>ref|XP_009763998.1| PREDICTED: peroxidase 51-like [Nicotiana sylvestris]
Length=332

 Score =   432 bits (1111),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 220/316 (70%), Positives = 255/316 (81%), Gaps = 1/316 (0%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            V +V + + A AQL+TN+Y  TCPNVES+VR+ V QKF+QTFVT PA LRLFFHDCFV G
Sbjct  17   VGVVFMPNLAFAQLKTNYYAKTCPNVESIVRNVVNQKFQQTFVTIPAVLRLFFHDCFVEG  76

Query  779  CDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            CDASV+++S P   AEKDHPDNLSLAGDGFDTVIKAKAAVDSN +C+NKVSCADILALAT
Sbjct  77   CDASVIVSSTPGNTAEKDHPDNLSLAGDGFDTVIKAKAAVDSNSRCKNKVSCADILALAT  136

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDV+ L+GG +YPVELGR DG  S  ++V+  LP   F L+QLNSMF  HGL Q+DMIAL
Sbjct  137  RDVIQLSGGPWYPVELGRLDGFTSKASNVEGKLPKPTFNLNQLNSMFASHGLNQSDMIAL  196

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            S AH++GFSHC + AKRIY F P+S +DPTLN +YA QL+ MCP  VDPRIAINMDP TP
Sbjct  197  SAAHSVGFSHCSKFAKRIYNFSPKSPVDPTLNKQYAAQLQGMCPRNVDPRIAINMDPKTP  256

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDNAYFKNLQQG GLF SDQVL+TD RS+ TV+ +ASN+ AFQ AF +AMTKLGR+GV
Sbjct  257  RTFDNAYFKNLQQGMGLFTSDQVLYTDGRSKGTVDIWASNSKAFQNAFVSAMTKLGRVGV  316

Query  62   LTGNLGEIRRDCTRPN  15
             TG  G IR DC R N
Sbjct  317  KTGRNGNIRFDCGRFN  332



>ref|XP_007011594.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY29213.1| Peroxidase superfamily protein [Theobroma cacao]
Length=324

 Score =   432 bits (1110),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 221/306 (72%), Positives = 252/306 (82%), Gaps = 0/306 (0%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            +HA+LR ++Y+N+CP+ ES+VRSAV   F+QTFVTAPATLRLFFHDCFVRGCDASV+LAS
Sbjct  19   SHARLRVDYYQNSCPHAESIVRSAVTHMFQQTFVTAPATLRLFFHDCFVRGCDASVMLAS  78

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
             N  AEKD+PDNLSLAGDGFDTVIKAKAAVDS P+CRNKVSCADILA+ATRDV+ L GG 
Sbjct  79   WNNTAEKDNPDNLSLAGDGFDTVIKAKAAVDSVPECRNKVSCADILAMATRDVIVLTGGP  138

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
             Y VELGR DGRIS   SV+ +LPG  FKLD+L +MF  HGLT TD++ALSGAHTIGFSH
Sbjct  139  SYAVELGRLDGRISRKASVRHHLPGPDFKLDKLKAMFAPHGLTVTDLVALSGAHTIGFSH  198

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C + ++RIY F+ +S IDPTLNL YA  LRQMCP  VDPR+AI MDP TP TFDN Y+KN
Sbjct  199  CSRFSRRIYNFKSKSRIDPTLNLEYARLLRQMCPKNVDPRVAIEMDPGTPGTFDNMYYKN  258

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            LQQGKGLF SDQ LFTD  SRN VN FASNN AF++AF AA+TKLGR+GV TG  GEIR 
Sbjct  259  LQQGKGLFTSDQALFTDAMSRNIVNVFASNNTAFEEAFVAAITKLGRVGVRTGKQGEIRH  318

Query  32   DCTRPN  15
            DC   N
Sbjct  319  DCALVN  324



>ref|XP_009604475.1| PREDICTED: peroxidase 51-like [Nicotiana tomentosiformis]
Length=332

 Score =   431 bits (1108),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/316 (70%), Positives = 253/316 (80%), Gaps = 1/316 (0%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            V +VL+ + A AQL+TN+Y NTCPNVES+VR+ V QKFRQTFVT PA LRLFFHDCFV G
Sbjct  17   VGVVLMPNLASAQLKTNYYANTCPNVESIVRNVVNQKFRQTFVTIPAVLRLFFHDCFVEG  76

Query  779  CDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            CDASV+++S P   AEKDHPDNLSLAGDGFDTVIKAKAA+DSN +C+NKVSCADILALAT
Sbjct  77   CDASVIVSSTPGNTAEKDHPDNLSLAGDGFDTVIKAKAAIDSNSRCKNKVSCADILALAT  136

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDV+ L+GG  YPVELGR DG  S  ++V+  LP   F L+QLNSMF  HGL Q DMIAL
Sbjct  137  RDVIQLSGGPSYPVELGRLDGFTSKASNVEGKLPKPTFNLNQLNSMFASHGLNQNDMIAL  196

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            S AH++GFSHC + + RIY F P++ IDPTLN +YA QL+ MCP  VDPRIAINMDP TP
Sbjct  197  SAAHSVGFSHCNKFSNRIYNFSPKNPIDPTLNKQYAAQLQGMCPRNVDPRIAINMDPKTP  256

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDNAYFKNLQQG GLF SDQVL+TD RS+ TV+ +ASN+ AFQ AF  AMTKLGR+GV
Sbjct  257  RTFDNAYFKNLQQGMGLFTSDQVLYTDGRSKGTVDIWASNSKAFQNAFVTAMTKLGRVGV  316

Query  62   LTGNLGEIRRDCTRPN  15
             TG  G IR DC R N
Sbjct  317  KTGRNGNIRFDCGRFN  332



>ref|XP_006600191.1| PREDICTED: uncharacterized protein LOC100793327 isoform X1 [Glycine 
max]
Length=332

 Score =   430 bits (1106),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 263/331 (79%), Gaps = 8/331 (2%)
 Frame = -2

Query  989  NSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLR  810
            +S++  A +   L+LL+   HAQLR ++YKNTCPNVES+VRSAV++K +QTFVTAPATLR
Sbjct  4    HSLIFHANLF--LLLLIVGCHAQLRVDYYKNTCPNVESIVRSAVEKKLQQTFVTAPATLR  61

Query  809  LFFHDCFVR------GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
            LFFHDCFVR      GCDASV+LA+ N  +EKD+P NLSLAGDGFDTVIKAKAAVDS P 
Sbjct  62   LFFHDCFVRVRIVTTGCDASVMLATRNNTSEKDNPINLSLAGDGFDTVIKAKAAVDSVPG  121

Query  647  CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
            C+NKVSCADILALATRDV++LAGG  Y VELGR DGR+ST  SV+ +LP   FKL+QLN 
Sbjct  122  CQNKVSCADILALATRDVIALAGGPSYAVELGRLDGRVSTKASVRHHLPHPEFKLEQLNQ  181

Query  467  MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
            MF  HGLT TD++ALSGAHTIGFSHC Q +KRIY F+ R  ID TLN  YA QL+Q+CP 
Sbjct  182  MFASHGLTLTDLVALSGAHTIGFSHCSQFSKRIYNFRRRKSIDHTLNPTYAKQLQQVCPK  241

Query  287  RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
             VDPR+AI+MDP TP TFDN Y+KNLQQG+GL  SDQ LFT  R+R+ VN FASNN AF+
Sbjct  242  NVDPRLAIDMDPVTPRTFDNQYYKNLQQGRGLLASDQALFTHKRTRDLVNLFASNNTAFE  301

Query  107  qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             +F +AM KLGRIGV TGN GEIR DCT  N
Sbjct  302  ASFVSAMMKLGRIGVKTGNQGEIRHDCTMIN  332



>ref|XP_010246526.1| PREDICTED: peroxidase 16-like [Nelumbo nucifera]
Length=325

 Score =   429 bits (1102),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 218/331 (66%), Positives = 257/331 (78%), Gaps = 6/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             MEH R  ++ + A      + L+++A AQLRT++YK+ CPNVE  VR+AV QKF QTFVT
Sbjct  1     MEHHRLFALSILA------LTLLATASAQLRTDYYKDICPNVEQYVRTAVTQKFLQTFVT  54

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
             APATLRLFFHDCFV+GCDASVLL SP+  AE DHPD++SLAGDGFDTV KAKAAVD +P 
Sbjct  55    APATLRLFFHDCFVKGCDASVLLYSPSHNAEMDHPDDISLAGDGFDTVAKAKAAVDQDPM  114

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             C NKVSCADILALATRDV++L GG  Y VE+GR DGRIST  SVQ NLP   F LDQLN+
Sbjct  115   CTNKVSCADILALATRDVIALTGGPSYKVEVGRLDGRISTKASVQHNLPKPYFNLDQLNA  174

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             +F  HGLTQTDMIALSG HTIGF+HC +   R+Y+F   S +DPTLN  YA QL+ +CP+
Sbjct  175   LFSWHGLTQTDMIALSGGHTIGFAHCSKFMNRLYKFSRSSNLDPTLNWNYARQLQAICPM  234

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
              VD RIA+ MD  TP  FDNAY+KNLQ+G GLF SDQ L+TDPRSR+TVN FASN  AF 
Sbjct  235   NVDSRIAVQMDQATPQIFDNAYYKNLQKGMGLFTSDQSLYTDPRSRDTVNLFASNTTAFY  294

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             +AF  A+TKLGR+GV T   GEIRRDC++ N
Sbjct  295   EAFVTAITKLGRVGVKTTRQGEIRRDCSKVN  325



>ref|XP_008219934.1| PREDICTED: peroxidase 16-like [Prunus mume]
Length=327

 Score =   428 bits (1101),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 248/307 (81%), Gaps = 0/307 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            +AHAQL    Y+++CPNVE++V +AV+QKF QTFVTAPATLRLFFHDCF+RGCDAS++LA
Sbjct  21   TAHAQLHVEHYRSSCPNVEAIVHAAVKQKFEQTFVTAPATLRLFFHDCFIRGCDASIMLA  80

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
              N  AEKD+ DNLSLAGDGFDTVIKAKAAVD  PQCRNKVSCADILALATRDVV L GG
Sbjct  81   FRNNSAEKDNSDNLSLAGDGFDTVIKAKAAVDRVPQCRNKVSCADILALATRDVVRLTGG  140

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
             +Y VELGR DGRIST  SV+++LP   F+LDQLNSMF  HGL+ TD+IALSGAHTIGFS
Sbjct  141  PYYRVELGRLDGRISTKASVRQHLPHPDFRLDQLNSMFASHGLSLTDLIALSGAHTIGFS  200

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC +   RIY F+ ++ IDPT+NL YA  L+Q CP  VDPRIA+NMDPTTP  FDN Y+K
Sbjct  201  HCNKFTHRIYSFKSQNRIDPTMNLAYARHLKQECPANVDPRIAVNMDPTTPQKFDNVYYK  260

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQGKGLF SDQ LFTD RSR  VN FA++ AAF++AF AAMTKLGR GV  G  GEIR
Sbjct  261  NLQQGKGLFTSDQSLFTDARSRKIVNLFAADAAAFERAFVAAMTKLGRFGVKNGKQGEIR  320

Query  35   RDCTRPN  15
             DC   N
Sbjct  321  HDCAAVN  327



>gb|ACJ11764.1| class III peroxidase [Gossypium hirsutum]
Length=331

 Score =   427 bits (1099),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/305 (72%), Positives = 251/305 (82%), Gaps = 1/305 (0%)
 Frame = -2

Query  938  SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLL  759
            S +HAQL   +Y N CP VES+V+SAV+QK  QTFVTAPATLRLFFHDCFVRGCDASV+L
Sbjct  20   SPSHAQLGVGYYHNLCPGVESIVKSAVKQKLEQTFVTAPATLRLFFHDCFVRGCDASVML  79

Query  758  ASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            AS  N  AEKD+ DNLSLAGDGFDTV+KAKAAVDS PQCRNKVSCADILALATRDV++L 
Sbjct  80   ASSWNKSAEKDNTDNLSLAGDGFDTVMKAKAAVDSVPQCRNKVSCADILALATRDVIALT  139

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  Y VELGR DGRIST  SV+ +LP   FKL +L +MF  HGLT TD++ALSGAHTIG
Sbjct  140  GGPSYAVELGRLDGRISTRASVRHHLPHPDFKLGKLKAMFASHGLTLTDLVALSGAHTIG  199

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + +KRIY+F+ +S IDPTLNLRYA QL+QMCP  VDPR+AI MDP+TP  FDN Y
Sbjct  200  FSHCSRFSKRIYKFKSKSRIDPTLNLRYARQLQQMCPENVDPRMAIEMDPSTPRIFDNMY  259

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            + NLQQGKGLF SDQ LFT+ RSRN VN FASN+ AF++AF AA+TKLGRIGV TG  GE
Sbjct  260  YINLQQGKGLFTSDQSLFTNARSRNIVNLFASNSTAFEEAFVAAITKLGRIGVKTGKQGE  319

Query  41   IRRDC  27
            IR DC
Sbjct  320  IRNDC  324



>gb|KDP32054.1| hypothetical protein JCGZ_12515 [Jatropha curcas]
Length=328

 Score =   427 bits (1097),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/301 (72%), Positives = 249/301 (83%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQLR N+Y N CPNVES+VR+AVQ+KF+QTFVT P T+RLFFHDCFV+GCDASV++ S P
Sbjct  24   AQLRRNYYANICPNVESIVRNAVQKKFQQTFVTVPGTIRLFFHDCFVQGCDASVIIQSTP  83

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKD+PDNLSLAGDGFDTVIKAKAAVD+ P CRNKVSCADILA+ATRD ++L+GG  
Sbjct  84   NNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPSCRNKVSCADILAMATRDAIALSGGPS  143

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST +SV   LP   F L+QLNS+F  HGL+QTDMIALSGAHT+GFSHC
Sbjct  144  YAVELGRLDGLSSTASSVNGKLPQPTFNLNQLNSLFASHGLSQTDMIALSGAHTVGFSHC  203

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY F  ++ +DPTLN  YA QL+ MCP  VDPRIAINMDP TPNTFDN YFKNL
Sbjct  204  NKFANRIYNFTRQNPVDPTLNKVYATQLQDMCPRNVDPRIAINMDPATPNTFDNVYFKNL  263

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQG+GLF SDQVLF DPRSR TVN +A N+AAFQ+AF AA+TKLGR+GV TG  G IRRD
Sbjct  264  QQGQGLFTSDQVLFADPRSRPTVNAWAQNSAAFQKAFVAAITKLGRVGVKTGKNGNIRRD  323

Query  29   C  27
            C
Sbjct  324  C  324



>ref|XP_010272213.1| PREDICTED: peroxidase 73-like [Nelumbo nucifera]
Length=332

 Score =   427 bits (1097),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 224/328 (68%), Positives = 257/328 (78%), Gaps = 1/328 (0%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             M   + N+ VV   +++ L L      AQLR N+Y N CPNVE++VR+ V+QKF+QTFVT
Sbjct  1     MAGFKFNARVVVWALVLNLCLFPQMGSAQLRRNYYANICPNVENIVRNVVRQKFQQTFVT  60

Query  827   APATLRLFFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNP  651
              PATLRLFFHDCFV+GCDASV++AS PN KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ P
Sbjct  61    VPATLRLFFHDCFVQGCDASVIIASTPNNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVP  120

Query  650   QCRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLN  471
              CRNKVSCADIL +ATRDV++L+GG  Y VELGR DG  ST +SV   LP   F L+QL+
Sbjct  121   SCRNKVSCADILTMATRDVIALSGGPSYAVELGRFDGLSSTASSVTGKLPQPTFNLNQLS  180

Query  470   SMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCP  291
             S+F  HGLTQTDMIALS AHT+GFSHC + A RIY F  RS +DPTLN  YA QL+ MCP
Sbjct  181   SLFASHGLTQTDMIALSAAHTLGFSHCGKFANRIYNFSARSVVDPTLNRAYASQLQAMCP  240

Query  290   LRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaaf  111
               VDPRIAINMDP TP  FDN Y+KNLQQGKGLF SDQVLF+DPRSR TVN +ASN+AAF
Sbjct  241   RNVDPRIAINMDPNTPRIFDNVYYKNLQQGKGLFTSDQVLFSDPRSRPTVNAWASNSAAF  300

Query  110   qqafaaAMTKLGRIGVLTGNLGEIRRDC  27
             QQAF  A+ KLGR+GV T   G IRRDC
Sbjct  301   QQAFVTAINKLGRVGVKTRGNGNIRRDC  328



>ref|XP_004231908.1| PREDICTED: peroxidase 51 [Solanum lycopersicum]
Length=332

 Score =   426 bits (1096),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 256/325 (79%), Gaps = 2/325 (1%)
 Frame = -2

Query  983  MVVSAGIL-VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            M V   IL V +VL+ + A AQL+TN+Y N CPNVES+VR+ V QKF+QTFVT PA LRL
Sbjct  8    MSVLLSILSVSIVLMPNLASAQLKTNYYANICPNVESIVRNVVNQKFKQTFVTVPAVLRL  67

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV GCDASV+++S P   AEKDH DNLSLAGDGFDTVIKAKAAVDSN +C+NKVS
Sbjct  68   FFHDCFVEGCDASVIVSSTPGNTAEKDHSDNLSLAGDGFDTVIKAKAAVDSNSRCKNKVS  127

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILALATRDV+ L+GG +YPVELGR DG  S  ++V+  LP   F L+QLNSMF  HG
Sbjct  128  CADILALATRDVIQLSGGPWYPVELGRLDGFTSKASNVEGKLPKPTFNLNQLNSMFASHG  187

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQ DMIALS AH++GFSHC + + RIY F P++ IDPTLN +YA QL+ MCP  VDPRI
Sbjct  188  LTQADMIALSAAHSVGFSHCGKFSNRIYNFSPKNPIDPTLNKQYAAQLQGMCPRNVDPRI  247

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            AI+MDP TP TFDN Y+KNLQQG GLF SDQVL+TD RS+ TV+ +ASN+ +FQ AF  A
Sbjct  248  AIDMDPKTPRTFDNNYYKNLQQGMGLFTSDQVLYTDKRSKGTVDLWASNSKSFQNAFVTA  307

Query  89   MTKLGRIGVLTGNLGEIRRDCTRPN  15
            MTKLGR+GV TG  G IR DC R N
Sbjct  308  MTKLGRVGVKTGRNGNIRFDCGRMN  332



>ref|XP_004136312.1| PREDICTED: peroxidase 45-like [Cucumis sativus]
 ref|XP_004168486.1| PREDICTED: peroxidase 45-like [Cucumis sativus]
 gb|KGN60168.1| hypothetical protein Csa_3G881810 [Cucumis sativus]
Length=323

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 250/304 (82%), Gaps = 0/304 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL  NFY+N+CPNVES+VR+AV+QKF QTFVTAPATLRLFFHDCFVRGCDASVL+ + N
Sbjct  20   AQLHLNFYQNSCPNVESIVRAAVKQKFEQTFVTAPATLRLFFHDCFVRGCDASVLIQTNN  79

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +EKD+ +NLSLAGDGFDTVIKAKAAVDS P C+NKVSCADILALATRDVV+L GG  Y
Sbjct  80   HTSEKDNAENLSLAGDGFDTVIKAKAAVDSVPGCKNKVSCADILALATRDVVALTGGPSY  139

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDG+IST  SV+ +LP   F L+QLN+MF +HGLTQTDMIALSGAHTIGFSHCK
Sbjct  140  AVELGRRDGQISTRKSVRHHLPKPDFGLNQLNAMFAKHGLTQTDMIALSGAHTIGFSHCK  199

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
              +KR+Y F  ++ IDPT N  Y  +L++ CP  VD RIAI+MD T+  TFDN YFKNLQ
Sbjct  200  HFSKRLYSFHSKNRIDPTFNPTYVDELKRECPRNVDQRIAIDMDSTSSFTFDNMYFKNLQ  259

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
             GKGLF SDQVLFTDPRSR TVN FASNN AF+QAF  AMTKLGR+GV T N GEIR DC
Sbjct  260  MGKGLFTSDQVLFTDPRSRKTVNLFASNNTAFEQAFVVAMTKLGRVGVKTKNQGEIRIDC  319

Query  26   TRPN  15
            +  N
Sbjct  320  SSVN  323



>emb|CAA09881.1| peroxidase [Trifolium repens]
Length=329

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 219/325 (67%), Positives = 258/325 (79%), Gaps = 1/325 (0%)
 Frame = -2

Query  995  RKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPAT  816
            R N++++   +L+ L  +  +  AQL  N Y N CPNV+S+VRSAVQ+KF+QTFVT PAT
Sbjct  3    RFNNVILVWSLLLMLCFIPYTTFAQLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPAT  62

Query  815  LRLFFHDCFVRGCDASVLLASPNG-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRN  639
            LRLFFHDCFV+GCDASVL+AS  G +AEKD+PDNLSLAGDGFDTVIKAKAA+D+ PQCRN
Sbjct  63   LRLFFHDCFVQGCDASVLVASSGGNQAEKDNPDNLSLAGDGFDTVIKAKAALDAVPQCRN  122

Query  638  KVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFG  459
            KVSCADILALATRDV++LAGG  Y VELGR DG +S  + V   LP  GF L+QLNS+F 
Sbjct  123  KVSCADILALATRDVINLAGGPSYTVELGRFDGLVSRSSDVNGRLPQPGFNLNQLNSLFA  182

Query  458  RHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVD  279
             +GLTQTDMIALSGAHT+GFSHC + + RI+ F  +S +DPTLN +YA QL+QMCP  VD
Sbjct  183  SNGLTQTDMIALSGAHTLGFSHCNRFSNRIFNFNNQSPVDPTLNKQYAAQLQQMCPRNVD  242

Query  278  PRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqaf  99
            PRIAINMDPTTP  FDNAY++NLQQGKGLF SDQ+LFTD RSR TVN FAS+   F   F
Sbjct  243  PRIAINMDPTTPRQFDNAYYQNLQQGKGLFTSDQILFTDTRSRATVNSFASSGNVFNANF  302

Query  98   aaAMTKLGRIGVLTGNLGEIRRDCT  24
              AMTKLGRIGV T   G+IR DC+
Sbjct  303  INAMTKLGRIGVKTARNGKIRTDCS  327



>ref|XP_006339817.1| PREDICTED: peroxidase 51-like [Solanum tuberosum]
Length=332

 Score =   426 bits (1095),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/316 (68%), Positives = 252/316 (80%), Gaps = 1/316 (0%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            V +VL+ + A AQL+TN+Y N CPNVES+VR+ V QKF+QTFVT PA LRLFFHDCFV G
Sbjct  17   VSIVLMPNLASAQLKTNYYANICPNVESIVRNVVNQKFKQTFVTVPAVLRLFFHDCFVEG  76

Query  779  CDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            CDASV+++S P   AEKDH DNLSLAGDGFDTVIKAKAAVDSN +C+NKVSCADILALAT
Sbjct  77   CDASVIVSSTPGNTAEKDHSDNLSLAGDGFDTVIKAKAAVDSNSRCKNKVSCADILALAT  136

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDV+ L+GG +YPVELGR DG  S  ++V+  LP   F L+QLNSMF  HGLTQ DMIAL
Sbjct  137  RDVIQLSGGPWYPVELGRLDGFTSKASNVEGKLPKPTFNLNQLNSMFASHGLTQADMIAL  196

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            S AH++GFSHC + + RIY F P++ IDPTLN +YA QL+ MCP  VDPRIAI+MDP TP
Sbjct  197  SAAHSVGFSHCGKFSNRIYNFSPQNPIDPTLNKQYAAQLQGMCPRNVDPRIAIDMDPKTP  256

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDN Y+KNLQQG GLF SDQVL+TD RS+ TV+ +ASN+ +FQ AF  AMTKLGR+GV
Sbjct  257  RTFDNNYYKNLQQGMGLFTSDQVLYTDKRSKGTVDLWASNSKSFQNAFTTAMTKLGRVGV  316

Query  62   LTGNLGEIRRDCTRPN  15
             TG  G IR DC R N
Sbjct  317  KTGRNGNIRFDCGRMN  332



>ref|XP_008466661.1| PREDICTED: peroxidase 45-like, partial [Cucumis melo]
Length=329

 Score =   426 bits (1094),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 249/304 (82%), Gaps = 0/304 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL  NFY+N+CPNVES+VR+AV+QKF QTFVTAPATLRLFFHDCFVRGCDASVL+ + N
Sbjct  26   AQLHLNFYQNSCPNVESIVRAAVKQKFEQTFVTAPATLRLFFHDCFVRGCDASVLIQTNN  85

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              +EKD+ +NLSLAGDGFDTVIKAKAAVDS P C+NKVSCADILALATRDVV+L GG  Y
Sbjct  86   HTSEKDNAENLSLAGDGFDTVIKAKAAVDSVPGCKNKVSCADILALATRDVVALTGGPSY  145

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDGRIST  SV+ +LP   F L+QLN+MF +HGLTQTDMIALSGAHTIGFSHCK
Sbjct  146  AVELGRRDGRISTRKSVRHHLPKPDFGLNQLNAMFAKHGLTQTDMIALSGAHTIGFSHCK  205

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
              +KR+Y F  ++ IDPT N  YA +L++ CP  VD RIA++MD  +  TFDN YFKNLQ
Sbjct  206  HFSKRLYSFHSKNRIDPTFNPTYADELKRECPRNVDQRIAVDMDSMSSFTFDNMYFKNLQ  265

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
             GKGLF SDQVLFTDPRSR TVN FASNN AF+QAF  AMTKLGR+GV T N GEIR DC
Sbjct  266  MGKGLFTSDQVLFTDPRSRKTVNLFASNNTAFEQAFVVAMTKLGRVGVKTKNQGEIRIDC  325

Query  26   TRPN  15
               N
Sbjct  326  ASVN  329



>ref|XP_002525252.1| Peroxidase 73 precursor, putative [Ricinus communis]
 gb|EEF37080.1| Peroxidase 73 precursor, putative [Ricinus communis]
Length=334

 Score =   425 bits (1093),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 247/300 (82%), Gaps = 1/300 (0%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-PN  747
            QLR N+Y N CPNVES+VRS VQ+KF+QTFVT PATLRLFFHDCFV+GCDASV++AS PN
Sbjct  31   QLRQNYYANICPNVESIVRSTVQKKFQQTFVTVPATLRLFFHDCFVQGCDASVVVASTPN  90

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
             KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ P CRNKVSCADILA+ATRDVV+L+GG  Y
Sbjct  91   NKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPSCRNKVSCADILAMATRDVVALSGGPSY  150

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGR DG  ST  SV   LP   F L+QLNS+F  +GL+QTDMIALS AHT+GFSHC 
Sbjct  151  AVELGRLDGLSSTAASVNGKLPQPTFNLNQLNSLFAANGLSQTDMIALSAAHTLGFSHCG  210

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + A RIY F  ++ +DPTLN  YA QL+QMCP  VDPRIAINMDP TP TFDNAY+KNLQ
Sbjct  211  KFANRIYNFSRQNPVDPTLNKAYATQLQQMCPKNVDPRIAINMDPKTPQTFDNAYYKNLQ  270

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QG GLF SDQ+LFTD RSR TVN +ASN+ AFQQAF AAMTKLGR+GV TG  G IR DC
Sbjct  271  QGMGLFTSDQILFTDARSRPTVNAWASNSPAFQQAFVAAMTKLGRVGVKTGRNGNIRTDC  330



>ref|XP_007227473.1| hypothetical protein PRUPE_ppa008550mg [Prunus persica]
 gb|EMJ28672.1| hypothetical protein PRUPE_ppa008550mg [Prunus persica]
Length=327

 Score =   424 bits (1091),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 215/308 (70%), Positives = 248/308 (81%), Gaps = 0/308 (0%)
 Frame = -2

Query  938  SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLL  759
            +SAHAQL    Y+++CPNVE++V +AV+QKF QTFVTAPATLRLFFHDCF+RGCDAS++L
Sbjct  20   NSAHAQLHVEHYRSSCPNVEAIVHAAVKQKFEQTFVTAPATLRLFFHDCFIRGCDASIML  79

Query  758  ASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAG  579
            A  N  AEKD+ DNLSLAGDGFDTVIKAKAAVD  PQCRNKVSCADILALATRDVV L G
Sbjct  80   AFRNNSAEKDNSDNLSLAGDGFDTVIKAKAAVDRVPQCRNKVSCADILALATRDVVRLTG  139

Query  578  GAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGF  399
            G +Y VELGR DGR ST  SV+++LP   F+LDQLNSMF  HGL+ TD+IALSGAHTIGF
Sbjct  140  GPYYRVELGRLDGRTSTKASVRQHLPHPDFRLDQLNSMFASHGLSLTDLIALSGAHTIGF  199

Query  398  SHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYF  219
            +HC +   RIY F+ ++ IDPT+NL YA  L+Q CP  VDPRIA++MDPTTP  FDN Y+
Sbjct  200  AHCNKFTHRIYSFKSQNRIDPTMNLAYARHLKQECPANVDPRIAVDMDPTTPQKFDNVYY  259

Query  218  KNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEI  39
            KNLQQGKGLF SDQ LFTD RSR  VN FA++ AAF++AF AAMTKLGR GV  G  GEI
Sbjct  260  KNLQQGKGLFTSDQSLFTDARSRKIVNLFAADAAAFERAFVAAMTKLGRFGVKNGKQGEI  319

Query  38   RRDCTRPN  15
            R DC   N
Sbjct  320  RHDCAAVN  327



>ref|XP_006845692.1| hypothetical protein AMTR_s00019p00237230 [Amborella trichopoda]
 gb|ERN07367.1| hypothetical protein AMTR_s00019p00237230 [Amborella trichopoda]
Length=315

 Score =   420 bits (1079),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/304 (72%), Positives = 244/304 (80%), Gaps = 6/304 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR NFY  TCPNVE +VR+AV +K RQTFVTAPATLRLFFHDCFV GCDASV++ASP 
Sbjct  18   AQLRRNFYSATCPNVEFIVRNAVTRKLRQTFVTAPATLRLFFHDCFVEGCDASVMIASPR  77

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              AEKD  DNLSLAGDGFDTV++AKAAVD+ P CRN+VSCADILA+ATRDV+++AGG FY
Sbjct  78   NNAEKDSSDNLSLAGDGFDTVMQAKAAVDAVPGCRNRVSCADILAMATRDVINMAGGPFY  137

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDGRIS+ + V   LP   F L+QLN MF   GL QTDMIALSGAHTIG SHC 
Sbjct  138  NVELGRRDGRISSASRVGGKLPQPSFNLNQLNFMFASQGLNQTDMIALSGAHTIGVSHCT  197

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            ++  RI+ F      DPTLN  YA QL+QMCP  VDP IAINMDP TP TFDN YFKNLQ
Sbjct  198  RITNRIFNF------DPTLNRNYAMQLQQMCPRNVDPTIAINMDPNTPRTFDNIYFKNLQ  251

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QG GLF SDQVLFTDPRSR TVN FA+N  AF+QAF AA+TKLGR+GV TGN GEIRRDC
Sbjct  252  QGMGLFSSDQVLFTDPRSRATVNQFAANKQAFEQAFVAAITKLGRVGVKTGNQGEIRRDC  311

Query  26   TRPN  15
            +R N
Sbjct  312  SRFN  315



>ref|XP_007161310.1| hypothetical protein PHAVU_001G059100g [Phaseolus vulgaris]
 gb|ESW33304.1| hypothetical protein PHAVU_001G059100g [Phaseolus vulgaris]
Length=326

 Score =   420 bits (1079),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 254/324 (78%), Gaps = 2/324 (1%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S+++ A +   L+LL++  HAQLR ++Y+NTCPNVES+VR AV+ K +QT VTAPATLRL
Sbjct  5    SLILHAEVF--LLLLIAGCHAQLRVDYYRNTCPNVESIVRRAVEMKLQQTPVTAPATLRL  62

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
             FHDCFVRGCDASV+LAS N  +EKD+P NLSLAGDGFDTVIKAKAAVDS P C+NKVSC
Sbjct  63   IFHDCFVRGCDASVMLASTNHTSEKDNPINLSLAGDGFDTVIKAKAAVDSVPGCQNKVSC  122

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILA+ATRDVV+LAGG  Y VELGR DGR+ST  SV+ +LP   FKL+QLN MF  HGL
Sbjct  123  ADILAMATRDVVALAGGPSYAVELGRLDGRVSTKASVRHHLPHPDFKLEQLNQMFASHGL  182

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            T TD++ALSGAHTIGFSHC Q +KRIY F+ +  ID TLN  YA +L+Q CP   DPR  
Sbjct  183  TLTDLVALSGAHTIGFSHCSQFSKRIYNFKSKKSIDHTLNSAYAEKLQQDCPKNADPRTV  242

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            + MD  TP  FDN Y+KNLQQGKGL  SDQ LFT  R+R+ VN FASNN  F+ AF +AM
Sbjct  243  VEMDLITPRIFDNQYYKNLQQGKGLLASDQALFTHKRTRDLVNLFASNNTVFETAFVSAM  302

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
            TKLGRIG+ TGN GEIRRDC+  N
Sbjct  303  TKLGRIGIKTGNQGEIRRDCSMVN  326



>ref|XP_006573655.1| PREDICTED: peroxidase 51 [Glycine max]
 gb|KHN36287.1| Peroxidase 51 [Glycine soja]
Length=328

 Score =   419 bits (1076),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 246/315 (78%), Gaps = 1/315 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
              + L L      AQL  + Y  TCPNVE++VR AV++KF QTFVT PAT+RLFFHDCFV
Sbjct  12   FFLSLCLYSCPTSAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATIRLFFHDCFV  71

Query  785  RGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDASVL+AS  N KAEKDHPDNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADILA+
Sbjct  72   QGCDASVLVASTKNNKAEKDHPDNLSLAGDGFDTVIKAKEAVDAVPLCRNKVSCADILAM  131

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV++LAGG FY VELGR DG  S  + V R LP A F L+QLNS+F  +GLTQT+MI
Sbjct  132  ATRDVIALAGGPFYEVELGRFDGLRSKSSDVNRRLPQAEFNLNQLNSLFAANGLTQTEMI  191

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC +   R+Y F+ +S +DPTLN +YA QLR MCP  VDPRIAI+MDPT
Sbjct  192  ALSGAHTVGFSHCNKFTNRVYNFKSKSRVDPTLNEKYATQLRSMCPRNVDPRIAIDMDPT  251

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP +FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN FAS++  F   FAAAMTKLGR+
Sbjct  252  TPRSFDNVYFKNLQQGKGLFSSDQVLFTDSRSKATVNAFASSSNIFHANFAAAMTKLGRV  311

Query  68   GVLTGNLGEIRRDCT  24
            GV     G IR DC+
Sbjct  312  GVKNAQNGNIRTDCS  326



>emb|CAA62228.1| peroxidase2 [Medicago sativa]
Length=323

 Score =   419 bits (1076),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 253/321 (79%), Gaps = 8/321 (2%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V S  + +CL+   +   AQL  N Y N CPNV+S+VRSAVQ+KF+QTFVT PATLRLF
Sbjct  8    LVWSLALTLCLIPYTT--FAQLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLF  65

Query  803  FHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV+GCDASVL+AS  N KAEKDHP+NLSLAGDGFDTVIKAKAA+D+ PQCRNKVSC
Sbjct  66   FHDCFVQGCDASVLVASSGNNKAEKDHPENLSLAGDGFDTVIKAKAALDAVPQCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV++LAGG  Y VELGR DG +S  + V   LP   F L+QLN++F  +GL
Sbjct  126  ADILALATRDVINLAGGPSYTVELGRFDGLVSRSSDVNGRLPQPSFNLNQLNTLFANNGL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQTDMIALSGAHT+GFSHC + + RI     ++ +DPTLN +YA QL+QMCP  VDPRIA
Sbjct  186  TQTDMIALSGAHTLGFSHCDRFSNRI-----QTPVDPTLNKQYAAQLQQMCPRNVDPRIA  240

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP TFDN Y+KNLQQGKGLF SDQ+LFTD RSRNTVN FA+N   F   F  AM
Sbjct  241  INMDPTTPRTFDNVYYKNLQQGKGLFTSDQILFTDTRSRNTVNSFATNGNVFNANFITAM  300

Query  86   TKLGRIGVLTGNLGEIRRDCT  24
            TKLGRIGV T   G+IR DCT
Sbjct  301  TKLGRIGVKTARNGKIRTDCT  321



>ref|XP_004509077.1| PREDICTED: peroxidase 73-like [Cicer arietinum]
Length=328

 Score =   418 bits (1075),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 254/321 (79%), Gaps = 3/321 (1%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V S  + +CL+  ++   AQL TN Y  TCPNVES+VR+AVQ KF+QTFVT PATLRLF
Sbjct  8    LVFSLSLNLCLIPYLT--LAQLSTNHYAKTCPNVESIVRTAVQNKFKQTFVTVPATLRLF  65

Query  803  FHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV+GCDASVL+AS  N +AEKDH DNLSLAGDGFDTVIKAKAA+D+ PQC+NKVSC
Sbjct  66   FHDCFVQGCDASVLVASSGNNQAEKDHSDNLSLAGDGFDTVIKAKAALDAVPQCKNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV++LAGG  Y VELGR DG +S  + V   LP   F L+QLNS+F  +GL
Sbjct  126  ADILALATRDVINLAGGPRYTVELGRFDGLVSRASDVNGRLPLPSFNLNQLNSLFAANGL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQTDMIALSGAHT+GFSHC + + RIY F  +S +DPTLN  YA QL+QMCP  VDPRIA
Sbjct  186  TQTDMIALSGAHTLGFSHCSRFSNRIYNFNKQSPVDPTLNKVYASQLQQMCPRNVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            I+MDPTTP TFDNAY++NL+QGKGLF SDQ+LFTD RSR TVN FASN   F   F  A+
Sbjct  246  IDMDPTTPRTFDNAYYQNLRQGKGLFTSDQILFTDTRSRATVNSFASNANVFNNNFINAI  305

Query  86   TKLGRIGVLTGNLGEIRRDCT  24
            TKLGR+GV T   G+IR DC+
Sbjct  306  TKLGRVGVKTARNGKIRTDCS  326



>ref|XP_011099352.1| PREDICTED: peroxidase 73 [Sesamum indicum]
 gb|ABB89209.1| peroxidase [Sesamum indicum]
 gb|AET09944.1| peroxidase [Sesamum indicum]
 gb|AET09945.1| peroxidase [Sesamum indicum]
Length=330

 Score =   418 bits (1074),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 245/314 (78%), Gaps = 1/314 (0%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            +++   S  AQL+ N+Y N CP+VE++VR AV  KF+QTFVT PATLRL+FHDCFV GCD
Sbjct  17   VIVFSGSVSAQLKQNYYANICPDVENIVRQAVTAKFKQTFVTVPATLRLYFHDCFVSGCD  76

Query  773  ASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRD  597
            ASV++AS P   AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P+CRNKVSCADILALATRD
Sbjct  77   ASVIIASTPGNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPRCRNKVSCADILALATRD  136

Query  596  VVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSG  417
            V++LAGG  YPVELGR DG  ST  SV  NLP   F LDQLN MF   GL+Q DMIALS 
Sbjct  137  VINLAGGPSYPVELGRLDGLKSTAASVNGNLPQPTFNLDQLNKMFASRGLSQADMIALSA  196

Query  416  AHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNT  237
             HT+GFSHC + + RIY F  ++ +DPTLN +YA QL+ MCP+ VDPRIAI+MDPTTP  
Sbjct  197  GHTLGFSHCSKFSNRIYNFSRQNPVDPTLNKQYATQLQGMCPINVDPRIAIDMDPTTPRK  256

Query  236  FDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLT  57
            FDNAYFKNL QGKGLF SDQVLFTD RSRNTVN +ASN  AF  AF  A+TKLGR+GV T
Sbjct  257  FDNAYFKNLVQGKGLFTSDQVLFTDTRSRNTVNTWASNPQAFNAAFIQAITKLGRVGVKT  316

