BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78714_g1_i1 len=776 path=[1:0-775]

Length=776
                                                                      Score     E

ref|XP_009769213.1|  PREDICTED: pathogenesis-related protein 1C         207   3e-63   
emb|CAA31010.1|  PR1c preprotein                                        207   3e-63   Nicotiana tabacum [American tobacco]
emb|CAA29023.1|  PR-1c protein                                          205   2e-62   Nicotiana tabacum [American tobacco]
ref|XP_004955414.1|  PREDICTED: pathogenesis-related protein 1-like     203   8e-62   
emb|CAA30017.1|  unnamed protein product                                202   3e-61   Nicotiana tabacum [American tobacco]
gb|ADN43432.1|  pathogenesis-related protein 1                          201   4e-61   
gb|ADN43433.1|  pathogenesis-related protein 1                          201   5e-61   
dbj|BAA14220.1|  PR1a protein precursor                                 201   7e-61   Nicotiana tabacum [American tobacco]
gb|ADN43435.1|  pathogenesis-related protein 1                          201   7e-61   
gb|ADN43437.1|  pathogenesis-related protein 1                          201   8e-61   
ref|XP_009610821.1|  PREDICTED: pathogenesis-related protein 1B         201   9e-61   
emb|CAA31008.1|  PR1a preprotein                                        201   9e-61   Nicotiana tabacum [American tobacco]
sp|P08299.1|PR1A_TOBAC  RecName: Full=Pathogenesis-related protei...    201   1e-60   Nicotiana tabacum [American tobacco]
gb|AAB05225.1|  pathogenesis-related protein-1                          201   1e-60   Nicotiana glutinosa
gb|ADN43436.1|  pathogenesis-related protein 1                          200   1e-60   
gb|AEL99925.1|  pathogenesis-related protein 1                          200   1e-60   
emb|CDP12737.1|  unnamed protein product                                200   1e-60   
emb|CAA29022.1|  PR-1b protein                                          200   2e-60   Nicotiana tabacum [American tobacco]
gb|ADN43434.1|  pathogenesis-related protein 1                          199   4e-60   
ref|XP_009605825.1|  PREDICTED: pathogenesis-related protein 1B-like    199   5e-60   
ref|XP_009803803.1|  PREDICTED: pathogenesis-related protein 1C-like    199   6e-60   
ref|XP_009798466.1|  PREDICTED: pathogenesis-related protein 1A         198   8e-60   
gb|EEC81457.1|  hypothetical protein OsI_24759                          197   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_011002601.1|  PREDICTED: pathogenesis-related protein 1-like     197   2e-59   
ref|XP_002274371.1|  PREDICTED: basic form of pathogenesis-relate...    197   2e-59   Vitis vinifera
gb|KDP37606.1|  hypothetical protein JCGZ_06949                         197   3e-59   
emb|CDO97325.1|  unnamed protein product                                196   3e-59   
emb|CAA36790.1|  unnamed protein product                                197   5e-59   Nicotiana tabacum [American tobacco]
gb|EAZ02649.1|  hypothetical protein OsI_24760                          196   5e-59   Oryza sativa Indica Group [Indian rice]
gb|ADN43415.1|  pathogenesis-related protein 1                          196   6e-59   
ref|XP_008798890.1|  PREDICTED: pathogenesis-related protein PR-1...    196   7e-59   
gb|ADN43439.1|  pathogenesis-related protein 1                          195   9e-59   
emb|CAA31009.1|  PR1b preprotein                                        195   1e-58   Nicotiana tabacum [American tobacco]
ref|NP_001058815.1|  Os07g0129200                                       195   1e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AAG44566.1|AF251277_1  acidic PR-1 type pathogenesis-related p...    195   1e-58   Oryza sativa Japonica Group [Japonica rice]
gb|EMT11012.1|  Pathogenesis-related protein PRMS                       195   2e-58   