Query  56   GNLGEIRRDCTRPN  15
               G IR DC R N
Sbjct  317  ARNGNIRFDCGRFN  330



>emb|CAC38106.1| peroxidase2 [Medicago sativa]
Length=323

 Score =   417 bits (1072),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 252/321 (79%), Gaps = 8/321 (2%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V S  + +CL+   +   AQL  N Y N CPNV+S+VRSAVQ+KF+QTFVT PATLRLF
Sbjct  8    LVWSLALTLCLIPYTT--FAQLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLF  65

Query  803  FHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV+GCDASVL+AS  N KAEKDHP+NLSLAGDGFDTVIKAKAA+D+ PQCRNKVSC
Sbjct  66   FHDCFVQGCDASVLVASSGNNKAEKDHPENLSLAGDGFDTVIKAKAALDAVPQCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV++LAGG  Y VELGR DG +S  + V   LP   F L+QLN++F  +GL
Sbjct  126  ADILALATRDVINLAGGPSYTVELGRFDGLVSRSSDVNGRLPQPSFNLNQLNTLFANNGL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQTDMIALSGAHT GFSHC + + RI     ++ +DPTLN +YA QL+QMCP  VDPRIA
Sbjct  186  TQTDMIALSGAHTSGFSHCDRFSNRI-----QTPVDPTLNKQYAAQLQQMCPRNVDPRIA  240

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP TFDN Y+KNLQQGKGLF SDQ+LFTD RSRNTVN FA+N   F   F  AM
Sbjct  241  INMDPTTPRTFDNVYYKNLQQGKGLFTSDQILFTDTRSRNTVNSFATNGNVFNANFITAM  300

Query  86   TKLGRIGVLTGNLGEIRRDCT  24
            TKLGRIGV T   G+IR DCT
Sbjct  301  TKLGRIGVKTARNGKIRTDCT  321



>gb|KHG21770.1| Peroxidase 51 -like protein [Gossypium arboreum]
Length=330

 Score =   417 bits (1072),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 210/304 (69%), Positives = 241/304 (79%), Gaps = 1/304 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            +A AQLR N+Y  TCPN ES+VR+AV +KFRQTFVT PAT+RLFFHDCFV+GCDASV++ 
Sbjct  23   TASAQLRQNYYAKTCPNAESIVRNAVTKKFRQTFVTVPATIRLFFHDCFVQGCDASVIIQ  82

Query  755  SP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAG  579
            S  + KAEKDHPDNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADILA+ATRDV++L+G
Sbjct  83   STGSNKAEKDHPDNLSLAGDGFDTVIKAKQAVDAVPSCRNKVSCADILAMATRDVIALSG  142

Query  578  GAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGF  399
            G  Y VELGR DG  ST  SV   LP   F L+QLNSMF  HGLTQTDMIALS AHT+GF
Sbjct  143  GPSYAVELGRLDGLRSTAASVNGKLPHPDFNLNQLNSMFAAHGLTQTDMIALSAAHTVGF  202

Query  398  SHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYF  219
            SHC + + RIY F  +S +DPTLN  YA QL+QMCP  VDPRIAINMDP TP  FDN Y+
Sbjct  203  SHCSKFSNRIYNFSRQSAVDPTLNRAYATQLQQMCPKNVDPRIAINMDPNTPRAFDNVYY  262

Query  218  KNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEI  39
            KNLQQGKGLF SDQVLFTD RS+  V+ +A+N+  F  AF  A+TKLGR+GV TG  G I
Sbjct  263  KNLQQGKGLFTSDQVLFTDRRSKPVVDAWAANSNTFNSAFITAITKLGRVGVKTGRNGNI  322

Query  38   RRDC  27
            RR+C
Sbjct  323  RRNC  326



>ref|XP_007205527.1| hypothetical protein PRUPE_ppa008489mg [Prunus persica]
 gb|EMJ06726.1| hypothetical protein PRUPE_ppa008489mg [Prunus persica]
Length=329

 Score =   416 bits (1070),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 244/302 (81%), Gaps = 1/302 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL+TNFY N CPNVE++V++ V QKF+QTFVT PAT+RLFFHDCFV+GCDASVL+AS  
Sbjct  25   AQLKTNFYANVCPNVENIVKNVVTQKFQQTFVTVPATIRLFFHDCFVQGCDASVLVASTG  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L+GG  
Sbjct  85   NNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIVLSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  S+  +V  NLP   F L+QLNSMF  HGL+Q DM+ALS AHT+GFSHC
Sbjct  145  YAVELGRLDGLSSSSKNVDGNLPKPTFNLNQLNSMFAAHGLSQADMVALSAAHTVGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + + RIY F   + +DP+LN  YA QL+QMCP  VDP IAINMDP TP TFDN YFKNL
Sbjct  205  DRFSNRIYSFSAGNPVDPSLNKTYATQLQQMCPKNVDPDIAINMDPNTPRTFDNVYFKNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            + G+GLF SDQVLFTD RS+ TV  +A +NAAFQQAF  AMTKLGR+GV TGN G IR D
Sbjct  265  ELGQGLFTSDQVLFTDARSQPTVKTWAKDNAAFQQAFITAMTKLGRVGVKTGNKGNIRSD  324

Query  29   CT  24
            C+
Sbjct  325  CS  326



>gb|ACI42310.2| peroxidase 5 [Litchi chinensis]
Length=329

 Score =   416 bits (1068),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 241/301 (80%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR N+Y N CPNVE +VR+ V +KFRQTFVT PAT+RLFFHDCFV+GCDASV +AS  
Sbjct  25   AQLRRNYYANICPNVEQIVRNEVNKKFRQTFVTVPATIRLFFHDCFVQGCDASVTIASTG  84

Query  746  GK-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            G  AEKDHPDNLSLAGDGFDTVIKAKAAVDSNP+CRNKVSCADILA+ATRDV++L+GG  
Sbjct  85   GNTAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPRCRNKVSCADILAMATRDVIALSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V  +LP   F L+QLNSMF  HGL Q DMIALS AHT+GFSHC
Sbjct  145  YAVELGRLDGLVSRASDVNGHLPQPTFNLNQLNSMFAAHGLNQADMIALSAAHTVGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY F   + +DPT+N  YA QL+ MCP  VDPRIAINMDP TPN FDN YFKNL
Sbjct  205  GKFAHRIYNFSRHNPVDPTINKLYATQLQSMCPRNVDPRIAINMDPVTPNAFDNTYFKNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q G+GLF SDQVLF DPRSR TVN +A+N+ AF++AF  A+TKLGR+GV TG  G IRRD
Sbjct  265  QNGQGLFTSDQVLFHDPRSRPTVNAWAANSPAFERAFVTAITKLGRVGVKTGRNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|NP_001275041.1| peroxidase 51-like precursor [Solanum tuberosum]
 emb|CAC42086.1| putative peroxidase [Solanum tuberosum]
Length=331

 Score =   415 bits (1067),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 239/301 (79%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL+TNFY  TCPNVES+VR+ V QKF+QTFVT PA LRLFFHDCFV GCDASV++AS +
Sbjct  27   AQLKTNFYAQTCPNVESIVRNVVNQKFKQTFVTIPAVLRLFFHDCFVEGCDASVIIASTS  86

Query  746  GK-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            G  AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADILALATRDV+ L+GG  
Sbjct  87   GNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPSCKNKVSCADILALATRDVIQLSGGPG  146

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  S  ++V  NLP   F LDQLN+MF  HGL Q DMIALS AHT+GFSHC
Sbjct  147  YAVELGRLDGLTSKSSNVGGNLPKPTFNLDQLNTMFASHGLNQADMIALSAAHTLGFSHC  206

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RI+ F P++ +DP++N  YA QL+QMCP  VDPRIAINMDP TP  FDN YF+NL
Sbjct  207  DQFSNRIFNFSPKNPVDPSVNKTYAAQLQQMCPKNVDPRIAINMDPITPRAFDNVYFQNL  266

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q+G GLF SDQVLFTD RS+ TV+ +ASN+  FQ AF  AMTKLGR+GV TG  G IR D
Sbjct  267  QKGMGLFTSDQVLFTDQRSKGTVDLWASNSKVFQTAFVNAMTKLGRVGVKTGKNGNIRID  326

Query  29   C  27
            C
Sbjct  327  C  327



>ref|XP_003608471.1| Peroxidase [Medicago truncatula]
 gb|AES90668.1| class III peroxidase [Medicago truncatula]
Length=323

 Score =   415 bits (1066),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 252/321 (79%), Gaps = 8/321 (2%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V S  + +CL+   +   AQL  N Y N CPNV+S+VRSAVQ+KF+QTFVT PATLRLF
Sbjct  8    LVWSLALTLCLIPYTT--FAQLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLF  65

Query  803  FHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV+GCDASVL+AS  N KAEKDHP+NLSLAGDGFDTVIKAKAA+D+ PQCRNKVSC
Sbjct  66   FHDCFVQGCDASVLVASSGNNKAEKDHPENLSLAGDGFDTVIKAKAALDAVPQCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV++LAGG  Y VELGR DG +S  + V   LP   F L+QLN++F  +GL
Sbjct  126  ADILALATRDVINLAGGPSYTVELGRFDGLVSRSSDVNGRLPQPSFNLNQLNTLFANNGL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQTDMIALSGAHT+GFSHC + + RI     ++ +DPTLN +YA QL+QMCP  VDPRIA
Sbjct  186  TQTDMIALSGAHTLGFSHCDRFSNRI-----QTPVDPTLNKQYAAQLQQMCPRNVDPRIA  240

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP TFDN Y+KNLQQGKGLF SDQ+LFTD RSRNTVN FA+N   F   F  AM
Sbjct  241  INMDPTTPRTFDNVYYKNLQQGKGLFTSDQILFTDTRSRNTVNSFATNGNVFNANFITAM  300

Query  86   TKLGRIGVLTGNLGEIRRDCT  24
            TKLGR+GV     G+IR DC+
Sbjct  301  TKLGRVGVKNARNGKIRTDCS  321



>ref|XP_009784349.1| PREDICTED: peroxidase 51-like [Nicotiana sylvestris]
Length=330

 Score =   414 bits (1065),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 251/321 (78%), Gaps = 2/321 (1%)
 Frame = -2

Query  983  MVVSAGILVCL-VLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            ++++  ++ C+ + L   A AQLRTN+Y  TCPNVES+VR+ V QK +QT +T PA LRL
Sbjct  6    ILIAVLLISCVSIFLPELASAQLRTNYYAKTCPNVESIVRNVVNQKIQQTIITVPAVLRL  65

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV GCD+SV++AS P   AEKDHPDNLSLAGDGFDTV+KAKAA+D+NP C+N+VS
Sbjct  66   FFHDCFVEGCDSSVIIASTPGNTAEKDHPDNLSLAGDGFDTVVKAKAAIDANPICKNRVS  125

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILA+ATRDV+ L+GG  Y VELGR DG  S  ++V+ NLP   F LDQLNSMF  HG
Sbjct  126  CADILAIATRDVIELSGGPRYQVELGRLDGFTSKASNVEGNLPKPTFNLDQLNSMFASHG  185

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            L QTDMIALS AHT+G SHC + + RIY F P++ +DPTL+  +A QL+QMCP  VDP+I
Sbjct  186  LDQTDMIALSAAHTLGASHCNKFSNRIYNFSPKNPVDPTLSKTFAAQLQQMCPKNVDPQI  245

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
             INMDP TPNTFDN YF+NLQ+G GLF SDQVLFTD RS+ TV+ +ASN+  FQ AF  A
Sbjct  246  VINMDPITPNTFDNVYFQNLQKGMGLFTSDQVLFTDKRSKGTVDLWASNSKVFQTAFVNA  305

Query  89   MTKLGRIGVLTGNLGEIRRDC  27
            MTKLGR+GV +G  G IRRDC
Sbjct  306  MTKLGRVGVKSGKNGNIRRDC  326



>ref|XP_008457736.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=336

 Score =   414 bits (1065),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 211/325 (65%), Positives = 252/325 (78%), Gaps = 6/325 (2%)
 Frame = -2

Query  983  MVVSAGILVCLVL-----LVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPA  819
            MVVS+ +   LVL     +VS+  AQLR +FY + CPNVES+VRSAV +KF+QTFVT PA
Sbjct  7    MVVSSFVGFVLVLTTLLAVVSTTEAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPA  66

Query  818  TLRLFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCR  642
            T+RLFFHDCFV+GCDASV++AS  +  AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+
Sbjct  67   TVRLFFHDCFVQGCDASVMIASDGSNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPGCK  126

Query  641  NKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMF  462
            NKVSCADIL +ATRDV+SLA G  Y VELGR+DG +S  + V+  LP   F L+QLN+MF
Sbjct  127  NKVSCADILVMATRDVISLARGPSYAVELGRKDGLVSRASDVEGKLPQPTFNLNQLNAMF  186

Query  461  GRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRV  282
              +GL+Q DMIALS AHT+GFSHC + A RIY F   + +DPTLN  YA +L++MCP  V
Sbjct  187  AANGLSQADMIALSAAHTVGFSHCSKFADRIYNFSRTNPVDPTLNPTYAKKLQEMCPKDV  246

Query  281  DPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqa  102
            DPRIAI+MDP TP  FDN YFKNLQQG GLF SDQ+LFTDPRSR+TV  +A +   F +A
Sbjct  247  DPRIAIDMDPNTPRRFDNMYFKNLQQGMGLFTSDQILFTDPRSRSTVKVWAHSGQTFYKA  306

Query  101  faaAMTKLGRIGVLTGNLGEIRRDC  27
            F  AMTKLGR+GV TG+ G IR DC
Sbjct  307  FINAMTKLGRVGVKTGSDGNIRTDC  331



>ref|XP_010028113.1| PREDICTED: peroxidase 73-like [Eucalyptus grandis]
 gb|KCW54772.1| hypothetical protein EUGRSUZ_I00717 [Eucalyptus grandis]
Length=329

 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 246/314 (78%), Gaps = 1/314 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            + +C  L   +  AQLR NFY N CPNVE +VR+AV+QKF+QTFVT P TLRLFFHDCFV
Sbjct  12   LAICFCLCPHTTSAQLRQNFYANVCPNVEGIVRNAVRQKFQQTFVTVPGTLRLFFHDCFV  71

Query  785  RGCDASVLLASPN-GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDASV++AS +  KAEKDHPDNLSLAGDGFDTVIKAKAA+D+   CRNKVSCADILA+
Sbjct  72   QGCDASVIVASTSTNKAEKDHPDNLSLAGDGFDTVIKAKAAIDAVASCRNKVSCADILAM  131

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV++L+GG  Y VELGR DG  ST  SV   LP     L QLN++F  +GL+QTDMI
Sbjct  132  ATRDVIALSGGPSYAVELGRLDGLSSTAASVNGRLPHPTDNLSQLNALFAANGLSQTDMI  191

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALS AHT+GFSHC + + RIY F  +  +DPTLN  YA QL+ MCP  VDPRIAINMDP 
Sbjct  192  ALSAAHTLGFSHCDKFSNRIYNFSRQKAVDPTLNPNYATQLQGMCPRNVDPRIAINMDPN  251

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP TFDN YFKNLQ GKGLF SDQVLFTDPRS+ TVN +ASN+ AFQ AF +AMTKLGR+
Sbjct  252  TPRTFDNMYFKNLQNGKGLFTSDQVLFTDPRSKPTVNAWASNSRAFQSAFISAMTKLGRV  311

Query  68   GVLTGNLGEIRRDC  27
            GV TG  G IRRDC
Sbjct  312  GVKTGKNGNIRRDC  325



>ref|XP_008238250.1| PREDICTED: peroxidase 73-like [Prunus mume]
Length=329

 Score =   413 bits (1061),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 243/302 (80%), Gaps = 1/302 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL+TNFY N CPNVE++V++ V QKF+QTFVT PAT+RLFFHDCFV+GCDASVL+AS  
Sbjct  25   AQLKTNFYANVCPNVENIVKNVVTQKFQQTFVTVPATIRLFFHDCFVQGCDASVLVASTG  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALA RDV+ L+GG  
Sbjct  85   NNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALAARDVIVLSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  S+  +V   LP   F L+QLNSMF  HGL+Q DM+ALS AHT+GFSHC
Sbjct  145  YAVELGRLDGLSSSSKNVGGKLPQPSFNLNQLNSMFAAHGLSQADMVALSAAHTVGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + + RIY F P + +DP+L+  YA QL+QMCP  VDP IAINMDP TP TFDN YFKNL
Sbjct  205  NRFSNRIYSFSPGNPVDPSLDKTYATQLQQMCPKNVDPDIAINMDPNTPRTFDNVYFKNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            + G+GLF SDQVLFTD RS+ TV  +A +NAAFQQAF  AMTKLGR+GV TGN G IR D
Sbjct  265  ELGQGLFTSDQVLFTDARSQPTVKTWAKDNAAFQQAFITAMTKLGRVGVKTGNNGNIRSD  324

Query  29   CT  24
            C+
Sbjct  325  CS  326



>ref|XP_004234654.1| PREDICTED: peroxidase 51 [Solanum lycopersicum]
Length=331

 Score =   412 bits (1060),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 234/301 (78%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL+TNFY  TCPNVES+VR+ V QKF+QTFVT PA LRLFFHDCFV GCDASV++AS  
Sbjct  27   AQLKTNFYAQTCPNVESIVRNVVNQKFKQTFVTIPAVLRLFFHDCFVEGCDASVIIASTA  86

Query  746  GK-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            G  AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADILALATRDV+ L+GG  
Sbjct  87   GNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPSCKNKVSCADILALATRDVIQLSGGPG  146

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  S   +V   LP   F LDQLN+MF  HGL Q DMIALS AHT+GFSHC
Sbjct  147  YAVELGRLDGLTSKSTNVGGKLPKPTFNLDQLNTMFASHGLNQADMIALSAAHTVGFSHC  206

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RI+ F P++ +DP+LN  YA QL QMCP  VDPRIAINMDP TP  FDN YF+NL
Sbjct  207  DQFSNRIFNFNPKNPVDPSLNKTYAAQLEQMCPKNVDPRIAINMDPITPRAFDNVYFQNL  266

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q G GLF SDQVLFTD RS+ TVN +ASN+  F+ AF  AMTKLGR+GV TG  G IR D
Sbjct  267  QNGMGLFTSDQVLFTDQRSKGTVNLWASNSKVFETAFVNAMTKLGRVGVKTGKNGNIRID  326

Query  29   C  27
            C
Sbjct  327  C  327



>ref|XP_007156729.1| hypothetical protein PHAVU_002G012300g [Phaseolus vulgaris]
 gb|ESW28723.1| hypothetical protein PHAVU_002G012300g [Phaseolus vulgaris]
Length=328

 Score =   412 bits (1060),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 210/311 (68%), Positives = 244/311 (78%), Gaps = 1/311 (0%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            L L    + AQL  + Y  TCPNVE++VR AV++KF QTFVT PATLRLFFHDCFV+GCD
Sbjct  16   LCLYSCPSSAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATLRLFFHDCFVQGCD  75

Query  773  ASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRD  597
            ASVL+AS  N KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ P CRNKVSCADILA+ATRD
Sbjct  76   ASVLVASTGNNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPLCRNKVSCADILAMATRD  135

Query  596  VVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSG  417
            V++L+GG FY VELGR DG  S  + V   LP   F L+QLNS+F  +GLTQT+MIALSG
Sbjct  136  VIALSGGPFYEVELGRFDGLRSKASDVNGRLPQPEFSLNQLNSLFAANGLTQTEMIALSG  195

Query  416  AHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNT  237
            AHT+GFSHC + + R+Y F+ +S +DP LN +YA QL+ MCP  VDPRIAI+MDPTTP  
Sbjct  196  AHTVGFSHCNKFSNRVYNFKSKSRVDPALNEKYATQLKSMCPRNVDPRIAIDMDPTTPRA  255

Query  236  FDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLT  57
            FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN FAS++  F   FAAAMTKLGR+G+  
Sbjct  256  FDNVYFKNLQQGKGLFSSDQVLFTDSRSKATVNSFASSSKTFHANFAAAMTKLGRVGIKN  315

Query  56   GNLGEIRRDCT  24
               G IR DC+
Sbjct  316  AQNGNIRTDCS  326



>ref|XP_009342775.1| PREDICTED: peroxidase 73-like [Pyrus x bretschneideri]
Length=325

 Score =   412 bits (1059),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/302 (71%), Positives = 241/302 (80%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+TN+Y N CPNVESLV+ AV +KF+QTFVT P TLRLFFHDCFV GCDASV++AS  
Sbjct  25   AQLKTNYYANICPNVESLVKDAVTKKFQQTFVTVPGTLRLFFHDCFVEGCDASVIVASTA  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKD+PDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L+GG  
Sbjct  85   NNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP + F L+QLNS+F  HGL+Q DM+ALSGAHT+GFSHC
Sbjct  145  YSVELGRLDGLSSTSTSVNGKLPKSTFNLNQLNSLFASHGLSQADMVALSGAHTLGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RIY     + +DPTLN  YA QL+QMCP  VDP IAINMDPTTP TFDN YF+NL
Sbjct  205  NQFSNRIY----SNPVDPTLNKAYATQLQQMCPKNVDPDIAINMDPTTPRTFDNVYFQNL  260

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVLFTD RS+ TV  +A N AAF QAF  AMTKLGR+GV TG  G IRRD
Sbjct  261  VEGKGLFTSDQVLFTDSRSQPTVRRWAKNKAAFNQAFITAMTKLGRVGVKTGKNGNIRRD  320

Query  29   CT  24
            C+
Sbjct  321  CS  322



>ref|XP_007155845.1| hypothetical protein PHAVU_003G236500g [Phaseolus vulgaris]
 gb|ESW27839.1| hypothetical protein PHAVU_003G236500g [Phaseolus vulgaris]
Length=329

 Score =   412 bits (1059),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 242/302 (80%), Gaps = 1/302 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  N Y N CPN+ES+VR AV  KF+QTFVT PATLRLFFHDCFV+GCDASVL+AS  
Sbjct  26   AQLSPNHYANVCPNLESIVRQAVTNKFQQTFVTVPATLRLFFHDCFVQGCDASVLVASNG  85

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N +AEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQCRNKVSCADILALATRDV+ L+GG  
Sbjct  86   NNQAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCRNKVSCADILALATRDVIVLSGGPS  145

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP   F L+QLNS+F  +GLTQTDMIALSGAHT+GFSHC
Sbjct  146  YKVELGRFDGLVSRASDVNGRLPQPTFNLNQLNSLFAANGLTQTDMIALSGAHTLGFSHC  205

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY F  ++ +DPTLN +YA QL+QMCP  VDPRIAI+MDPTT   FDN Y++NL
Sbjct  206  SKFANRIYNFNGQTPVDPTLNKQYATQLQQMCPRNVDPRIAIDMDPTTARKFDNVYYQNL  265

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ+LFTD RSRNTVN FASN+  F   F AA+TKLGR+GV T   G+IR D
Sbjct  266  QQGKGLFTSDQILFTDQRSRNTVNSFASNSNVFNSNFIAAITKLGRVGVKTARNGKIRTD  325

Query  29   CT  24
            C+
Sbjct  326  CS  327



>ref|XP_003550018.1| PREDICTED: peroxidase 50-like [Glycine max]
Length=325

 Score =   411 bits (1057),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 242/302 (80%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  N Y  TCPN+ES+VR AV +KF+QTFVT PATLRLFFHDCFV+GCDASVL+AS  
Sbjct  26   AQLSPNHYAKTCPNLESIVRQAVTKKFQQTFVTVPATLRLFFHDCFVQGCDASVLIASTG  85

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N +AEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQCRNKVSCADILALATRDV++L+GG  
Sbjct  86   NNQAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPQCRNKVSCADILALATRDVIALSGGPS  145

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP     L+QLNS+F  +GLTQTDMIALSGAHT+GFSHC
Sbjct  146  YTVELGRFDGLVSRTSDVNGRLPQPTNNLNQLNSLFAANGLTQTDMIALSGAHTLGFSHC  205

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY     + +DPTLN +Y  QL+QMCP  VDPRIAINMDPTTP  FDN Y++NL
Sbjct  206  SKFASRIY----STPVDPTLNKQYVAQLQQMCPRNVDPRIAINMDPTTPRKFDNVYYQNL  261

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ+LFTDPRSRNTVN FAS++  F   F AAMTKLGR+GV T   G+IR D
Sbjct  262  QQGKGLFTSDQILFTDPRSRNTVNSFASSSNVFNSNFVAAMTKLGRVGVKTARNGKIRTD  321

Query  29   CT  24
            C+
Sbjct  322  CS  323



>gb|KHN28333.1| Peroxidase 73 [Glycine soja]
Length=325

 Score =   411 bits (1057),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 242/302 (80%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  N Y  TCPN+ES+VR AV +KF+QTFVT PATLRLFFHDCFV+GCDASVL+AS  
Sbjct  26   AQLSPNHYAKTCPNLESIVRQAVAKKFQQTFVTVPATLRLFFHDCFVQGCDASVLIASTG  85

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N +AEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQCRNKVSCADILALATRDV++L+GG  
Sbjct  86   NNQAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPQCRNKVSCADILALATRDVIALSGGPS  145

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP     L+QLNS+F  +GLTQTDMIALSGAHT+GFSHC
Sbjct  146  YTVELGRFDGLVSRTSDVNGRLPQPTNNLNQLNSLFAANGLTQTDMIALSGAHTLGFSHC  205

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY     + +DPTLN +Y  QL+QMCP  VDPRIAINMDPTTP  FDN Y++NL
Sbjct  206  SKFASRIY----STPVDPTLNKQYVAQLQQMCPRNVDPRIAINMDPTTPRKFDNVYYQNL  261

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ+LFTDPRSRNTVN FAS++  F   F AAMTKLGR+GV T   G+IR D
Sbjct  262  QQGKGLFTSDQILFTDPRSRNTVNSFASSSNVFNSNFVAAMTKLGRVGVKTARNGKIRTD  321

Query  29   CT  24
            C+
Sbjct  322  CS  323



>gb|AAO45182.1| peroxidase 1 [Artemisia annua]
Length=328

 Score =   411 bits (1057),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/313 (66%), Positives = 241/313 (77%), Gaps = 1/313 (0%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            L  L++  + A AQL+ N+Y N CPNVES+V+ AV  K +QTFVT P TLRLFFHDCFV+
Sbjct  12   LCSLLVFPNIAFAQLKQNYYANICPNVESIVQKAVAAKVKQTFVTIPGTLRLFFHDCFVQ  71

Query  782  GCDASVLL-ASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
            GCDASV++ +S +  AEKDHPDNLSLAGDGFDTVIKAKAAVD+NP CRNKVSCADIL +A
Sbjct  72   GCDASVMIQSSGSNTAEKDHPDNLSLAGDGFDTVIKAKAAVDANPSCRNKVSCADILTMA  131

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
            TRDVV +AGG  Y VELGR DG  ST  SV  NLP     LDQLN++F  +GLTQ DMIA
Sbjct  132  TRDVVKIAGGPSYSVELGRLDGLSSTAASVGGNLPKPNQNLDQLNALFAANGLTQADMIA  191

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC Q + RIY F  ++ +DPTLN  YA QL+Q CP  VDPRIAINMDP T
Sbjct  192  LSGAHTLGFSHCNQFSNRIYNFSKQNPVDPTLNPSYATQLQQQCPKNVDPRIAINMDPNT  251

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            P TFDN Y+KNLQ G+GLF SDQVLFTD RS+ TV  +A++  AF  AF  AMTKLGR+G
Sbjct  252  PRTFDNVYYKNLQNGQGLFTSDQVLFTDTRSKQTVISWANSPTAFNNAFITAMTKLGRVG  311

Query  65   VLTGNLGEIRRDC  27
            V TG  G IR+DC
Sbjct  312  VKTGTKGNIRKDC  324



>ref|XP_009363613.1| PREDICTED: peroxidase 16-like [Pyrus x bretschneideri]
 ref|XP_009368010.1| PREDICTED: peroxidase 16-like [Pyrus x bretschneideri]
Length=327

 Score =   411 bits (1057),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/307 (67%), Positives = 246/307 (80%), Gaps = 0/307 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            S  AQL    Y+ +CPNVES+V +AV+QKF QTFVTAPATLRLFFHDCFV+GCDAS++LA
Sbjct  21   STFAQLHVEHYRKSCPNVESIVLAAVRQKFEQTFVTAPATLRLFFHDCFVQGCDASIMLA  80

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
              N  AEKD+ DNLSLAGDGFDTVIKAKAAVD  P CRNKVSCADILALATRDV+ L GG
Sbjct  81   FRNNSAEKDNSDNLSLAGDGFDTVIKAKAAVDRVPNCRNKVSCADILALATRDVIRLTGG  140

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
             FY VELGR DGR ST  SV+++LP   FK+++L+S+F +HGL+ TD++ALSGAHTIGFS
Sbjct  141  PFYKVELGRLDGRTSTKASVRQHLPHPDFKVEELDSLFAKHGLSLTDLVALSGAHTIGFS  200

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC +   RIY F+ ++ IDPT+N+ YA +LR+ CP  VDPRIA+ MDPTTP  FDN Y+K
Sbjct  201  HCNRFTHRIYNFKSKNRIDPTMNIAYARELRKECPKNVDPRIAVTMDPTTPQRFDNVYYK  260

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQGKGLF SDQ LFTD +SR  VN FA++ AAF++AF AAMTKLGR+G+ TG  GEIR
Sbjct  261  NLQQGKGLFTSDQSLFTDTKSRKIVNKFAADAAAFERAFVAAMTKLGRVGIKTGKQGEIR  320

Query  35   RDCTRPN  15
             +C   N
Sbjct  321  HNCAAVN  327



>ref|XP_009421098.1| PREDICTED: peroxidase 51 [Musa acuminata subsp. malaccensis]
Length=330

 Score =   411 bits (1057),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/328 (65%), Positives = 249/328 (76%), Gaps = 3/328 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             M H +   ++++A  ++ L  +   A+AQLR N+Y N CPNVES+VR AV  KFRQTFVT
Sbjct  1     MAHAKL--VLIAAAAVLILCQIPRFANAQLRQNYYANICPNVESIVRDAVTAKFRQTFVT  58

Query  827   APATLRLFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNP  651
              PATLRLFFHDCFV GCDASV++AS  N  AEKDHPDN+SLAGDGFDTVIKAKAA+D+  
Sbjct  59    VPATLRLFFHDCFVEGCDASVIVASTGNNTAEKDHPDNISLAGDGFDTVIKAKAAIDAVA  118

Query  650   QCRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLN  471
             QCRN VSCADILA+A RDV++LAGG  Y VELGR DG  ST  SV   LP  GF L+QL 
Sbjct  119   QCRNTVSCADILAIAARDVIALAGGPSYAVELGRMDGFTSTAASVTGKLPQPGFNLNQLT  178

Query  470   SMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCP  291
             S+F  +GL+ +DMIALS AHT+GFSHC   A RIY F P++ +DPTLN  YA QL+ MCP
Sbjct  179   SLFAANGLSHSDMIALSAAHTLGFSHCSSFASRIYDFSPQNPVDPTLNRAYAAQLQAMCP  238

Query  290   LRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaaf  111
               VDPR+A+NMDP TP  FDN Y+KNLQQG GLF SDQVLFTD RSR  V+ +A + AAF
Sbjct  239   RDVDPRVAVNMDPVTPRAFDNQYYKNLQQGMGLFTSDQVLFTDARSRPVVDSWAQSVAAF  298

Query  110   qqafaaAMTKLGRIGVLTGNLGEIRRDC  27
              QAF AA+TKLGR+GV TG  G IRRDC
Sbjct  299   DQAFVAAITKLGRVGVKTGANGNIRRDC  326



>gb|ACJ11763.1| class III peroxidase [Gossypium hirsutum]
Length=329

 Score =   411 bits (1056),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/327 (66%), Positives = 254/327 (78%), Gaps = 2/327 (1%)
 Frame = -2

Query  989  NSMVVSAGILVCLVLLVS-SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATL  813
            +S+  S  ++   +L VS +  AQLR NFY N+C NVE++VR  V +KF QTFVT PATL
Sbjct  3    HSLTFSFPVISLKLLFVSGTVSAQLRQNFYANSCSNVEAIVRGEVAKKFSQTFVTVPATL  62

Query  812  RLFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNK  636
            RLFFHDCFV+GCDASV++AS  + KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ P CRNK
Sbjct  63   RLFFHDCFVQGCDASVMIASTGSNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPSCRNK  122

Query  635  VSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGR  456
            VSCADILALATRDV++++GG  Y VELGR DG  ST  SV   LP   F L+QLNS+F  
Sbjct  123  VSCADILALATRDVIAMSGGPSYAVELGRLDGLSSTAASVNGKLPHPTFNLNQLNSLFAA  182

Query  455  HGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDP  276
            +GL+QTDMIALS AHT+GFSHC + + RIY F  ++ +DPTLN  YA QL+QMCP  VDP
Sbjct  183  NGLSQTDMIALSAAHTLGFSHCDKFSNRIYNFSRQNAVDPTLNKDYATQLQQMCPRNVDP  242

Query  275  RIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafa  96
             IAINMDP TP TFDN YF+NLQ+G+GLF SDQVLFTD RSR TV+ +ASN+ AF QAF 
Sbjct  243  SIAINMDPNTPRTFDNVYFQNLQKGQGLFTSDQVLFTDTRSRPTVDAWASNSQAFNQAFI  302

Query  95   aAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             AM+KLGR+GV TG  G IRR+C   N
Sbjct  303  TAMSKLGRVGVKTGRNGNIRRNCAAFN  329



>gb|ACU19256.1| unknown [Glycine max]
Length=325

 Score =   410 bits (1055),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/302 (70%), Positives = 241/302 (80%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  N Y  TCPN+ES+VR AV +KF+QTFVT PATLRLFFHDCFV+GCDASVL+AS  
Sbjct  26   AQLSPNHYAKTCPNLESIVRQAVTKKFQQTFVTVPATLRLFFHDCFVQGCDASVLIASTG  85

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N +AEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQCRNKVSCADILALATRDV++L+GG  
Sbjct  86   NNQAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPQCRNKVSCADILALATRDVIALSGGPS  145

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP     L+QLNS+F  +GLTQTDMIALSGAHT+GFSHC
Sbjct  146  YTVELGRFDGLVSRTSDVNGRLPQPTNNLNQLNSLFAANGLTQTDMIALSGAHTLGFSHC  205

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY     + +DPTLN +Y  QL+QMCP  VDPRIAINMDPTTP  FDN Y++NL
Sbjct  206  SKFASRIY----STPVDPTLNKQYVAQLQQMCPRNVDPRIAINMDPTTPRKFDNVYYQNL  261

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ+LFTDPRSRNTVN FA ++  F   F AAMTKLGR+GV T   G+IR D
Sbjct  262  QQGKGLFTSDQILFTDPRSRNTVNSFAPSSNVFNSNFVAAMTKLGRVGVKTARNGKIRTD  321

Query  29   CT  24
            C+
Sbjct  322  CS  323



>ref|XP_008440361.1| PREDICTED: peroxidase 73-like [Cucumis melo]
Length=329

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 241/301 (80%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQLR NFY N CPNVE++VRS V +KF+QTFVT PATLRLFFHDCFV+GCDASV++AS  
Sbjct  25   AQLRQNFYANICPNVENIVRSEVTKKFQQTFVTVPATLRLFFHDCFVQGCDASVIIASTA  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            + KAEKDHPDNLSLAGDGFDTVIKAKAA+D+ PQCRN+VSCADILALATRDV++L+GG  
Sbjct  85   SNKAEKDHPDNLSLAGDGFDTVIKAKAALDAIPQCRNRVSCADILALATRDVIALSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP   F L+QLNS+F  +GLTQ DMIALS AHT+GFSHC
Sbjct  145  YAVELGRLDGLVSRASDVNGRLPAPTFNLNQLNSLFAANGLTQQDMIALSAAHTVGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
            ++ + RIY F P   +DPTLN  YA QL+ MCP  VDPR+AINMDP TP  FDN YF+NL
Sbjct  205  EKFSNRIYNFAPGRPVDPTLNRTYATQLQAMCPKNVDPRVAINMDPITPRAFDNVYFRNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQG GLF SDQVLF+D RSR TVN +A ++ AF +AF  AMTKLGR+GV TG  G IRRD
Sbjct  265  QQGMGLFTSDQVLFSDGRSRPTVNTWARDSQAFNKAFIQAMTKLGRVGVKTGRNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|NP_001241630.1| uncharacterized protein LOC100804350 precursor [Glycine max]
 gb|ACU23656.1| unknown [Glycine max]
Length=328

 Score =   410 bits (1054),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 210/315 (67%), Positives = 244/315 (77%), Gaps = 1/315 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
             L+ L L      AQL  + Y  TCPNVE++VR AV++KF QTFVT PAT+RLFFHDCFV
Sbjct  12   FLLSLCLYSCPTSAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATIRLFFHDCFV  71

Query  785  RGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDASVL+AS  N KAEKDHPDN+SLAGDGFDTVIKAK AVD+ P CRNKVSCADILAL
Sbjct  72   QGCDASVLVASTKNNKAEKDHPDNVSLAGDGFDTVIKAKEAVDAVPLCRNKVSCADILAL  131

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV+ LAGG FY VELGR DG  S  + V   LP   F L+QLNS+F  +GLTQT+MI
Sbjct  132  ATRDVIELAGGPFYEVELGRFDGLRSKDSDVNGRLPHPEFNLNQLNSLFAANGLTQTEMI  191

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC +   R+Y F+ +S +DPTLN +YA QL+ MCP  VDPRIAI+MDP+
Sbjct  192  ALSGAHTVGFSHCNKFTNRVYNFKSKSRVDPTLNEKYATQLKSMCPRNVDPRIAIDMDPS  251

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP +FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN FAS++  F   FAAAMTKLGR+
Sbjct  252  TPRSFDNVYFKNLQQGKGLFSSDQVLFTDSRSKATVNAFASSSKIFHANFAAAMTKLGRV  311

Query  68   GVLTGNLGEIRRDCT  24
            G+     G IR DC+
Sbjct  312  GIKNAQNGNIRTDCS  326



>ref|XP_010444652.1| PREDICTED: peroxidase 73 [Camelina sativa]
Length=329

 Score =   410 bits (1054),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/321 (66%), Positives = 246/321 (77%), Gaps = 1/321 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S+V+   + + + +   +A AQL+TNFY N+CPNVE +VR+ VQQK +QTFVT PATLRL
Sbjct  5    SLVLVVALSITISMFPDTATAQLKTNFYGNSCPNVEQIVRTVVQQKVKQTFVTIPATLRL  64

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNK+S
Sbjct  65   FFHDCFVNGCDASVMIQSTPTNKAEKDHPDNVSLAGDGFDVVIKAKKALDAIPSCRNKIS  124

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADIL LATRDVV  AGG  YPVELGR DG +ST  SV  NLPG   K+ +LN +F ++ 
Sbjct  125  CADILTLATRDVVVAAGGPSYPVELGRFDGLVSTAASVTGNLPGPNDKVTELNKLFAKNK  184

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQ DMIALS AHT+GF+HC +V  RIY F     +DPTLN  YA +L+  CP +VDPRI
Sbjct  185  LTQEDMIALSAAHTLGFAHCGKVFNRIYNFNRTHSVDPTLNKAYAKELQLACPKKVDPRI  244

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            AINMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RSR TVN +A N+AAF +AF  A
Sbjct  245  AINMDPTTPRKFDNLYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWAKNSAAFNKAFVTA  304

Query  89   MTKLGRIGVLTGNLGEIRRDC  27
            MTKLGR+GV T   G IRRDC
Sbjct  305  MTKLGRVGVKTRRNGNIRRDC  325



>ref|XP_010906276.1| PREDICTED: peroxidase 51-like [Elaeis guineensis]
Length=328

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 247/312 (79%), Gaps = 3/312 (1%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            +CL   +SSA  QLR N+Y   CPNVES+VR+AV +KF+QTFVT PATLRLFFHDCFV+G
Sbjct  15   ICLFPQLSSA--QLRRNYYSKICPNVESIVRNAVTKKFQQTFVTVPATLRLFFHDCFVQG  72

Query  779  CDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            CDASV++AS  N  AEKDHPDNLSLAGDGFDTVIKAK AVD+ PQCRNKVSCADILA+AT
Sbjct  73   CDASVIIASTANNTAEKDHPDNLSLAGDGFDTVIKAKEAVDAVPQCRNKVSCADILAMAT  132