sp|Q41359.1|PR1_SAMNI  RecName: Full=Pathogenesis-related protein...    195   2e-58   Sambucus nigra
ref|NP_001058816.1|  Os07g0129300                                       194   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002522071.1|  STS14 protein precursor, putative                  194   3e-58   Ricinus communis
gb|ADN43419.1|  pathogenesis-related protein 1                          194   3e-58   
ref|XP_006486822.1|  PREDICTED: pathogenesis-related protein 1-like     194   4e-58   
gb|ADN43416.1|  pathogenesis-related protein 1                          194   4e-58   
gb|ADN43438.1|  pathogenesis-related protein 1                          193   5e-58   
ref|XP_002273788.2|  PREDICTED: pathogenesis-related protein 1          194   6e-58   Vitis vinifera
gb|ADN43417.1|  pathogenesis-related protein 1                          193   8e-58   
gb|ADN43428.1|  pathogenesis-related protein 1                          192   1e-57   
ref|XP_002273416.1|  PREDICTED: basic form of pathogenesis-relate...    192   1e-57   Vitis vinifera
gb|ADN43431.1|  pathogenesis-related protein 1                          192   2e-57   
gb|AEH25622.1|  pathogenesis-related protein 1-7                        192   2e-57   
gb|ABK94784.1|  unknown                                                 192   2e-57   Populus trichocarpa [western balsam poplar]
gb|ADN43418.1|  pathogenesis-related protein 1                          192   2e-57   
ref|XP_010943450.1|  PREDICTED: pathogenesis-related protein PR-1...    192   2e-57   
ref|XP_006379156.1|  pathogenesis-related family protein                192   2e-57   
ref|XP_007148303.1|  hypothetical protein PHAVU_006G197100g             191   5e-57   
ref|XP_002459696.1|  hypothetical protein SORBIDRAFT_02g008970          191   6e-57   Sorghum bicolor [broomcorn]
ref|XP_010691525.1|  PREDICTED: pathogenesis-related protein 1A-like    191   6e-57   
gb|KDP37611.1|  hypothetical protein JCGZ_06954                         191   7e-57   
ref|XP_010691524.1|  PREDICTED: pathogenesis-related protein PR-1...    191   8e-57   
dbj|BAF95881.1|  putative pathogenesis-related protein 1                190   8e-57   Vitis hybrid cultivar
gb|AGK89727.1|  pathogenesis-related 1 protein                          190   1e-56   
gb|AAZ94265.1|  pathogenesis-related 1a                                 190   1e-56   Triticum monococcum [einkorn wheat]
gb|ADN43427.1|  pathogenesis-related protein 1                          189   2e-56   
gb|ADN43429.1|  pathogenesis-related protein 1                          189   2e-56   
gb|KDP37603.1|  hypothetical protein JCGZ_06946                         189   2e-56   
ref|XP_006486820.1|  PREDICTED: pathogenesis-related protein 1-like     189   3e-56   
ref|XP_002274275.1|  PREDICTED: basic form of pathogenesis-relate...    189   3e-56   Vitis vinifera
ref|XP_007041421.1|  CAP (Cysteine-rich secretory proteins, Antig...    189   3e-56   
gb|AHA56682.1|  pathogenesis related protein                            189   4e-56   
gb|AEH25624.1|  pathogenesis-related protein 1-9                        189   4e-56   
ref|XP_006422714.1|  hypothetical protein CICLE_v10029431mg             189   4e-56   
ref|XP_011092473.1|  PREDICTED: pathogenesis-related leaf protein...    188   4e-56   
gb|AHE81273.1|  pathogenesis-related protein 1-9                        188   5e-56   
gb|AHE81252.1|  pathogenesis-related protein 1-9                        188   5e-56   
gb|AEM36335.1|  pathogenesis-related protein                            187   1e-55   
ref|XP_004230669.1|  PREDICTED: pathogenesis-related leaf protein 6     187   1e-55   
ref|XP_010527028.1|  PREDICTED: pathogenesis-related protein PR-1...    187   1e-55   
ref|XP_010691522.1|  PREDICTED: pathogenesis-related protein PR-1...    187   1e-55   
gb|AEH25634.1|  pathogenesis-related protein 1-19                       187   2e-55   
ref|XP_008651988.1|  PREDICTED: pathogenesis-related protein PRB1...    187   2e-55   