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDVV+LAGG  Y VELGR DG  ST NSV   LP   F L+QLN++F  +GL+Q DMIAL
Sbjct  133  RDVVALAGGPSYAVELGRLDGLSSTANSVNGKLPQPTFNLNQLNALFAANGLSQGDMIAL  192

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            S AHT+GFSHC + A RIY F  ++ +DPTLN  YA QL+ MCP  VDP IA+NMDP TP
Sbjct  193  SAAHTVGFSHCSRFANRIYNFNSQNPVDPTLNKTYASQLQAMCPKNVDPTIAVNMDPITP  252

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
              FDN Y+KNLQQG GLF SDQ LFTDPRSR TVN +A +++AF++AF AA+ KLGR+GV
Sbjct  253  RIFDNQYYKNLQQGMGLFTSDQSLFTDPRSRPTVNSWAQSSSAFEKAFVAAIIKLGRVGV  312

Query  62   LTGNLGEIRRDC  27
             TG+ G IR +C
Sbjct  313  KTGSNGNIRHEC  324



>ref|XP_004141876.1| PREDICTED: peroxidase 73-like [Cucumis sativus]
 ref|XP_004166165.1| PREDICTED: peroxidase 73-like [Cucumis sativus]
 gb|KGN48595.1| Class III peroxidase [Cucumis sativus]
Length=329

 Score =   410 bits (1054),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 240/301 (80%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQLR NFY N CPNVE++VRS V +KF+QTFVT PATLRLFFHDCFV+GCDASV++AS  
Sbjct  25   AQLRQNFYANICPNVENIVRSEVTKKFQQTFVTVPATLRLFFHDCFVQGCDASVIIASTA  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            + KAEKDHPDNLSLAGDGFDTVIKAKAA+D+ PQCRN+VSCADILALATRDV++L+GG  
Sbjct  85   SNKAEKDHPDNLSLAGDGFDTVIKAKAALDAIPQCRNRVSCADILALATRDVIALSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP   F L+QLNS+F  +GLTQ DMIALS AHT+GFSHC
Sbjct  145  YAVELGRLDGLVSKASDVNGRLPAPTFNLNQLNSLFAANGLTQQDMIALSAAHTVGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + + RIY F P   +DPTLN  YA QL+ MCP  VDPR+AINMDP TP  FDN YF+NL
Sbjct  205  GKFSNRIYTFAPGRQVDPTLNRTYATQLQAMCPKNVDPRVAINMDPITPRAFDNVYFRNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQG GLF SDQVLF+D RSR TV+ +A ++ AF +AF  AMTKLGR+GV TG  G IRRD
Sbjct  265  QQGMGLFTSDQVLFSDRRSRPTVDTWARDSKAFNKAFIEAMTKLGRVGVKTGRNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|XP_003597105.1| Peroxidase [Medicago truncatula]
 ref|XP_003611621.1| Peroxidase [Medicago truncatula]
 gb|AES94579.1| peroxidase family protein [Medicago truncatula]
Length=328

 Score =   410 bits (1053),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 252/322 (78%), Gaps = 1/322 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            ++++ + + + L L     HAQL  + YKN+CPNVE++VR AV++KF QTF T PATLRL
Sbjct  5    NLILVSLLFLTLFLHSRPTHAQLSRHHYKNSCPNVENIVREAVKKKFHQTFTTVPATLRL  64

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV+GCD S+L++S P+ +AE+DHPDNLSLAGDGFDTVI+AKAAVD+ P C+NKVS
Sbjct  65   FFHDCFVQGCDGSILVSSTPHNRAERDHPDNLSLAGDGFDTVIQAKAAVDAVPLCQNKVS  124

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILA+ATRDV++LAGG +Y VELGR DG  S  + V   LP  GF L+QLN++F  HG
Sbjct  125  CADILAMATRDVIALAGGPYYEVELGRFDGLRSKDSDVNGKLPEPGFNLNQLNTLFKHHG  184

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQT+MIALSGAHT+GFSHC +   R+Y F+  S +DPTL+L+YA QL+ MCP  VDPR+
Sbjct  185  LTQTEMIALSGAHTVGFSHCNKFTNRVYNFKTTSRVDPTLDLKYAAQLKSMCPRNVDPRV  244

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            A++MDP TP+ FDN YFKNLQ+GKGLF SDQVLFTD RS+  VN FAS+N  F   F AA
Sbjct  245  AVDMDPVTPHAFDNVYFKNLQKGKGLFTSDQVLFTDSRSKAAVNAFASSNKIFHANFVAA  304

Query  89   MTKLGRIGVLTGNLGEIRRDCT  24
            MTKLGR+GV   + G IR DC+
Sbjct  305  MTKLGRVGVKNSHNGNIRTDCS  326



>ref|XP_010531296.1| PREDICTED: peroxidase 50 [Tarenaya hassleriana]
Length=331

 Score =   410 bits (1053),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 217/322 (67%), Positives = 248/322 (77%), Gaps = 1/322 (0%)
 Frame = -2

Query  989  NSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLR  810
            N ++V   + + L LL  +A AQLR NFY N+CPNVE +VR+ VQQK +QTFVT PATLR
Sbjct  6    NLVLVMLCMYMSLCLLPDTASAQLRRNFYANSCPNVEQIVRNVVQQKIQQTFVTIPATLR  65

Query  809  LFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKV  633
            LFFHDCFV GCDASV++AS  N KAEKDHPDNLSLAGDGFDTVIKAK AVD+ P CRNKV
Sbjct  66   LFFHDCFVNGCDASVMIASTGNNKAEKDHPDNLSLAGDGFDTVIKAKQAVDAFPSCRNKV  125

Query  632  SCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRH  453
            SCADILA+ATRDVV LAGG  Y VELGR DG  ST  SV   LP     L++L+S+F ++
Sbjct  126  SCADILAIATRDVVLLAGGPRYEVELGRLDGLSSTAASVGGKLPQPTDDLNKLSSLFAKN  185

Query  452  GLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPR  273
            GL+ TDMIALSGAHT+GF+HC +V  RIY F   S +DPTLN  Y  QL+  CP  VDPR
Sbjct  186  GLSLTDMIALSGAHTLGFAHCTKVFNRIYSFSRTSPVDPTLNKAYVAQLQAACPRNVDPR  245

Query  272  IAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaa  93
            +AINMDPTTP  FDN Y+KNLQQGKGLF SDQVLFTDPRS++TVN +ASN   F QAF  
Sbjct  246  VAINMDPTTPRQFDNVYYKNLQQGKGLFTSDQVLFTDPRSKSTVNQWASNGQLFNQAFTN  305

Query  92   AMTKLGRIGVLTGNLGEIRRDC  27
            AM KLGR+GV TG  G IRRDC
Sbjct  306  AMIKLGRVGVKTGRNGNIRRDC  327



>gb|KHN06005.1| Peroxidase 73 [Glycine soja]
Length=325

 Score =   409 bits (1051),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 215/325 (66%), Positives = 248/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  995  RKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPAT  816
            R N ++V +  L   +  +    AQL  N Y N CPN+ES+VR AV  KF+QTFVT PAT
Sbjct  3    RLNLLLVWSLSLTLFLNYLHPTSAQLSPNHYANICPNLESIVRQAVTNKFQQTFVTVPAT  62

Query  815  LRLFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRN  639
            LRLFFHDCFV+GCDASVL+AS  N +AEKDH DNLSLAGDGFDTVIKAKAAVD+ PQCRN
Sbjct  63   LRLFFHDCFVQGCDASVLIASTGNNQAEKDHQDNLSLAGDGFDTVIKAKAAVDAVPQCRN  122

Query  638  KVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFG  459
            KVSCADILALATRDV++L+GG  Y VELGR DG +S  + V   LP     L+QLNS+F 
Sbjct  123  KVSCADILALATRDVIALSGGPSYTVELGRFDGLVSRASDVNGRLPQPTNNLNQLNSLFA  182

Query  458  RHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVD  279
             +GLTQTDMIALSGAHT+GFSHC + A RIY     + +DPTLN +Y  QL+QMCP  VD
Sbjct  183  ANGLTQTDMIALSGAHTLGFSHCSKFASRIY----STPVDPTLNKQYVAQLQQMCPRNVD  238

Query  278  PRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqaf  99
            PRIAINMDPTTP  FDN Y++NLQQGKGLF SDQ+LFTDPRSRNTVN FAS+   F   F
Sbjct  239  PRIAINMDPTTPRKFDNVYYQNLQQGKGLFTSDQILFTDPRSRNTVNSFASSTNVFNSNF  298

Query  98   aaAMTKLGRIGVLTGNLGEIRRDCT  24
             AAMTKLGR+GV T   G+IR DC+
Sbjct  299  VAAMTKLGRVGVKTARNGKIRTDCS  323



>gb|KHN12986.1| Peroxidase 51 [Glycine soja]
Length=328

 Score =   409 bits (1051),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 243/315 (77%), Gaps = 1/315 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
              + L L      AQL  + Y  TCPNVE++VR AV++KF QTFVT PAT+RLFFHDCFV
Sbjct  12   FFLSLCLYSCPTSAQLSRHHYAKTCPNVENIVREAVKKKFHQTFVTVPATIRLFFHDCFV  71

Query  785  RGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDASVL+AS  N KAEKDHPDN+SLAGDGFDTVIKAK AVD+ P CRNKVSCADILAL
Sbjct  72   QGCDASVLVASTKNNKAEKDHPDNVSLAGDGFDTVIKAKEAVDAVPLCRNKVSCADILAL  131

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV+ LAGG FY VELGR DG  S  + V   LP   F L+QLNS+F  +GLTQT+MI
Sbjct  132  ATRDVIELAGGPFYEVELGRFDGLRSKDSDVNGRLPHPEFNLNQLNSLFAANGLTQTEMI  191

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC +   R+Y F+ +S +DPTLN +YA QL+ MCP  VDPRIAI+MDP+
Sbjct  192  ALSGAHTVGFSHCNKFTNRVYNFKSKSRVDPTLNEKYATQLKSMCPRNVDPRIAIDMDPS  251

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP +FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN FAS++  F   FAAAMTKLGR+
Sbjct  252  TPRSFDNVYFKNLQQGKGLFSSDQVLFTDSRSKATVNAFASSSKIFHANFAAAMTKLGRV  311

Query  68   GVLTGNLGEIRRDCT  24
            G+     G IR DC+
Sbjct  312  GIKNAQNGNIRTDCS  326



>ref|XP_009620453.1| PREDICTED: peroxidase 51-like [Nicotiana tomentosiformis]
Length=327

 Score =   409 bits (1051),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/315 (64%), Positives = 243/315 (77%), Gaps = 1/315 (0%)
 Frame = -2

Query  968  GILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCF  789
             +L   + L     AQLRTN+Y  TCP+VE++VR+ V QK +Q  +T PA LRLFFHDCF
Sbjct  9    AVLSISIFLPELVSAQLRTNYYAKTCPSVETIVRNVVNQKIQQIIITVPAVLRLFFHDCF  68

Query  788  VRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILA  612
            V GCDASV++ S P   AEKDHPDNLSLAGDGFDTV+KAKAA+D+NP C+N+VSCADILA
Sbjct  69   VEGCDASVIITSTPGNTAEKDHPDNLSLAGDGFDTVVKAKAAIDANPSCKNRVSCADILA  128

Query  611  LATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDM  432
            +ATRDV+ L+GG  YPVELGR DG  S  ++V+ NLP   F LDQLNSMF  HGL QTDM
Sbjct  129  IATRDVIELSGGPRYPVELGRLDGFTSKASNVEGNLPKPTFNLDQLNSMFASHGLDQTDM  188

Query  431  IALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDP  252
            IALS AHT+G SHC + + R+Y F P++ +DPTL+  +A QL+QMCP  VDP+I IN+DP
Sbjct  189  IALSAAHTLGASHCNKFSNRLYNFSPKNPVDPTLSKTFAAQLQQMCPKNVDPQIVINLDP  248

Query  251  TTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGR  72
             TPNTFDN YF+NLQ+G GLF SDQVLFTD RS+ TV+ +ASN+  FQ AF  AMTKLGR
Sbjct  249  ITPNTFDNVYFQNLQKGMGLFTSDQVLFTDKRSKGTVDLWASNSKVFQAAFVNAMTKLGR  308

Query  71   IGVLTGNLGEIRRDC  27
            +GV +G  G IRRDC
Sbjct  309  VGVKSGKNGNIRRDC  323



>ref|XP_008787159.1| PREDICTED: peroxidase 50 [Phoenix dactylifera]
Length=328

 Score =   409 bits (1050),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/301 (68%), Positives = 240/301 (80%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQLR N+Y  +CPNVE++VR  V++KF+QTFVT PA LRLFFHDCFV GCDASV++AS  
Sbjct  24   AQLRKNYYAKSCPNVENIVRKVVEKKFKQTFVTVPAVLRLFFHDCFVNGCDASVIVASTA  83

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N  AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P CRN VSCADILA+A RDVV+L+GG  
Sbjct  84   NNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPPCRNNVSCADILAIAARDVVALSGGPS  143

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV  NLP   F LDQL +MF ++GL+Q DM+ALS AHT+GFSHC
Sbjct  144  YEVELGRLDGLSSTAASVNGNLPQPVFNLDQLTAMFAKNGLSQKDMVALSAAHTLGFSHC  203

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + AKRIY F P+S +DPTLN  YA QL+ MCP  VDPRIAINMDP TP TFDN Y+KNL
Sbjct  204  DKFAKRIYSFSPQSSVDPTLNEGYAAQLQSMCPKGVDPRIAINMDPVTPRTFDNQYYKNL  263

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q GKGLF SDQVLFT PRS+  VNF+A + ++FQ+ F +A+TKLGR+GV TG+ G IR D
Sbjct  264  QHGKGLFTSDQVLFTHPRSKPIVNFWAQSPSSFQRGFVSAITKLGRVGVKTGSNGNIRHD  323

Query  29   C  27
            C
Sbjct  324  C  324



>gb|AFY97684.1| peroxidase 1 [Pyrus pyrifolia]
Length=325

 Score =   408 bits (1049),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 211/302 (70%), Positives = 241/302 (80%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+TN+Y N CPNVES+V+ AV +KF+QTFVT P TLRLFFHDCFV GCDASV++AS  
Sbjct  25   AQLKTNYYANICPNVESIVKDAVTKKFQQTFVTVPGTLRLFFHDCFVEGCDASVIVASTA  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKD+PDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L+GG  
Sbjct  85   NNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP + F L+QLNS+F  HGL+Q DM+ALSGA+T+GFSHC
Sbjct  145  YSVELGRLDGLSSTSTSVNGKLPKSTFNLNQLNSLFASHGLSQVDMVALSGANTLGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RIY     + +DPTLN  YA QL+QMCP  VDP IAINMDPTTP TFDN YF+NL
Sbjct  205  NQFSNRIY----SNPVDPTLNKAYATQLQQMCPKNVDPDIAINMDPTTPRTFDNVYFQNL  260

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVLFTD RS+ TV  +A N AAF QAF  AMTKLGR+GV TG  G IRRD
Sbjct  261  VEGKGLFTSDQVLFTDSRSQPTVRRWAKNKAAFNQAFITAMTKLGRVGVKTGKNGNIRRD  320

Query  29   CT  24
            C+
Sbjct  321  CS  322



>ref|XP_004291278.1| PREDICTED: peroxidase 45-like [Fragaria vesca subsp. vesca]
Length=326

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 249/305 (82%), Gaps = 1/305 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR + Y+NTCPNVES+V +AV+QKF QTF TAP TLRLFFHDCFVRGCDASV+LA  N
Sbjct  22   AQLRVDHYRNTCPNVESIVHAAVKQKFEQTFTTAPGTLRLFFHDCFVRGCDASVILAFRN  81

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              AEKD+PD++SLAGDGFDTVI+AKAAVD    CRNKVSCADILA+ATRDV+SL+GG FY
Sbjct  82   KSAEKDNPDDMSLAGDGFDTVIRAKAAVDRVAGCRNKVSCADILAMATRDVISLSGGPFY  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGR DGR+ST  SV+++LP   F++DQL SMF +HGLT TD++ALSGAHTIGFSHC 
Sbjct  142  GVELGRLDGRVSTKTSVRKHLPKPDFRVDQLKSMFAQHGLTLTDLVALSGAHTIGFSHCD  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            +   RI+RF+ ++ +DPT+N+ YA  LR+ CP  VDPR AI +DPTTP  FDN Y+KNLQ
Sbjct  202  RFNHRIHRFKSKNRMDPTMNVGYAMSLRKQCPKNVDPRTAITLDPTTPRRFDNMYYKNLQ  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV-LTGNLGEIRRD  30
            QG+GL  SDQ L+TD R+R+ VNFFA+NN AF+ AF AA+TKLGR+GV  TG  GEIRRD
Sbjct  262  QGRGLLTSDQCLYTDTRTRHIVNFFAANNTAFEHAFVAAITKLGRVGVKTTGKQGEIRRD  321

Query  29   CTRPN  15
            CT  N
Sbjct  322  CTAVN  326



>ref|XP_004147080.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
 ref|XP_004158397.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=329

 Score =   408 bits (1049),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 245/314 (78%), Gaps = 1/314 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +L  L+ +V +  AQLR +FY + CPNVES+VRSAV +KF+QTFVT PATLRLFFHDCFV
Sbjct  11   VLTTLLAVVPTTEAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPATLRLFFHDCFV  70

Query  785  RGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDASV++AS  + KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADIL +
Sbjct  71   QGCDASVMIASDGSNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPGCKNKVSCADILVM  130

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV+SLA G  Y VELGR+DG +S  + V+  LP   F L+QLN+MF  +GL+Q DMI
Sbjct  131  ATRDVISLARGPSYAVELGRKDGLVSRASDVEGKLPQPSFNLNQLNAMFAANGLSQADMI  190

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALS AHT+GFSHC + A RIY F   + +DPT+N  YA +L+ MCP  VDPRIAI+MDP 
Sbjct  191  ALSAAHTVGFSHCSKFANRIYNFSRTNPVDPTINPTYAKKLQDMCPQDVDPRIAIDMDPN  250

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN YFKNLQQG GLF SDQ+LFTD RS++TVN +A +   F  AF  AMTKLGR+
Sbjct  251  TPRRFDNMYFKNLQQGMGLFTSDQILFTDRRSKSTVNIWAHSGRTFYTAFIDAMTKLGRV  310

Query  68   GVLTGNLGEIRRDC  27
            GV TG+ G IR DC
Sbjct  311  GVKTGSDGNIRTDC  324



>ref|XP_010277087.1| PREDICTED: peroxidase 51-like [Nelumbo nucifera]
Length=330

 Score =   407 bits (1046),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 214/316 (68%), Positives = 248/316 (78%), Gaps = 3/316 (1%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            VCL   + SA  QLR ++Y NTCPNVE++VR+ V QKF+QTFVT PATLRLFFHDCFV+G
Sbjct  17   VCLFPQLGSA--QLRRDYYANTCPNVETIVRNVVTQKFQQTFVTVPATLRLFFHDCFVQG  74

Query  779  CDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            CDASV++AS  N +AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADIL++AT
Sbjct  75   CDASVIIASTQNNQAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPSCKNKVSCADILSMAT  134

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDV++L+GG  Y VELGR DG  ST  SV   LP   F L QL S+F  +GLTQ DMIAL
Sbjct  135  RDVIALSGGPSYAVELGRLDGLSSTAASVDGKLPQPTFNLKQLTSLFAANGLTQIDMIAL  194

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            S AHT+GFSHC + A RIY F  ++ +DPTLN  YA QL+ MCP  VDP +AINMDP TP
Sbjct  195  SAAHTVGFSHCSRFANRIYNFSAQNPVDPTLNKAYASQLQGMCPKNVDPSVAINMDPNTP  254

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDN Y+KNLQQG GLF SDQVLFTD RSR TVN +ASN+AAFQ+AF  A+TKLGR+GV
Sbjct  255  RTFDNVYYKNLQQGIGLFTSDQVLFTDARSRPTVNAWASNSAAFQKAFIKAITKLGRVGV  314

Query  62   LTGNLGEIRRDCTRPN  15
             TG+ G IR DC   N
Sbjct  315  KTGSQGNIRSDCAAFN  330



>ref|XP_006393941.1| hypothetical protein EUTSA_v10004576mg [Eutrema salsugineum]
 gb|ESQ31227.1| hypothetical protein EUTSA_v10004576mg [Eutrema salsugineum]
Length=329

 Score =   407 bits (1046),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 245/320 (77%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            MV++  + + + ++  +  AQL+T+FYK++CPNVE  VR+ VQQK +QTFVT PATLRLF
Sbjct  6    MVLAVALCLTISVIPDTTTAQLKTDFYKSSCPNVERTVRTVVQQKVKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASVL+ S P+ KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNKVSC
Sbjct  66   FHDCFVNGCDASVLIQSTPDNKAEKDHPDNVSLAGDGFDVVIKAKKALDAIPSCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDVV  AGG  YPVELGRRDG +ST  SV  NLPG    +D+LN +F ++ L
Sbjct  126  ADILALATRDVVVAAGGKSYPVELGRRDGLVSTAASVHGNLPGPNDNVDKLNKLFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DM+ALS AHT+GF+HC +V  RIY F     +DPTLN  YA  L+  CP  VDPRIA
Sbjct  186  TQEDMVALSAAHTVGFAHCSKVFNRIYNFNRTHSVDPTLNKAYAKDLQAACPKNVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            IN+DP +P  FDN YFKNLQ GKGLF SDQVL+TD RSR TV+ +A N+AAF  AF  AM
Sbjct  246  INIDPVSPRKFDNIYFKNLQNGKGLFTSDQVLYTDRRSRPTVDAWAKNSAAFDAAFGRAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV TG  G IRRDC
Sbjct  306  TKLGRVGVKTGRNGNIRRDC  325



>gb|EYU44477.1| hypothetical protein MIMGU_mgv1a026768mg [Erythranthe guttata]
Length=322

 Score =   407 bits (1045),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 204/305 (67%), Positives = 236/305 (77%), Gaps = 1/305 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR N+Y NTCPNVES+V++AV +KF+QTFVT PA +RLFFHDCFV GCDAS ++AS  
Sbjct  18   AQLRQNYYANTCPNVESIVKTAVTKKFKQTFVTVPAVIRLFFHDCFVSGCDASTIIASAG  77

Query  746  GK-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            G  AEKDHPDNLSLAGDGFDTVIKAK AVD+  +C+NKVSCADILALATRDV+ L+GG  
Sbjct  78   GNTAEKDHPDNLSLAGDGFDTVIKAKQAVDAVSKCKNKVSCADILALATRDVIVLSGGPS  137

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV+ NLP   F L+QLN+MF   GL+Q DMIALS  HT+GFSHC
Sbjct  138  YAVELGRLDGLSSTAASVEGNLPKPTFTLNQLNAMFASRGLSQADMIALSACHTVGFSHC  197

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +   RIY F P S +DPTLN +YA QL+ MCP  VDP+IA++MDPTTP  FDN YFKNL
Sbjct  198  NKFMNRIYNFSPNSSVDPTLNKQYATQLQAMCPRNVDPQIAVDMDPTTPRKFDNVYFKNL  257

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
              GKGLF SDQVLFTD RS+ TVN +A+N+ AF  A   A+TKLGR+GV TG  G IR D
Sbjct  258  IDGKGLFTSDQVLFTDARSKGTVNTWATNSQAFNTALIQALTKLGRVGVKTGTNGNIRFD  317

Query  29   CTRPN  15
            C R N
Sbjct  318  CGRFN  322



>gb|KGN61954.1| hypothetical protein Csa_2G271470 [Cucumis sativus]
Length=361

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 205/314 (65%), Positives = 245/314 (78%), Gaps = 1/314 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +L  L+ +V +  AQLR +FY + CPNVES+VRSAV +KF+QTFVT PATLRLFFHDCFV
Sbjct  43   VLTTLLAVVPTTEAQLRRDFYADVCPNVESIVRSAVTKKFKQTFVTVPATLRLFFHDCFV  102

Query  785  RGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDASV++AS  + KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADIL +
Sbjct  103  QGCDASVMIASDGSNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPGCKNKVSCADILVM  162

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV+SLA G  Y VELGR+DG +S  + V+  LP   F L+QLN+MF  +GL+Q DMI
Sbjct  163  ATRDVISLARGPSYAVELGRKDGLVSRASDVEGKLPQPSFNLNQLNAMFAANGLSQADMI  222

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALS AHT+GFSHC + A RIY F   + +DPT+N  YA +L+ MCP  VDPRIAI+MDP 
Sbjct  223  ALSAAHTVGFSHCSKFANRIYNFSRTNPVDPTINPTYAKKLQDMCPQDVDPRIAIDMDPN  282

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN YFKNLQQG GLF SDQ+LFTD RS++TVN +A +   F  AF  AMTKLGR+
Sbjct  283  TPRRFDNMYFKNLQQGMGLFTSDQILFTDRRSKSTVNIWAHSGRTFYTAFIDAMTKLGRV  342

Query  68   GVLTGNLGEIRRDC  27
            GV TG+ G IR DC
Sbjct  343  GVKTGSDGNIRTDC  356



>ref|XP_002284278.1| PREDICTED: peroxidase 73 [Vitis vinifera]
Length=331

 Score =   407 bits (1045),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 245/318 (77%), Gaps = 3/318 (1%)
 Frame = -2

Query  974  SAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHD  795
            S  + VC+     +A AQL+ N+Y N CPNVE++VR  V  KF+QTFVT PATLRLFFHD
Sbjct  13   SLSLSVCV--FPDTASAQLKQNYYANICPNVENIVRGVVNTKFKQTFVTVPATLRLFFHD  70

Query  794  CFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADI  618
            CFV+GCDASV+++S  +  AEKDHPDNLSLAGDGFDTVIKAKA VD NP CRNKVSCADI
Sbjct  71   CFVQGCDASVIISSTGSNTAEKDHPDNLSLAGDGFDTVIKAKAEVDKNPTCRNKVSCADI  130

Query  617  LALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQT  438
            L +ATRDV++L+GG  Y VELGR DG  ST  SV   LP   F LD+LNS+F   GL+QT
Sbjct  131  LTMATRDVIALSGGPSYAVELGRLDGLSSTSASVNGKLPQPTFNLDKLNSLFAAKGLSQT  190

Query  437  DMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINM  258
            DMIALS AHT+GFSHC + A RIY F   + +DPTL+  YA QL+ MCP  VDPRIAI+M
Sbjct  191  DMIALSAAHTLGFSHCSKFANRIYNFSRENPVDPTLDKTYAAQLQSMCPKNVDPRIAIDM  250

Query  257  DPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKL  78
            DPTTP  FDN Y++NLQQGKGLF SD+VLFTD RS+ TVN +AS++ AFQ AF  A+TKL
Sbjct  251  DPTTPKKFDNVYYQNLQQGKGLFTSDEVLFTDSRSKPTVNTWASSSTAFQTAFVQAITKL  310

Query  77   GRIGVLTGNLGEIRRDCT  24
            GR+GV TG  G IRRDC+
Sbjct  311  GRVGVKTGKNGNIRRDCS  328



>ref|XP_010484504.1| PREDICTED: peroxidase 73-like [Camelina sativa]
Length=329

 Score =   407 bits (1045),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 244/320 (76%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V+   + + + +   +A AQL+TNFY N+CPNVE +VR+ VQQK +QTFVT PATLRLF
Sbjct  6    LVLVVALSLTISMFPDTATAQLKTNFYGNSCPNVEQIVRTVVQQKVKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNK+SC
Sbjct  66   FHDCFVNGCDASVMIQSTPTNKAEKDHPDNVSLAGDGFDVVIKAKKALDAIPSCRNKISC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADIL LATRDVV  AGG  YPVELGR DG +ST  SV  NLPG   K+ +LN +F ++ L
Sbjct  126  ADILTLATRDVVVAAGGPSYPVELGRFDGLVSTAASVTGNLPGPNDKVTELNKLFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V  RIY F     +DPTLN  YA +L+  CP +VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCGKVFNRIYNFNRTHSVDPTLNKAYAKELQLACPKKVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RSR TV+ +A N+ AF +AF  AM
Sbjct  246  INMDPTTPRKFDNLYFKNLQQGKGLFTSDQVLFTDGRSRPTVDAWAKNSVAFNKAFVTAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV T   G IRRDC
Sbjct  306  TKLGRVGVKTRRNGNIRRDC  325



>ref|XP_008340941.1| PREDICTED: peroxidase 51-like [Malus domestica]
Length=325

 Score =   407 bits (1045),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 241/302 (80%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+TN+Y N CPNVES+VR AV +KF+QTFVT P TLRLFFHDCFV GCDASV++AS  
Sbjct  25   AQLKTNYYANICPNVESIVRDAVTKKFQQTFVTVPGTLRLFFHDCFVEGCDASVIVASTA  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKD+PDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L+GG  
Sbjct  85   NNKAEKDNPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP + F L+QLNS+F  HGL+Q DM+ALSGAHT+GFSHC
Sbjct  145  YSVELGRLDGLSSTSTSVNGKLPKSTFNLNQLNSLFASHGLSQADMVALSGAHTLGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RIY     + +DPTLN  YA QL+QMCP  VDP IAI+MDPTTP  FDN YF+NL
Sbjct  205  NQFSNRIY----SNPVDPTLNKTYATQLQQMCPKNVDPDIAIDMDPTTPRKFDNVYFQNL  260

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVL+TD RS+ TV  +A NNAAF QAF  AMTKLGR+G+ TG  G IRRD
Sbjct  261  VEGKGLFTSDQVLYTDSRSQPTVRTWAKNNAAFNQAFITAMTKLGRVGMKTGKNGNIRRD  320

Query  29   CT  24
            C+
Sbjct  321  CS  322



>ref|XP_010905285.1| PREDICTED: peroxidase 35-like [Elaeis guineensis]
Length=328

 Score =   407 bits (1045),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 208/301 (69%), Positives = 243/301 (81%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+ N+Y NTCPNVE++VR  V +KF+QTFVT PA LRLFFHDCFV GCDASV++AS  
Sbjct  24   AQLQQNYYANTCPNVENIVREVVTKKFKQTFVTVPAVLRLFFHDCFVNGCDASVIVASTA  83

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            +  AEKDHPDNLSLAGDGFDTVIKAKAAVD+  QCRNKVSCADILA+ATRDVV+L+GG  
Sbjct  84   DNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVSQCRNKVSCADILAIATRDVVALSGGPS  143

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV  NLP   F LDQL +MFG++GL+Q DMIALS AHT+GFSHC
Sbjct  144  YEVELGRLDGLSSTAASVTGNLPQPEFNLDQLTAMFGKNGLSQEDMIALSAAHTLGFSHC  203

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + AKRIY F  +S +DPTLN  Y  QL+ MCP  VD RIAI+MDP TP TFDN Y+KNL
Sbjct  204  GKFAKRIYSFSQQSSVDPTLNQSYVVQLQSMCPKVVDSRIAIDMDPITPRTFDNQYYKNL  263

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q G GLF SDQVLFTDPRS+  VNF+A++ +AFQ+AF +A+TKLGR+GV TG+ G IR+D
Sbjct  264  QHGMGLFTSDQVLFTDPRSKPAVNFWAASPSAFQRAFVSAITKLGRVGVKTGSDGNIRQD  323

Query  29   C  27
            C
Sbjct  324  C  324



>gb|KEH39756.1| class III peroxidase [Medicago truncatula]
Length=328

 Score =   406 bits (1044),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 250/314 (80%), Gaps = 1/314 (0%)
 Frame = -2

Query  953  LVLLVSSAHA-QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGC  777
            L+ L+++ HA +LR ++Y+NTCPNVES+V++AV+ K +QTFVTAPATLRLFFHDCFV+GC
Sbjct  15   LLQLITNCHATKLRVDYYRNTCPNVESIVKNAVEMKLQQTFVTAPATLRLFFHDCFVQGC  74

Query  776  DASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRD  597
            DASV+LA+ N  +EKD+P NLSLAGDGFDTVIKAKAAVD  P C+NKVSCADILALATRD
Sbjct  75   DASVMLATRNSTSEKDNPINLSLAGDGFDTVIKAKAAVDGVPGCQNKVSCADILALATRD  134

Query  596  VVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSG  417
            V++L GG  Y VELGR DGRIST  SV  +LP   FKL +L  MF  HGLT TD+IALSG
Sbjct  135  VIALTGGPSYAVELGRLDGRISTKASVTNHLPHPEFKLAKLTKMFASHGLTLTDLIALSG  194

Query  416  AHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNT  237
            AHTIGFSHC Q +KRIY F+    IDP+LN+ YA QL+ +CP  VDPR+AI+MDP TP T
Sbjct  195  AHTIGFSHCSQFSKRIYNFKSGKVIDPSLNIGYAKQLQNVCPKDVDPRLAIDMDPITPRT  254

Query  236  FDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLT  57
            FDN Y+KNLQQG GL  SDQ LFT   SRN VN FAS+N AF++AF  A+TKLGRIGV +
Sbjct  255  FDNQYYKNLQQGIGLLSSDQSLFTHKSSRNLVNLFASDNTAFERAFVIAITKLGRIGVKS  314

Query  56   GNLGEIRRDCTRPN  15
            G  GEIR DC+  N
Sbjct  315  GRQGEIRHDCSMIN  328



>ref|XP_006290363.1| hypothetical protein CARUB_v10017623mg [Capsella rubella]
 gb|EOA23261.1| hypothetical protein CARUB_v10017623mg [Capsella rubella]
Length=329

 Score =   406 bits (1044),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 247/316 (78%), Gaps = 3/316 (1%)
 Frame = -2

Query  965  ILVCLVLLV--SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            +++CL + V   +  AQL   FY  TCPNVE +VR+AVQ+K +QTFVT PATLRLFFHDC
Sbjct  10   VVLCLTISVFPDTTTAQLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLFFHDC  69

Query  791  FVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADIL  615
            FV GCDASV++ S P  KAEKDHPDN+SLAGDGFD V++AK A+D+NPQCRNKVSCADIL
Sbjct  70   FVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVMQAKKALDANPQCRNKVSCADIL  129

Query  614  ALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTD  435
             LATRDVV  AGG  Y VELGR DG +ST +SV+ NLPG    +D+LN++F ++ LTQ D
Sbjct  130  TLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFKKNKLTQED  189

Query  434  MIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMD  255
            MIALS AHT+GF+HC +V KRIY F   + +DPTLN  YA +L++ CP  VDPRIAINMD
Sbjct  190  MIALSAAHTLGFAHCGKVFKRIYNFNGINSVDPTLNKAYAIELQKACPKNVDPRIAINMD  249

Query  254  PTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLG  75
            P TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TVN +ASN+ AF +AF  A+TKLG
Sbjct  250  PVTPKTFDNTYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWASNSTAFNRAFVTAITKLG  309

Query  74   RIGVLTGNLGEIRRDC  27
            R+GV   + G IRRDC
Sbjct  310  RVGVKNSHNGNIRRDC  325



>emb|CDP02582.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   406 bits (1044),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 226/332 (68%), Positives = 259/332 (78%), Gaps = 8/332 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVV---SAGILVCLVL-LVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQ  840
             M+  R +++V+   S  ++ CL   LVS   AQL+ N+Y N CPNVES+VR+AV QKF+Q
Sbjct  1     MDRHRLSNVVITVFSLSLVACLSPDLVS---AQLKRNYYANICPNVESIVRNAVTQKFQQ  57

Query  839   TFVTAPATLRLFFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAV  663
             TFVT P TLRLFFHDCFV GCDASV++AS PN KAEKDHPDNLSLAGDGFDTVIKAKAAV
Sbjct  58    TFVTVPGTLRLFFHDCFVNGCDASVIIASTPNNKAEKDHPDNLSLAGDGFDTVIKAKAAV  117

Query  662   DSNPQCRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKL  483
             D+   CRNKVSCADILA+A RDV++LAGG  Y VELGR DG  ST +SV   LP   F L
Sbjct  118   DAVASCRNKVSCADILAMAARDVIALAGGPSYAVELGRLDGLSSTASSVNGKLPQPSFNL  177

Query  482   DQLNSMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLR  303
             +QLN++F  HGL+QTDMIALSGAHT+GFSHC + A RIY F P++ IDPTLN  YA QL+
Sbjct  178   NQLNAIFAAHGLSQTDMIALSGAHTVGFSHCNRFANRIYNFSPQNPIDPTLNRAYASQLQ  237

Query  302   QMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasn  123
              MCP  V+P IAINMDPTTP TFDN YF+NL  GKGLF SDQVLFTD RS+ TVN +ASN
Sbjct  238   AMCPRVVNPTIAINMDPTTPRTFDNVYFQNLVTGKGLFTSDQVLFTDSRSKPTVNAWASN  297

Query  122   naafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
               AFQ AF AAMTKLGR+GV TG  G IRRDC
Sbjct  298   PQAFQNAFVAAMTKLGRVGVKTGRNGNIRRDC  329



>gb|AAB41812.1| peroxidase, partial [Medicago sativa]
Length=325

 Score =   406 bits (1043),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 251/322 (78%), Gaps = 1/322 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            ++++   + + L L     HAQL  + YKN+CPNVE++VR AV++KF QTF T PATLRL
Sbjct  2    NLILVPLLFLTLFLHSCRTHAQLSRHHYKNSCPNVENIVRQAVKKKFHQTFTTVPATLRL  61

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV+GCD S+L+AS P+ +AE+DHPDNLSLAGDGFDTVI+AKAAVD+ P C+NKVS
Sbjct  62   FFHDCFVQGCDGSILVASTPHNRAERDHPDNLSLAGDGFDTVIQAKAAVDAVPLCQNKVS  121

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILA+ATRDV++LAGG +Y VELGR DG  S  + V   LP  GF L+QLN++F  HG
Sbjct  122  CADILAMATRDVIALAGGPYYEVELGRFDGLRSKDSDVNGKLPEPGFNLNQLNTLFKHHG  181

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQT+MIALSGAHT+GFSHC +   R+Y F+  S +DPTL+L YA +L+ MCP  VDPR+
Sbjct  182  LTQTEMIALSGAHTVGFSHCNKFTNRVYNFKTTSRVDPTLDLHYAAKLKSMCPRDVDPRV  241

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            A++MDP TP+ FDN YFKNLQ+GKGLF SDQVLFTD RS+  VN FAS+N  F+  F AA
Sbjct  242  AVDMDPITPHAFDNVYFKNLQKGKGLFTSDQVLFTDSRSKAAVNAFASSNKIFRANFVAA  301

Query  89   MTKLGRIGVLTGNLGEIRRDCT  24
            MTKLGR+GV   + G IR DC+
Sbjct  302  MTKLGRVGVKNSHNGNIRTDCS  323



>ref|XP_008792666.1| PREDICTED: peroxidase 51-like [Phoenix dactylifera]
Length=328

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/316 (67%), Positives = 246/316 (78%), Gaps = 3/316 (1%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            +CL   +SSA  QLR N+Y N CPNVES+VR+AV +KF+QTFVT PATLRLFFHDCFV+G
Sbjct  15   ICLFPQLSSA--QLRRNYYANICPNVESIVRNAVTKKFQQTFVTVPATLRLFFHDCFVQG  72

Query  779  CDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            CDASV++AS  N  AEKDHPDNLSLAGDGFDTVIKAK AVD+ PQCRNKVSCADILA+AT
Sbjct  73   CDASVIIASTANNTAEKDHPDNLSLAGDGFDTVIKAKEAVDAVPQCRNKVSCADILAMAT  132

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDVV+LAGG  Y VELGR DG  ST  SV   LP   F L+QL+++F  +GL+Q DMIAL
Sbjct  133  RDVVALAGGPSYAVELGRLDGLSSTAKSVNGKLPQPTFDLNQLSAIFAANGLSQADMIAL  192

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            S AHT+GFSHC + A RIY F  ++ +DPTLN  YA QL+ MCP  VDP IA+NMDP TP
Sbjct  193  SAAHTVGFSHCSRFANRIYDFSSQNPVDPTLNQTYAAQLQAMCPKNVDPTIAVNMDPITP  252

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDN Y+KNLQ G GLF SDQ LFTD RSR TVN +A +++AF++AF AA+ KLGR GV
Sbjct  253  RTFDNQYYKNLQHGMGLFTSDQALFTDSRSRPTVNSWAQSSSAFEKAFIAAIIKLGRTGV  312

Query  62   LTGNLGEIRRDCTRPN  15
             TG+ G IR DC   N
Sbjct  313  KTGSNGNIRHDCATFN  328



>ref|XP_010515362.1| PREDICTED: peroxidase 35 [Camelina sativa]
Length=329

 Score =   405 bits (1042),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 245/320 (77%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            MV+   + + + +   +  AQL   FY  TCPNVE +VR+AVQ+K +QTFVT PATLRLF
Sbjct  6    MVLVVALCLTISVFPDTTTAQLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VI+AK A+D+NP CRNK+SC
Sbjct  66   FHDCFVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVIQAKKALDANPHCRNKISC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADIL LATRDVV  AGG  Y VELGR DG +ST +SV+ NLPG    +D+LN++F ++ L
Sbjct  126  ADILTLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFKKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V KRIY F   + +DPTLN  YA +L++ CP  VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCGKVFKRIYNFNGINSVDPTLNKAYAIELQKACPKNVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TVN +ASN+ AF +AF  AM
Sbjct  246  INMDPVTPKTFDNTYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWASNSTAFNRAFVTAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV     G IRRDC
Sbjct  306  TKLGRVGVKNSRNGNIRRDC  325



>ref|XP_002866704.1| peroxidase 73 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42963.1| peroxidase 73 [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 242/320 (76%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V+   + + + +L  +  AQL+TNFY  +CPNVE +V+  V QK +QTFVT PATLRLF
Sbjct  6    LVLVVALSITISMLPDTTTAQLKTNFYGKSCPNVEKIVKQVVNQKIKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S PN KAEKDHPDNLSLAGDGFD VIKAK A+D+ P C+NKVSC
Sbjct  66   FHDCFVNGCDASVMIQSTPNNKAEKDHPDNLSLAGDGFDVVIKAKKAIDAIPSCKNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADIL LATRDVV  AGG  Y VELGR DG +ST  SV  NLPG  FK+ +LN++F ++ L
Sbjct  126  ADILTLATRDVVVAAGGPSYTVELGRFDGLVSTAASVNGNLPGPNFKVTELNALFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V  RIY F     +DPT+N  YA +L+  CP +VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCGKVFNRIYNFNRTHSVDPTINKAYAKELQLACPKKVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RSR TVN +A +  AF +AF  AM
Sbjct  246  INMDPTTPRKFDNIYFKNLQQGKGLFTSDQVLFTDGRSRPTVNDWAKDPVAFNKAFVTAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV T   G IRRDC
Sbjct  306  TKLGRVGVKTRRNGNIRRDC  325



>ref|XP_010426527.1| PREDICTED: peroxidase 35-like [Camelina sativa]
Length=329

 Score =   405 bits (1041),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 245/320 (77%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            MV+   + + + +   +  AQL   FY  TCPNVE +VR+AVQ+K +QTFVT PATLRLF
Sbjct  6    MVLVVALCLTISVFPDTTTAQLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VI+AK A+D+NP CRNKVSC
Sbjct  66   FHDCFVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVIQAKKALDANPHCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADIL LATRDVV  AGG  Y VELGR DG +ST +SV+ NLPG    +D+LN++F ++ L
Sbjct  126  ADILTLATRDVVVGAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFKKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V KRIY F   + +DPTLN  YA +L++ CP  VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCGKVFKRIYNFNGINSVDPTLNKAYAIELQKACPKNVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TVN +ASN+ AF +AF  AM
Sbjct  246  INMDPVTPKTFDNTYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWASNSTAFNRAFVTAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV     G IRRDC
Sbjct  306  TKLGRVGVKNSRNGNIRRDC  325



>ref|XP_008367710.1| PREDICTED: peroxidase 16-like [Malus domestica]
Length=326

 Score =   405 bits (1040),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 243/307 (79%), Gaps = 0/307 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            S  AQL    Y+ +CPNVES+V +AV+ KF QTFVTAPATLRLFFHDCFV+GCDAS++LA
Sbjct  20   STFAQLHVEHYRKSCPNVESIVHAAVKLKFEQTFVTAPATLRLFFHDCFVQGCDASIMLA  79

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
              N  AEKD+ DNLSLAGDGFDTVIKAKAAVD  P CRNKVSCADILALATRDV+ L GG
Sbjct  80   FRNNSAEKDNSDNLSLAGDGFDTVIKAKAAVDRVPNCRNKVSCADILALATRDVIRLTGG  139

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
             FY VELGR DGR ST  SV+++LP   F +++L+S+F +HGL+ TD++ALSGAHTIGFS
Sbjct  140  PFYKVELGRLDGRTSTKASVRQHLPHPDFNVEELDSLFAKHGLSLTDLVALSGAHTIGFS  199

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC +   RIY F+ ++ IDPT+N+ YA +LR+ CP  VDPRIA+ MDP TP  FDN Y+K
Sbjct  200  HCNRFTHRIYNFKSKNRIDPTMNVAYARELRKECPKNVDPRIAVTMDPXTPQRFDNVYYK  259

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQGKGLF SDQ LFTD +SR  VN FA++ AAF++AF AAMTKLGR+G+ TG  GEIR
Sbjct  260  NLQQGKGLFTSDQSLFTDTKSRKIVNLFAADAAAFERAFVAAMTKLGRVGIKTGKQGEIR  319

Query  35   RDCTRPN  15
             +C   N
Sbjct  320  HNCAAVN  326



>ref|XP_010111940.1| Peroxidase 45 [Morus notabilis]
 gb|EXC32058.1| Peroxidase 45 [Morus notabilis]
Length=326

 Score =   405 bits (1040),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/306 (67%), Positives = 245/306 (80%), Gaps = 0/306 (0%)
 Frame = -2

Query  944  LVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASV  765
            + S++HAQL  ++YKN+CPNVES+VR+AV++K + +  TAP TLRLFFHDCFVRGCDASV
Sbjct  17   ISSTSHAQLSKDYYKNSCPNVESIVRTAVERKVQLSIATAPGTLRLFFHDCFVRGCDASV  76

Query  764  LLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +L S N  AEKD+ D+LSLAGDGFDTVIKAK AV+  P CR KVSCADILALA RDVV L
Sbjct  77   MLFSWNSTAEKDNSDDLSLAGDGFDTVIKAKEAVERVPGCRQKVSCADILALAARDVVRL  136

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
             GG  Y VELGRRDGRIST  SV+  LP   F++ +L SMF  HGL+ TD++ALSGAHTI
Sbjct  137  KGGPSYEVELGRRDGRISTKASVRHQLPHPEFRVKKLKSMFASHGLSLTDLVALSGAHTI  196

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC  + KR+Y F+ ++ IDPTLNL+YA +L++ CP  VDPRI + MDP++P  FDN 
Sbjct  197  GFAHCSFIDKRVYSFKSKTRIDPTLNLQYAKELKRQCPENVDPRIVVGMDPSSPQKFDNE  256

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y+KNLQQGKGLF SDQ LFTD ++R  VN FASNN AFQ+AF  AMTKLGRIGVLTGN G
Sbjct  257  YYKNLQQGKGLFTSDQTLFTDKKARVIVNQFASNNTAFQEAFVNAMTKLGRIGVLTGNRG  316

Query  44   EIRRDC  27
            EIRR+C
Sbjct  317  EIRRNC  322



>ref|XP_010503665.1| PREDICTED: peroxidase 35-like [Camelina sativa]
Length=329

 Score =   404 bits (1039),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 208/320 (65%), Positives = 244/320 (76%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            MV+   + + + +   +  AQL   FY  TCPNVE +VR+AVQ+K +QTFVT PATLRLF
Sbjct  6    MVLVVALCLTISVFPDTTTAQLSRGFYSKTCPNVEQIVRNAVQKKVKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VI AK A+D+NP CRNKVSC
Sbjct  66   FHDCFVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVILAKKALDANPHCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADIL LATRDVV  AGG  Y VELGR DG +ST +SV+ NLPG    +D+LN++F ++ L
Sbjct  126  ADILTLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFKKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V KRIY F   + +DPTLN  YA +L++ CP  VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCGKVFKRIYNFNGINSVDPTLNKAYAIELQKACPKNVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TVN +ASN+ AF +AF  AM
Sbjct  246  INMDPVTPKTFDNTYFKNLQQGKGLFTSDQVLFTDGRSRPTVNVWASNSTAFNRAFVTAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV     G IRRDC
Sbjct  306  TKLGRVGVKNSRNGNIRRDC  325



>ref|XP_010464099.1| PREDICTED: peroxidase 73-like [Camelina sativa]
Length=329

 Score =   404 bits (1039),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 241/318 (76%), Gaps = 5/318 (2%)
 Frame = -2

Query  965  ILVCLVLLVS----SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFH  798
            I+V L L +S    +  AQL+TNFY   CPNVE +VR+ VQQK +QTFVT PATLRLFFH
Sbjct  8    IVVALSLTISMFPDTTTAQLKTNFYGKVCPNVEQIVRTVVQQKVKQTFVTIPATLRLFFH  67

Query  797  DCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCAD  621
            DCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNK+SCAD
Sbjct  68   DCFVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVIKAKKALDAIPSCRNKISCAD  127

Query  620  ILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQ  441
            IL LATRDVV  AGG  YPVELGR DG +ST  SV  NLPG   K+ +LN +F ++ LTQ
Sbjct  128  ILTLATRDVVVAAGGPSYPVELGRFDGLVSTAASVTGNLPGPNDKVTELNKLFAKNKLTQ  187

Query  440  TDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAIN  261
             DMIALS AHT+GF+HC +V  RIY F     +DPTLN  YA +L+  CP +VDPRIAIN
Sbjct  188  EDMIALSAAHTLGFAHCGKVFNRIYNFNRTHSVDPTLNKAYAKELQAACPKKVDPRIAIN  247

Query  260  MDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTK  81
            MDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RSR TVN +A N+ AF +AF  AMTK
Sbjct  248  MDPTTPRKFDNLYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWAKNSVAFNKAFVTAMTK  307

Query  80   LGRIGVLTGNLGEIRRDC  27
            LGR+GV T   G IRRDC
Sbjct  308  LGRVGVKTRRNGNIRRDC  325



>ref|NP_190565.1| peroxidase 35 [Arabidopsis thaliana]
 sp|Q96510.1|PER35_ARATH RecName: Full=Peroxidase 35; Short=Atperox P35; AltName: Full=ATP21a; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA67339.1| peroxidase [Arabidopsis thaliana]
 emb|CAB62104.1| peroxidase ATP21a [Arabidopsis thaliana]
 dbj|BAE99565.1| peroxidase ATP21a [Arabidopsis thaliana]
 gb|AEE78611.1| peroxidase 35 [Arabidopsis thaliana]
Length=329

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/316 (66%), Positives = 246/316 (78%), Gaps = 3/316 (1%)
 Frame = -2

Query  965  ILVCLVLLV--SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            I +CL++ V   +  AQL   FY  TCPNVE +VR+AVQ+K ++TFV  PATLRLFFHDC
Sbjct  10   IGLCLIISVFPDTTTAQLSRGFYSKTCPNVEQIVRNAVQKKIKKTFVAVPATLRLFFHDC  69

Query  791  FVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADIL  615
            FV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VI+AK A+DSNP CRNKVSCADIL
Sbjct  70   FVNGCDASVMIQSTPKNKAEKDHPDNISLAGDGFDVVIQAKKALDSNPSCRNKVSCADIL  129

Query  614  ALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTD  435
             LATRDVV  AGG  Y VELGR DG +ST +SV+ NLPG    +D+LN++F ++ LTQ D
Sbjct  130  TLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFTKNKLTQED  189

Query  434  MIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMD  255
            MIALS AHT+GF+HC +V KRI++F   + +DPTLN  YA +L++ CP  VDPRIAINMD
Sbjct  190  MIALSAAHTLGFAHCGKVFKRIHKFNGINSVDPTLNKAYAIELQKACPKNVDPRIAINMD  249

Query  254  PTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLG  75
            P TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TVN +ASN+ AF +AF  AMTKLG
Sbjct  250  PVTPKTFDNTYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWASNSTAFNRAFVIAMTKLG  309

Query  74   RIGVLTGNLGEIRRDC  27
            R+GV   + G IRRDC
Sbjct  310  RVGVKNSSNGNIRRDC  325



>ref|NP_001242402.1| uncharacterized protein LOC100817540 precursor [Glycine max]
 gb|ACU21352.1| unknown [Glycine max]
Length=325

 Score =   404 bits (1037),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/325 (66%), Positives = 245/325 (75%), Gaps = 5/325 (2%)
 Frame = -2

Query  995  RKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPAT  816
            R N ++V +  L   +  +    AQL  N Y N CPN+ES+VR AV  K +QTFVT PAT
Sbjct  3    RLNLLLVWSLSLTLFLNYLHPTSAQLSPNHYANICPNLESIVRQAVTNKSQQTFVTVPAT  62

Query  815  LRLFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRN  639
            LRLFFHDCFV+GCDASVL+AS  N +AEKDH DNLSLAGDGFDTVIKAKAAVD+ PQCRN
Sbjct  63   LRLFFHDCFVQGCDASVLIASTGNNQAEKDHQDNLSLAGDGFDTVIKAKAAVDAVPQCRN  122

Query  638  KVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFG  459
            KVSCADILALATRDV++L+ G  Y VELGR DG +S    V   LP     L+QLNS+F 
Sbjct  123  KVSCADILALATRDVIALSSGPSYTVELGRFDGLVSRATDVNGRLPQPTNNLNQLNSLFA  182

Query  458  RHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVD  279
             +GLTQTDMIALSGAHT+GFSHC + A RIY     + +DPTLN +Y  QL+QMCP  VD
Sbjct  183  ANGLTQTDMIALSGAHTLGFSHCSKFASRIY----STPVDPTLNKQYVAQLQQMCPRNVD  238

Query  278  PRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqaf  99
            PRIAINMDPTTP  FDN Y++NLQQGKGLF SDQ+LFTDPRSRNTVN FAS+   F   F
Sbjct  239  PRIAINMDPTTPRKFDNVYYQNLQQGKGLFTSDQILFTDPRSRNTVNSFASSTNVFNSNF  298

Query  98   aaAMTKLGRIGVLTGNLGEIRRDCT  24
             AAMTKLGR+GV T   G+IR DC+
Sbjct  299  VAAMTKLGRVGVKTARNGKIRTDCS  323



>ref|XP_004498581.1| PREDICTED: peroxidase 45-like [Cicer arietinum]
Length=326

 Score =   403 bits (1036),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 249/317 (79%), Gaps = 1/317 (0%)
 Frame = -2

Query  962  LVCLVLLVSSAHA-QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            L  L L+ S+ HA +L  ++YKNTCPNVES+V +AV+ K +QTFVTAPATLRLFFHDCFV
Sbjct  10   LFLLQLIASTCHAAKLSIDYYKNTCPNVESIVHNAVEMKLQQTFVTAPATLRLFFHDCFV  69

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
            +GCDASV+LAS N  +EKD+P NLSLAGDGFDTVIKAKAAVDS P C+NKVSCADILALA
Sbjct  70   QGCDASVMLASRNSTSEKDNPINLSLAGDGFDTVIKAKAAVDSVPGCQNKVSCADILALA  129

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
            TRDV++L GG  Y VELGR DGRIST  SV  +LP   +KL +L  MF  HGLT TD+IA
Sbjct  130  TRDVIALTGGPSYEVELGRLDGRISTKASVTNHLPHPEYKLAKLTKMFASHGLTLTDLIA  189

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHTIGFSHC Q +KRIY F+    IDP+LN  YA QL+Q+CP  VDPR+AI++DPTT
Sbjct  190  LSGAHTIGFSHCSQFSKRIYNFRSGKIIDPSLNPSYAKQLQQVCPKDVDPRLAIDLDPTT  249

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            P TFDN Y+KNLQ+G GL  SDQ LFT   S++ VN FASNN AF+++F  A+TKLGRIG
Sbjct  250  PRTFDNQYYKNLQKGIGLLSSDQSLFTHKSSKSLVNLFASNNTAFEKSFVIAITKLGRIG  309

Query  65   VLTGNLGEIRRDCTRPN  15
            V T + GEIR +C   N
Sbjct  310  VKTASQGEIRHNCAMIN  326



>ref|XP_006404085.1| hypothetical protein EUTSA_v10010538mg [Eutrema salsugineum]
 gb|ESQ45538.1| hypothetical protein EUTSA_v10010538mg [Eutrema salsugineum]
Length=329

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/321 (64%), Positives = 242/321 (75%), Gaps = 1/321 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            SMV+   + V + +L     AQL  NFY  TCPN+E +VR+ VQ+K +QTFVT PATLRL
Sbjct  5    SMVLVVALCVTIFVLPDPTTAQLSRNFYSKTCPNIEQIVRNVVQKKVKQTFVTIPATLRL  64

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VI+AK A+D+NP+CRNKVS
Sbjct  65   FFHDCFVNGCDASVMIQSTPKNKAEKDHPDNVSLAGDGFDVVIQAKKALDANPRCRNKVS  124

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADIL LATRDVV  AGG  Y VELGR DG +ST +SVQ NLPG    +++LN++F ++ 
Sbjct  125  CADILTLATRDVVVAAGGPSYEVELGRFDGLVSTASSVQGNLPGPSDNVNKLNALFKKNK  184

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQ DMIALS AHT+GF+HC +V KRIY F     +DPTLN  YA  L+  CP  VDPRI
Sbjct  185  LTQEDMIALSAAHTLGFAHCGKVFKRIYNFNRTMSVDPTLNKAYAKDLQMACPKNVDPRI  244

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            AINMDP TP  FDN YFKNLQQGKGLF SDQVLFTD RSR TVN +A ++ AF +AF  A
Sbjct  245  AINMDPVTPKKFDNVYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWARDSKAFNRAFVTA  304

Query  89   MTKLGRIGVLTGNLGEIRRDC  27
            MTKLGR+GV     G IRRDC
Sbjct  305  MTKLGRVGVKNSRNGNIRRDC  325



>ref|XP_007047481.1| Class III peroxidase [Theobroma cacao]
 gb|EOX91638.1| Class III peroxidase [Theobroma cacao]
Length=330

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/304 (68%), Positives = 238/304 (78%), Gaps = 1/304 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            +A AQL+ N+Y N CPNVE++VR AV +KF QTFVT PAT+RLFFHDC V+GCDASV++ 
Sbjct  23   TASAQLKRNYYANICPNVENIVRGAVAKKFSQTFVTVPATIRLFFHDCVVQGCDASVIIT  82

Query  755  SPNGK-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAG  579
            S  G  AEKDHPDNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADILA+ATRD ++LAG
Sbjct  83   SSGGNTAEKDHPDNLSLAGDGFDTVIKAKEAVDAVPSCRNKVSCADILAMATRDAIALAG  142

Query  578  GAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGF  399
            G  Y VELGR DG  ST  SV   LP   F L+QLNS+F  HGL Q DMIALS AHT+GF
Sbjct  143  GPSYAVELGRLDGLSSTAASVNGKLPQPFFNLNQLNSLFAAHGLNQADMIALSAAHTVGF  202

Query  398  SHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYF  219
            SHC + A RI  F  ++ +DPTLN  YA QL+QMCP  VDPRIAINMDP TP  FDN Y+
Sbjct  203  SHCSKFANRINNFSRQNPVDPTLNRAYASQLQQMCPRNVDPRIAINMDPNTPTKFDNVYY  262

Query  218  KNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEI  39
            +NLQQGKGLF SDQVLFTD RS+ TVN +A+N+ AFQQAF  A+TKLGR+GV TG  G I
Sbjct  263  QNLQQGKGLFTSDQVLFTDQRSKPTVNAWATNSQAFQQAFVTAITKLGRVGVKTGKNGNI  322

Query  38   RRDC  27
            RR+C
Sbjct  323  RRNC  326



>ref|XP_002877713.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53972.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=329

 Score =   403 bits (1036),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 246/316 (78%), Gaps = 3/316 (1%)
 Frame = -2

Query  965  ILVCLVLLV--SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            I +CL + V   +  AQL   FY  TCPNVE +VR+AVQ+K +QTFVT PATLRLFFHDC
Sbjct  10   ISLCLTISVLPDTTIAQLSRGFYSKTCPNVEQIVRNAVQKKIKQTFVTVPATLRLFFHDC  69

Query  791  FVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADIL  615
            FV GCDASV++ S P  KAE+DHPDN+SLAGDGFD VI+AK A+D+NP+C+NKVSCADIL
Sbjct  70   FVNGCDASVMIQSTPTNKAERDHPDNISLAGDGFDVVIQAKKALDANPRCQNKVSCADIL  129

Query  614  ALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTD  435
             LATRDVV  AGG  Y VELGR DG +ST +SV+ NLPG    +D+LN++F ++ LTQ D
Sbjct  130  TLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFKKNKLTQED  189

Query  434  MIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMD  255
            MIALS AHT+GF+HC++V KRIY F   + +DP+LN  YA +L++ CP  VDPRIAINMD
Sbjct  190  MIALSAAHTLGFAHCRKVFKRIYNFNGINSVDPSLNKAYAIELQKACPKNVDPRIAINMD  249

Query  254  PTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLG  75
            P TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TVN +ASN+ AF +AF  AMTKLG
Sbjct  250  PVTPKTFDNTYFKNLQQGKGLFTSDQVLFTDGRSRPTVNAWASNSTAFNRAFVTAMTKLG  309

Query  74   RIGVLTGNLGEIRRDC  27
            R+GV     G IRRDC
Sbjct  310  RVGVKNSRNGNIRRDC  325



>ref|XP_011013593.1| PREDICTED: peroxidase 73-like [Populus euphratica]
Length=331

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 239/301 (79%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQLR N+Y ++CP VES+VR  VQ K +QTFVT PATLRLFFHDCFV+GCDASV++AS  
Sbjct  27   AQLRQNYYASSCPKVESIVRGVVQNKIKQTFVTIPATLRLFFHDCFVQGCDASVIVASTA  86

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
              KAEKDH DNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADILA+ATRDV++L+GG  
Sbjct  87   TNKAEKDHSDNLSLAGDGFDTVIKAKAAVDATPGCKNKVSCADILAIATRDVIALSGGPS  146

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            YPVELGR DG  ST  SV   LP   F L+QL +MF  +GL+QTDMIALS AHT+GFSHC
Sbjct  147  YPVELGRLDGLSSTAASVNGKLPQPTFSLNQLTAMFAANGLSQTDMIALSAAHTVGFSHC  206

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + AKRIY F  +  IDPTLN  YA  L+ +CP +VD RIAINMDP TP TFDN Y+KNL
Sbjct  207  SRFAKRIYSFSRKGPIDPTLNRTYAKTLQTLCPKKVDSRIAINMDPNTPRTFDNMYYKNL  266

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             QG GLF SDQVLFTDPRS+ TV  +A+++ AF+QAF  AMTKLGR+GV +G  G+IR+D
Sbjct  267  VQGMGLFTSDQVLFTDPRSKPTVTKWAADSQAFRQAFITAMTKLGRVGVKSGRNGKIRQD  326

Query  29   C  27
            C
Sbjct  327  C  327



>ref|XP_004511856.1| PREDICTED: peroxidase 51-like [Cicer arietinum]
Length=328

 Score =   402 bits (1032),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 248/319 (78%), Gaps = 6/319 (2%)
 Frame = -2

Query  965  ILVCLVLLVSSAH-----AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFF  801
            ILV L+ L    H     +QL  + Y N+CPNVE++VR AV++KF QTFVT PATLRLFF
Sbjct  7    ILVYLLFLTLCLHPCPTYSQLSRHHYANSCPNVENIVREAVKKKFHQTFVTVPATLRLFF  66

Query  800  HDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCA  624
            HDCFV+GCD S+L++S  + +AE+DHPDNLSLAGDGFDTVIKAK AVD+ P C NKVSCA
Sbjct  67   HDCFVQGCDGSILVSSTAHNRAERDHPDNLSLAGDGFDTVIKAKEAVDAVPLCMNKVSCA  126

Query  623  DILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLT  444
            DILA+ATRDV++LAGG +Y VELGR DG  S  + V   LP  GF L+QLNS+F  +GLT
Sbjct  127  DILAMATRDVIALAGGPYYEVELGRFDGLRSKDSDVSGRLPQPGFNLNQLNSLFANNGLT  186

Query  443  QTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAI  264
            QT+MIALSGAHT+GFSHC + + R+Y F  +S +DPTL+L+YA +L+ MCP  VDPR+AI
Sbjct  187  QTEMIALSGAHTVGFSHCNKFSNRVYNFNTKSRVDPTLDLQYAAELKTMCPRNVDPRVAI  246

Query  263  NMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMT  84
            +MDPTTP +FDNAYFKNLQ+GKGLF SDQVLFTD RS+  VN FAS+N  F+  F AAMT
Sbjct  247  DMDPTTPKSFDNAYFKNLQKGKGLFTSDQVLFTDSRSKAAVNAFASSNKIFRANFVAAMT  306

Query  83   KLGRIGVLTGNLGEIRRDC  27
            KLGR+GV     G IR DC
Sbjct  307  KLGRVGVKNAQNGNIRTDC  325



>gb|AFK48158.1| unknown [Lotus japonicus]
Length=322

 Score =   401 bits (1031),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 240/302 (79%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  N Y +TCPN++S+V+  VQ+KF+QTFVT PATLRLFFHDCFV+GCDASV++AS  
Sbjct  23   AQLSPNHYASTCPNLQSIVKGVVQKKFQQTFVTVPATLRLFFHDCFVQGCDASVMVASSG  82

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDN SLAGDGFDTVIKAKAAVD+ PQCRNKVSCADILALATRDVV LAGG  
Sbjct  83   NNKAEKDHPDNPSLAGDGFDTVIKAKAAVDAVPQCRNKVSCADILALATRDVVVLAGGPS  142

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP   F L+QLNS+F   GLTQTDMIALSGAHT+GFSHC
Sbjct  143  YTVELGRFDGLVSRASDVNGRLPEPNFNLNQLNSLFASQGLTQTDMIALSGAHTLGFSHC  202

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + + RIY     + +DPTLN  YA QL+QMCP  V+P+IAINMDPTTP TFDN Y+KNL
Sbjct  203  NRFSNRIY----STPVDPTLNRNYATQLQQMCPKNVNPQIAINMDPTTPRTFDNIYYKNL  258

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ+LFTD RS+ TVN FASN+  F   FAAAM KLGR+GV T   G+IR D
Sbjct  259  QQGKGLFTSDQILFTDQRSKATVNSFASNSNTFNANFAAAMIKLGRVGVKTARNGKIRTD  318

Query  29   CT  24
            C+
Sbjct  319  CS  320



>ref|XP_009344467.1| PREDICTED: peroxidase 50-like [Pyrus x bretschneideri]
 ref|XP_009344468.1| PREDICTED: peroxidase 50-like [Pyrus x bretschneideri]
Length=363

 Score =   402 bits (1033),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/301 (68%), Positives = 236/301 (78%), Gaps = 5/301 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+TN+Y N CP+VE +V++ V  KF+QTFVT PATLRLFFHDCFV+GCDASV++AS  
Sbjct  25   AQLKTNYYANICPDVEKIVKNVVTNKFQQTFVTVPATLRLFFHDCFVQGCDASVIVASTA  84

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L GG  
Sbjct  85   NNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLVGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP   F L+QL SMF  +GL+Q DM+ALSGAHT+GFSHC
Sbjct  145  YSVELGRLDGLTSTSTSVDGKLPKPTFNLNQLTSMFASNGLSQADMVALSGAHTLGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RIY     + +DPTLN  YA QL+QMCP  VDP IAINMDPTTP  FDNAYF+NL
Sbjct  205  NQFSNRIY----SNPVDPTLNKTYATQLQQMCPKNVDPDIAINMDPTTPREFDNAYFENL  260

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVLFTD RS+  V  +A +  AF QAF  AMTKLGR+G+ TG+ G IRRD
Sbjct  261  IEGKGLFTSDQVLFTDSRSQPMVRTWAKDKTAFNQAFINAMTKLGRVGIKTGHNGNIRRD  320

Query  29   C  27
            C
Sbjct  321  C  321



>gb|AFK33671.1| unknown [Lotus japonicus]
Length=322

 Score =   400 bits (1028),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 210/302 (70%), Positives = 240/302 (79%), Gaps = 5/302 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  N Y +TCPN++S+V+  VQ+KF+QTFVT PATLRLFFHDCFV+GC ASV++AS  
Sbjct  23   AQLSPNHYASTCPNLQSIVKGVVQKKFQQTFVTVPATLRLFFHDCFVQGCGASVMVASSG  82

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQCRNKVSCADILALATRDVV LAGG  
Sbjct  83   NNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCRNKVSCADILALATRDVVVLAGGPS  142

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG +S  + V   LP   F L+QLNS+F   GLTQTDMIALSGAHT+GFSHC
Sbjct  143  YTVELGRFDGLVSRASDVNGRLPEPNFNLNQLNSLFASQGLTQTDMIALSGAHTLGFSHC  202

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + + RIY     + +DPTLN  YA QL+QMCP  V+P+IAINMDPTTP TFDN Y+KNL
Sbjct  203  NRFSNRIY----STPVDPTLNRNYATQLQQMCPKNVNPQIAINMDPTTPRTFDNIYYKNL  258

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ+LFTD RS+ TVN FASN+  F   FAAAM KLGR+GV T   G+IR D
Sbjct  259  QQGKGLFTSDQILFTDQRSKATVNSFASNSNPFNANFAAAMIKLGRVGVKTARNGKIRTD  318

Query  29   CT  24
            C+
Sbjct  319  CS  320



>gb|ACJ11759.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   400 bits (1027),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 246/312 (79%), Gaps = 1/312 (0%)
 Frame = -2

Query  947  LLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDAS  768
            L   +A  +LR N+Y  TCPNVE++VR+AV +KF+QTFVTAPAT+RLFFHDCFV+GCDAS
Sbjct  19   LFPGTASVKLRRNYYHKTCPNVENIVRAAVTKKFQQTFVTAPATIRLFFHDCFVQGCDAS  78

Query  767  VLLASPNG-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVV  591
            +++AS +G KAEKDHPDNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADILA+ATRDV+
Sbjct  79   IMIASSDGSKAEKDHPDNLSLAGDGFDTVIKAKEAVDAVPSCRNKVSCADILAMATRDVI  138

Query  590  SLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAH  411
            +LAGG  Y VELGR DG  ST  SV   LP   F L+QLNS+F  +GLTQ +MIALS AH
Sbjct  139  ALAGGPSYEVELGRLDGLSSTAGSVDGKLPQPFFNLNQLNSLFAANGLTQKNMIALSAAH  198

Query  410  TIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFD  231
            T+GFSHC + A RI+ F   + +DP LN  YA QLR MCP  VD RIAI+MDP TP  FD
Sbjct  199  TVGFSHCSKFANRIHNFSRETAVDPALNQGYAAQLRGMCPKNVDTRIAIDMDPKTPRKFD  258

Query  230  NAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGN  51
            N YF+NL++GKGLF SDQVLF DPRS+ TVN +A+++ AF++AF AA+TKLGR+GV TG 
Sbjct  259  NVYFQNLKKGKGLFSSDQVLFHDPRSKPTVNNWANDSHAFKRAFIAAITKLGRVGVKTGK  318

Query  50   LGEIRRDCTRPN  15
             G IRR+C   N
Sbjct  319  NGNIRRNCAAFN  330



>ref|NP_201541.1| peroxidase 73 [Arabidopsis thaliana]
 sp|Q43873.1|PER73_ARATH RecName: Full=Peroxidase 73; Short=Atperox P73; AltName: Full=ATP10a; 
AltName: Full=PRXR11; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA66967.1| peroxidase [Arabidopsis thaliana]
 emb|CAA67428.1| peroxidase ATP10a [Arabidopsis thaliana]
 dbj|BAB09025.1| peroxidase [Arabidopsis thaliana]
 gb|ABO09891.1| At5g67400 [Arabidopsis thaliana]
 gb|AED98339.1| peroxidase 73 [Arabidopsis thaliana]
 dbj|BAP16473.1| peroxidase [Cloning vector pTACAtg1]
Length=329

 Score =   399 bits (1026),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 241/321 (75%), Gaps = 1/321 (0%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S+VV   + + + +   +  AQL+TNFY N+CPNVE +V+  VQ+K +QTFVT PATLRL
Sbjct  5    SLVVVVTLSLAISMFPDTTTAQLKTNFYGNSCPNVEQIVKKVVQEKIKQTFVTIPATLRL  64

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV GCDASV++ S P  KAEKDHPDN+SLAGDGFD VIKAK A+D+ P C+NKVS
Sbjct  65   FFHDCFVNGCDASVMIQSTPTNKAEKDHPDNISLAGDGFDVVIKAKKALDAIPSCKNKVS  124

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILALATRDVV  A G  Y VELGR DG +ST  SV  NLPG   K+ +LN +F ++ 
Sbjct  125  CADILALATRDVVVAAKGPSYAVELGRFDGLVSTAASVNGNLPGPNNKVTELNKLFAKNK  184

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQ DMIALS AHT+GF+HC +V  RIY F     +DPTLN  YA +L+  CP  VDPRI
Sbjct  185  LTQEDMIALSAAHTLGFAHCGKVFNRIYNFNLTHAVDPTLNKAYAKELQLACPKTVDPRI  244

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            AINMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN +A N+ AF +AF  A
Sbjct  245  AINMDPTTPRQFDNIYFKNLQQGKGLFTSDQVLFTDGRSKPTVNDWAKNSVAFNKAFVTA  304

Query  89   MTKLGRIGVLTGNLGEIRRDC  27
            MTKLGR+GV T   G IRRDC
Sbjct  305  MTKLGRVGVKTRRNGNIRRDC  325



>gb|ACU20973.1| unknown [Glycine max]
Length=262

 Score =   397 bits (1019),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 204/235 (87%), Gaps = 0/235 (0%)
 Frame = -2

Query  935  SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLA  756
            ++ AQL   FY NTCPNVE LVRSAV+QKF+QTFVTAPATLRLFFHDCFVRGCDAS+LLA
Sbjct  22   TSSAQLTRGFYLNTCPNVEQLVRSAVEQKFQQTFVTAPATLRLFFHDCFVRGCDASILLA  81

Query  755  SPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
            SPN KAEKDHPD++SLAGDGFDTV KAKAAVDS+PQCRNKVSCADILALATRDV++LAGG
Sbjct  82   SPNNKAEKDHPDDISLAGDGFDTVAKAKAAVDSDPQCRNKVSCADILALATRDVINLAGG  141

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
             FY VELGRRDGRIST+ SVQR LP   F LD+LNSMF  HGLTQTDMIALSGAHTIGFS
Sbjct  142  PFYKVELGRRDGRISTIASVQRQLPHPDFNLDKLNSMFSFHGLTQTDMIALSGAHTIGFS  201

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFD  231
            HC   ++RIY F P+  IDPTLNL YAFQLRQ CPLRVD RIAINMDP TP  FD
Sbjct  202  HCNHFSRRIYNFSPKKLIDPTLNLHYAFQLRQSCPLRVDSRIAINMDPVTPQKFD  256



>ref|XP_006466484.1| PREDICTED: peroxidase 51-like [Citrus sinensis]
Length=329

 Score =   399 bits (1024),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/305 (67%), Positives = 242/305 (79%), Gaps = 3/305 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL+ ++Y  TCPNVE +VR+ V++KFRQTFVT PAT+RLFFHDCFV+GCDASV++ S  
Sbjct  27   AQLKQDYYAKTCPNVEKIVRTQVEKKFRQTFVTVPATIRLFFHDCFVQGCDASVIIQSDG  86

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTV+KAK AV+    C+N VSCADILALATRDV++L+GG  
Sbjct  87   NNKAEKDHPDNLSLAGDGFDTVVKAKQAVEQ--VCKNTVSCADILALATRDVIALSGGPS  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST +SV   LP   F L+QLNS+FG +GL QTDMIALS  HT+GFSHC
Sbjct  145  YSVELGRLDGLSSTASSVSGKLPQPTFNLNQLNSLFGANGLDQTDMIALSAGHTVGFSHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY F P++ +DPTLN  YA +L+QMCP  VDPRIAINMDP TP TFDN YFKNL
Sbjct  205  SKFANRIYNFSPQNPVDPTLNKTYATELQQMCPKNVDPRIAINMDPNTPKTFDNMYFKNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVL+TD RS+  V+ +AS+ A FQ+AF  A+TKLGR+ V TG+ G IRRD
Sbjct  265  QQGKGLFTSDQVLYTDGRSKPAVDRWASSPADFQRAFITAITKLGRVNVKTGSDGNIRRD  324

Query  29   CTRPN  15
            C+  N
Sbjct  325  CSAFN  329



>ref|XP_006380636.1| Peroxidase 50 precursor family protein [Populus trichocarpa]
 gb|ERP58433.1| Peroxidase 50 precursor family protein [Populus trichocarpa]
 gb|AHL39155.1| class III peroxidase [Populus trichocarpa]
Length=331

 Score =   399 bits (1024),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 237/301 (79%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQLR N+Y ++CP VES+VR  VQ K +QTFVT PATLRLFFHDCFV+GCDASV++AS  
Sbjct  27   AQLRQNYYASSCPRVESIVRGVVQNKIKQTFVTIPATLRLFFHDCFVQGCDASVIVASTA  86

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
              KAEKDH DNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADILA+ATRDV++L+GG  
Sbjct  87   TNKAEKDHSDNLSLAGDGFDTVIKAKAAVDATPGCKNKVSCADILAIATRDVIALSGGPS  146

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            YPVELGR DG  ST  SV   LP   F L+QL +MF  +GL+QTDMIALS AHT+GFSHC
Sbjct  147  YPVELGRLDGLSSTAASVNGKLPQPTFSLNQLTAMFAANGLSQTDMIALSAAHTLGFSHC  206

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY F  +  IDPTLN  YA  L+ +CP  VD RIAINMDP TPNTFDN Y+KNL
Sbjct  207  SKFANRIYSFSRQGPIDPTLNRTYAKTLQTLCPKNVDSRIAINMDPNTPNTFDNMYYKNL  266

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             QG GLF SDQVLFTD RS+ TV  +A+++ AFQQAF  AMTKLGR+GV +G  G+IR+D
Sbjct  267  VQGMGLFTSDQVLFTDSRSKPTVTKWATDSQAFQQAFITAMTKLGRVGVKSGRNGKIRQD  326

Query  29   C  27
            C
Sbjct  327  C  327



>ref|XP_006470079.1| PREDICTED: peroxidase 55-like [Citrus sinensis]
Length=326

 Score =   398 bits (1023),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/331 (63%), Positives = 241/331 (73%), Gaps = 5/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME      M+V    L  ++L++     QL  NFY +TCPNVES+V   V  KF QTF+T
Sbjct  1     MEMGVMREMMV---FLFTILLIMQRGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFIT  57

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
              PATLRLFFHDCF+ GCDASVL+ SPNG AEKD PDNLSLAGDGFDTV++AK AV++  Q
Sbjct  58    VPATLRLFFHDCFIVGCDASVLIQSPNGDAEKDAPDNLSLAGDGFDTVVQAKQAVEA--Q  115

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             C   VSCADILA+A RDVV LAGGA + VELGRRDG +S  +SV+ NLP   F LD+LN 
Sbjct  116   CPGVVSCADILAIAARDVVVLAGGASFSVELGRRDGLVSRASSVKGNLPEPTFNLDELNQ  175

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF +HGL+Q DMIALSGAHT+GFSHC + A RIY F   S +DP+L+  YA QL Q CP 
Sbjct  176   MFAKHGLSQIDMIALSGAHTLGFSHCDRFANRIYSFSSSSPVDPSLDPAYAQQLMQACPR  235

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
              VDP+IAINMDP TP TFDN Y++NL  GKGLF SDQVLFTD  S+ TV  FA N   F 
Sbjct  236   NVDPQIAINMDPVTPRTFDNMYYQNLVAGKGLFTSDQVLFTDASSQPTVKDFARNPLDFN  295