emb|CAN77102.1|  hypothetical protein VITISV_021166                     186   2e-55   Vitis vinifera
gb|AHE81280.1|  pathogenesis-related protein 1-16                       187   2e-55   
gb|AHE81259.1|  pathogenesis-related protein 1-16                       187   2e-55   
gb|AEH25631.1|  pathogenesis-related protein 1-16                       187   2e-55   
gb|EMS62872.1|  Pathogenesis-related protein PRMS                       187   2e-55   
ref|XP_010270273.1|  PREDICTED: pathogenesis-related leaf protein...    187   3e-55   
ref|XP_010941969.1|  PREDICTED: pathogenesis-related protein PRB1...    186   3e-55   
ref|XP_010245650.1|  PREDICTED: basic form of pathogenesis-relate...    186   4e-55   
gb|ADN43430.1|  pathogenesis-related protein 1                          186   5e-55   
ref|XP_002274105.1|  PREDICTED: pathogenesis-related leaf protein 6     186   6e-55   Vitis vinifera
ref|XP_003631695.1|  PREDICTED: basic form of pathogenesis-relate...    186   7e-55   
gb|ADB54822.1|  pathogenesis-related protein 1                          186   7e-55   Vitis pseudoreticulata
gb|ADN43442.1|  pathogenesis-related protein 1                          185   7e-55   
ref|XP_010691521.1|  PREDICTED: pathogenesis-related protein PR-1...    185   9e-55   
ref|XP_004955412.1|  PREDICTED: pathogenesis-related protein PRB1...    185   9e-55   
gb|AFK36478.1|  unknown                                                 185   1e-54   
emb|CBI25093.3|  unnamed protein product                                185   1e-54   
ref|XP_006367096.1|  PREDICTED: pathogenesis-related leaf protein...    185   1e-54   
ref|XP_004246724.1|  PREDICTED: pathogenesis-related leaf protein 4     184   2e-54   
ref|XP_009787159.1|  PREDICTED: basic form of pathogenesis-relate...    185   2e-54   
ref|XP_002273546.1|  PREDICTED: basic form of pathogenesis-relate...    184   2e-54   Vitis vinifera
gb|AHW81904.1|  pathogenesis-related protein                            184   3e-54   
gb|AHA43767.1|  pathogenesis related protein 1 isoform 4                184   3e-54   
ref|XP_008652242.1|  PREDICTED: pathogenesis-related protein 1-like     184   3e-54   
gb|KDP35900.1|  hypothetical protein JCGZ_09872                         184   3e-54   
ref|XP_006367094.1|  PREDICTED: pathogenesis-related leaf protein...    184   3e-54   
ref|XP_010088980.1|  hypothetical protein L484_013560                   184   3e-54   
ref|XP_004955413.1|  PREDICTED: pathogenesis-related protein 1-like     184   4e-54   
ref|XP_002274307.1|  PREDICTED: pathogenesis-related leaf protein 6     183   6e-54   Vitis vinifera
ref|NP_001234358.1|  PR1 protein precursor                              184   6e-54   
ref|XP_010941967.1|  PREDICTED: pathogenesis-related protein PRB1...    182   9e-54   
gb|ADB54823.1|  pathogenesis-related protein 1                          182   1e-53   Vitis pseudoreticulata
gb|AAK30143.1|AF348141_1  pathogenesis-related protein PR-1 precu...    182   2e-53   Capsicum annuum
ref|XP_002313935.2|  hypothetical protein POPTR_0009s08660g             182   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006486832.1|  PREDICTED: pathogenesis-related protein PR-1...    182   2e-53   
ref|XP_009388943.1|  PREDICTED: pathogenesis-related protein 1-like     182   2e-53   
ref|XP_004136927.1|  PREDICTED: basic form of pathogenesis-relate...    182   2e-53   
gb|AHE81270.1|  pathogenesis-related protein 1-6                        181   3e-53   
gb|AEH25621.1|  pathogenesis-related protein 1-6                        181   3e-53   
ref|XP_004504945.1|  PREDICTED: basic form of pathogenesis-relate...    181   3e-53   
ref|XP_009788195.1|  PREDICTED: basic form of pathogenesis-relate...    181   4e-53   
ref|NP_188603.1|  putative pathogenesis-related protein                 181   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266628.1|  PREDICTED: pathogenesis-related protein 1A-like    181   4e-53   