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
              AFA AM KLGR+GV TGN GEIRRDCT  N
Sbjct  296   AAFATAMRKLGRVGVKTGNQGEIRRDCTAFN  326



>gb|KDO63914.1| hypothetical protein CISIN_1g020449mg [Citrus sinensis]
Length=326

 Score =   397 bits (1021),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 210/331 (63%), Positives = 242/331 (73%), Gaps = 5/331 (2%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVT  828
             ME      M+V    L  ++L++     QL  NFY +TCPNVES+V   V  KF QTF+T
Sbjct  1     MEMGVMREMMV---FLFTILLIMQRGDGQLVENFYSSTCPNVESIVNRVVSTKFSQTFIT  57

Query  827   APATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQ  648
              PATLRLFFHDCF+ GCDASVL+ SPNG AEKD PDNLSLAGDGFDTV++AK AV++  Q
Sbjct  58    VPATLRLFFHDCFIVGCDASVLIQSPNGDAEKDAPDNLSLAGDGFDTVVQAKQAVEA--Q  115

Query  647   CRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNS  468
             C   VSCADILA+A RDVV LAGGA + VELGRRDG +S  +SV+ NLP   F LD+LN 
Sbjct  116   CPGVVSCADILAIAARDVVVLAGGAPFSVELGRRDGLVSRASSVKGNLPEPTFNLDELNQ  175

Query  467   MFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL  288
             MF +HGL+Q DMIALSGAHT+GFSHC + A RIY F   S +DP+L+  YA QL Q CP 
Sbjct  176   MFAKHGLSQIDMIALSGAHTLGFSHCDRFANRIYSFSSSSPVDPSLDPAYAQQLMQSCPR  235

Query  287   RVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafq  108
              VDP+IAINMDP TP TFDN Y++NL  GKGLF SDQVLFTD  S+ TVN FA N   F 
Sbjct  236   NVDPQIAINMDPVTPRTFDNMYYQNLVAGKGLFTSDQVLFTDASSQPTVNDFARNPLDFN  295

Query  107   qafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
              AFA AM KLGR+GV TGN GEIRRDCT  N
Sbjct  296   AAFATAMRKLGRVGVKTGNQGEIRRDCTAFN  326



>ref|XP_006279521.1| hypothetical protein CARUB_v10027970mg [Capsella rubella]
 gb|EOA12419.1| hypothetical protein CARUB_v10027970mg [Capsella rubella]
Length=329

 Score =   397 bits (1020),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 238/320 (74%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V+   + + + +   +  AQL TNFY  +CPNVE +VR  VQ K +QTFVT PATLRLF
Sbjct  6    LVLVVALSLAISMFPDTTTAQLNTNFYGKSCPNVEQIVRKVVQTKVKQTFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S P  KAEKDHPDN SLAGDGFD VIKAK A+D+ P CRNKVSC
Sbjct  66   FHDCFVNGCDASVMIQSTPTNKAEKDHPDNQSLAGDGFDVVIKAKKALDAIPSCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADIL LATRDVV  AGG  Y VELGR DG +ST  SV  NLPG   K+ QLN +F ++ L
Sbjct  126  ADILTLATRDVVVAAGGPSYKVELGRFDGLVSTAASVTGNLPGPNDKVTQLNKLFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V  RIY F     +DPTLN  YA +L+  CP +VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCGKVFNRIYNFNRTHSVDPTLNKAYAKELQLACPKKVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RSR TVN +A+N+ AF +AF  AM
Sbjct  246  INMDPTTPRKFDNLYFKNLQQGKGLFTSDQVLFTDARSRPTVNAWATNSVAFNKAFVTAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV T   G IRRDC
Sbjct  306  TKLGRVGVKTRRNGNIRRDC  325



>ref|XP_004288471.1| PREDICTED: peroxidase 73-like [Fragaria vesca subsp. vesca]
Length=324

 Score =   397 bits (1019),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 216/321 (67%), Positives = 254/321 (79%), Gaps = 6/321 (2%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S+V+   + + L +  +   AQL+TNFY N CPNVES+V+SAV +KF+QTFVT PAT+RL
Sbjct  5    SLVLVWSLCLSLCMFSTPTSAQLKTNFYANICPNVESIVKSAVTKKFQQTFVTVPATIRL  64

Query  806  FFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV+GCDASV++AS  + KAEKDHPDNLSLAGDGFDTVIKAKAAVD+  QCRNKVS
Sbjct  65   FFHDCFVQGCDASVIVASSGSNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVAQCRNKVS  124

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADILALATRD + L+GG  YPVELGR DG  ST +SV   LP   F +DQL SMF  +G
Sbjct  125  CADILALATRDAIVLSGGPSYPVELGRLDGLRSTSSSVNGKLPQPTFNVDQLTSMFKANG  184

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            L QTDM+ALS AHT+GFSHC + A RI     R+ +DPT++  YA QL+Q CP  VDP I
Sbjct  185  LDQTDMVALSAAHTVGFSHCSKFASRI-----RNRVDPTMSKTYAAQLQQQCPTNVDPNI  239

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            A+NMDP TP TFDN Y+KNLQQGKGLF SDQVLFTD R+R+TVN +ASNNAAFQ+AF  A
Sbjct  240  AVNMDPNTPRTFDNMYYKNLQQGKGLFTSDQVLFTDTRTRSTVNTWASNNAAFQKAFINA  299

Query  89   MTKLGRIGVLTGNLGEIRRDC  27
            MTKLGR+GV TG+ G IRRDC
Sbjct  300  MTKLGRVGVKTGSNGNIRRDC  320



>gb|EPS60801.1| hypothetical protein M569_13997, partial [Genlisea aurea]
Length=327

 Score =   397 bits (1020),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 240/305 (79%), Gaps = 0/305 (0%)
 Frame = -2

Query  929  HAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP  750
            +A+LR  FY++ CPN+ES+VR+AVQ K ++T +TAP TLRL+FHDCFVRGCDAS++L SP
Sbjct  23   NARLRVGFYRDVCPNLESIVRNAVQIKLQETVITAPGTLRLYFHDCFVRGCDASIMLVSP  82

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            +G+AE+++P NLSLAGDGFDTVIKAKAAVDS+PQC NKVSCADILALA RDVV+L GG F
Sbjct  83   DGRAERNNPINLSLAGDGFDTVIKAKAAVDSDPQCTNKVSCADILALAARDVVNLVGGPF  142

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGRRDG IST+ SV  NLP AGF L +L +MF  + L+ TD+IALSGAHTIG SHC
Sbjct  143  YEVELGRRDGLISTITSVHHNLPLAGFNLTRLMTMFSNNNLSLTDLIALSGAHTIGVSHC  202

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q +KR+  F  ++WIDPTLN +YA +L Q CP  VDP IA+  DP TPN FDNAYFK+L
Sbjct  203  NQFSKRLRGFSGQNWIDPTLNPQYAQELGQACPRGVDPDIAVFNDPITPNVFDNAYFKDL  262

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q+G GL  SDQVLF D RSR  VN FA N + F  AF  A+TK+GRIG  TG+ GEIR D
Sbjct  263  QRGSGLLSSDQVLFVDERSRGIVNQFAGNGSDFNLAFIEAITKMGRIGAKTGDEGEIRID  322

Query  29   CTRPN  15
            CT  N
Sbjct  323  CTTTN  327



>ref|XP_009130545.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 73 [Brassica rapa]
Length=329

 Score =   397 bits (1019),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 240/320 (75%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V++  + + + +   +  AQL  NFY  +CPNVE++VR  VQQK ++TFVT PATLRLF
Sbjct  6    LVLAMALCLTISVFPDTTTAQLNXNFYGKSCPNVEAIVRKIVQQKVKETFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S PN KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNKVSC
Sbjct  66   FHDCFVNGCDASVMIQSTPNNKAEKDHPDNVSLAGDGFDVVIKAKKALDAIPSCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDVV  A G  YPVELGRRDG  ST  SV  NLPG    +D+LN +F ++ L
Sbjct  126  ADILALATRDVVVAAEGPSYPVELGRRDGLESTAASVHGNLPGPNDNVDKLNKLFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +V  RIY F     IDPTLN  YA  LR  CP  VDPRIA
Sbjct  186  TQEDMIALSAAHTLGFAHCSKVFNRIYNFNRTHIIDPTLNKGYAKDLRLACPKNVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            IN+DP TP   DN YF+NLQQGKGLF SDQVL+T+ RSR TV+ +A N+AAF  AF  AM
Sbjct  246  INIDPITPKKLDNIYFRNLQQGKGLFTSDQVLYTNRRSRPTVDSWAKNSAAFNAAFVKAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV TG+ G IRRDC
Sbjct  306  TKLGRVGVKTGHNGNIRRDC  325



>ref|XP_006426061.1| hypothetical protein CICLE_v10026050mg [Citrus clementina]
 gb|ESR39301.1| hypothetical protein CICLE_v10026050mg [Citrus clementina]
Length=331

 Score =   397 bits (1019),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 203/305 (67%), Positives = 240/305 (79%), Gaps = 3/305 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL+ ++Y  TCPNVE +VR+ V++KFRQTFVT PAT+RLFFHDCFV+GCDASV++ S  
Sbjct  29   AQLKQDYYAKTCPNVEKIVRTQVEKKFRQTFVTVPATIRLFFHDCFVQGCDASVIIQSTG  88

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N  AEKDHPDNLSLAGDGFDTV+KAK AV+    C+N VSCADILALATRDV++L+GG  
Sbjct  89   NNTAEKDHPDNLSLAGDGFDTVVKAKQAVEQ--FCKNTVSCADILALATRDVIALSGGPS  146

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST +SV   LP   F L+QLNS+FG +GL QTDMIALS  HT+GFSHC
Sbjct  147  YSVELGRLDGLSSTASSVSGKLPQPTFNLNQLNSLFGANGLDQTDMIALSAGHTVGFSHC  206

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A RIY F P++ +DPTLN  YA +L+QMCP  VDPRIAINMDP TP TFDN YFKNL
Sbjct  207  SKFANRIYNFSPQNPVDPTLNKTYATELQQMCPKNVDPRIAINMDPNTPKTFDNMYFKNL  266

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVL+TD RS+  V+ +AS+ A FQ AF  A+TKLGR+ V TG+ G IRRD
Sbjct  267  QQGKGLFTSDQVLYTDGRSKPAVDRWASSPADFQTAFITAITKLGRVNVKTGSDGNIRRD  326

Query  29   CTRPN  15
            C+  N
Sbjct  327  CSAFN  331



>ref|XP_008781029.1| PREDICTED: peroxidase 51-like [Phoenix dactylifera]
Length=328

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 243/314 (77%), Gaps = 1/314 (0%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            + LL     AQLR N+Y N CPNVES+VR+ V+ KF +TFVT PAT+RL FHDCFV+GCD
Sbjct  15   ICLLPQLGSAQLRQNYYANVCPNVESIVRNVVKTKFDETFVTVPATIRLLFHDCFVQGCD  74

Query  773  ASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRD  597
            ASVL+AS  N +AEKDHPDNLSLAGDGFDTV+KAKAA+D+ P+CRN+VSCADIL +ATRD
Sbjct  75   ASVLIASTANNRAEKDHPDNLSLAGDGFDTVVKAKAAIDAVPRCRNRVSCADILVMATRD  134

Query  596  VVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSG  417
            V+S++GG  Y VELGR DG  ST +SV+  LP   F L QLN++F  +GLTQTDMIALS 
Sbjct  135  VISMSGGPSYAVELGRLDGLSSTADSVEGRLPQPEFDLVQLNTLFAANGLTQTDMIALSA  194

Query  416  AHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNT  237
            AHT+GFSHC + A RIY F   + +DPTLN  YA QLR +CP  VDP +AINMDP +P  
Sbjct  195  AHTVGFSHCNKFANRIYSFSAGNPVDPTLNTTYASQLRAICPQNVDPTVAINMDPVSPRI  254

Query  236  FDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLT  57
            FDN YF NL QG GLF SDQVLFTD RSR+TVN +A ++ AFQQAF AA+ KLGR+GV T
Sbjct  255  FDNQYFLNLLQGMGLFTSDQVLFTDSRSRSTVNSWAQSSFAFQQAFVAAIAKLGRVGVKT  314

Query  56   GNLGEIRRDCTRPN  15
            G+ G IR+DC   N
Sbjct  315  GSGGNIRQDCAAFN  328



>ref|XP_008368006.1| PREDICTED: peroxidase 51-like [Malus domestica]
Length=329

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 233/301 (77%), Gaps = 5/301 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+TN+Y N CP+VE +V++AV  KF+QTFVT  ATLRLFFHDCFV GCDASV++AS  
Sbjct  29   AQLKTNYYANICPDVEKIVKNAVNNKFQQTFVTVXATLRLFFHDCFVHGCDASVIVASTA  88

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            + KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L GG  
Sbjct  89   SNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLVGGPS  148

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP   F L+QL SMF  +GL+Q DM+ALSGAH +GFSHC
Sbjct  149  YSVELGRLDGLTSTSTSVDGKLPKPTFNLNQLTSMFASNGLSQVDMVALSGAHXLGFSHC  208

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RIY     + +DPTLN  YA QL+QMCP  VDP IAINMDPT+P  FDNAYF+NL
Sbjct  209  NQFSNRIY----SNPVDPTLNKTYATQLQQMCPQNVDPDIAINMDPTSPREFDNAYFQNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVLF D RS  TV  +A +  AF QAF  AMTKLGR+G+ TGN G IRRD
Sbjct  265  IEGKGLFTSDQVLFXDSRSXPTVRTWAKDKTAFNQAFINAMTKLGRVGIKTGNNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|XP_004245302.1| PREDICTED: peroxidase 45-like [Solanum lycopersicum]
Length=336

 Score =   395 bits (1015),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 241/309 (78%), Gaps = 1/309 (0%)
 Frame = -2

Query  938  SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLL  759
            S  +AQL  +FY+N+CPNVES+VRSAV+QK+RQT VTA ATLRLFFHDCF++GCDAS++L
Sbjct  25   SCINAQLHRDFYRNSCPNVESIVRSAVEQKYRQTIVTAAATLRLFFHDCFIQGCDASIIL  84

Query  758  -ASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
             +S N  AEKDHPDN+SLAGDG+DTVIKAKAAVD+ P C+NKVSCADILA+ATRDVV+LA
Sbjct  85   RSSGNNTAEKDHPDNISLAGDGYDTVIKAKAAVDNVPACKNKVSCADILAMATRDVVALA  144

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  Y VELGRRDGR+S+ NSV  NLP + F L +L  MF   GL+   +IALSGAHT+G
Sbjct  145  GGPHYAVELGRRDGRVSSQNSVPSNLPHSEFHLKKLLPMFASRGLSIRHLIALSGAHTLG  204

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC Q + RIY F  +  +DPT+N  YA +L++MCP    P + I +DP TP  FDN Y
Sbjct  205  FSHCNQFSNRIYSFNSKRKVDPTINEVYAKELQEMCPQNASPGVVIPLDPDTPQVFDNMY  264

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            FKNLQ+GKGLF SDQ L+T   SRN V+ FASN  AF++ F AAMTKLGR GV TGNLGE
Sbjct  265  FKNLQRGKGLFTSDQTLYTKRGSRNIVDLFASNKTAFERVFIAAMTKLGRFGVKTGNLGE  324

Query  41   IRRDCTRPN  15
            IR+DC   N
Sbjct  325  IRKDCAVVN  333



>ref|NP_195469.1| peroxidase 51 [Arabidopsis thaliana]
 sp|Q9SZE7.1|PER51_ARATH RecName: Full=Peroxidase 51; Short=Atperox P51; AltName: Full=ATP37; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL79842.1|AF469928_1 peroxidase ATP37 [Arabidopsis thaliana]
 emb|CAB38292.1| peroxidase-like protein [Arabidopsis thaliana]
 emb|CAB80418.1| peroxidase-like protein [Arabidopsis thaliana]
 gb|AAN13031.1| putative peroxidase [Arabidopsis thaliana]
 gb|AEE86806.1| peroxidase 51 [Arabidopsis thaliana]
Length=329

 Score =   395 bits (1014),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 238/306 (78%), Gaps = 1/306 (0%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            ++ + AQLR +FY  TCPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV+
Sbjct  20   INLSSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVM  79

Query  761  LASPN-GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +AS N  KAEKDH DNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADIL +ATRDVV+L
Sbjct  80   IASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNL  139

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGRRDG  S+ +SV   LP   F L+QLN++F  +GL+  DMIALSGAHT+
Sbjct  140  AGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTL  199

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC +V  R+Y F   + +DPT+N  Y  +L+  CP  +DPR+AINMDP TP  FDN 
Sbjct  200  GFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNV  259

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y+KNLQQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF ++M KLGR+GV TG+ G
Sbjct  260  YYKNLQQGKGLFTSDQVLFTDSRSKPTVDLWANNGQLFNQAFISSMIKLGRVGVKTGSNG  319

Query  44   EIRRDC  27
             IRRDC
Sbjct  320  NIRRDC  325



>ref|XP_006447048.1| hypothetical protein CICLE_v10016043mg [Citrus clementina]
 gb|ESR60288.1| hypothetical protein CICLE_v10016043mg [Citrus clementina]
Length=307

 Score =   394 bits (1011),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 230/304 (76%), Gaps = 2/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
             QL  NFY +TCPNVES+V   V  KF QTF+T PATLRLFFHDCF+ GCDASVL+ SPN
Sbjct  6    GQLVENFYSSTCPNVESIVNRVVSTKFSQTFITVPATLRLFFHDCFIVGCDASVLIQSPN  65

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
            G AEKD PDNLSLAGDGFDTV++AK AV++  QC   VSCADILA+A RDVV LAGGA +
Sbjct  66   GDAEKDAPDNLSLAGDGFDTVVQAKQAVEA--QCPGVVSCADILAIAARDVVVLAGGASF  123

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDG +S  +SV+ NLP   F LD+LN MF +HGL+Q DMIALSGAHT+GFSHC 
Sbjct  124  SVELGRRDGLVSRASSVKGNLPEPTFNLDELNQMFAKHGLSQIDMIALSGAHTLGFSHCD  183

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + A RIY F   S +DP+L+  YA QL Q CP  VDP+IAINMDP TP TFDN Y++NL 
Sbjct  184  RFANRIYSFSSSSPVDPSLDPAYAQQLMQACPRNVDPQIAINMDPVTPRTFDNMYYQNLV  243

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
             GKGLF SDQVLFTD  S+ TV  FA N   F  AFA AM KLGR+GV TGN GEIRRDC
Sbjct  244  AGKGLFTSDQVLFTDASSQPTVKDFARNPLDFNAAFATAMRKLGRVGVKTGNQGEIRRDC  303

Query  26   TRPN  15
            T  N
Sbjct  304  TAFN  307



>ref|XP_008350315.1| PREDICTED: peroxidase 51-like [Malus domestica]
Length=329

 Score =   394 bits (1012),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 204/301 (68%), Positives = 232/301 (77%), Gaps = 5/301 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-P  750
            AQL+TN+Y N CP+VE +V++AV  KF+QTFVT  ATLRLFFHDCFV GCDASV++AS  
Sbjct  29   AQLKTNYYANICPDVEKIVKNAVNNKFQQTFVTVXATLRLFFHDCFVHGCDASVIVASTA  88

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            + KAEKDHPDNLSLAGDGFDTVIKAKAAVD+ PQC+NKVSCADILALATRDV+ L GG  
Sbjct  89   SNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPQCKNKVSCADILALATRDVIGLVGGPS  148

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP   F L+QL SMF  +GL+Q DM+ALSGAH +GFSHC
Sbjct  149  YSVELGRLDGLTSTSTSVDGKLPKPTFNLNQLTSMFASNGLSQADMVALSGAHXLGFSHC  208

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             Q + RIY     + +DPTLN  YA QL+QMCP  VDP IAINMDPT+P  FDNAYF+NL
Sbjct  209  NQFSNRIY----SNPVDPTLNKTYATQLQQMCPQNVDPDIAINMDPTSPREFDNAYFQNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVLF D RS  TV  +A +  AF QAF  AMTKLGR G+ TGN G IRRD
Sbjct  265  IEGKGLFTSDQVLFXDSRSXPTVRTWAKDKTAFNQAFINAMTKLGRXGIKTGNNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|XP_010547542.1| PREDICTED: peroxidase 35-like [Tarenaya hassleriana]
Length=329

 Score =   394 bits (1012),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 244/323 (76%), Gaps = 1/323 (0%)
 Frame = -2

Query  980  VVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFF  801
            V++  + + + + + +A AQL  NFY  TCPN++ +VR+ V++K +QTFVT PATLRLFF
Sbjct  7    VIAMALCLSISVHMDTATAQLSPNFYSKTCPNIQEIVRNVVKRKVKQTFVTIPATLRLFF  66

Query  800  HDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCA  624
            HDC + GCDASVL+ S PN KAEKDHPDNLSLAGDGFD VI+AK A+++NP+CRNKVSC+
Sbjct  67   HDCAINGCDASVLIQSTPNNKAEKDHPDNLSLAGDGFDVVIQAKKALEANPRCRNKVSCS  126

Query  623  DILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLT  444
            DILALATRDVV  AGG FY VELGR DG +S   SV+ NLP     LD+LN++F +  L+
Sbjct  127  DILALATRDVVVEAGGPFYEVELGRFDGLVSKAASVEGNLPKPTDNLDKLNAIFSKMKLS  186

Query  443  QTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAI  264
            Q DMIALS AHT+GF+HC +V  RIY F   S  DPTLN  YA +L+  CP  VDPRIAI
Sbjct  187  QQDMIALSAAHTVGFAHCSKVFNRIYSFSRTSPADPTLNRAYAKELQMACPRNVDPRIAI  246

Query  263  NMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMT  84
            NMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RSR TV+ +A +  AF +AFA AMT
Sbjct  247  NMDPTTPRIFDNVYFKNLQQGKGLFTSDQVLFTDRRSRPTVDAWAKDPKAFNRAFAIAMT  306

Query  83   KLGRIGVLTGNLGEIRRDCTRPN  15
            KLGR+GV     G IRRDC R N
Sbjct  307  KLGRVGVKNRFNGNIRRDCGRFN  329



>ref|XP_011097275.1| PREDICTED: peroxidase 51 [Sesamum indicum]
Length=326

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 236/316 (75%), Gaps = 2/316 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            L+ ++++     AQL  NFY ++CPNVE++VR  V+ K  QTFVT PATLRL+FHDCFV 
Sbjct  12   LILMLIVTRMGEAQLMENFYSSSCPNVEAIVRQVVRTKINQTFVTIPATLRLYFHDCFVE  71

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDASV++ASPN  AEKD PDNLSLAGDGFDTV+KAK AV++  QC   VSCADILA+A 
Sbjct  72   GCDASVVIASPNNDAEKDAPDNLSLAGDGFDTVVKAKQAVEA--QCPGIVSCADILAIAA  129

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDVV LAGG  Y VELGRRDG IS  + V  NLP   F L QLN++F ++ L+Q DMIAL
Sbjct  130  RDVVFLAGGPAYDVELGRRDGLISQASRVAGNLPEPTFNLIQLNTIFAKNNLSQIDMIAL  189

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHT+GFSHC +VA R+Y F P + +DP L+  YA QL Q CP  VDP+IAINMDP TP
Sbjct  190  SGAHTLGFSHCNRVANRLYSFSPSNPVDPALDPTYAQQLMQECPQNVDPQIAINMDPVTP  249

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDN YF+NL  GKGLF SDQVLFTDP S+ TV  FA N+  F  AF  AMTKLGR+GV
Sbjct  250  QTFDNVYFQNLVGGKGLFTSDQVLFTDPASQPTVMDFAQNSGDFNGAFITAMTKLGRVGV  309

Query  62   LTGNLGEIRRDCTRPN  15
              GN GEIRRDCT  N
Sbjct  310  KIGNQGEIRRDCTAFN  325



>gb|AAL49862.1| putative peroxidase [Arabidopsis thaliana]
Length=329

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            ++ + AQLR + Y  TCPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV+
Sbjct  20   INLSSAQLRGDLYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVM  79

Query  761  LASPN-GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +AS N  KAEKDH DNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADIL +ATRDVV+L
Sbjct  80   IASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNL  139

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGRRDG  S+ +SV   LP   F L+QLN++F  +GL+  DMIALSGAHT+
Sbjct  140  AGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTL  199

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC +V  R+Y F   + +DPT+N  Y  +L+  CP  +DPR+AINMDP TP  FDN 
Sbjct  200  GFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNV  259

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y+KNLQQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF ++M KLGR+GV TG+ G
Sbjct  260  YYKNLQQGKGLFTSDQVLFTDSRSKPTVDLWANNGQLFNQAFISSMIKLGRVGVKTGSNG  319

Query  44   EIRRDC  27
             IRRDC
Sbjct  320  NIRRDC  325



>ref|XP_006338701.1| PREDICTED: peroxidase 51-like [Solanum tuberosum]
Length=325

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 237/317 (75%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +++ +++++  A  QL  NFY  TCPNVE +V+ AV  KF QTFVT PATLRLFFHDCFV
Sbjct  10   LILAIIVILGGAEGQLVENFYGFTCPNVEFIVQQAVSIKFSQTFVTIPATLRLFFHDCFV  69

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDASV++ASPNG AEKD  DNLSLAGDGFDTV+KAK AV++  QC   VSCADILA+A
Sbjct  70   EGCDASVMIASPNGDAEKDSKDNLSLAGDGFDTVVKAKQAVEA--QCPGVVSCADILAIA  127

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
            TRDVV LAGG  Y VELGRRDG IS  + V   LP   F L QLN+MF  H L+Q DMIA
Sbjct  128  TRDVVVLAGGPSYNVELGRRDGLISQASRVAGKLPEPDFNLIQLNTMFASHNLSQFDMIA  187

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC + A R+Y F P + +DP+L+  YA +L+ MCP  VDP IAINMDP T
Sbjct  188  LSGAHTLGFSHCDRFANRLYSFTPSNPVDPSLDPEYAKELKDMCPQNVDPSIAINMDPAT  247

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            P TFDN Y+KNL +GKGLF SDQVLFTD  S+ TV+ FA+N   F  AF  AM KLGR+G
Sbjct  248  PRTFDNEYYKNLVKGKGLFTSDQVLFTDESSQGTVSDFANNAFDFNGAFVTAMRKLGRVG  307

Query  65   VLTGNLGEIRRDCTRPN  15
            V TG+ GEIR DCTR N
Sbjct  308  VKTGDQGEIRLDCTRFN  324



>gb|ABK21900.1| unknown [Picea sitchensis]
Length=333

 Score =   392 bits (1006),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 203/318 (64%), Positives = 237/318 (75%), Gaps = 3/318 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            + V L L VS   AQL+ NFY   CPNVES+VR+AV QKF QTFVT P TLRLFFHDCFV
Sbjct  18   VWVLLGLCVSKGSAQLKENFYAKICPNVESIVRNAVSQKFSQTFVTVPGTLRLFFHDCFV  77

Query  785  RGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
             GCDASV++ S  N  AEKD  DNLSLAGDGFDTV+KAK AV+    C N VSCADIL +
Sbjct  78   EGCDASVIIQSTSNNTAEKDFSDNLSLAGDGFDTVVKAKQAVEK--VCPNTVSCADILTM  135

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            A RDVV+LAGG  + VELGRRDG IS  + V  NLP A F L+QLN +F   GL+QTDM+
Sbjct  136  AARDVVALAGGPQFNVELGRRDGLISQASRVSGNLPKASFTLNQLNFLFASKGLSQTDMV  195

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC Q++ RIY F   + +DP+LN  YA QL+QMCP  VDP IAIN+DPT
Sbjct  196  ALSGAHTLGFSHCNQISNRIYSFSASTPVDPSLNPSYATQLQQMCPKNVDPTIAINIDPT  255

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN Y++NLQ GKGLF SD+VL+TD R+RN VN FA ++ AF  AF  AM  LGR+
Sbjct  256  TPRQFDNVYYQNLQSGKGLFSSDEVLYTDLRTRNAVNTFAQSSGAFNTAFVNAMRNLGRV  315

Query  68   GVLTGNLGEIRRDCTRPN  15
            GV TG  GEIR+DC+R N
Sbjct  316  GVKTGFQGEIRQDCSRFN  333



>ref|XP_008441332.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=325

 Score =   391 bits (1004),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 199/322 (62%), Positives = 244/322 (76%), Gaps = 4/322 (1%)
 Frame = -2

Query  980  VVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFF  801
            VV +  LVC+  L++ A AQL  NFY ++CPNVE +VR AV  K  QTFVT PATLRLFF
Sbjct  8    VVLSLALVCM--LIAVAQAQLSFNFYNSSCPNVEQIVRQAVSLKISQTFVTIPATLRLFF  65

Query  800  HDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCAD  621
            HDCFV+GCDASV++ASP+G AEKD  DNLSLAGDGFDTV+KAK AV++  QC  KVSCAD
Sbjct  66   HDCFVQGCDASVMIASPSGDAEKDSEDNLSLAGDGFDTVVKAKQAVEA--QCPGKVSCAD  123

Query  620  ILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQ  441
            IL +A RDVV LAGG ++ VELGRRDG IS  + V  NLPG  F L QLN+MF ++ LTQ
Sbjct  124  ILTIAARDVVVLAGGPYFAVELGRRDGLISKASLVAGNLPGPNFNLSQLNTMFAKNNLTQ  183

Query  440  TDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAIN  261
            TDMIALSGAHT+GFSHC + A R+Y F   S +DP+L+  YA +L  +CP  VDPR+A++
Sbjct  184  TDMIALSGAHTVGFSHCNRFANRLYNFSATSKVDPSLDPNYAKKLMDLCPQNVDPRVAVD  243

Query  260  MDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTK  81
            MDP +P   DN Y++NLQ  KGLF SDQVL+TDP S+ TV+ FA++   F +AF AAM +
Sbjct  244  MDPVSPKKMDNVYYQNLQNHKGLFTSDQVLYTDPLSQATVSGFANDRNRFNKAFVAAMVR  303

Query  80   LGRIGVLTGNLGEIRRDCTRPN  15
            LGR+GV TG +GEIR+DCT  N
Sbjct  304  LGRVGVKTGVVGEIRKDCTTFN  325



>ref|XP_009606506.1| PREDICTED: peroxidase 55 [Nicotiana tomentosiformis]
Length=354

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 235/317 (74%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            ++V  + +VS A  QL  NFY  TCPNVE +V+ AV  KF QTFVT PATLRLFFHDCFV
Sbjct  39   LIVATLSIVSGAEGQLVENFYGFTCPNVEFMVQQAVSTKFSQTFVTIPATLRLFFHDCFV  98

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDASVL+ASPNG AEKD  DN+SLAGDGFDTVIKAK AV++  QC   VSCADILA+A
Sbjct  99   EGCDASVLIASPNGDAEKDSSDNISLAGDGFDTVIKAKEAVEA--QCPGVVSCADILAIA  156

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
            TRDVV LAGG  Y VELGRRDG IS  + V   LP   F L++L +MF  H L+Q DMIA
Sbjct  157  TRDVVVLAGGPAYNVELGRRDGLISKASRVAGKLPEPHFNLNRLTTMFANHNLSQFDMIA  216

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC + A R+Y F   + +DP+L+  YA QL QMCP +VDP IAINMDP T
Sbjct  217  LSGAHTLGFSHCDRFANRLYSFTSSNPVDPSLDPEYAKQLMQMCPQKVDPSIAINMDPVT  276

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            P TFDN Y+KNL  GKGLF SDQVLFTD  S+ TVN FA+N   F  AF  AM KLGR+G
Sbjct  277  PRTFDNEYYKNLVGGKGLFTSDQVLFTDEASQRTVNDFANNAFEFNGAFVTAMRKLGRVG  336

Query  65   VLTGNLGEIRRDCTRPN  15
            V TGN GEIR DCTR N
Sbjct  337  VKTGNQGEIRLDCTRFN  353



>emb|CDY37853.1| BnaAnng05140D [Brassica napus]
Length=335

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 230/302 (76%), Gaps = 1/302 (0%)
 Frame = -2

Query  929  HAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-  753
            H   + NFY  +CPNVE++VR  VQQK ++TFVT PATLRLFFHDCFV GCDASV++ S 
Sbjct  30   HCSAQHNFYGKSCPNVEAIVRKIVQQKVKETFVTIPATLRLFFHDCFVNGCDASVMIQST  89

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
            PN KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNKVSCADILALATRDVV  A G 
Sbjct  90   PNNKAEKDHPDNVSLAGDGFDVVIKAKKALDAIPSCRNKVSCADILALATRDVVVAAEGP  149

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
             YPVELGRRDG  ST  SV  NLPG    +D+LN +F ++ LTQ DMIALS AHT+GF+H
Sbjct  150  SYPVELGRRDGLESTAASVHGNLPGPNDNVDKLNKLFAKNKLTQEDMIALSAAHTLGFAH  209

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C +V  RIY F     IDPTLN  YA  LR  CP  VDPRIAIN+DP TP   DN YF+N
Sbjct  210  CSKVFNRIYNFNRTHIIDPTLNKGYAKDLRLACPKNVDPRIAINIDPITPKKLDNIYFRN  269

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            LQQGKGLF SDQVL+T+ RSR TV+ +A N+AAF  AF  AMTKLGR+GV TG+ G IRR
Sbjct  270  LQQGKGLFTSDQVLYTNRRSRPTVDSWAKNSAAFNAAFVKAMTKLGRVGVKTGHNGNIRR  329

Query  32   DC  27
            DC
Sbjct  330  DC  331



>ref|XP_009112219.1| PREDICTED: peroxidase 73 [Brassica rapa]
 emb|CDY18657.1| BnaA09g07380D [Brassica napus]
Length=329

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 242/320 (76%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V++  + + + +   +  AQL+ NFY  +CPNVE++V+  VQQK ++TFVT PATLRLF
Sbjct  6    LVLAMALCLTISVFPDTTTAQLKPNFYGKSCPNVEAIVKKVVQQKVKETFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASVL+ S PN KAEKDHPDN+SLAGDGFD VIKAK A+D+ P CRNKVSC
Sbjct  66   FHDCFVNGCDASVLIQSTPNNKAEKDHPDNVSLAGDGFDVVIKAKKAIDAIPSCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV+  A G  Y VELGRRDG +ST  SV  NLPG    +D+LN +F ++ L
Sbjct  126  ADILALATRDVIVAAKGPSYKVELGRRDGLVSTAASVNGNLPGPNDNVDKLNKLFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +VA RIY F     +DPT+N  Y  +L+  CP +VDPRIA
Sbjct  186  TQDDMIALSAAHTLGFAHCSKVANRIYNFNRTHPVDPTINKAYVKELQAACPKKVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TV+ +A ++ AF  AF  AM
Sbjct  246  INMDPVTPRTFDNIYFKNLQQGKGLFTSDQVLFTDRRSRPTVDAWAKSSPAFNAAFVKAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV  G  G IRRDC
Sbjct  306  TKLGRVGVKVGRNGNIRRDC  325



>ref|XP_010033422.1| PREDICTED: peroxidase 51-like [Eucalyptus grandis]
 gb|KCW53058.1| hypothetical protein EUGRSUZ_J02352 [Eucalyptus grandis]
Length=326

 Score =   389 bits (1000),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 199/304 (65%), Positives = 231/304 (76%), Gaps = 2/304 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQL   FY  TCPNVES+V+ AV  KF QTF+T P TLRLFFHDCF+ GCDAS+L++SPN
Sbjct  24   AQLTEGFYGQTCPNVESIVKQAVTTKFGQTFITIPGTLRLFFHDCFIEGCDASILISSPN  83

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
            G AEKD PDN SLAGDGFDTVIKAK AV+++  C+  VSCADILA+A RDVV LAGG  +
Sbjct  84   GDAEKDAPDNQSLAGDGFDTVIKAKQAVEAS--CQGVVSCADILAIAARDVVVLAGGPSF  141

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGRRDG IS  + V   LP   F LDQLN++F +HGLTQ+DMIALSGAHT+GFSHC 
Sbjct  142  NVELGRRDGLISKASQVAGKLPEPNFDLDQLNAIFSQHGLTQSDMIALSGAHTLGFSHCD  201

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + A R+Y F   S +DPTLN  YA QL Q CP  VDP+IAINMDP TP TFDN Y+ NL 
Sbjct  202  RFANRLYSFSSSSPVDPTLNSTYAVQLMQECPQNVDPQIAINMDPVTPQTFDNMYYTNLV  261

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            QGKGLF SD+ LFTD  S+ TV  FA++  +F QAFA AM KLGR+G+ TG+ GEIRRDC
Sbjct  262  QGKGLFTSDETLFTDSASKPTVLNFANSPGSFNQAFATAMRKLGRVGIKTGSQGEIRRDC  321

Query  26   TRPN  15
            T  N
Sbjct  322  TAFN  325



>ref|XP_010086957.1| Peroxidase 51 [Morus notabilis]
 gb|EXB25093.1| Peroxidase 51 [Morus notabilis]
Length=326

 Score =   389 bits (999),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 234/300 (78%), Gaps = 5/300 (2%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPNG  744
            QL+ N+Y NTCPNVE+LVR+AVQ+KF+QTFVT PAT+RLFFHDCFV+GCDASV++AS  G
Sbjct  27   QLKNNYYANTCPNVETLVRNAVQKKFQQTFVTVPATIRLFFHDCFVQGCDASVIVASSGG  86

Query  743  K-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              AEKDH DNLSLAGDGFDTVIKAK AVD++P+CRNKVSCADILALATRDV++LAGG  Y
Sbjct  87   NTAEKDHSDNLSLAGDGFDTVIKAKEAVDADPKCRNKVSCADILALATRDVIALAGGPSY  146

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGR DG  ST +SV   LP     L QLNS+F  +GL+QTDMIALSGAHT+GFSHC 
Sbjct  147  AVELGRLDGLTSTSSSVNGKLPQPSSNLKQLNSLFAANGLSQTDMIALSGAHTVGFSHCN  206

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
            + + RIY     + +DPTLN  Y  QLR  CP  VDP IAIN+DP TP TFDN YFKNLQ
Sbjct  207  RFSSRIY----GNPVDPTLNKTYLAQLRSQCPKNVDPNIAINIDPNTPRTFDNVYFKNLQ  262

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
            Q  GL  SDQVLF D  SR TVN +A+N  AF+ AF  A+TKLGR+GV TG  G IRR+C
Sbjct  263  QRMGLLTSDQVLFEDSSSRPTVNAWANNKQAFENAFVTAITKLGRVGVKTGRNGNIRRNC  322



>emb|CDX81319.1| BnaC09g07300D [Brassica napus]
Length=329

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 242/320 (76%), Gaps = 1/320 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V++  + + + +   +  AQL+ NFY  +CPNVE++V+  VQQK ++TFVT PATLRLF
Sbjct  6    LVLAMALCLTISVFPDTTTAQLKPNFYGKSCPNVEAIVKKVVQQKVKETFVTIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDCFV GCDASV++ S PN KAEKDHPDN+SLAGDGFD V+KAK A+D+ P CRNKVSC
Sbjct  66   FHDCFVNGCDASVMIQSTPNNKAEKDHPDNVSLAGDGFDVVVKAKKAIDAIPSCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDV+  A G  Y VELGRRDG +ST  SV  NLPG    +D+LN +F ++ L
Sbjct  126  ADILALATRDVIVAAKGPSYTVELGRRDGLVSTAASVNGNLPGPNDNVDKLNKLFAKNKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALS AHT+GF+HC +VA RIY F     +DPT+N  Y  +L+  CP +VDPRIA
Sbjct  186  TQDDMIALSAAHTLGFAHCSKVANRIYNFNRTHPVDPTINKAYVKELQAACPKKVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP TFDN YFKNLQQGKGLF SDQVLFTD RSR TV+ +A ++ AF  AF  AM
Sbjct  246  INMDPVTPRTFDNIYFKNLQQGKGLFTSDQVLFTDRRSRPTVDAWAKSSPAFNAAFVKAM  305

Query  86   TKLGRIGVLTGNLGEIRRDC  27
            TKLGR+GV  G  G IRRDC
Sbjct  306  TKLGRVGVKVGRNGNIRRDC  325



>ref|XP_010669285.1| PREDICTED: peroxidase 16-like [Beta vulgaris subsp. vulgaris]
Length=332