ref|NP_001043089.1|  Os01g0382000                                       181   4e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010530683.1|  PREDICTED: pathogenesis-related protein 1-like     181   4e-53   
ref|XP_006644187.1|  PREDICTED: pathogenesis-related protein PRB1...    181   4e-53   
gb|KDP37600.1|  hypothetical protein JCGZ_06943                         180   5e-53   
ref|XP_006422718.1|  hypothetical protein CICLE_v10029873mg             181   5e-53   
ref|XP_010530686.1|  PREDICTED: pathogenesis-related protein 1-like     181   5e-53   
ref|XP_006367091.1|  PREDICTED: basic form of pathogenesis-relate...    181   5e-53   
gb|AFK39516.1|  unknown                                                 181   5e-53   
gb|AFK93503.1|  pathogenesis related protein 1 isoform 4                181   5e-53   
gb|AFM77011.1|  pathogenesis related protein 1a                         180   6e-53   
gb|AEH25623.1|  pathogenesis-related protein 1-8                        181   6e-53   
gb|EMS35766.1|  Pathogenesis-related protein PRMS                       181   7e-53   
emb|CAA70070.1|  PR protein                                             181   7e-53   Solanum lycopersicum
ref|XP_010088981.1|  hypothetical protein L484_013561                   180   8e-53   
ref|XP_009605697.1|  PREDICTED: pathogenesis-related leaf protein...    180   9e-53   
emb|CAD38277.1|  pathogenesis related protein isoform b2                180   9e-53   Solanum phureja [chaucha]
ref|XP_006387932.1|  hypothetical protein POPTR_0473s00220g             179   9e-53   
ref|XP_004955945.1|  PREDICTED: pathogenesis-related protein PRMS...    180   9e-53   
ref|XP_006848057.1|  hypothetical protein AMTR_s00029p00197310          180   1e-52   
ref|XP_008796970.1|  PREDICTED: pathogenesis-related protein PRB1...    180   1e-52   
ref|XP_008346349.1|  PREDICTED: pathogenesis-related protein 1-like     179   1e-52   
ref|XP_009397726.1|  PREDICTED: pathogenesis-related protein PRB1...    182   1e-52   
gb|AFK64734.1|  pathogenesis related protein 1a                         179   2e-52   
emb|CAD38276.1|  pathogenesis related protein isoform b1                179   2e-52   Solanum phureja [chaucha]
ref|XP_004289701.1|  PREDICTED: pathogenesis-related protein 1B-like    179   2e-52   
gb|ADD97801.1|  pathogenesis-related protein 1                          179   3e-52   
ref|NP_001234523.1|  pathogenesis-related leaf protein 4 precursor      179   3e-52   
ref|XP_010252393.1|  PREDICTED: basic form of pathogenesis-relate...    179   3e-52   
ref|NP_001234314.1|  pathogenesis-related leaf protein 6 precursor      178   3e-52   
ref|XP_010941968.1|  PREDICTED: pathogenesis-related protein PRB1...    178   3e-52   
ref|XP_006412319.1|  hypothetical protein EUTSA_v10026438mg             178   4e-52   
ref|XP_007201612.1|  hypothetical protein PRUPE_ppa019807mg             178   4e-52   
ref|XP_009605696.1|  PREDICTED: basic form of pathogenesis-relate...    179   4e-52   
emb|CAB58263.1|  pathogenesis related protein PR-1                      178   5e-52   Solanum tuberosum [potatoes]
ref|NP_001275095.1|  pathogenesis-related protein 1b precursor          178   6e-52   
ref|XP_009135645.1|  PREDICTED: pathogenesis-related protein 1          178   6e-52   
gb|AFR90191.1|  pathogenesis-related protein 1a                         178   6e-52   
sp|P11670.1|PRB1_TOBAC  RecName: Full=Basic form of pathogenesis-...    178   7e-52   Nicotiana tabacum [American tobacco]
emb|CAA47374.1|  prb-1b                                                 178   8e-52   Nicotiana tabacum [American tobacco]
ref|XP_006367092.1|  PREDICTED: basic form of pathogenesis-relate...    178   8e-52   
ref|XP_008372945.1|  PREDICTED: pathogenesis-related protein 1-like     177   8e-52   