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 250/323 (77%), Gaps = 2/323 (1%)
 Frame = -2

Query  989  NSMVVSAGILVCLVLLVSSAH--AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPAT  816
            N+ ++     + +VL++S  H  AQL+ N+Y N+CPNVE++VR+AV++K ++T VTAPAT
Sbjct  4    NNFIIFVLSTILIVLIISPNHCSAQLKHNYYSNSCPNVETIVRNAVKKKLQETIVTAPAT  63

Query  815  LRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNK  636
            LRLFFHDCF++GCDASV+LASP+G AEKD  D+LSLAGDGFDTVI+AK AV+  P C++K
Sbjct  64   LRLFFHDCFIKGCDASVILASPSGNAEKDSEDDLSLAGDGFDTVIRAKTAVERVPGCKHK  123

Query  635  VSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGR  456
            VSCADILALATRDV+ L+GG  Y VELGR+DG+ ST  SV+ +LP A F   QL  MF  
Sbjct  124  VSCADILALATRDVIVLSGGPNYGVELGRKDGKTSTKASVEGHLPLARFNYKQLRKMFAS  183

Query  455  HGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDP  276
            HGL+Q D+IALSGAHT+GFSHC Q +KRIY ++ +S IDP L   +A +L++ CP  VDP
Sbjct  184  HGLSQVDLIALSGAHTLGFSHCSQFSKRIYNYKSKSSIDPKLEQGFAKELQKQCPRDVDP  243

Query  275  RIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafa  96
            RI I +DPT+P  FDN+++KNLQQGKGL  SDQ L+T  +S+  VN FA+N   F++ F 
Sbjct  244  RIVIPLDPTSPFRFDNSFYKNLQQGKGLLASDQALYTTRKSKRVVNAFAANTTLFERVFV  303

Query  95   aAMTKLGRIGVLTGNLGEIRRDC  27
            AA+T+LGR+GV TGN GEIR DC
Sbjct  304  AAITRLGRLGVKTGNQGEIRHDC  326



>ref|XP_002274131.2| PREDICTED: peroxidase 55-like [Vitis vinifera]
 ref|XP_010660749.1| PREDICTED: peroxidase 55-like [Vitis vinifera]
Length=336

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 231/316 (73%), Gaps = 2/316 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            LV ++L+V     QL  NFY ++CPNVE++V+  V  KF QTF T PATLRLFFHDCFV 
Sbjct  22   LVMVLLMVGQGEGQLAENFYSSSCPNVEAIVKQEVSTKFSQTFTTIPATLRLFFHDCFVE  81

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDASVL++SPNG AEKD  DNLSLAGDGFDTVIKAK +V++   C   VSCADILALA 
Sbjct  82   GCDASVLISSPNGDAEKDSDDNLSLAGDGFDTVIKAKQSVEA--ACPGIVSCADILALAA  139

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDVV LAGG  + VELGRRDG IS  + V  NLP   F LDQLNSMF RH L+Q DMIAL
Sbjct  140  RDVVVLAGGPSFSVELGRRDGLISQASRVAGNLPEPSFDLDQLNSMFARHNLSQLDMIAL  199

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHT+GFSHC + A R+Y F   S +DP+L+  YA QL   CP  VDP IAI+MDP TP
Sbjct  200  SGAHTVGFSHCSRFANRLYSFSSSSQVDPSLDSDYAKQLMSGCPQNVDPSIAIDMDPVTP  259

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDN Y++NL  GKGLF SD+ LF+DP S+ TV  FA++   F  AF  AM KLGR+GV
Sbjct  260  RTFDNEYYQNLVAGKGLFTSDEALFSDPSSQPTVTDFANSPGEFNGAFITAMRKLGRVGV  319

Query  62   LTGNLGEIRRDCTRPN  15
             TG+ GEIR+DCT  N
Sbjct  320  KTGDQGEIRKDCTAFN  335



>ref|XP_010550341.1| PREDICTED: peroxidase 35-like [Tarenaya hassleriana]
Length=329

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 239/324 (74%), Gaps = 1/324 (0%)
 Frame = -2

Query  983  MVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            +V++  + + + +      AQL   FY  TCPNVE +VR+ V++K +QTFV+ PATLRLF
Sbjct  6    LVLATALCLAVSMFPDLTTAQLMPKFYAKTCPNVEQIVRNVVKRKVKQTFVSIPATLRLF  65

Query  803  FHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FHDC V GCDAS+++ S PN KAEKDHPDNLSLAGDGFD VI+AK A+D+NP CRNKVSC
Sbjct  66   FHDCAVSGCDASLMIQSTPNNKAEKDHPDNLSLAGDGFDVVIQAKKALDANPNCRNKVSC  125

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILALATRDVV  AGG FY VELGR D  +S   SV+ NLP     L++LN++F +  L
Sbjct  126  ADILALATRDVVVEAGGPFYEVELGRFDSLVSKAASVEGNLPKPTDDLNKLNALFSKLKL  185

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            +Q DMIALS AHT+GF+HC +V  RIY F   S +DPTLN  YA  L+  CP +VDPRIA
Sbjct  186  SQDDMIALSAAHTVGFAHCSKVFNRIYSFSKTSPVDPTLNKTYAKDLQMACPKKVDPRIA  245

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDPTTP  FDN YFKNLQQGKGLF SDQVLFTD RS+ TVN +A +  AF +AFA AM
Sbjct  246  INMDPTTPRIFDNVYFKNLQQGKGLFTSDQVLFTDSRSKQTVNAWAKDPQAFNRAFATAM  305

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
            TKLGR GV     G IRRDC R N
Sbjct  306  TKLGRFGVKNRFNGNIRRDCGRFN  329



>gb|KGN63167.1| hypothetical protein Csa_2G406650 [Cucumis sativus]
Length=326

 Score =   387 bits (995),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 239/324 (74%), Gaps = 2/324 (1%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            +M V+   L  L +L+   HAQL  NFY ++CPNVE +VR AV  K  QTFVT PATLRL
Sbjct  5    AMRVAVLSLALLCMLIGVVHAQLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRL  64

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFV+GCDASV++AS +G AEKD  DNLSLAGDGFDTVIKAK AV++  QC  KVSC
Sbjct  65   FFHDCFVQGCDASVMIASASGDAEKDSEDNLSLAGDGFDTVIKAKQAVEA--QCPGKVSC  122

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILA+A RDVV LAGG  + VELGRRDG IS  + V  NLPG  F L QLN+MF ++ L
Sbjct  123  ADILAIAARDVVVLAGGQNFAVELGRRDGLISKASLVAGNLPGPNFNLSQLNTMFAKNNL  182

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQT+MIALSGAHT+GFSHC + A R+Y F   S +DP+L+ +YA QL   CP  VDPRIA
Sbjct  183  TQTNMIALSGAHTVGFSHCSRFANRLYNFSATSKVDPSLDPKYAKQLMGACPQDVDPRIA  242

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            +NMDP TP   DN Y++NL   KGLF SDQVL+TDP S+ TV+ FA++ + F  AF  AM
Sbjct  243  VNMDPVTPRKMDNVYYQNLVNHKGLFTSDQVLYTDPLSQATVSGFANDRSGFNNAFGEAM  302

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
             +LGR+GV TG  GEIR+DCT  N
Sbjct  303  VQLGRVGVKTGAAGEIRKDCTAFN  326



>ref|XP_004138794.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=323

 Score =   387 bits (994),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 239/324 (74%), Gaps = 2/324 (1%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            +M V+   L  L +L+   HAQL  NFY ++CPNVE +VR AV  K  QTFVT PATLRL
Sbjct  2    AMRVAVLSLALLCMLIGVVHAQLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRL  61

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFV+GCDASV++AS +G AEKD  DNLSLAGDGFDTVIKAK AV++  QC  KVSC
Sbjct  62   FFHDCFVQGCDASVMIASASGDAEKDSEDNLSLAGDGFDTVIKAKQAVEA--QCPGKVSC  119

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILA+A RDVV LAGG  + VELGRRDG IS  + V  NLPG  F L QLN+MF ++ L
Sbjct  120  ADILAIAARDVVVLAGGQNFAVELGRRDGLISKASLVAGNLPGPNFNLSQLNTMFAKNNL  179

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQT+MIALSGAHT+GFSHC + A R+Y F   S +DP+L+ +YA QL   CP  VDPRIA
Sbjct  180  TQTNMIALSGAHTVGFSHCSRFANRLYNFSATSKVDPSLDPKYAKQLMGACPQDVDPRIA  239

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            +NMDP TP   DN Y++NL   KGLF SDQVL+TDP S+ TV+ FA++ + F  AF  AM
Sbjct  240  VNMDPVTPRKMDNVYYQNLVNHKGLFTSDQVLYTDPLSQATVSGFANDRSGFNNAFGEAM  299

Query  86   TKLGRIGVLTGNLGEIRRDCTRPN  15
             +LGR+GV TG  GEIR+DCT  N
Sbjct  300  VQLGRVGVKTGAAGEIRKDCTAFN  323



>ref|XP_010315910.1| PREDICTED: peroxidase 51 [Solanum lycopersicum]
Length=325

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/305 (66%), Positives = 228/305 (75%), Gaps = 2/305 (1%)
 Frame = -2

Query  929  HAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP  750
              +L  NFY  TCPNVE +V+ AV  KF QTFVT PATLRLFFHDCFV GCDASV++ASP
Sbjct  22   EGELVENFYGFTCPNVEFIVQQAVSLKFSQTFVTIPATLRLFFHDCFVEGCDASVMIASP  81

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            NG AEKD  DNLSLAGDGFDTV+KAK AV++  QC   VSCADILA+ATRDVV LAGG  
Sbjct  82   NGDAEKDSKDNLSLAGDGFDTVVKAKQAVEA--QCPGVVSCADILAIATRDVVVLAGGPS  139

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGRRDG IS  + V   LP   F L QLN+MF RH L+Q DMIALSGAHT+GFSHC
Sbjct  140  YNVELGRRDGLISQASRVAGKLPEPDFNLIQLNTMFARHNLSQFDMIALSGAHTLGFSHC  199

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + A R+Y F P + +DP+L+  YA +L+ MCP  VDP IAINMDP TP TFDN Y+KNL
Sbjct  200  DRFANRLYSFTPSNPVDPSLDPEYAKELKDMCPQNVDPTIAINMDPATPRTFDNEYYKNL  259

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +GKGLF SDQVLFTD  S+ TV+ FA+N   F  AF  AM KLGR+GV TG  GEIR D
Sbjct  260  VKGKGLFTSDQVLFTDESSQGTVSDFANNAFDFNGAFVTAMRKLGRVGVKTGGQGEIRLD  319

Query  29   CTRPN  15
            CTR N
Sbjct  320  CTRFN  324



>ref|XP_009802952.1| PREDICTED: peroxidase 55-like [Nicotiana sylvestris]
Length=325

 Score =   385 bits (990),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 205/308 (67%), Positives = 228/308 (74%), Gaps = 2/308 (1%)
 Frame = -2

Query  938  SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLL  759
            S A  QL  NFY  TCPNVE +V+ AV  KF QTFVT PATLRLFFHDCFV GCDASVL+
Sbjct  19   SGAEGQLVENFYGFTCPNVEFIVQQAVSTKFSQTFVTIPATLRLFFHDCFVEGCDASVLI  78

Query  758  ASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAG  579
            ASPNG AEKD  DN+SLAGDGFDTVIKAK AV++  QC   VSCADILA+ATRDVV LAG
Sbjct  79   ASPNGDAEKDSSDNISLAGDGFDTVIKAKEAVEA--QCPGVVSCADILAIATRDVVVLAG  136

Query  578  GAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGF  399
            G  Y VELGRRDG IS  + V   LP   F L+QL +MF  H L+Q DMIALSGAHT+GF
Sbjct  137  GPAYNVELGRRDGLISKASRVAGKLPEPQFNLNQLTTMFANHNLSQFDMIALSGAHTLGF  196

Query  398  SHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYF  219
            SHC + A R+Y F   + +DP+L+  YA QL QMCP +VDP IAINMDP TP TFDN Y+
Sbjct  197  SHCDRFANRLYSFTSSNPVDPSLDPEYAKQLMQMCPQKVDPSIAINMDPVTPRTFDNEYY  256

Query  218  KNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEI  39
            KNL  GKGLF SDQVLFTD  S+ TVN FA+N   F  AF  AM KLGR+ V TGN GEI
Sbjct  257  KNLVGGKGLFTSDQVLFTDEASQRTVNDFANNAFDFNGAFVTAMRKLGRVDVKTGNQGEI  316

Query  38   RRDCTRPN  15
            R DCTR N
Sbjct  317  RLDCTRFN  324



>gb|EYU29641.1| hypothetical protein MIMGU_mgv1a009564mg [Erythranthe guttata]
Length=338

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 233/306 (76%), Gaps = 2/306 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            A+LR NFY N CP+VE++VRSAV +K  QT +T P TLRLFFHDCFV GCDASV++AS  
Sbjct  33   AELRQNFYSNICPDVENIVRSAVSRKASQTSITIPGTLRLFFHDCFVSGCDASVIVASTE  92

Query  746  -GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
               AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P+C+NKVSCADILALA RDV+ LAGG  
Sbjct  93   RNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPRCKNKVSCADILALAARDVIVLAGGPT  152

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            YPVELGR DG  ST  SV  NLP   F L+QLNSMF   GLTQ DMIALSGAHT+GF+HC
Sbjct  153  YPVELGRLDGLSSTSASVNGNLPQPNFNLNQLNSMFASRGLTQADMIALSGAHTLGFTHC  212

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPL-RVDPRIAINMDPTTPNTFDNAYFKN  213
             ++  RIY F   + +DPTLN +YA QL+  C     DPRI++N+DPTTP  FDNAYF+N
Sbjct  213  SRITNRIYNFSSANPVDPTLNKQYASQLQATCRRNESDPRISVNLDPTTPGIFDNAYFEN  272

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            L QGKG+F SDQVLFTD RSRN V  +AS++ AF  AF  A+TKLGR+GV T   G IR 
Sbjct  273  LIQGKGIFTSDQVLFTDSRSRNIVTNWASDSRAFNDAFIRAITKLGRVGVKTQGNGNIRF  332

Query  32   DCTRPN  15
            DC + N
Sbjct  333  DCAKFN  338



>ref|XP_004166423.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=330

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            L +L+   HAQL  NFY ++CPNVE +VR AV  K  QTFVT PATLRLFFHDCFV+GCD
Sbjct  20   LCMLIGVVHAQLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPATLRLFFHDCFVQGCD  79

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            ASV++AS +G AEKD  DNLSLAGDGFDTVIKAK AV++  QC  KVSCADILA+A RDV
Sbjct  80   ASVMIASASGDAEKDSEDNLSLAGDGFDTVIKAKQAVEA--QCPGKVSCADILAIAARDV  137

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            V LAGG  + VELGRRDG IS  + V  NLPG  F L QLN+MF ++ LTQT+MIALSGA
Sbjct  138  VVLAGGQNFAVELGRRDGLISKASLVAGNLPGPNFNLSQLNTMFAKNNLTQTNMIALSGA  197

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HT+GFSHC + A R+Y F   S +DP+L+ +YA QL   CP  VDPRIA+NMDP TP   
Sbjct  198  HTVGFSHCSRFANRLYNFSATSKVDPSLDPKYAKQLMGACPQDVDPRIAVNMDPVTPRKM  257

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DN Y++NL   KGLF SDQVL+TDP S+ TV+ FA++ + F  AF  AM +LGR+GV TG
Sbjct  258  DNVYYQNLVNHKGLFTSDQVLYTDPLSQATVSGFANDRSGFNNAFGEAMVQLGRVGVKTG  317

Query  53   NLGEIRRDCTRPN  15
              GEIR+DCT  N
Sbjct  318  AAGEIRKDCTAFN  330



>ref|XP_008441333.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=325

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 239/322 (74%), Gaps = 4/322 (1%)
 Frame = -2

Query  980  VVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFF  801
            VV +  LVC+  L+  A AQL  NFY ++CPNVE +VR AV  K  QTFVT P TLRLFF
Sbjct  8    VVLSLALVCM--LIGVAQAQLSFNFYNSSCPNVEQIVRQAVSLKINQTFVTIPGTLRLFF  65

Query  800  HDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCAD  621
            HDCFV+GCDASV++AS +G AEKD  DNLSLAGDGFDTV+KAK AV++  QC  KVSCAD
Sbjct  66   HDCFVQGCDASVMIASASGDAEKDSEDNLSLAGDGFDTVVKAKQAVEA--QCPGKVSCAD  123

Query  620  ILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQ  441
            ILA+A RDVV LAGG  + VELGRRDG IS  + V  NLPG  F L QLN+MF ++ LTQ
Sbjct  124  ILAIAARDVVVLAGGPNFAVELGRRDGLISKASLVVGNLPGPNFNLSQLNTMFAKNNLTQ  183

Query  440  TDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAIN  261
            TDMIALSGAHT+GFSHC + A R+Y F   S +DP+L+  YA QL   CP  VDPRIA+N
Sbjct  184  TDMIALSGAHTVGFSHCSRFANRLYNFSATSKVDPSLDPNYAKQLMDACPQNVDPRIAVN  243

Query  260  MDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTK  81
            MDP TP   DN Y++NL   KGLF SDQVLF DP S+ TV+ FA+N + F +AFA AM +
Sbjct  244  MDPVTPRKMDNVYYQNLVNHKGLFTSDQVLFMDPLSQATVSGFANNGSGFNKAFAEAMVR  303

Query  80   LGRIGVLTGNLGEIRRDCTRPN  15
            LGR+GV TG +GEIR+DCT  N
Sbjct  304  LGRVGVKTGAVGEIRKDCTTFN  325



>ref|XP_006411878.1| hypothetical protein EUTSA_v10025695mg [Eutrema salsugineum]
 dbj|BAJ34486.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53331.1| hypothetical protein EUTSA_v10025695mg [Eutrema salsugineum]
Length=328

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 231/301 (77%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR NFY  +CPNVE +VRSAVQQK +QTF T PATLRL+FHDCFV GCDASV++AS N
Sbjct  24   AQLRRNFYAGSCPNVEQIVRSAVQQKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTN  83

Query  746  G-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
              KAEKDHPDNLSLAGDGFDTVIKAK  +D+   CRNKVSCADIL +ATRDVV+LAGG  
Sbjct  84   NNKAEKDHPDNLSLAGDGFDTVIKAKQVLDAVANCRNKVSCADILTIATRDVVNLAGGPR  143

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  S+  SV+  LP     ++QL S+F ++GL+  DMIALSGAHT+GF+HC
Sbjct  144  YEVELGRLDGLSSSAASVEGKLPHPTDDVNQLTSLFAKNGLSLKDMIALSGAHTLGFAHC  203

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+KNL
Sbjct  204  TKVFNRIYSFNKTTKVDPTVNKAYVAELQASCPRNIDPRVAINMDPTTPRQFDNVYYKNL  263

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF  +M +LGR+GV TG  G IRRD
Sbjct  264  QQGKGLFTSDQVLFTDRRSKPTVDLWANNAKLFNQAFGNSMIRLGRVGVKTGRNGNIRRD  323

Query  29   C  27
            C
Sbjct  324  C  324



>ref|XP_006841967.1| hypothetical protein AMTR_s00144p00031900 [Amborella trichopoda]
 gb|ERN03642.1| hypothetical protein AMTR_s00144p00031900 [Amborella trichopoda]
Length=326

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 204/305 (67%), Positives = 234/305 (77%), Gaps = 5/305 (2%)
 Frame = -2

Query  938  SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLL  759
            S+A+AQL  NFY   CPNVES+VR+ V  K +QTFVT PATLRLFFHDCFV+GCDASV++
Sbjct  22   STANAQLSQNFYAKICPNVESIVRNVVANKIKQTFVTIPATLRLFFHDCFVQGCDASVMI  81

Query  758  ASPNGK-AEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            AS  G  AEKDH DN+SLAGDGFDTVIKAKA VD   QC+NKVSCADILALATRDV++++
Sbjct  82   ASAGGNTAEKDHEDNMSLAGDGFDTVIKAKAEVDKVLQCKNKVSCADILALATRDVIAMS  141

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  Y VELGRRDG  ST +SV   LP     L++LN++F  H L+QTDMIALS AHT+G
Sbjct  142  GGPSYAVELGRRDGLTSTASSVTGKLPHPTDNLNRLNALFASHRLSQTDMIALSAAHTVG  201

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + + RIY     + IDPTLN  YA +L+ MCP  VDPRIAINMDP TP  FDN Y
Sbjct  202  FSHCGKFSNRIY----SNPIDPTLNKTYAKELQDMCPRIVDPRIAINMDPITPRKFDNEY  257

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            FKNLQ+G GLF SDQVLFTD RSR TVN FA ++ AF  AFAAAMTKLGR+ V TGN G 
Sbjct  258  FKNLQKGMGLFTSDQVLFTDARSRQTVNTFAQSSTAFFNAFAAAMTKLGRVDVKTGNQGN  317

Query  41   IRRDC  27
            IR  C
Sbjct  318  IRIRC  322



>ref|XP_007031900.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY02826.1| Peroxidase superfamily protein [Theobroma cacao]
Length=324

 Score =   384 bits (986),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 231/319 (72%), Gaps = 3/319 (1%)
 Frame = -2

Query  968  GILVCLVLLV-SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            G++  LV ++     AQL  NFY NTCPN+ES+V+  V  KF QTFVT PATLRLFFHDC
Sbjct  7    GLVWLLVFMILQRGEAQLSENFYSNTCPNLESIVKQEVSTKFSQTFVTIPATLRLFFHDC  66

Query  791  FVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILA  612
            FV GCDASV+++SPNG AEKD  DNLSLAGDGFDTVIKAK AV+   QC   VSCADILA
Sbjct  67   FVEGCDASVMISSPNGDAEKDAQDNLSLAGDGFDTVIKAKQAVER--QCHGIVSCADILA  124

Query  611  LATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDM  432
            LA RDVV LAGG  + VELGR DG +S  ++V  NLP   F   QLN+MF RH LTQ DM
Sbjct  125  LAARDVVVLAGGPSWEVELGRLDGLVSKASNVAGNLPEPEFNRVQLNTMFARHNLTQLDM  184

Query  431  IALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDP  252
            IALSGAHT+GFSHC + A R+Y F   S +DPTL+  YA +L Q CP  VDP IAINMDP
Sbjct  185  IALSGAHTVGFSHCNRFANRLYSFSSSSPVDPTLDPNYAQELMQACPRNVDPSIAINMDP  244

Query  251  TTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGR  72
             TP TFDN Y++NL  GKGLF SD+VLFTDP S  TVN FA+N   F  AF  AM KLGR
Sbjct  245  ETPQTFDNVYYQNLVAGKGLFTSDEVLFTDPASDPTVNDFATNPGNFNGAFITAMRKLGR  304

Query  71   IGVLTGNLGEIRRDCTRPN  15
            +GV TG  GEIR DCT  N
Sbjct  305  VGVKTGKNGEIRIDCTAFN  323



>ref|XP_009135008.1| PREDICTED: peroxidase 50 [Brassica rapa]
 emb|CDX75661.1| BnaA01g00410D [Brassica napus]
Length=326

 Score =   384 bits (986),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 233/306 (76%), Gaps = 1/306 (0%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            V+   AQLR+NFY  +CPNVE +VR AVQ+K +QTF T PATLRL+FHDCFV GCDASV+
Sbjct  17   VNLVSAQLRSNFYAGSCPNVEKIVRDAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVM  76

Query  761  LASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +AS  N KAEKDHPDNLSLAGDGFDTVIKAK A+D+   CRNKVSCADIL +ATRDVV+L
Sbjct  77   IASTGNNKAEKDHPDNLSLAGDGFDTVIKAKQALDAVANCRNKVSCADILTIATRDVVNL  136

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGR DG  ST  SV+  LP     +++L S+F ++GL+  +MIALSGAHT+
Sbjct  137  AGGPRYEVELGRLDGLSSTAASVEGKLPQPTDDVNKLTSLFAKNGLSLNEMIALSGAHTL  196

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC +V  RIY F   + +DPT+N  Y  +LR  CP  +DPR+AINMDPTTP  FDN 
Sbjct  197  GFAHCTKVFNRIYSFNKTTQVDPTVNKAYVTELRASCPRNIDPRVAINMDPTTPRQFDNV  256

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y+KNLQQGKGLF SDQ LFTD RS+ TV+ +A+N   F QAF  +M KLGR+GV TG  G
Sbjct  257  YYKNLQQGKGLFTSDQDLFTDRRSKPTVDLWANNANLFNQAFVNSMIKLGRVGVKTGRNG  316

Query  44   EIRRDC  27
             IRRDC
Sbjct  317  NIRRDC  322



>ref|XP_011009184.1| PREDICTED: peroxidase 55 [Populus euphratica]
Length=323

 Score =   384 bits (985),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 232/317 (73%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +LV L++ +     QL  NFY ++CPNVE +VR AV  KFRQTF T PATLRLFFHDCFV
Sbjct  8    LLVVLIIAIGRGEGQLVENFYSSSCPNVEGIVRQAVSTKFRQTFTTIPATLRLFFHDCFV  67

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDAS +++SPNG AEKD PDNLSLAGDGFDTV+KAK AV++   C   VSCADILALA
Sbjct  68   TGCDASTMVSSPNGDAEKDAPDNLSLAGDGFDTVVKAKQAVEA--ACPKVVSCADILALA  125

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
             RDVV LAGG  + VELGRRDG +S  + V+ NLP   F L QLN+MF R+ L Q DMIA
Sbjct  126  ARDVVVLAGGPSFNVELGRRDGMVSQASLVKGNLPEPDFNLSQLNAMFARNNLNQIDMIA  185

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC + AKR+Y F   S +DP+L+  YA QL   CP  VDP IAI+MDP T
Sbjct  186  LSGAHTLGFSHCNRFAKRLYSFSSSSPVDPSLDAEYAQQLMNACPRNVDPSIAIDMDPVT  245

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
              TFDN YF+NL  GKGLF SD+VLF+DP S+ TVN FA N+  F  AFA AM KLGR+G
Sbjct  246  SRTFDNVYFQNLVSGKGLFTSDEVLFSDPASQPTVNDFAKNSGNFNGAFATAMRKLGRVG  305

Query  65   VLTGNLGEIRRDCTRPN  15
            V TG+ G IR DCT  N
Sbjct  306  VKTGSQGRIRTDCTVIN  322



>ref|XP_010432051.1| PREDICTED: peroxidase 50-like [Camelina sativa]
Length=329

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 231/303 (76%), Gaps = 1/303 (0%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            A AQLR NFY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS
Sbjct  23   ASAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIAS  82

Query  752  PNG-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
             N  KAEKDH +NLSLAGDGFDTVIKAK A+D+   CRNKVSCADIL +ATRDVV+LAGG
Sbjct  83   TNNNKAEKDHEENLSLAGDGFDTVIKAKEALDAVANCRNKVSCADILTMATRDVVNLAGG  142

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
              Y VELGR DG  ST  SV   LP     ++QL S+F ++GL+  DMIALSGAHT+GF+
Sbjct  143  PKYDVELGRLDGLSSTAASVGGKLPHPTDNVNQLTSLFAKNGLSLNDMIALSGAHTLGFA  202

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+K
Sbjct  203  HCTKVFNRIYSFNKTTKVDPTVNKAYVTELKASCPQNIDPRVAINMDPTTPRQFDNVYYK  262

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQGKGLF SDQ LFTD RS+ TV+ +ASN   F QAF  +M KLGR+GV TGN G IR
Sbjct  263  NLQQGKGLFTSDQDLFTDRRSKPTVDLWASNAQLFNQAFVNSMIKLGRVGVKTGNNGNIR  322

Query  35   RDC  27
            RDC
Sbjct  323  RDC  325



>gb|KDP46270.1| hypothetical protein JCGZ_10110 [Jatropha curcas]
Length=326

 Score =   383 bits (984),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 236/317 (74%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            IL+ L++++     QL  NFY ++CPNVE++V+  V +KF +TF T PATLRLFFHDCFV
Sbjct  11   ILIVLMMMIRRGEGQLIENFYSSSCPNVEAIVKQVVTKKFTETFPTVPATLRLFFHDCFV  70

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDAS+L++SPNG AEKD PDNLSLAGDGFDTVIKAK AV+   QC N VSCADILA+A
Sbjct  71   TGCDASILISSPNGDAEKDAPDNLSLAGDGFDTVIKAKQAVEQ--QCPNVVSCADILAIA  128

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
             RDVV LAGG  + VELGRRDG IS  + V  NLP   F L QLN++F ++ LTQ DMIA
Sbjct  129  ARDVVVLAGGPSFNVELGRRDGLISKSSLVTGNLPEPNFNLAQLNTLFAKNNLTQIDMIA  188

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC + A R+Y F P S +DP+L+  YA QL + CP  VDP IA++MDPTT
Sbjct  189  LSGAHTVGFSHCNRFANRLYSFSPSSPVDPSLDPNYAKQLMEACPQNVDPTIAVDMDPTT  248

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
              TFDN Y++NL  GKG+F SD+VLFTD +S++TV  FA+N   F+ AF  AM KLGR+G
Sbjct  249  ARTFDNMYYQNLIDGKGMFTSDEVLFTDSKSKSTVIEFANNPEDFKAAFTVAMRKLGRVG  308

Query  65   VLTGNLGEIRRDCTRPN  15
            +  GN G IR DCT  N
Sbjct  309  IKIGNQGRIRIDCTDIN  325



>emb|CAA67362.1| peroxidase ATP9a [Arabidopsis thaliana]
Length=312

 Score =   382 bits (982),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/308 (63%), Positives = 235/308 (76%), Gaps = 1/308 (0%)
 Frame = -2

Query  947  LLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDAS  768
            L +  + AQLR NFY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDAS
Sbjct  1    LTLDLSSAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDAS  60

Query  767  VLLASPNG-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVV  591
            V++AS N  KAEKDH +NLSLAGDGFDTVIKAK A+D+ P CRNKVSCADIL +ATRDVV
Sbjct  61   VMIASTNNNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVV  120

Query  590  SLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAH  411
            +LAGG  Y VELGR DG  ST  SV   LP     +++L S+F ++GL+  DMIALSGAH
Sbjct  121  NLAGGPQYDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAH  180

Query  410  TIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFD  231
            T+GF+HC +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FD
Sbjct  181  TLGFAHCTKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNIDPRVAINMDPTTPRQFD  240

Query  230  NAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGN  51
            N Y+KNLQQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF  +M KLGR+GV TG+
Sbjct  241  NVYYKNLQQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAFINSMIKLGRVGVKTGS  300

Query  50   LGEIRRDC  27
             G IRRDC
Sbjct  301  NGNIRRDC  308



>emb|CDY29561.1| BnaA03g54060D [Brassica napus]
Length=326

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 229/301 (76%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  NFY  +CPNVE +VR+AVQQK +QTF T PATLRL+FHDCFV GCDASV++AS  
Sbjct  22   AQLSRNFYAGSCPNVEQIVRNAVQQKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTD  81

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTVIKAK A+D+   CRNKVSCADIL +ATRDVV+LAGG  
Sbjct  82   NNKAEKDHPDNLSLAGDGFDTVIKAKQALDAVANCRNKVSCADILTIATRDVVNLAGGPR  141

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGRRDG  ST +SV+  LP     ++QL S+F ++GL++ DMIALSGAHT+GF+HC
Sbjct  142  YEVELGRRDGLSSTADSVEGKLPHPTDNVNQLTSLFAKNGLSRKDMIALSGAHTLGFAHC  201

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
            K V  RIY F   + +DPT+N  Y   L+  CP  VDP +AINMDPTTP  FDN Y++NL
Sbjct  202  KLVFNRIYNFNSTTQVDPTVNKDYVAALQGSCPRNVDPSVAINMDPTTPRQFDNVYYQNL  261

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ LFTD RS+  VN +ASN   F Q F  +M KLGR+GV TG  G IRRD
Sbjct  262  QQGKGLFTSDQDLFTDSRSKPIVNLWASNAKLFNQDFVNSMIKLGRVGVKTGRNGNIRRD  321

Query  29   C  27
            C
Sbjct  322  C  322



>emb|CAA71495.1| peroxidase [Spinacia oleracea]
Length=329

 Score =   382 bits (982),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 243/322 (75%), Gaps = 2/322 (1%)
 Frame = -2

Query  989  NSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLR  810
            N++ +SA +L+ L L        L T +Y  TCPNVE +VR AVQ+K +QTFVT PATLR
Sbjct  5    NNVSISA-LLIILCLSFPYTATSLSTTYYAKTCPNVEKIVRQAVQKKIQQTFVTIPATLR  63

Query  809  LFFHDCFVRGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKV  633
            LFFHDCFV GCDAS+++ S     AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C N V
Sbjct  64   LFFHDCFVSGCDASIIIQSTGTNTAEKDHPDNLSLAGDGFDTVIKAKAAVDAVPGCTNNV  123

Query  632  SCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRH  453
            SCADILALATRDVV+L+GG F+ VELGR DG +S  +SV   LP    +L++LNS+F  +
Sbjct  124  SCADILALATRDVVNLSGGPFWEVELGRFDGLVSKASSVNGRLPQPTDELNRLNSLFASN  183

Query  452  GLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPR  273
            GLTQ +M+ALSGAHT+GFSHC + +KRIY F P++ IDPTLN ++A QL+ MCP  VDPR
Sbjct  184  GLTQAEMVALSGAHTVGFSHCSKFSKRIYGFTPKNPIDPTLNAQFATQLQTMCPKNVDPR  243

Query  272  IAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaa  93
            IA+NMD  +P  FDNAY++NL  GKGLF SDQVL+TDPR++  V  +A ++++F+QAFA 
Sbjct  244  IAVNMDVQSPRIFDNAYYRNLINGKGLFTSDQVLYTDPRTKGLVTGWAQSSSSFKQAFAQ  303

Query  92   AMTKLGRIGVLTGNLGEIRRDC  27
            +M KLGR+GV     G IR  C
Sbjct  304  SMIKLGRVGVKNSKNGNIRVQC  325



>ref|XP_006373205.1| hypothetical protein POPTR_0017s09640g [Populus trichocarpa]
 gb|ERP51002.1| hypothetical protein POPTR_0017s09640g [Populus trichocarpa]
 gb|AHL39192.1| class III peroxidase [Populus trichocarpa]
Length=323

 Score =   382 bits (982),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 232/317 (73%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +LV L++ +     QL  NFY ++CPNVE +VR AV  KFRQTF T PATLRLFFHDCFV
Sbjct  8    LLVVLIIAIGRGEGQLVENFYSSSCPNVEGIVRQAVSTKFRQTFTTIPATLRLFFHDCFV  67

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDAS +++SPNG AEKD PDNLSLAGDGFDTV+KAK AV++   C   VSCADILALA
Sbjct  68   TGCDASTMVSSPNGDAEKDAPDNLSLAGDGFDTVVKAKQAVEA--ACPKVVSCADILALA  125

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
             RDVV LAGG  + VELGRRDG +S  + V+ NLP   F L QLN+MF ++ L Q DMIA
Sbjct  126  ARDVVVLAGGPSFNVELGRRDGMVSQASLVKGNLPDPDFTLSQLNAMFAKNNLNQIDMIA  185

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC + AKR+Y F   S +DP+L+  YA QL   CP  VDP IAI+MDP T
Sbjct  186  LSGAHTLGFSHCNRFAKRLYSFSSSSPVDPSLDAEYAQQLMNACPRNVDPSIAIDMDPVT  245

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
              TFDN YF+NL  GKGLF SD+VLF+DP S+ TVN FA N+  F  AFA AM KLGR+G
Sbjct  246  SRTFDNVYFQNLVSGKGLFTSDEVLFSDPASQPTVNDFAKNSGDFNGAFATAMRKLGRVG  305

Query  65   VLTGNLGEIRRDCTRPN  15
            V TG+ G IR DCT  N
Sbjct  306  VKTGSQGTIRTDCTVIN  322



>ref|XP_009607563.1| PREDICTED: peroxidase 16-like [Nicotiana tomentosiformis]
Length=328

 Score =   382 bits (982),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 237/313 (76%), Gaps = 1/313 (0%)
 Frame = -2

Query  950  VLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDA  771
            +   S  +AQL+ NFY+N+CPNVES+VRSAV+ KF+QT VTA ATLRLFFHDCF++GCDA
Sbjct  16   IFTSSCINAQLQRNFYRNSCPNVESIVRSAVEDKFKQTIVTAAATLRLFFHDCFIQGCDA  75

Query  770  SVLL-ASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            S++L +S N  AEKDH +NLSLAGDGFDTVIKAKAAVD+ P C NKVSCADILA+A RDV
Sbjct  76   SIILRSSGNNTAEKDHLENLSLAGDGFDTVIKAKAAVDNVPSCNNKVSCADILAIAARDV  135

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            V+LAGG  Y VELGRRDGR+S+  SVQ NLP +   +++L  MF   GLT   +IALSGA
Sbjct  136  VALAGGPNYAVELGRRDGRMSSQTSVQNNLPHSSSDIEKLLPMFASRGLTIRHLIALSGA  195

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HT+GFSHC Q + RIY F     +DPT++  YA +L++MCP    P + I MDP TP  F
Sbjct  196  HTLGFSHCNQFSSRIYNFNSTHKVDPTIDATYAKKLQEMCPQDAPPGVVIPMDPDTPQVF  255

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DN Y+KNLQ+GKGLF SDQ LFT   SR  VN FASN  AF++ F AAMTKLGR GV TG
Sbjct  256  DNTYYKNLQRGKGLFTSDQTLFTKRGSRRIVNIFASNRTAFERVFIAAMTKLGRFGVKTG  315

Query  53   NLGEIRRDCTRPN  15
            NLGEIR+DC   N
Sbjct  316  NLGEIRKDCAVVN  328



>ref|NP_195468.1| peroxidase 50 [Arabidopsis thaliana]
 sp|Q43731.1|PER50_ARATH RecName: Full=Peroxidase 50; Short=Atperox P50; AltName: Full=ATP9a; 
AltName: Full=PRXR2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA66958.1| peroxidase [Arabidopsis thaliana]
 emb|CAB38291.1| peroxidase, prxr2 [Arabidopsis thaliana]
 emb|CAB80417.1| peroxidase, prxr2 [Arabidopsis thaliana]
 gb|AAL32894.1| peroxidase, prxr2 [Arabidopsis thaliana]
 gb|AAM10139.1| peroxidase, prxr2 [Arabidopsis thaliana]
 gb|AEE86804.1| peroxidase 50 [Arabidopsis thaliana]
Length=329

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 232/301 (77%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR NFY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS N
Sbjct  25   AQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTN  84

Query  746  G-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
              KAEKDH +NLSLAGDGFDTVIKAK A+D+ P CRNKVSCADIL +ATRDVV+LAGG  
Sbjct  85   NNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPQ  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP     +++L S+F ++GL+  DMIALSGAHT+GF+HC
Sbjct  145  YDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGFAHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+KNL
Sbjct  205  TKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNIDPRVAINMDPTTPRQFDNVYYKNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF  +M KLGR+GV TG+ G IRRD
Sbjct  265  QQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|XP_009772707.1| PREDICTED: peroxidase 16-like [Nicotiana sylvestris]
Length=338

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 198/318 (62%), Positives = 240/318 (75%), Gaps = 1/318 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +LV ++L  S  +AQL+ +FY+N CPNVES+VRSAV+ KF+QT VTA ATLRLFFHDCF+
Sbjct  21   LLVSVILTSSCVNAQLQRDFYRNLCPNVESIVRSAVEDKFKQTIVTAAATLRLFFHDCFI  80

Query  785  RGCDASVLLASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            +GCDAS++L S  N  AEKDHPDNLSLAGDGFDTVIKAKAAVD+ P C+NKVSCADILA+
Sbjct  81   QGCDASIILRSAGNNTAEKDHPDNLSLAGDGFDTVIKAKAAVDNVPACKNKVSCADILAM  140

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            A RDV++LAGG  Y VELGRRDGR+S+  SVQ NLP +   L +L  MF   GL+   +I
Sbjct  141  AARDVIALAGGPHYAVELGRRDGRMSSQTSVQNNLPHSNSGLQKLLPMFASRGLSIRHLI  200

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC Q + R+Y F     +DPT+++ YA +L++MCP    P + I MDP 
Sbjct  201  ALSGAHTLGFSHCNQFSSRLYNFNSTHKVDPTIDVTYAKKLQEMCPQDALPGVVIPMDPD  260

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN Y+KNLQ+GKGLF SD  L T   SR  VN FASN  AF++ F AA+TKLGR 
Sbjct  261  TPQLFDNTYYKNLQRGKGLFTSDHTLVTKRGSRRIVNIFASNKTAFERVFIAAITKLGRF  320

Query  68   GVLTGNLGEIRRDCTRPN  15
            GV TGNLGEIR+DC   N
Sbjct  321  GVKTGNLGEIRKDCAVVN  338



>ref|XP_006282666.1| hypothetical protein CARUB_v10005222mg [Capsella rubella]
 gb|EOA15564.1| hypothetical protein CARUB_v10005222mg [Capsella rubella]
Length=330

 Score =   381 bits (979),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 232/301 (77%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQLR +FY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS  
Sbjct  26   AQLRRDFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTD  85

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDH +NLSLAGDGFDTVIKAK A+D+ P CRNKVSCADI+ +ATRDVV+LAGG  
Sbjct  86   NNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADIITMATRDVVNLAGGPK  145

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP     ++QL S+F ++GL+  DM+ALSGAHT+GF+HC
Sbjct  146  YDVELGRLDGLSSTAASVGGKLPHPTDDVNQLTSLFAKNGLSLNDMVALSGAHTLGFAHC  205

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+KNL
Sbjct  206  TKVFNRIYSFNKTTKVDPTVNKDYVTELKASCPQNIDPRVAINMDPTTPRQFDNVYYKNL  265

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVLFTD RS+ TV+ +ASN   F QAF  +M KLGR+GV TG+ G IRRD
Sbjct  266  QQGKGLFTSDQVLFTDRRSKPTVDLWASNAQLFNQAFVNSMIKLGRVGVKTGSNGNIRRD  325

Query  29   C  27
            C
Sbjct  326  C  326



>emb|CDX69313.1| BnaC01g01400D [Brassica napus]
Length=326

 Score =   380 bits (977),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 230/306 (75%), Gaps = 1/306 (0%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            V+   AQLR NFY  +CPNVE +VR AVQ+K +QTF T PATLRL+FHDCFV GCDASV+
Sbjct  17   VNLVSAQLRRNFYAGSCPNVEQIVRDAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVM  76

Query  761  LASP-NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +AS  N KAEKDHPDNLSLAGDGFDTV KAK A+D+   CRNKVSCADIL +ATRDVV+L
Sbjct  77   IASTGNNKAEKDHPDNLSLAGDGFDTVTKAKQALDAVANCRNKVSCADILTIATRDVVNL  136

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGR DG  ST  SV+  LP     +++L S+F ++GL   +MIALSGAHT+
Sbjct  137  AGGPRYEVELGRLDGLSSTAASVEGKLPQPTDDVNKLTSLFAKNGLNLNEMIALSGAHTL  196

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC +V  RIY F   + +DPT+N  Y  +LR  CP  +DPR+AINMDPTTP  FDN 
Sbjct  197  GFAHCTKVFNRIYTFNKTTQVDPTVNKGYVTELRASCPRNIDPRVAINMDPTTPRQFDNV  256

Query  224  YFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLG  45
            Y+KNLQQGKGLF SDQ LFTD RS+ TV+ +A+N   F QAF  +M KLGR+GV TG  G
Sbjct  257  YYKNLQQGKGLFTSDQDLFTDRRSKTTVDLWANNANLFNQAFVNSMIKLGRVGVKTGRNG  316

Query  44   EIRRDC  27
             IRRDC
Sbjct  317  NIRRDC  322



>gb|AAM63630.1| peroxidase, prxr2 [Arabidopsis thaliana]
Length=329

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/301 (64%), Positives = 231/301 (77%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR NFY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS N
Sbjct  25   AQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTN  84

Query  746  G-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
              KAEKDH +NLSLAGDGFDTVIK K A+D+ P CRNKVSCADIL +ATRDVV+LAGG  
Sbjct  85   NNKAEKDHEENLSLAGDGFDTVIKTKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPQ  144

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP     +++L S+F ++GL+  DMIALSGAHT+GF+HC
Sbjct  145  YDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGFAHC  204

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+KNL
Sbjct  205  TKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNIDPRVAINMDPTTPRQFDNVYYKNL  264

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF  +M KLGR+GV TG+ G IRRD
Sbjct  265  QQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRD  324

Query  29   C  27
            C
Sbjct  325  C  325



>ref|XP_010437219.1| PREDICTED: peroxidase 50 [Camelina sativa]
Length=329

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/303 (64%), Positives = 231/303 (76%), Gaps = 1/303 (0%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            A AQLR NFY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS
Sbjct  23   ASAQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIAS  82

Query  752  PNG-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
             N  KAEKDH +NLSLAGDGFDTVIKAK A+D+   CRNKVSCADIL +ATRDVV+LAGG
Sbjct  83   TNNNKAEKDHEENLSLAGDGFDTVIKAKEALDAVANCRNKVSCADILTMATRDVVNLAGG  142

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
              Y VELGR DG  ST  SV   LP     ++QL S+F ++GL+  DMIALSGAHT+GF+
Sbjct  143  PKYDVELGRLDGLSSTAASVGGKLPHPTDNVNQLTSLFAKNGLSLNDMIALSGAHTLGFA  202

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC +V  R+Y F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+K
Sbjct  203  HCTKVFNRLYSFNKTTKVDPTVNKAYVTELKASCPQNIDPRVAINMDPTTPRQFDNVYYK  262

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQGKGLF SDQ LFTD RS+ TV+ +ASN   F QAF  +M KLGR+GV TG+ G IR
Sbjct  263  NLQQGKGLFTSDQDLFTDRRSKPTVDLWASNAQLFNQAFVNSMIKLGRVGVKTGSNGNIR  322

Query  35   RDC  27
            RDC
Sbjct  323  RDC  325



>ref|XP_002868984.1| peroxidase ATP9a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45243.1| peroxidase ATP9a [Arabidopsis lyrata subsp. lyrata]
Length=327

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 230/301 (76%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQLR NFY   CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS  
Sbjct  23   AQLRRNFYAGICPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTD  82

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDH +NLSLAGDGFDTVIKAK A+D+ P CRNKVSCADIL +ATRDVV+LAGG  
Sbjct  83   NNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPK  142

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP     +++L S+F ++GL+  DMIALSG HT+GF+HC
Sbjct  143  YDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGTHTLGFAHC  202

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +V  RIY F   + +DPT+N  Y  +L+  CP  VDPR+AINMDPTTP  FDN Y+KNL
Sbjct  203  TKVFDRIYTFNKTTKVDPTVNKDYVTELKASCPQNVDPRVAINMDPTTPRQFDNVYYKNL  262

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVLFTD RS+ TV+ +ASN   F QAF  +M KLGR+GV TG+ G IRRD
Sbjct  263  QQGKGLFTSDQVLFTDRRSKPTVDLWASNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRD  322

Query  29   C  27
            C
Sbjct  323  C  323



>gb|KHG27040.1| Peroxidase 51 -like protein [Gossypium arboreum]
Length=324

 Score =   379 bits (973),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 199/323 (62%), Positives = 234/323 (72%), Gaps = 3/323 (1%)
 Frame = -2

Query  980  VVSAGILVCLVLLV-SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            V+  G+++ +V +V      QL  NFY+ TCPN+E +V+  V  KF QTFVT PATLRLF
Sbjct  3    VLKRGLVLLMVFMVFQRGEGQLFENFYRGTCPNLEMIVKQVVSIKFSQTFVTIPATLRLF  62

Query  803  FHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCA  624
            FHDCFV GCD SV++ASPNG AEKD  DNLSLAGDGFDTVIKAK AV+   QC   VSCA
Sbjct  63   FHDCFVEGCDTSVMIASPNGDAEKDAQDNLSLAGDGFDTVIKAKQAVEI--QCPGIVSCA  120

Query  623  DILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLT  444
            DILALA RDVV LAGG  + VELGRRDG +S  + V  NLP   F L QLN++F ++ LT
Sbjct  121  DILALAARDVVVLAGGPSWEVELGRRDGLVSQASKVAGNLPDPEFNLVQLNTIFAKNNLT  180

Query  443  QTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAI  264
            Q DMIALSGAHT+GFSHC + + R+Y F   S +DP+L+  YA QL Q CP  VDP IAI
Sbjct  181  QFDMIALSGAHTLGFSHCNRFSNRLYSFSSSSVVDPSLDPNYAQQLMQACPQNVDPSIAI  240

Query  263  NMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMT  84
            NMDP TP TFDN Y++NL  GKGLF SD+VLF+DP S+ TV  FASN   F  AF  AM 
Sbjct  241  NMDPETPRTFDNVYYQNLVSGKGLFTSDEVLFSDPASQPTVRDFASNPGNFNGAFITAMR  300

Query  83   KLGRIGVLTGNLGEIRRDCTRPN  15
            KLGR+GV +GN GEIR DCT+ N
Sbjct  301  KLGRVGVKSGNEGEIRTDCTKFN  323



>ref|XP_010249037.1| PREDICTED: peroxidase 55-like [Nelumbo nucifera]
Length=326

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 198/317 (62%), Positives = 229/317 (72%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +LV L+ L      QL  NFY  TCPNVE++VR  V  KF QTF T PATLRLFFHDCFV
Sbjct  11   LLVVLMGLAGRGEGQLAENFYAFTCPNVEAIVRQTVSTKFSQTFTTIPATLRLFFHDCFV  70

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDASVL+ASPNG AEKD  DNLSLAGDGFDTVIKAK AV++   C   VSCAD+LA+A
Sbjct  71   EGCDASVLIASPNGDAEKDAKDNLSLAGDGFDTVIKAKQAVEA--VCPGVVSCADVLAIA  128

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
             RDVV LAGG  + VELGRRDG IS  + V  NLP   F + QL S+F ++ L+  DMIA
Sbjct  129  ARDVVVLAGGPSFNVELGRRDGLISQASRVDGNLPQPEFNIGQLTSIFSKNNLSLIDMIA  188

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHC + AKR+Y F P S +DP+L+  YA QL   CP  VDP IA+NMDP T
Sbjct  189  LSGAHTVGFSHCNRFAKRLYSFSPSSPVDPSLDPNYATQLMAECPQNVDPTIAVNMDPVT  248

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            PN FDN Y++NL  GKGLF SD+VLFT+P S++TV  FASN   F  AFA AM  LGR+G
Sbjct  249  PNKFDNVYYQNLVAGKGLFTSDEVLFTNPASQSTVKDFASNPFNFNAAFATAMVNLGRVG  308

Query  65   VLTGNLGEIRRDCTRPN  15
            V TG  G+IRRDCT  N
Sbjct  309  VKTGAQGQIRRDCTAFN  325



>ref|XP_004166427.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
Length=331

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 225/306 (74%), Gaps = 2/306 (1%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            V    AQL  NFY + CPN+E +V  +VQ KF QTFVT PATLRLFFHDCFV GCDASVL
Sbjct  24   VKRGEAQLVENFYGSNCPNLEQIVTQSVQTKFAQTFVTIPATLRLFFHDCFVEGCDASVL  83

Query  761  LASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            +AS NG AEKD  DNLSLAGDGFDTV+KAK AV++   C   VSCADILALATRDVV+LA
Sbjct  84   IASLNGDAEKDAKDNLSLAGDGFDTVVKAKQAVEN--VCPGLVSCADILALATRDVVNLA  141

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  Y VELGRRDG IS  + V  NLP   F L+QL +MF  H LT  DMIALSGAHT G
Sbjct  142  GGPQYSVELGRRDGLISQASRVAGNLPEPFFDLNQLTNMFAAHNLTLIDMIALSGAHTQG  201

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + A R+Y F P S  DP+L+  YA QL   CP  VDP +AINMDP TP TFDN Y
Sbjct  202  FSHCDRFANRLYSFSPSSPTDPSLDPEYARQLMDACPQNVDPSVAINMDPITPQTFDNVY  261

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            ++NL  GKGLF SDQ+LFT+  S+ TV+ FA+N A F  AF  AMTKLGR+GV TGN GE
Sbjct  262  YQNLISGKGLFTSDQILFTESESQPTVSSFATNGAEFNAAFITAMTKLGRVGVKTGNAGE  321

Query  41   IRRDCT  24
            IRRDCT
Sbjct  322  IRRDCT  327



>ref|XP_002298633.2| hypothetical protein POPTR_0001s33680g [Populus trichocarpa]
 gb|EEE83438.2| hypothetical protein POPTR_0001s33680g [Populus trichocarpa]
Length=315

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 230/316 (73%), Gaps = 2/316 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            ++ L++ +     QL  +FY  TCPNVE+LV+ AV  KF QTF T PATLRLFFHDCFV 
Sbjct  1    MMVLIMDIDRGEGQLVEDFYSLTCPNVEALVKKAVSTKFNQTFTTIPATLRLFFHDCFVT  60

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDAS +++SPNG AEKD PDNLSLAGDGFDTV+KAK  V+    C   VSCADILA+A 
Sbjct  61   GCDASTMVSSPNGDAEKDAPDNLSLAGDGFDTVVKAKQKVEG--ACPGVVSCADILAIAA  118

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDVV LAGG  + VELGRRDG +S  + V+ NLP  GF L QLN+MF R+ L+Q DMIAL
Sbjct  119  RDVVVLAGGPSFNVELGRRDGLVSKASLVKGNLPEPGFNLSQLNAMFARNNLSQIDMIAL  178

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHT+GFSHC + A R+Y F   S +DP+LN  YA QL   CP  VDP IAINMDP TP
Sbjct  179  SGAHTLGFSHCSRFANRLYSFSSSSPVDPSLNQDYAKQLMDGCPRNVDPSIAINMDPVTP  238

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
             TFDN YF+NL  GKGLF SD+VLFTDP S+ TV  FA++++ F  AFA AM KLGR+ V
Sbjct  239  QTFDNVYFQNLVNGKGLFTSDEVLFTDPASQPTVKDFANSSSDFNGAFATAMRKLGRVRV  298

Query  62   LTGNLGEIRRDCTRPN  15
             TG+ G IR DCT  N
Sbjct  299  KTGSQGSIRTDCTVIN  314



>ref|XP_008441329.1| PREDICTED: peroxidase 51-like [Cucumis melo]
Length=331

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 226/309 (73%), Gaps = 2/309 (1%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            V    AQL  NFY + CPN+E +V  +VQ K  QTFVT PATLRLFFHDCFV GCDASVL
Sbjct  24   VKRGKAQLVENFYGSKCPNLEQIVTQSVQTKIAQTFVTIPATLRLFFHDCFVEGCDASVL  83

Query  761  LASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            +ASPNG AEKD  DNLSLAGDGFDTV+KAK AV++   C   VSCADILALATRDVV+LA
Sbjct  84   IASPNGDAEKDAKDNLSLAGDGFDTVVKAKQAVEN--VCPGIVSCADILALATRDVVNLA  141

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  Y VELGRRDG IS  + V  NLP   F L+QL +MF  H LT  DMIALSGAHT+G
Sbjct  142  GGPQYSVELGRRDGLISQASRVAGNLPEPSFNLNQLTNMFATHNLTLIDMIALSGAHTLG  201

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + A R+Y F P S  DP+L+  YA QL   CP  VDP +AINMDP TP TFDN Y
Sbjct  202  FSHCDRFANRLYSFSPLSPTDPSLDPGYARQLMDACPHNVDPSVAINMDPKTPQTFDNVY  261

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            ++NL  GKGLF SDQVLFT+  S+ TV+ FA++ A F   F  AMTKLGR+GV TG+ GE
Sbjct  262  YQNLISGKGLFTSDQVLFTESESQPTVSSFATSGAEFNATFIRAMTKLGRVGVKTGSDGE  321

Query  41   IRRDCTRPN  15
            IRRDCT  N
Sbjct  322  IRRDCTTFN  330



>ref|XP_007161721.1| hypothetical protein PHAVU_001G092900g [Phaseolus vulgaris]
 gb|ESW33715.1| hypothetical protein PHAVU_001G092900g [Phaseolus vulgaris]
Length=328

 Score =   378 bits (970),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 232/318 (73%), Gaps = 2/318 (1%)
 Frame = -2

Query  968  GILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCF  789
              L+   +L+S   AQL  NFY ++CPNVES+V  AV  KF QT  T  ATLRLFFHDCF
Sbjct  12   AFLLAFTMLISKGEAQLSQNFYSSSCPNVESIVSQAVTNKFTQTLTTGQATLRLFFHDCF  71

Query  788  VRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            V GCDASV+++SPNG AEKD+ +NLSL GDGFDTVIKAK AV+++  C   VSCADIL+L
Sbjct  72   VEGCDASVIISSPNGDAEKDYTENLSLPGDGFDTVIKAKQAVEAS--CPGVVSCADILSL  129

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV+SL GG  + VELGRRDG IS  + V+ NLP A F LDQL S+F +HGLTQTDMI
Sbjct  130  ATRDVISLLGGPSFKVELGRRDGLISKASRVEGNLPKANFNLDQLTSLFQKHGLTQTDMI  189

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC Q A R+Y F   + +DPTL+  YA  L   CP   DP +AI +DP 
Sbjct  190  ALSGAHTVGFSHCDQFANRLYSFSSSNPVDPTLDPTYAQTLMAGCPRNPDPTVAIELDPQ  249

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN Y++NL  GKGL  SDQVLF+D  S+ TV  FA+N A F +AF AA+ KLGR+
Sbjct  250  TPAAFDNIYYQNLVSGKGLLTSDQVLFSDAASQPTVVRFANNAADFNEAFVAAIRKLGRV  309

Query  68   GVLTGNLGEIRRDCTRPN  15
            G+ TGN GEIRRDCT  N
Sbjct  310  GIKTGNEGEIRRDCTAFN  327



>emb|CDX72634.1| BnaC07g46560D [Brassica napus]
Length=326

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 229/301 (76%), Gaps = 1/301 (0%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQL  NFY  +C NVE +VR+AVQQK +QTF T PATLRL+FHDCFV GCDASV++AS  
Sbjct  22   AQLSRNFYAGSCHNVEQIVRNAVQQKIQQTFTTIPATLRLYFHDCFVNGCDASVMIASTD  81

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N KAEKDHPDNLSLAGDGFDTVIKAK A+D+   CRNKVSCADIL +ATRDVV+LAGG  
Sbjct  82   NNKAEKDHPDNLSLAGDGFDTVIKAKQALDAVANCRNKVSCADILTIATRDVVNLAGGPR  141

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGRRDG  ST +SV+  LP     ++QL ++F ++GL++ DMIALSGAHT+GF+HC
Sbjct  142  YEVELGRRDGLSSTSDSVEGRLPHPTDDVNQLTTLFAKNGLSRNDMIALSGAHTLGFAHC  201

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
            K V  RIY F   + +DPT+N  Y   L+  CP  VDP +AINMDPTTP  FDN Y+KNL
Sbjct  202  KLVFNRIYNFNSTTQVDPTVNKDYVAALQGSCPRNVDPSVAINMDPTTPRQFDNVYYKNL  261

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQ LFTD RS+  VN +ASN   F QAF  +M KLGR+GV TG  G IRRD
Sbjct  262  QQGKGLFTSDQDLFTDGRSKPVVNLWASNPKLFNQAFVHSMIKLGRVGVRTGRNGNIRRD  321

Query  29   C  27
            C
Sbjct  322  C  322



>ref|XP_004138796.1| PREDICTED: peroxidase 51-like [Cucumis sativus]
 gb|KGN63165.1| hypothetical protein Csa_2G406630 [Cucumis sativus]
Length=331

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 226/309 (73%), Gaps = 2/309 (1%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            V    AQL  NFY + CPN+E +V  +VQ KF QTFVT PATLRLFFHDCFV GCDASVL
Sbjct  24   VKRGEAQLVENFYGSNCPNLEQIVTQSVQTKFAQTFVTIPATLRLFFHDCFVEGCDASVL  83

Query  761  LASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            +AS NG AEKD  DNLSLAGDGFDTV+KAK AV++   C   VSCADILALATRDVV+LA
Sbjct  84   IASLNGDAEKDAKDNLSLAGDGFDTVVKAKQAVEN--VCPGLVSCADILALATRDVVNLA  141

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  Y VELGRRDG IS  + V  NLP   F L+QL +MF  H LT  DMIALSGAHT G
Sbjct  142  GGPQYSVELGRRDGLISQASRVAGNLPEPFFDLNQLTNMFAAHNLTLIDMIALSGAHTQG  201

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + A R+Y F P S  DP+L+  YA QL   CP  VDP +AINMDP TP TFDN Y
Sbjct  202  FSHCDRFANRLYSFSPSSPTDPSLDPEYARQLMDACPQNVDPSVAINMDPITPQTFDNVY  261

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            ++NL  GKGLF SDQ+LFT+  S+ TV+ FA+N A F  AF  AMTKLGR+GV TGN GE
Sbjct  262  YQNLISGKGLFTSDQILFTESESQPTVSSFATNGAEFNAAFITAMTKLGRVGVKTGNDGE  321

Query  41   IRRDCTRPN  15
            IRRDCT  N
Sbjct  322  IRRDCTAFN  330



>ref|XP_010250695.1| PREDICTED: peroxidase 51 [Nelumbo nucifera]
Length=326

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/317 (62%), Positives = 234/317 (74%), Gaps = 2/317 (1%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +++ ++++++    QL  NFY +TCP VE +V   V+ K +QT VT PATLRLFFHDCFV
Sbjct  9    LILLVLMMMARGEGQLVENFYGSTCPKVEDIVSETVRTKIKQTNVTIPATLRLFFHDCFV  68

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDASVL+AS NG AEKD  DNLSLAGDGFDTV++AK A++   +C   VSCADILALA
Sbjct  69   EGCDASVLIASANGDAEKDAEDNLSLAGDGFDTVVRAKQALEK--ECPGVVSCADILALA  126

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
            TRDVV  AGG  Y VELGRRDG +S  + V  NLP A F LDQLNS+F  + L+Q DMIA
Sbjct  127  TRDVVFQAGGPRYQVELGRRDGLVSQKSRVAGNLPEAKFDLDQLNSIFSSNNLSQIDMIA  186

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHT+GFSHCKQ A R+Y F P S +DP+++  YA ++   CP  VDP +A+NMDP T
Sbjct  187  LSGAHTVGFSHCKQFANRLYSFTPSSPVDPSMDSNYASEIMLSCPQNVDPSVAVNMDPLT  246

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            P  FDN Y++NL  GKGLF SDQVLFTDP SR TVN FASN   F +AF  AMTKLGR+G
Sbjct  247  PVVFDNVYYQNLLAGKGLFTSDQVLFTDPASRPTVNDFASNPNNFNEAFKTAMTKLGRVG  306

Query  65   VLTGNLGEIRRDCTRPN  15
            V TG  GEIR+DCT  N
Sbjct  307  VKTGTEGEIRKDCTSFN  323



>gb|KFK30370.1| hypothetical protein AALP_AA7G252300 [Arabis alpina]
Length=328

 Score =   377 bits (968),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 192/303 (63%), Positives = 230/303 (76%), Gaps = 1/303 (0%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            + AQLR NFY  TCP+VE +VR+AVQ K +QTF T PATLRL+FHDCFV GCDASV++AS
Sbjct  22   SSAQLRRNFYAGTCPDVEKIVRNAVQLKIQQTFTTIPATLRLYFHDCFVNGCDASVMIAS  81

Query  752  PNG-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGG  576
             N  KAEKDH DNLSLAGDGFDTVIKAK A+D+   CRNKVSCADIL +ATRDVV+LAGG
Sbjct  82   TNSNKAEKDHSDNLSLAGDGFDTVIKAKEALDAVATCRNKVSCADILTIATRDVVNLAGG  141

Query  575  AFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFS  396
              Y VELGR DG  ST  SV+  LP     +++L S+F ++GL+  DM+ALSGAHT+GF+
Sbjct  142  PRYEVELGRLDGLSSTAASVEGKLPQPTDDVNKLTSLFAKNGLSLKDMVALSGAHTLGFA  201

Query  395  HCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFK  216
            HC +V  RIY F   S +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+K
Sbjct  202  HCTKVFNRIYTFNKTSKVDPTINKAYVAELQASCPRNIDPRVAINMDPTTPRQFDNVYYK  261

Query  215  NLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIR  36
            NLQQGKGLF SDQ LFTD RS+ TV+ +ASN   F +AF  +M +LGR+GV TG  G IR
Sbjct  262  NLQQGKGLFTSDQDLFTDSRSKPTVDLWASNGQLFNKAFGNSMIRLGRVGVKTGRNGNIR  321

Query  35   RDC  27
            RDC
Sbjct  322  RDC  324



>ref|XP_008790752.1| PREDICTED: peroxidase 55 [Phoenix dactylifera]
Length=323

 Score =   376 bits (966),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 233/319 (73%), Gaps = 4/319 (1%)
 Frame = -2

Query  965  ILVCLVLLVS--SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDC  792
            + V +V+L++  S  AQL   FY+ TCPNVES+VR AVQ+K  QTF T PATLRLFFHDC
Sbjct  7    LFVGMVMLMAAGSGEAQLSPTFYQWTCPNVESMVREAVQKKLSQTFATVPATLRLFFHDC  66

Query  791  FVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILA  612
            F+ GCDAS+++ASP   AEKD PDNLSLAGDGFDTVIKAK AV+   QC   VSCADILA
Sbjct  67   FIEGCDASIMIASPRHDAEKDAPDNLSLAGDGFDTVIKAKEAVEE--QCPGVVSCADILA  124

Query  611  LATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDM  432
            +A RDVV L+GG  + VELGRRDGRIS    V   LPG  F L+ L  +FG++ LT  DM
Sbjct  125  IAARDVVVLSGGPSFTVELGRRDGRISEAGRVSGKLPGPDFNLELLAWIFGKNNLTLFDM  184

Query  431  IALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDP  252
            IALSGAHT+GFSHC + AKR+Y F P S +DP+L+ +YA QL   CP  VDP IA+ MDP
Sbjct  185  IALSGAHTLGFSHCSRFAKRLYSFTPSSPVDPSLDPKYARQLMLACPENVDPNIAVGMDP  244

Query  251  TTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGR  72
             TPNTFDN YFKNL  G+GLF SD+VLFT   SR  V  FA N  +F  AFA+AM +LGR
Sbjct  245  FTPNTFDNIYFKNLVNGRGLFTSDEVLFTQLLSRPAVYNFAVNQESFFTAFASAMVRLGR  304

Query  71   IGVLTGNLGEIRRDCTRPN  15
            +GV  G+ GEIRRDCT  N
Sbjct  305  VGVKIGDEGEIRRDCTAFN  323



>ref|XP_009387950.1| PREDICTED: peroxidase 51-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=323

 Score =   375 bits (962),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 236/313 (75%), Gaps = 2/313 (1%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            LVL++ +  AQL  NFY+ +CP+VES+VR AV +K +QT VT PATLRLFFHDCFV GCD
Sbjct  13   LVLMLRTGEAQLNPNFYQVSCPSVESIVRQAVLKKLKQTIVTVPATLRLFFHDCFVEGCD  72

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            ASV++ASP G AEKD PDNLSLAGDGFDTVIKAK AV++  QC   VSCADILA+A RDV
Sbjct  73   ASVIIASPRGDAEKDAPDNLSLAGDGFDTVIKAKQAVEA--QCPGVVSCADILAIAARDV  130

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            V L+GG  + VELGRRDG  S  + V  NLPG  F +D L+SMF ++ L+  DMIALSGA
Sbjct  131  VVLSGGPTFAVELGRRDGVTSRADRVTGNLPGPEFSVDLLSSMFRKNNLSTRDMIALSGA  190

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HT+GFSHC + A R+Y F   S +DP++N  YA  L ++CP  VDP IAINMD  TP TF
Sbjct  191  HTVGFSHCSRFADRLYSFNSTSPVDPSMNPAYAKALMRVCPRNVDPTIAINMDLNTPITF  250

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DN Y+KNL  G+GLF SDQVLFTD RSR  V  FA++  +F +AFA++M +LGR+GV TG
Sbjct  251  DNVYYKNLLNGEGLFTSDQVLFTDQRSRPVVKEFAADQNSFFKAFASSMIRLGRLGVKTG  310

Query  53   NLGEIRRDCTRPN  15
            + GEIRRDCT  N
Sbjct  311  SQGEIRRDCTAFN  323



>ref|XP_002509503.1| Peroxidase 55 precursor, putative [Ricinus communis]
 gb|EEF50890.1| Peroxidase 55 precursor, putative [Ricinus communis]
Length=330

 Score =   374 bits (960),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 221/303 (73%), Gaps = 2/303 (1%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
               QL  NFY + CPNVE++V+  V  KFRQTF T PATLRLFFHDCFV GCDAS++++S
Sbjct  26   GEGQLTENFYSSNCPNVEAIVKQVVSTKFRQTFTTIPATLRLFFHDCFVTGCDASIMISS  85

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
            PNG AEKD  DNLSLAGDGFDTV KAK AV++  QC   VSCADI+A+A RDVV LAGG 
Sbjct  86   PNGGAEKDAEDNLSLAGDGFDTVTKAKQAVEA--QCPQVVSCADIIAIAARDVVVLAGGP  143

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
             + VELGRRD  +S  + V  NLP   F L QLN MFG++ L+Q DMIALSGAHT+GFSH
Sbjct  144  SFSVELGRRDSLVSQASLVVGNLPEPDFTLSQLNDMFGKNNLSQIDMIALSGAHTLGFSH  203

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C + A R+Y F P S +DPTL+  YA QL   CP  VDP IA++MDPTTP  FDN Y++N
Sbjct  204  CNRFANRLYSFSPASPVDPTLDPNYAKQLMDACPQNVDPVIAVDMDPTTPRIFDNVYYQN  263

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            L  GKGLF SDQVLFTDP S++T   FA++   F  AF  AM KLGR+G+ TGN G IR 
Sbjct  264  LVAGKGLFTSDQVLFTDPSSKSTAIDFANSEGEFNGAFVTAMRKLGRVGIKTGNQGRIRT  323

Query  32   DCT  24
            DCT
Sbjct  324  DCT  326



>ref|XP_010679610.1| PREDICTED: peroxidase 51-like [Beta vulgaris subsp. vulgaris]
Length=327

 Score =   374 bits (959),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 232/314 (74%), Gaps = 1/314 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +L+ + L+   A AQL+ NFY +TCPNVE +V+ AV++K  QTF+T PATLRLFFHDC +
Sbjct  10   VLIGIWLMRHLAAAQLQQNFYASTCPNVERIVKKAVKKKLSQTFITIPATLRLFFHDCMI  69

Query  785  RGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
             GCDASV++ S  N KAEKDH DNLSLAGDGFDTVIKAK AVD+ P C+NKVSCADILA+
Sbjct  70   NGCDASVMIQSTSNNKAEKDHSDNLSLAGDGFDTVIKAKEAVDAIPGCKNKVSCADILAI  129

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDVV +AGG FYP+ELGRRDG +ST  SV+  LP   F LDQL S F   GL+QT MI
Sbjct  130  ATRDVVRMAGGPFYPIELGRRDGLVSTAASVEGKLPHPNFNLDQLTSSFASRGLSQTHMI  189

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALS AHT+GFSHC + +KR+Y F  ++  D  L   YA QL+ MCP  VDP I +++DPT
Sbjct  190  ALSAAHTLGFSHCDKFSKRLYNFSAKNPTDTKLYPPYAAQLKAMCPQNVDPGIVVSIDPT  249

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN YF+NL + KG+F SDQ+L+ DPRS+ TV  +A N+  F +AF  AMT LGR+
Sbjct  250  TPMRFDNIYFRNLIKRKGIFTSDQILYEDPRSKPTVVDWAQNSTRFNEAFIQAMTALGRV  309

Query  68   GVLTGNLGEIRRDC  27
            GV T + G IR  C
Sbjct  310  GVKTASNGNIRIRC  323



>ref|XP_009402171.1| PREDICTED: peroxidase 51-like [Musa acuminata subsp. malaccensis]
Length=323

 Score =   373 bits (958),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 232/313 (74%), Gaps = 2/313 (1%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            L L++ +  AQL  NFY+ +CPNVES+VR AV +K  QT VT PATLRLFFHDCFV GCD
Sbjct  13   LALMLRTGEAQLNPNFYQVSCPNVESIVRRAVLKKLNQTIVTVPATLRLFFHDCFVEGCD  72

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            ASV++ASP G AEKD PDNLSLAGDGFDTVIKAK AV++  QC   VSCADILA+A RDV
Sbjct  73   ASVIIASPRGDAEKDAPDNLSLAGDGFDTVIKAKQAVEA--QCPGVVSCADILAIAARDV  130

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
            V L+GG  + VELGRRDG  S  + V  NLPG  F +D L+SMF ++ LT  DMIALSGA
Sbjct  131  VVLSGGPTFAVELGRRDGVTSRADRVTGNLPGPEFSVDLLSSMFRKNNLTTRDMIALSGA  190

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HT+GFSHC + A R+Y F   S +DP+LN  YA  L + CP  VDP IA+NMD  TP TF
Sbjct  191  HTVGFSHCNRFADRLYSFNSTSAVDPSLNPAYANALMRACPRNVDPTIAVNMDLNTPITF  250

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DN Y+KNL  G+GLF SDQVLFTD RSR  V  FA++  +F +AFA +M +LGR+GV TG
Sbjct  251  DNVYYKNLLNGEGLFTSDQVLFTDQRSRPVVKKFAADQNSFFKAFARSMIRLGRLGVKTG  310

Query  53   NLGEIRRDCTRPN  15
            + GEIRRDCT  N
Sbjct  311  SQGEIRRDCTAFN  323



>gb|AHL39115.1| class III peroxidase [Populus trichocarpa]
Length=325

 Score =   374 bits (959),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 224/306 (73%), Gaps = 2/306 (1%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            +     QL  +FY  TCPNVE+LV+ AV  KF QTF T PATLRLFFHDCFV GCDAS +
Sbjct  18   IDRGEGQLVEDFYSLTCPNVEALVKKAVSTKFNQTFTTIPATLRLFFHDCFVTGCDASTM  77

Query  761  LASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            ++SPNG AEKD PDNLSLAGDGFDTV+KAK  V+    C   VSCADILA+A RDVV LA
Sbjct  78   VSSPNGDAEKDAPDNLSLAGDGFDTVVKAKQKVEG--ACPGVVSCADILAIAARDVVVLA  135

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  + VELGRRDG +S  + V+ NLP  GF L QLN+MF R+ L+Q DMIALSGAHT+G
Sbjct  136  GGPSFNVELGRRDGLVSKASLVKGNLPEPGFNLSQLNAMFARNNLSQIDMIALSGAHTLG  195

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + A R+Y F   S +DP+LN  YA QL   CP  VDP IAINMDP TP TFDN Y
Sbjct  196  FSHCSRFANRLYSFSSSSPVDPSLNQDYAKQLMDGCPRNVDPSIAINMDPVTPQTFDNVY  255

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGE  42
            F+NL  GKGLF SD+VLFTDP S+ TV  FA++++ F  AFA AM KLGR+ V TG+ G 
Sbjct  256  FQNLVNGKGLFTSDEVLFTDPASQPTVKDFANSSSDFNGAFATAMRKLGRVRVKTGSQGS  315

Query  41   IRRDCT  24
            IR DCT
Sbjct  316  IRTDCT  321



>ref|NP_001190944.1| peroxidase 50 [Arabidopsis thaliana]
 gb|AEE86805.1| peroxidase 50 [Arabidopsis thaliana]
Length=326

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 229/301 (76%), Gaps = 4/301 (1%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASPN  747
            AQLR NFY  +CPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV++AS N
Sbjct  25   AQLRRNFYAGSCPNVEQIVRNAVQKKVQQTFTTIPATLRLYFHDCFVNGCDASVMIASTN  84

Query  746  G-KAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
              KAEKDH +NLSLAGDGFDTVIKAK A+D+ P CRNKVSCADIL +ATRDV   AGG  
Sbjct  85   NNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDV---AGGPQ  141

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST  SV   LP     +++L S+F ++GL+  DMIALSGAHT+GF+HC
Sbjct  142  YDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGFAHC  201

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             +V  RIY F   + +DPT+N  Y  +L+  CP  +DPR+AINMDPTTP  FDN Y+KNL
Sbjct  202  TKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNIDPRVAINMDPTTPRQFDNVYYKNL  261

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            QQGKGLF SDQVLFTD RS+ TV+ +A+N   F QAF  +M KLGR+GV TG+ G IRRD
Sbjct  262  QQGKGLFTSDQVLFTDRRSKPTVDLWANNGQLFNQAFINSMIKLGRVGVKTGSNGNIRRD  321

Query  29   C  27
            C
Sbjct  322  C  322



>ref|XP_010112376.1| Peroxidase 55 [Morus notabilis]
 gb|EXC33371.1| Peroxidase 55 [Morus notabilis]
Length=332

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 197/333 (59%), Positives = 238/333 (71%), Gaps = 4/333 (1%)
 Frame = -2

Query  1007  MEHQRKNSMVVSAGILVCLVLL--VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTF  834
             ME +R  S+++   +++ L ++       AQL  NFY  TCPNVE +V+ +V  KF QTF
Sbjct  1     MEVRRSRSLIMLTLVIMVLTVMGNFRGYDAQLTENFYAETCPNVEFIVKQSVSTKFIQTF  60

Query  833   VTAPATLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSN  654
              T P+TLRLFFHDCFV GCDASV++ASPNG AEKD  DNLSLAGDGFDTVIKAK A+++ 
Sbjct  61    TTIPSTLRLFFHDCFVEGCDASVMIASPNGDAEKDSDDNLSLAGDGFDTVIKAKQAIEA-  119

Query  653   PQCRNKVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQL  474
              QC   VSCADILALA RDVV LAGG  + VELGRRDG IS  + V   LP     LD+L
Sbjct  120   -QCPGVVSCADILALAARDVVVLAGGPDFKVELGRRDGLISKASRVTGKLPQPTAHLDEL  178

Query  473   NSMFGRHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMC  294
             NS+F ++ LTQ DMIALSGAHT+GFSHC + A RIY F   + IDP+L+  YA QL+  C
Sbjct  179   NSLFAKNNLTQLDMIALSGAHTLGFSHCSRFANRIYSFTQSNPIDPSLDSNYAEQLKASC  238

Query  293   PLRVDPRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaa  114
             P  VDP IAI+MDP TP  FDNAY++NL   KGLF SDQVLF+   S++TV  FA++  A
Sbjct  239   PQDVDPSIAIDMDPVTPRAFDNAYYQNLVNKKGLFTSDQVLFSISESQSTVQEFANSPDA  298

Query  113   fqqafaaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             F  AF  AM KLGR+GV TG+ GEIR+DCT  N
Sbjct  299   FNGAFITAMIKLGRVGVKTGSAGEIRKDCTAFN  331



>ref|XP_010927767.1| PREDICTED: peroxidase 55-like [Elaeis guineensis]
Length=325

 Score =   372 bits (954),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 193/315 (61%), Positives = 230/315 (73%), Gaps = 2/315 (1%)
 Frame = -2

Query  959  VCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRG  780
            + L++   S  AQL  NFY+++CPNVES+VR A+QQK  QT VT  ATLRLFFHDCF+ G
Sbjct  11   IVLLMATGSGEAQLSPNFYQSSCPNVESIVRQAIQQKLSQTSVTVAATLRLFFHDCFIEG  70

Query  779  CDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATR  600
            CDAS+++ASP    E+D PDNLSLAGDGFDT+ KAK AV++  QC   VSCADILA+A R
Sbjct  71   CDASIMVASPKHDTERDAPDNLSLAGDGFDTIEKAKEAVEA--QCPGVVSCADILAIAAR  128

Query  599  DVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALS  420
            DVV L+GG  + VELGRRDG IS    V   LPG  F L  L  +FG++ LT  DMIALS
Sbjct  129  DVVVLSGGPSFIVELGRRDGLISQAGRVPGKLPGPDFDLKLLAWIFGKNNLTLLDMIALS  188