emb|CAD60273.1|  putative pathogenesis related protein 1 precursor      177   9e-52   Vitis vinifera
ref|XP_010904546.1|  PREDICTED: pathogenesis-related protein PRB1...    177   9e-52   
ref|XP_009787160.1|  PREDICTED: pathogenesis-related leaf protein...    177   1e-51   
dbj|BAC84725.1|  putative pathogenesis-related protein 1                177   1e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KDP37604.1|  hypothetical protein JCGZ_06947                         177   1e-51   
ref|XP_008796972.1|  PREDICTED: pathogenesis-related protein PRB1...    177   1e-51   
ref|XP_009388942.1|  PREDICTED: pathogenesis-related protein 1-like     177   1e-51   
ref|XP_008798894.1|  PREDICTED: pathogenesis-related protein PRB1...    177   1e-51   
ref|XP_003608310.1|  F-box/FBD/LRR-repeat protein                       190   1e-51   
ref|XP_009378591.1|  PREDICTED: pathogenesis-related leaf protein...    177   2e-51   
dbj|BAD11072.1|  pathogenesis-related protein 1                         177   2e-51   Capsicum chinense [bonnet pepper]
ref|XP_002522065.1|  STS14 protein precursor, putative                  177   2e-51   Ricinus communis
gb|ABK41053.2|  pathogenesis-related protein 1                          177   2e-51   Musa acuminata [banana]
ref|XP_004289700.1|  PREDICTED: basic form of pathogenesis-relate...    177   2e-51   
ref|XP_010489949.1|  PREDICTED: pathogenesis-related protein 1A-like    176   2e-51   
gb|AAQ19681.1|  cytoplasmic small heat shock protein class I            176   2e-51   Capsicum frutescens [bird pepper]
ref|XP_002522070.1|  STS14 protein precursor, putative                  176   2e-51   Ricinus communis
ref|XP_007148301.1|  hypothetical protein PHAVU_006G196900g             177   2e-51   
ref|XP_009342365.1|  PREDICTED: pathogenesis-related protein 1-like     176   3e-51   
ref|XP_009378592.1|  PREDICTED: pathogenesis-related protein PR-1...    176   3e-51   
gb|AGS80328.1|  pathogenesis-related protein 1                          176   3e-51   
ref|XP_006406470.1|  hypothetical protein EUTSA_v10022205mg             176   3e-51   
ref|XP_009398311.1|  PREDICTED: pathogenesis-related protein PRB1...    176   3e-51   
ref|XP_004289697.1|  PREDICTED: pathogenesis-related protein 1C-like    176   4e-51   
ref|XP_009335379.1|  PREDICTED: LOW QUALITY PROTEIN: basic form o...    176   4e-51   
ref|XP_010507919.1|  PREDICTED: pathogenesis-related protein 1A-like    176   5e-51   
ref|XP_008455064.1|  PREDICTED: pathogenesis-related protein PRB1...    176   5e-51   
ref|XP_010530685.1|  PREDICTED: pathogenesis-related protein 1-like     175   5e-51   
ref|XP_007041422.1|  Pathogenesis-related protein 1                     175   5e-51   
gb|AAX20041.1|  cytoplasmic small heat shock protein class I            175   5e-51   Capsicum annuum
gb|AFM76999.1|  pathogenesis related protein 1a                         175   5e-51   
ref|XP_004289699.1|  PREDICTED: pathogenesis-related protein 1B-like    175   5e-51   
gb|ADN43443.1|  pathogenesis-related protein 1                          175   5e-51   
ref|XP_010691519.1|  PREDICTED: pathogenesis-related protein 1A-like    176   6e-51   
gb|EMT26678.1|  Pathogenesis-related protein 1                          175   6e-51   
emb|CDX82282.1|  BnaA03g35390D                                          176   6e-51   
ref|XP_003593358.1|  Pathogenesis-related protein 1a                    175   6e-51   
ref|XP_010687897.1|  PREDICTED: pathogenesis-related protein PR-1...    175   7e-51   
ref|XP_006367102.1|  PREDICTED: basic form of pathogenesis-relate...    175   7e-51   
ref|XP_002313932.2|  pathogenesis-related family protein                175   7e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010525646.1|  PREDICTED: pathogenesis-related leaf protein...    175   8e-51   
ref|XP_009342367.1|  PREDICTED: pathogenesis-related protein PR-1...    175   9e-51   
ref|XP_008798895.1|  PREDICTED: pathogenesis-related protein 1-like     175   1e-50   
ref|XP_006657421.1|  PREDICTED: pathogenesis-related protein PRB1...    175   1e-50   
emb|CDY22960.1|  BnaC03g41090D                                          175   1e-50   
dbj|BAF03626.1|  pathogenesis related protein 1                         174   1e-50   Eutrema japonicum [wasabe]
ref|XP_009398310.1|  PREDICTED: pathogenesis-related protein 1-like     174   1e-50   
ref|XP_011092436.1|  PREDICTED: basic form of pathogenesis-relate...    174   1e-50   
ref|XP_006422719.1|  hypothetical protein CICLE_v10029950mg             174   1e-50   
ref|XP_006657422.1|  PREDICTED: pathogenesis-related protein 1-like     175   2e-50   
ref|XP_002265050.1|  PREDICTED: basic form of pathogenesis-relate...    174   2e-50   Vitis vinifera
ref|XP_008455066.1|  PREDICTED: basic form of pathogenesis-relate...    174   2e-50   
gb|ABA34060.1|  pathogenesis-related protein 1                          174   2e-50   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADN43441.1|  pathogenesis-related protein 1                          174   2e-50   
dbj|BAO09561.1|  pathogenesis-related protein 1                         174   2e-50   
ref|XP_003545770.1|  PREDICTED: basic form of pathogenesis-relate...    174   2e-50   
gb|EEC81456.1|  hypothetical protein OsI_24758                          174   3e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_008236237.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    173   3e-50   
dbj|BAB78476.1|  PR-1                                                   174   3e-50   Solanum torvum [berenjena cimarrona]
ref|XP_002885324.1|  hypothetical protein ARALYDRAFT_898358             173   3e-50   
ref|XP_006409652.1|  hypothetical protein EUTSA_v10022888mg             173   4e-50   
ref|XP_009138211.1|  PREDICTED: pathogenesis-related protein 1-like     173   4e-50   
gb|EMS56527.1|  Pathogenesis-related protein PRMS                       173   4e-50   
ref|NP_195098.1|  putative pathogenesis-related protein                 173   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422707.1|  hypothetical protein CICLE_v10030029mg             173   4e-50   
ref|XP_006368144.1|  PREDICTED: pathogenesis-related protein 1C-like    172   5e-50   
ref|XP_010943469.1|  PREDICTED: pathogenesis-related protein PRB1...    173   5e-50   
gb|AHE81254.1|  pathogenesis-related protein 1-11                       173   5e-50   
gb|KDP37607.1|  hypothetical protein JCGZ_06950                         173   5e-50   
ref|XP_008236225.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    173   6e-50   
ref|XP_009388944.1|  PREDICTED: pathogenesis-related protein 1C-like    172   6e-50   
gb|AHE81275.1|  pathogenesis-related protein 1-11                       173   7e-50   
ref|XP_006486833.1|  PREDICTED: pathogenesis-related leaf protein...    172   7e-50   
ref|NP_001043091.1|  Os01g0382400                                       172   8e-50   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ62489.1|  pathogenesis-related protein class I                    172   8e-50   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62461.1|  pathogenesis-related protein class I                    172   8e-50   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010517589.1|  PREDICTED: pathogenesis-related protein 1-like     172   9e-50   
ref|XP_009138212.1|  PREDICTED: pathogenesis-related protein 1-like     172   9e-50   
gb|AEQ33601.1|  pathogenesis-related protein 1a                         172   1e-49   
ref|XP_007201285.1|  hypothetical protein PRUPE_ppa012617mg             172   1e-49   
ref|XP_006367093.1|  PREDICTED: basic form of pathogenesis-relate...    173   1e-49   
emb|CAN68901.1|  hypothetical protein VITISV_019988                     172   1e-49   Vitis vinifera
ref|XP_007199955.1|  hypothetical protein PRUPE_ppa1027191mg            172   1e-49   