Query  419  GAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPN  240
            GAHT+GFSHC + AKR+Y F P   +DP+LN RYA QL   CP  VDP I + MDP TPN
Sbjct  189  GAHTLGFSHCSRFAKRLYSFAPSLPVDPSLNPRYAQQLMHACPQNVDPNIVVGMDPFTPN  248

Query  239  TFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVL  60
            TFDN YFKNL  G+GLF SD+VLFT+P SR  V+ FA+N   F +AFA+AM +LGR+GV 
Sbjct  249  TFDNVYFKNLVNGRGLFTSDEVLFTNPLSRPVVSNFAANQGNFFKAFASAMVRLGRVGVK  308

Query  59   TGNLGEIRRDCTRPN  15
            TGN GEIRRDCT  N
Sbjct  309  TGNEGEIRRDCTAFN  323



>ref|XP_010679607.1| PREDICTED: peroxidase 50-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679608.1| PREDICTED: peroxidase 50-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010679609.1| PREDICTED: peroxidase 50-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=326

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 236/314 (75%), Gaps = 1/314 (0%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
            +L+   LL       L  N+Y  TCPNVE +VR AVQ+K +QTFVT P TLRLFFHDCFV
Sbjct  9    LLLVACLLYPFTATALSQNYYAKTCPNVEKIVRQAVQKKIQQTFVTIPGTLRLFFHDCFV  68

Query  785  RGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
             GCDASV++ S  N KAEKDHPDN+SLAGDGFDTVIKAKAAVD+   C N VSCADILAL
Sbjct  69   NGCDASVIIQSTSNNKAEKDHPDNISLAGDGFDTVIKAKAAVDAVAGCTNNVSCADILAL  128

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDVV+L+GG F+ VELGR DG +ST +SV   LP     L++LNS+F ++GLTQ +M+
Sbjct  129  ATRDVVNLSGGPFWEVELGRFDGLVSTASSVNGKLPQPTDDLNKLNSLFAKNGLTQAEMV  188

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC +  KRIY F P++ +DPTLN +YA QL++MCP  VDPRIA++MDP 
Sbjct  189  ALSGAHTVGFSHCDRFTKRIYGFTPKNPVDPTLNAQYATQLQKMCPTNVDPRIAVSMDPI  248

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            +P  FDN Y+KNL  GKGLF SDQVL+TDPR+R  V  +A ++  F++AFA +M KLGR+
Sbjct  249  SPRIFDNVYYKNLINGKGLFTSDQVLYTDPRTRGLVTNWAQSSFNFKKAFAQSMIKLGRV  308

Query  68   GVLTGNLGEIRRDC  27
            GV     G IR  C
Sbjct  309  GVKNAKNGNIRVQC  322



>ref|XP_008379105.1| PREDICTED: peroxidase 55-like [Malus domestica]
Length=326

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 231/321 (72%), Gaps = 5/321 (2%)
 Frame = -2

Query  968  GILVCLVLLVS---SAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFH  798
            G+L+ LV++ S    +  QL  NFY   CPNVES+V  AV +K  QT +T  ATLRLF H
Sbjct  7    GLLLVLVMMFSQGKESEGQLVENFYSAXCPNVESIVNQAVSRKRDQTIITLAATLRLFLH  66

Query  797  DCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADI  618
            DCFV GCDAS+++ASPNG AEK+  DNLSLAGDGFDTVIKAK AV++  QC   VSCADI
Sbjct  67   DCFVEGCDASIIIASPNGDAEKNFADNLSLAGDGFDTVIKAKQAVEA--QCPGVVSCADI  124

Query  617  LALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQT  438
            LA+A RD V LAGG  +PVELGRRDG IS  + V  NLP   F L+QL +MF +H L+ T
Sbjct  125  LAVAARDCVVLAGGPSFPVELGRRDGLISKASRVAGNLPEPTFNLNQLTTMFAKHNLSLT  184

Query  437  DMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINM  258
            D+IALSGAHT+GFSHC + + R+Y F P S +DP+LN  YA QL   CP+ VDP I + +
Sbjct  185  DVIALSGAHTLGFSHCNRFSDRLYNFSPSSTVDPSLNPDYAKQLMATCPIAVDPNIVMTL  244

Query  257  DPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKL  78
            DP TP TFDNAY++NL  GKGL  SDQVLF+D  SR+TV  FA+N   F  AF  AM KL
Sbjct  245  DPDTPFTFDNAYYRNLVAGKGLLSSDQVLFSDSASRSTVLNFANNADNFNGAFVTAMRKL  304

Query  77   GRIGVLTGNLGEIRRDCTRPN  15
            GR+GV TGN GEIRRDCT  N
Sbjct  305  GRVGVKTGNQGEIRRDCTTFN  325



>ref|XP_003553930.1| PREDICTED: peroxidase 55 [Glycine max]
Length=327

 Score =   369 bits (948),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 229/318 (72%), Gaps = 2/318 (1%)
 Frame = -2

Query  968  GILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCF  789
             +L+   +L+S    QL  NFY ++CPNVES+V+ AV  KF +T  T  ATLRLFFHDCF
Sbjct  11   ALLMAFTMLISKGEGQLVENFYSSSCPNVESMVKQAVTNKFTETITTGQATLRLFFHDCF  70

Query  788  VRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            V GCDASV+++SPNG  EKD  +N+SL GDGFDTVIKAK AV+++  C   VSCADILAL
Sbjct  71   VEGCDASVIISSPNGDTEKDAEENISLPGDGFDTVIKAKQAVEAS--CPGVVSCADILAL  128

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            ATRDV+ L GG  + VELGRRDG IS  +SV+ NLP A F LDQLN++F +HGLTQTD+I
Sbjct  129  ATRDVIGLLGGPSFNVELGRRDGLISKASSVEGNLPKANFNLDQLNALFAKHGLTQTDVI  188

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHT+GFSHC Q A R+Y F   + +DPTL+  YA  L   CP   DP + + +DP 
Sbjct  189  ALSGAHTVGFSHCDQFANRLYSFSSSNPVDPTLDPTYAQDLMAGCPRNPDPAVVLPLDPQ  248

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            +P  FDNAY++NL  GKGL  SDQVLF D  S+ TV  FA++ A F  AF AAM KLGR+
Sbjct  249  SPAAFDNAYYQNLLSGKGLLTSDQVLFEDATSQPTVVRFANSAADFNDAFVAAMRKLGRV  308

Query  68   GVLTGNLGEIRRDCTRPN  15
            GV TG  GEIRRDCT  N
Sbjct  309  GVKTGKDGEIRRDCTTFN  326



>ref|XP_003548517.2| PREDICTED: peroxidase 55-like [Glycine max]
Length=326

 Score =   369 bits (947),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 234/328 (71%), Gaps = 4/328 (1%)
 Frame = -2

Query  998  QRKNSMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPA  819
            ++   MV+ A  L+   +L+S    QL  NFY  +CPNVES+V+ AV  KF QT  T  A
Sbjct  2    EKSMRMVLMA--LLAFTMLLSKGEGQLVENFYSLSCPNVESIVKQAVTNKFTQTITTGQA  59

Query  818  TLRLFFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRN  639
            TLRLFFHDCFV GCDASV+++SPNG AEKD  +N+SL GDGFDTVIKAK AV+S+  C  
Sbjct  60   TLRLFFHDCFVEGCDASVIISSPNGDAEKDAEENISLPGDGFDTVIKAKQAVESS--CPG  117

Query  638  KVSCADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFG  459
             VSCADILALATRDV+ L GG  + VELGR+DG IS  +SV+ NLP A F LDQLN++F 
Sbjct  118  VVSCADILALATRDVIGLLGGPSFNVELGRKDGLISKASSVEGNLPKANFNLDQLNALFS  177

Query  458  RHGLTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVD  279
            +HGL+QTDMIALSGAHT+GFSHC Q A R+Y F   + +DPTL+  YA  L   CP   D
Sbjct  178  KHGLSQTDMIALSGAHTVGFSHCDQFANRLYSFSSSNTVDPTLDPSYAQDLMAGCPRNPD  237

Query  278  PRIAINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqaf  99
            P +A+ +DP +P  FDN Y++NL  GKGL  SDQVLF D  S+ TV  FA+N A F  AF
Sbjct  238  PTVAVALDPQSPAAFDNLYYQNLLSGKGLLTSDQVLFEDATSQPTVVRFANNVADFNDAF  297

Query  98   aaAMTKLGRIGVLTGNLGEIRRDCTRPN  15
             AA+ KL R+GV TGN GEIRRDCT  N
Sbjct  298  VAAIRKLARVGVKTGNDGEIRRDCTTFN  325



>ref|XP_004303962.1| PREDICTED: peroxidase 55-like [Fragaria vesca subsp. vesca]
Length=329

 Score =   369 bits (947),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 222/306 (73%), Gaps = 2/306 (1%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
            + AQL  NFY ++CPNVES+V+ AV  KF QTF T PATLRLFFHDCFV GCDASV++ S
Sbjct  25   SEAQLVENFYSSSCPNVESIVKQAVSTKFSQTFTTIPATLRLFFHDCFVEGCDASVMITS  84

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
            PNG AEKD  DNLSLAGDGFDTVIKAK AV++  QC   VSCADILALA RDVV L GG 
Sbjct  85   PNGDAEKDSSDNLSLAGDGFDTVIKAKQAVEA--QCPAVVSCADILALAARDVVVLGGGP  142

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
             + VELGRRDG +S  + V  NLP   F L QLN+MF +H LTQTD+IALSGAHT+GFSH
Sbjct  143  DFNVELGRRDGLVSKASRVAGNLPEPSFDLKQLNTMFSKHNLTQTDVIALSGAHTLGFSH  202

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C + A R+Y F   S +DP+L+  YA QL   CP  VDPRIAI+MDP      DN Y++N
Sbjct  203  CNRFADRLYSFSSSSAVDPSLDPDYAKQLMSACPKDVDPRIAIDMDPRNSTNVDNVYYQN  262

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            L  GKGLF SD+VLF+D  S++TV  FA++   F  AF  AM KLGR+ V TG+ GEIR 
Sbjct  263  LVAGKGLFTSDEVLFSDSASQSTVVDFANSPGEFSGAFITAMRKLGRVDVKTGSEGEIRT  322

Query  32   DCTRPN  15
            DCT  N
Sbjct  323  DCTAFN  328



>gb|KHN09929.1| Peroxidase 55 [Glycine soja]
Length=322

 Score =   368 bits (945),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 228/316 (72%), Gaps = 2/316 (1%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            L+   +L+S    QL  NFY  +CPNVES+V+ AV  KF QT  T  ATLRLFFHDCFV 
Sbjct  8    LLAFTMLLSKGEGQLVENFYSLSCPNVESIVKQAVTNKFTQTITTGQATLRLFFHDCFVE  67

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDASV+++SPNG AEKD  +N+SL GDGFDTVIKAK AV+S+  C   VSCADILALAT
Sbjct  68   GCDASVIISSPNGDAEKDAEENISLPGDGFDTVIKAKQAVESS--CPGVVSCADILALAT  125

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RDV+ L GG  + VELGR+DG IS  +SV+ NLP A F LDQLN++F +HGL+QTDMIAL
Sbjct  126  RDVIGLLGGPSFNVELGRKDGLISKASSVEGNLPKANFNLDQLNALFSKHGLSQTDMIAL  185

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHT+GFSHC Q A R+Y F   + +DPTL+  YA  L   CP   DP +A+ +DP +P
Sbjct  186  SGAHTVGFSHCDQFANRLYSFSSSNTVDPTLDPSYAQDLMAGCPRNPDPTVAVALDPQSP  245

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
              FDN Y++NL  GKGL  SDQVLF D  S+ TV  FA+N A F  AF AA+ KL R+GV
Sbjct  246  AAFDNLYYQNLLSGKGLLTSDQVLFEDATSQPTVVRFANNVADFNDAFVAAIRKLARVGV  305

Query  62   LTGNLGEIRRDCTRPN  15
             TGN GEIRRDCT  N
Sbjct  306  KTGNDGEIRRDCTTFN  321



>ref|NP_001078508.1| peroxidase 51 [Arabidopsis thaliana]
 gb|AEE86807.1| peroxidase 51 [Arabidopsis thaliana]
Length=282

 Score =   367 bits (941),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 206/263 (78%), Gaps = 1/263 (0%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            ++ + AQLR +FY  TCPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV+
Sbjct  20   INLSSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVM  79

Query  761  LASPN-GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +AS N  KAEKDH DNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADIL +ATRDVV+L
Sbjct  80   IASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNL  139

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGRRDG  S+ +SV   LP   F L+QLN++F  +GL+  DMIALSGAHT+
Sbjct  140  AGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTL  199

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC +V  R+Y F   + +DPT+N  Y  +L+  CP  +DPR+AINMDP TP  FDN 
Sbjct  200  GFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNV  259

Query  224  YFKNLQQGKGLFVSDQVLFTDPR  156
            Y+KNLQQGKGLF SDQVLFTD R
Sbjct  260  YYKNLQQGKGLFTSDQVLFTDTR  282



>gb|KFK28390.1| hypothetical protein AALP_AA8G508800 [Arabis alpina]
Length=327

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 237/321 (74%), Gaps = 3/321 (1%)
 Frame = -2

Query  986  SMVVSAGILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            S+V+   + + + +   +  AQLR +FYK++CPNVE +V   V+ K +QTFVT PATLRL
Sbjct  5    SLVIVVALCITISVFPDTTTAQLRNDFYKSSCPNVEQIVTKVVKDKVKQTFVTIPATLRL  64

Query  806  FFHDCFVRGCDASVLLAS-PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVS  630
            FFHDCFV GCDASVL+ S PN KAEKDHPDN+SLAGDGFD V+KAK A+ +   C +KVS
Sbjct  65   FFHDCFVNGCDASVLIQSTPNNKAEKDHPDNVSLAGDGFDVVVKAKKALVAK-GC-SKVS  122

Query  629  CADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHG  450
            CADIL LATRDVV  AGG  Y VELGR DG +ST  SV  NLPG    +++LN++F ++ 
Sbjct  123  CADILTLATRDVVVEAGGPKYTVELGRFDGLVSTAASVNGNLPGPNDNVNKLNALFAKNK  182

Query  449  LTQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRI  270
            LTQ DMIALS AHT+GF+HC +VA RI  F    ++DPTLN  YA QL+  CP  VDPRI
Sbjct  183  LTQEDMIALSAAHTVGFAHCSKVANRIRNFNSTHFVDPTLNKDYAKQLQAACPKNVDPRI  242

Query  269  AINMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaA  90
            AIN+DP TP  FDN YFKNLQQGKG F SDQVLFTD RSR TVN +A +NAAF  AF  A
Sbjct  243  AINIDPETPRKFDNIYFKNLQQGKGTFTSDQVLFTDGRSRPTVNAWAKDNAAFNTAFVKA  302

Query  89   MTKLGRIGVLTGNLGEIRRDC  27
            MTKLGR+GV T   G IRRDC
Sbjct  303  MTKLGRVGVKTSRNGNIRRDC  323



>ref|XP_008441330.1| PREDICTED: peroxidase 55-like [Cucumis melo]
Length=335

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/316 (59%), Positives = 230/316 (73%), Gaps = 5/316 (2%)
 Frame = -2

Query  962  LVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVR  783
            +V + + V     QL  NFYK+TCP +E +VR AV+ KF QT +T PATLRLFFHDCFV 
Sbjct  25   IVLMGIFVERGEGQLVENFYKSTCPKLEQIVRQAVRNKFSQTIITIPATLRLFFHDCFVE  84

Query  782  GCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALAT  603
            GCDASV+++SP+G AEKD  DNLSLAGDGFDTV+KAK AV++   C  +VSCADILALA 
Sbjct  85   GCDASVMISSPSGDAEKDAQDNLSLAGDGFDTVVKAKQAVEA--ACPGRVSCADILALAA  142

Query  602  RDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIAL  423
            RD V LAGG  + VELGRRDG IS  + V  NLP   F L+ L SMF +HGL+QTDMIAL
Sbjct  143  RDAVVLAGGPNFNVELGRRDGLISKASRVDGNLPSPNFDLNSLTSMFAKHGLSQTDMIAL  202

Query  422  SGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTP  243
            SGAHTIG SHC + + R++     S +DP+LN  YA +L+Q CP  VDP + + +DP+TP
Sbjct  203  SGAHTIGASHCNRFSDRLF---SASGVDPSLNPAYAEELKQACPRNVDPGVVVKLDPSTP  259

Query  242  NTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGV  63
            ++FDNAY++NL +GKGLF SD+VLFT+  S+ TV  FA+    F  AF  AM KLGR+GV
Sbjct  260  DSFDNAYYRNLVEGKGLFRSDEVLFTNSASKGTVVGFANKGGEFNAAFVGAMRKLGRVGV  319

Query  62   LTGNLGEIRRDCTRPN  15
             TG  GEIRRDCT  N
Sbjct  320  KTGKAGEIRRDCTAFN  335



>ref|XP_009387951.1| PREDICTED: peroxidase 51-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=320

 Score =   367 bits (941),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 234/313 (75%), Gaps = 5/313 (2%)
 Frame = -2

Query  953  LVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCD  774
            LVL++ +  AQL  NFY+ +CP+VES+VR AV +K +QT VT PATLRLFFHDCFV GCD
Sbjct  13   LVLMLRTGEAQLNPNFYQVSCPSVESIVRQAVLKKLKQTIVTVPATLRLFFHDCFVEGCD  72

Query  773  ASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDV  594
            ASV++ASP G AEKD PDNLSLAGDGFDTVIKAK AV++  QC   VSCADILA+A RDV
Sbjct  73   ASVIIASPRGDAEKDAPDNLSLAGDGFDTVIKAKQAVEA--QCPGVVSCADILAIAARDV  130

Query  593  VSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGA  414
               +GG  + VELGRRDG  S  + V  NLPG  F +D L+SMF ++ L+  DMIALSGA
Sbjct  131  ---SGGPTFAVELGRRDGVTSRADRVTGNLPGPEFSVDLLSSMFRKNNLSTRDMIALSGA  187

Query  413  HTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTF  234
            HT+GFSHC + A R+Y F   S +DP++N  YA  L ++CP  VDP IAINMD  TP TF
Sbjct  188  HTVGFSHCSRFADRLYSFNSTSPVDPSMNPAYAKALMRVCPRNVDPTIAINMDLNTPITF  247

Query  233  DNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTG  54
            DN Y+KNL  G+GLF SDQVLFTD RSR  V  FA++  +F +AFA++M +LGR+GV TG
Sbjct  248  DNVYYKNLLNGEGLFTSDQVLFTDQRSRPVVKEFAADQNSFFKAFASSMIRLGRLGVKTG  307

Query  53   NLGEIRRDCTRPN  15
            + GEIRRDCT  N
Sbjct  308  SQGEIRRDCTAFN  320



>dbj|BAH56994.1| AT4G37530 [Arabidopsis thaliana]
Length=281

 Score =   365 bits (936),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 172/261 (66%), Positives = 205/261 (79%), Gaps = 1/261 (0%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            ++ + AQLR +FY  TCPNVE +VR+AVQ+K +QTF T PATLRL+FHDCFV GCDASV+
Sbjct  20   INLSSAQLRGDFYAGTCPNVEQIVRNAVQKKIQQTFTTIPATLRLYFHDCFVNGCDASVM  79

Query  761  LASPN-GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSL  585
            +AS N  KAEKDH DNLSLAGDGFDTVIKAK AVD+ P CRNKVSCADIL +ATRDVV+L
Sbjct  80   IASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNL  139

Query  584  AGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTI  405
            AGG  Y VELGRRDG  S+ +SV   LP   F L+QLN++F  +GL+  DMIALSGAHT+
Sbjct  140  AGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTL  199

Query  404  GFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNA  225
            GF+HC +V  R+Y F   + +DPT+N  Y  +L+  CP  +DPR+AINMDP TP  FDN 
Sbjct  200  GFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNIDPRVAINMDPNTPRQFDNV  259

Query  224  YFKNLQQGKGLFVSDQVLFTD  162
            Y+KNLQQGKGLF SDQVLFTD
Sbjct  260  YYKNLQQGKGLFTSDQVLFTD  280



>gb|KEH39755.1| class III peroxidase [Medicago truncatula]
Length=311

 Score =   365 bits (937),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 233/314 (74%), Gaps = 18/314 (6%)
 Frame = -2

Query  953  LVLLVSSAHA-QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGC  777
            L+ L+++ HA +LR ++Y+NTCPNVES+V++AV+ K +QTFVTAPATLRLFFHDCFV+GC
Sbjct  15   LLQLITNCHATKLRVDYYRNTCPNVESIVKNAVEMKLQQTFVTAPATLRLFFHDCFVQGC  74

Query  776  DASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRD  597
            DASV+LA+ N  +EKD+P NLSLAGDGFDTVIKAKAAVD  P C+NK             
Sbjct  75   DASVMLATRNSTSEKDNPINLSLAGDGFDTVIKAKAAVDGVPGCQNKT------------  122

Query  596  VVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSG  417
                 GG  Y VELGR DGRIST  SV  +LP   FKL +L  MF  HGLT TD+IALSG
Sbjct  123  -----GGPSYAVELGRLDGRISTKASVTNHLPHPEFKLAKLTKMFASHGLTLTDLIALSG  177

Query  416  AHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNT  237
            AHTIGFSHC Q +KRIY F+    IDP+LN+ YA QL+ +CP  VDPR+AI+MDP TP T
Sbjct  178  AHTIGFSHCSQFSKRIYNFKSGKVIDPSLNIGYAKQLQNVCPKDVDPRLAIDMDPITPRT  237

Query  236  FDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLT  57
            FDN Y+KNLQQG GL  SDQ LFT   SRN VN FAS+N AF++AF  A+TKLGRIGV +
Sbjct  238  FDNQYYKNLQQGIGLLSSDQSLFTHKSSRNLVNLFASDNTAFERAFVIAITKLGRIGVKS  297

Query  56   GNLGEIRRDCTRPN  15
            G  GEIR DC+  N
Sbjct  298  GRQGEIRHDCSMIN  311



>ref|XP_007031901.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY02827.1| Peroxidase superfamily protein [Theobroma cacao]
Length=587

 Score =   374 bits (959),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/317 (61%), Positives = 228/317 (72%), Gaps = 3/317 (1%)
 Frame = -2

Query  983  MVVSAGILVCLVLLV-SSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRL  807
            M V  G+++ LV ++      QL   FY+ TCP +ES+VR  V QK  QTFVT PATLRL
Sbjct  1    MEVKTGLILFLVFMILQRGEGQLSETFYQTTCPKLESIVRKVVTQKINQTFVTVPATLRL  60

Query  806  FFHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSC  627
            FFHDCFV GCDAS+L+ASPNG AEKD PDNLSLAGDGFDTVIKAK AV+   +C   VSC
Sbjct  61   FFHDCFVEGCDASILIASPNGDAEKDAPDNLSLAGDGFDTVIKAKQAVEK--RCPGLVSC  118

Query  626  ADILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGL  447
            ADILA+ATRD++ LAGG  + VELGRRDG IS  + V  NLP   F L QL+++F ++ L
Sbjct  119  ADILAIATRDIIDLAGGPSFKVELGRRDGLISQASRVAGNLPEPNFNLTQLDTIFAKNSL  178

Query  446  TQTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIA  267
            TQ DMIALSG HT+GFSHC + A R+Y F P S +DP L+  YA +L+Q CP  VD RIA
Sbjct  179  TQIDMIALSGCHTVGFSHCNRFASRLYSFSPSSPVDPDLDPTYAQELKQACPQDVDARIA  238

Query  266  INMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAM  87
            INMDP TP TFDN YF+NL   KGLF SD+VLFT+P S+ TV  FA N   F  AF  AM
Sbjct  239  INMDPITPQTFDNMYFQNLVAKKGLFTSDEVLFTNPASQPTVIDFAKNPGDFNAAFITAM  298

Query  86   TKLGRIGVLTGNLGEIR  36
             KLGR+GV TG  G+IR
Sbjct  299  RKLGRVGVKTGQAGQIR  315


 Score =   347 bits (889),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/267 (62%), Positives = 199/267 (75%), Gaps = 2/267 (1%)
 Frame = -2

Query  941  VSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVL  762
            + S   +L  +FY  TCP +ES+VR  V++K  QTFVT PATLRLFFHDCFV GCDAS++
Sbjct  314  IRSGEGRLSQSFYNTTCPILESIVRKVVEEKVNQTFVTVPATLRLFFHDCFVEGCDASIM  373

Query  761  LASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLA  582
            +ASPNG AEKD PDNLSLAGDGFDTVIKAK AV++  +C   VSCADIL +A RDVV LA
Sbjct  374  IASPNGDAEKDAPDNLSLAGDGFDTVIKAKQAVEA--KCPGVVSCADILVIAARDVVRLA  431

Query  581  GGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIG  402
            GG  + ++LGRRDG +S  + V  NLP   F L QLN++F ++ LTQTDMIALSGAHT+G
Sbjct  432  GGPSFKIQLGRRDGLVSQASRVAGNLPEPNFDLTQLNTLFAKNNLTQTDMIALSGAHTLG  491

Query  401  FSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAY  222
            FSHC + A R+Y F P S +DP L+  Y  QL++ CP  VDPRIAI+MDP TP  FDN Y
Sbjct  492  FSHCSRFANRLYSFSPSSPVDPDLDPTYVQQLKEDCPQDVDPRIAIDMDPVTPQIFDNMY  551

Query  221  FKNLQQGKGLFVSDQVLFTDPRSRNTV  141
            FKNL   KGLF SD VLFT+P S+ TV
Sbjct  552  FKNLIAKKGLFTSDDVLFTNPASKPTV  578



>gb|KGN63166.1| hypothetical protein Csa_2G406640 [Cucumis sativus]
Length=330

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 229/317 (72%), Gaps = 5/317 (2%)
 Frame = -2

Query  965  ILVCLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFV  786
             ++ + + V     QL  NFYK+TCPNVE +V  AV+ KF QT +T  ATLRLFFHDCFV
Sbjct  19   FIILMGIFVEIGEGQLVKNFYKSTCPNVEQIVTQAVRNKFSQTIITISATLRLFFHDCFV  78

Query  785  RGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALA  606
             GCDASV++ASP G AEKD  DNLSLAGDGFDTV+KAK AV++   C  +VSCADILALA
Sbjct  79   EGCDASVMIASPTGDAEKDAQDNLSLAGDGFDTVVKAKQAVEA--ACPGRVSCADILALA  136

Query  605  TRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIA  426
             RDVV LAGG  + VELGRRDG IS  + V  NLP   F L+ L SMF +HGL+QTDMIA
Sbjct  137  ARDVVVLAGGPNFNVELGRRDGLISKASRVDGNLPSPNFDLNSLTSMFAKHGLSQTDMIA  196

Query  425  LSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTT  246
            LSGAHTIG SHC + + R++     S +DP+LN  YA +L+Q CP  VDP + + +DPTT
Sbjct  197  LSGAHTIGASHCNRFSDRLFS---DSGVDPSLNPGYAEELKQACPRNVDPGVVVKLDPTT  253

Query  245  PNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIG  66
            P++FDNAY++NL +GKGLF SD+VLFT+  S+  V  FA+N   F  AF  AM KLGR+G
Sbjct  254  PDSFDNAYYRNLVEGKGLFRSDEVLFTNSASKGRVVGFANNKGKFNGAFVKAMRKLGRVG  313

Query  65   VLTGNLGEIRRDCTRPN  15
            V TG  GEIRRDCT  N
Sbjct  314  VKTGKAGEIRRDCTAFN  330



>ref|XP_009408351.1| PREDICTED: peroxidase 55-like [Musa acuminata subsp. malaccensis]
Length=325

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 192/305 (63%), Positives = 230/305 (75%), Gaps = 2/305 (1%)
 Frame = -2

Query  929  HAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP  750
             AQLR NFY+ TCP VES+VR AV +K RQTFVT PATLRLFFHDCFV GCDASVL+ASP
Sbjct  23   EAQLRPNFYQFTCPKVESIVRQAVLKKVRQTFVTVPATLRLFFHDCFVEGCDASVLIASP  82

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
             G AEKD PDNLSLAGDGFDTVIKAK AV++  +C   VSCAD+LA+A RDVV L+GG  
Sbjct  83   RGDAEKDAPDNLSLAGDGFDTVIKAKQAVEA--RCPGVVSCADVLAIAARDVVVLSGGPS  140

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            + VELGRRDG IS    V  +LPG  F L+ L ++F  + LT  DMIALSGAHT+GFSHC
Sbjct  141  FTVELGRRDGLISQARRVAGHLPGPDFNLNILANLFRMNNLTTHDMIALSGAHTVGFSHC  200

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
             + AKR+Y F P S +DP+ NL YA  L + CP  V P IA+NMDP TP  FDN Y++NL
Sbjct  201  SRFAKRLYAFGPSSPVDPSFNLPYAQLLMRACPRDVGPTIAVNMDPFTPTVFDNVYYRNL  260

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
             +G+GLF SDQVLF++  SR  V  FA++ ++F +AFAA+M KLGR+GV TG+ GEIR+D
Sbjct  261  LKGEGLFTSDQVLFSNLLSRPVVKKFAADQSSFFRAFAASMVKLGRVGVKTGHQGEIRKD  320

Query  29   CTRPN  15
            CT  N
Sbjct  321  CTAFN  325



>emb|CDP16702.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 229/318 (72%), Gaps = 5/318 (2%)
 Frame = -2

Query  959  VCLVLLVSS-AHAQLRTNFYKNTCPNVESLVRSAVQQKF--RQTFVTAPATLRLFFHDCF  789
            V LVL+V S   A+L+ NFY ++CPNVES+V  AV  K    QTF   PATLRLFFHDCF
Sbjct  7    VLLVLMVMSIGEAELKENFYSSSCPNVESIVLQAVNAKLAETQTFTPIPATLRLFFHDCF  66

Query  788  VRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILAL  609
            V GCDASVL+ASPNG AEKD PDNLSLAGDGFDTV KAK AV++  QC   VSCADILA+
Sbjct  67   VEGCDASVLIASPNGDAEKDAPDNLSLAGDGFDTVFKAKQAVEA--QCPGIVSCADILAI  124

Query  608  ATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMI  429
            A RDVV LAG   + VELGRRDG IS  + V  NLP     +DQL + F    L+Q+DMI
Sbjct  125  AARDVVVLAGCPSFSVELGRRDGLISAASRVAGNLPEPTDDVDQLTAHFAAKNLSQSDMI  184

Query  428  ALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPT  249
            ALSGAHTIGFSHC + A R+Y F P + IDP+L+  YA QL Q CP  VDP IA+N+DPT
Sbjct  185  ALSGAHTIGFSHCTRFANRLYSFTPSNPIDPSLDPNYAQQLIQECPQNVDPLIAVNLDPT  244

Query  248  TPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRI  69
            TP  FDN Y++NL  GKG+F SDQVLFT P ++  V  FA++ + F  AFAAAM  LGR+
Sbjct  245  TPTIFDNVYYQNLVGGKGMFTSDQVLFTHPSTKPAVTNFANSPSRFNAAFAAAMRNLGRV  304

Query  68   GVLTGNLGEIRRDCTRPN  15
            GV TG  GEIRRDCT  N
Sbjct  305  GVKTGRQGEIRRDCTTFN  322



>ref|XP_006658226.1| PREDICTED: peroxidase 51-like [Oryza brachyantha]
Length=324

 Score =   364 bits (935),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 226/300 (75%), Gaps = 5/300 (2%)
 Frame = -2

Query  923  QLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS-PN  747
            QLR N+Y   CPNVES+VR AV +KF+QTFVT  AT+RLFFHDCFV GCDASV++AS  N
Sbjct  25   QLRRNYYAGVCPNVESVVRDAVSKKFQQTFVTVGATVRLFFHDCFVGGCDASVVVASTAN  84

Query  746  GKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAFY  567
              AEKDHP+NLSLAGDGFDTVI+AKAAVD+ P CR++VSCADILA+ATRD ++LAGG  Y
Sbjct  85   NTAEKDHPNNLSLAGDGFDTVIRAKAAVDAVPGCRDRVSCADILAMATRDAIALAGGPSY  144

Query  566  PVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHCK  387
             VELGR DG  ST +SV   LP   F LDQL ++F  +GL+Q DMIALS  HT+GF+HC 
Sbjct  145  AVELGRLDGLSSTASSVNGRLPPPSFNLDQLTALFAANGLSQADMIALSAGHTVGFAHCN  204

Query  386  QVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNLQ  207
              + RI        +DPT++ RYA QL++ CP  VDPRIA+ MDP TP  FDN YFKNLQ
Sbjct  205  TFSGRIRGPS----MDPTMSPRYAAQLQKSCPPNVDPRIAVAMDPVTPRAFDNQYFKNLQ  260

Query  206  QGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRDC  27
             G GL  SDQVL++DPRSR  V+ +A ++ AF QAF  AMTKLGR+GV TG  G IRR+C
Sbjct  261  NGMGLLGSDQVLYSDPRSRPIVDSWAQSSVAFNQAFVTAMTKLGRVGVKTGPQGNIRRNC  320



>ref|NP_001058755.1| Os07g0115300 [Oryza sativa Japonica Group]
 dbj|BAC16194.1| putative peroxidase [Oryza sativa Japonica Group]
 tpe|CAH69340.1| TPA: class III peroxidase 98 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF20669.1| Os07g0115300 [Oryza sativa Japonica Group]
 dbj|BAG87974.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81418.1| hypothetical protein OsI_24670 [Oryza sativa Indica Group]
Length=330

 Score =   364 bits (934),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 190/301 (63%), Positives = 227/301 (75%), Gaps = 5/301 (2%)
 Frame = -2

Query  926  AQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLASP-  750
            AQLR N+Y   CPNVES+VR AV +K ++TF T  AT+RLFFHDCFV GCDASV++AS  
Sbjct  30   AQLRRNYYAGVCPNVESIVRGAVARKVQETFATVGATVRLFFHDCFVDGCDASVVVASAG  89

Query  749  NGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGAF  570
            N  AEKDHP+NLSLAGDGFDTVIKAKAAVD+ P CR++VSCADILA+ATRD ++LAGG  
Sbjct  90   NNTAEKDHPNNLSLAGDGFDTVIKAKAAVDAVPGCRDRVSCADILAMATRDAIALAGGPS  149

Query  569  YPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSHC  390
            Y VELGR DG  ST +SV   LP   F LDQL ++F  +GL+Q DMIALS  HT+GF+HC
Sbjct  150  YAVELGRLDGLRSTASSVNGRLPPPTFNLDQLTALFAANGLSQADMIALSAGHTVGFAHC  209

Query  389  KQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKNL  210
                 RI      S +DPT++ RYA QL++ CP  VDPRIA+ MDP TP  FDN YFKNL
Sbjct  210  NTFLGRIR----GSSVDPTMSPRYAAQLQRSCPPNVDPRIAVTMDPVTPRAFDNQYFKNL  265

Query  209  QQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRRD  30
            Q G GL  SDQVL++DPRSR  V+ +A ++AAF QAF  AMTKLGR+GV TG+ G IRR+
Sbjct  266  QNGMGLLGSDQVLYSDPRSRPIVDSWAQSSAAFNQAFVTAMTKLGRVGVKTGSQGNIRRN  325

Query  29   C  27
            C
Sbjct  326  C  326



>ref|XP_004138795.1| PREDICTED: peroxidase 55-like [Cucumis sativus]
 ref|XP_004166426.1| PREDICTED: peroxidase 55-like [Cucumis sativus]
Length=304

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 224/306 (73%), Gaps = 5/306 (2%)
 Frame = -2

Query  932  AHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLFFHDCFVRGCDASVLLAS  753
               QL  NFYK+TCPNVE +V  AV+ KF QT +T  ATLRLFFHDCFV GCDASV++AS
Sbjct  4    GEGQLVKNFYKSTCPNVEQIVTQAVRNKFSQTIITISATLRLFFHDCFVEGCDASVMIAS  63

Query  752  PNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCADILALATRDVVSLAGGA  573
            P G AEKD  DNLSLAGDGFDTV+KAK AV++   C  +VSCADILALA RDVV LAGG 
Sbjct  64   PTGDAEKDAQDNLSLAGDGFDTVVKAKQAVEA--ACPGRVSCADILALAARDVVVLAGGP  121

Query  572  FYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLTQTDMIALSGAHTIGFSH  393
             + VELGRRDG IS  + V  NLP   F L+ L SMF +HGL+QTDMIALSGAHTIG SH
Sbjct  122  NFNVELGRRDGLISKASRVDGNLPSPNFDLNSLTSMFAKHGLSQTDMIALSGAHTIGASH  181

Query  392  CKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAINMDPTTPNTFDNAYFKN  213
            C + + R++     S +DP+LN  YA +L+Q CP  VDP + + +DPTTP++FDNAY++N
Sbjct  182  CNRFSDRLFS---DSGVDPSLNPGYAEELKQACPRNVDPGVVVKLDPTTPDSFDNAYYRN  238

Query  212  LQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMTKLGRIGVLTGNLGEIRR  33
            L +GKGLF SD+VLFT+  S+  V  FA+N   F  AF  AM KLGR+GV TG  GEIRR
Sbjct  239  LVEGKGLFRSDEVLFTNSASKGRVVGFANNKGKFNGAFVKAMRKLGRVGVKTGKAGEIRR  298

Query  32   DCTRPN  15
            DCT  N
Sbjct  299  DCTAFN  304



>ref|XP_006848256.1| hypothetical protein AMTR_s00013p00052590 [Amborella trichopoda]
 gb|ERN09837.1| hypothetical protein AMTR_s00013p00052590 [Amborella trichopoda]
Length=324

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 191/320 (60%), Positives = 230/320 (72%), Gaps = 3/320 (1%)
 Frame = -2

Query  980  VVSAGILV-CLVLLVSSAHAQLRTNFYKNTCPNVESLVRSAVQQKFRQTFVTAPATLRLF  804
            V  AG+ +  LV++  ++ AQL  NFY   C  +E+ VR  V  K  QTFVT P+TLRLF
Sbjct  3    VWRAGVFLGILVIVFVASDAQLVENFYGLRCQTLEATVRQVVIMKLNQTFVTVPSTLRLF  62

Query  803  FHDCFVRGCDASVLLASPNGKAEKDHPDNLSLAGDGFDTVIKAKAAVDSNPQCRNKVSCA  624
            FHDCFV GCDASV+++SPN  AEKD  DNLSLAGDGFDT++KAKAAV++   C N VSCA
Sbjct  63   FHDCFVTGCDASVMISSPNRDAEKDASDNLSLAGDGFDTIVKAKAAVEA--LCPNVVSCA  120

Query  623  DILALATRDVVSLAGGAFYPVELGRRDGRISTLNSVQRNLPGAGFKLDQLNSMFGRHGLT  444
            DI+A+A RDVV LAGG  + VELGRRD   S  + V  NLP   F ++QLN++F ++GL 
Sbjct  121  DIMAIAARDVVVLAGGPMFNVELGRRDNLQSKASLVAGNLPDPTFDVNQLNAIFQKNGLN  180

Query  443  QTDMIALSGAHTIGFSHCKQVAKRIYRFQPRSWIDPTLNLRYAFQLRQMCPLRVDPRIAI  264
            QTDMIALSGAHT+GFSHC + A RIY F   S +DPTLN  Y  QL Q CP  VDP IAI
Sbjct  181  QTDMIALSGAHTVGFSHCSRFANRIYNFSSTSRVDPTLNPTYVQQLMQSCPQNVDPTIAI  240

Query  263  NMDPTTPNTFDNAYFKNLQQGKGLFVSDQVLFTDPRSRNTVnffasnnaafqqafaaAMT  84
            NMDP TP  FDN Y++NL  GKGLF SD+VLFTD R+   V  FA+N   F  AFAAAM 
Sbjct  241  NMDPITPRIFDNVYYQNLINGKGLFTSDEVLFTDARTSGVVRDFAANPLDFSSAFAAAMI  300

Query  83   KLGRIGVLTGNLGEIRRDCT  24
            KLGR+GV TG+ G++R+DCT
Sbjct  301  KLGRVGVKTGSQGQVRKDCT  320



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2363439201630