gb|ACJ62499.1|  pathogenesis-related protein class I                    172   1e-49   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004487816.1|  PREDICTED: pathogenesis-related protein 1-like     173   1e-49   
ref|XP_009335372.1|  PREDICTED: pathogenesis-related leaf protein...    172   1e-49   
ref|XP_009605695.1|  PREDICTED: basic form of pathogenesis-relate...    172   1e-49   
gb|ACJ62486.1|  pathogenesis-related protein class I                    172   1e-49   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62462.1|  pathogenesis-related protein class I                    172   1e-49   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010437726.1|  PREDICTED: pathogenesis-related protein 1-like     172   1e-49   
ref|XP_010904557.1|  PREDICTED: pathogenesis-related protein 1-like     172   1e-49   
gb|AEH25638.1|  pathogenesis-related protein 1-23                       172   1e-49   
ref|XP_006368158.1|  PREDICTED: pathogenesis-related protein 1A-like    171   1e-49   
ref|XP_007148304.1|  hypothetical protein PHAVU_006G197200g             171   2e-49   
gb|AFM77000.1|  pathogenesis related protein 1a                         172   2e-49   
ref|XP_006658251.1|  PREDICTED: uncharacterized protein LOC102701282    178   2e-49   
ref|XP_010942046.1|  PREDICTED: uncharacterized protein LOC105060136    176   2e-49   
ref|XP_007148305.1|  hypothetical protein PHAVU_006G197300g             171   2e-49   
gb|ACJ62513.1|  pathogenesis-related protein class I                    171   2e-49   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006282972.1|  hypothetical protein CARUB_v10007846mg             171   2e-49   
ref|XP_011091978.1|  PREDICTED: basic form of pathogenesis-relate...    171   2e-49   
emb|CDY49367.1|  BnaA03g50560D                                          171   2e-49   
ref|XP_011092471.1|  PREDICTED: basic form of pathogenesis-relate...    171   3e-49   
gb|KGN43833.1|  hypothetical protein Csa_7G070255                       171   3e-49   
ref|XP_010447203.1|  PREDICTED: pathogenesis-related protein 1-like     171   3e-49   
gb|AEH25628.1|  pathogenesis-related protein 1-13                       171   3e-49   
gb|ADN43440.1|  pathogenesis-related protein 1                          171   3e-49   
ref|XP_010252392.1|  PREDICTED: basic form of pathogenesis-relate...    171   3e-49   
ref|XP_006298656.1|  hypothetical protein CARUB_v10014746mg             171   3e-49   
gb|ACT99721.1|  pathogen-related protein 1                              171   3e-49   Nepenthes mirabilis
ref|XP_010468301.1|  PREDICTED: pathogenesis-related protein 1A-like    171   4e-49   
ref|XP_010252394.1|  PREDICTED: basic form of pathogenesis-relate...    171   4e-49   
ref|XP_010095625.1|  hypothetical protein L484_003726                   171   5e-49   
ref|XP_010547940.1|  PREDICTED: pathogenesis-related protein 1-like     170   5e-49   
ref|XP_011092435.1|  PREDICTED: basic form of pathogenesis-relate...    170   5e-49   
gb|ACJ62530.1|  pathogenesis-related protein class I                    170   5e-49   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009138206.1|  PREDICTED: pathogenesis-related protein 1-like     170   5e-49   
ref|XP_009138205.1|  PREDICTED: pathogenesis-related protein 1-like     170   6e-49   
ref|XP_010266519.1|  PREDICTED: pathogenesis-related protein 1A-like    170   6e-49   
ref|XP_010095627.1|  hypothetical protein L484_003728                   170   6e-49   
ref|XP_010065833.1|  PREDICTED: pathogenesis-related protein 1-like     171   6e-49   
emb|CAA65420.1|  pathogenesis-related protein 1                         170   6e-49   
ref|XP_004246723.1|  PREDICTED: pathogenesis-related leaf protein...    170   6e-49   
gb|KDP36353.1|  hypothetical protein JCGZ_09850                         171   7e-49   
ref|XP_011002583.1|  PREDICTED: pathogenesis-related leaf protein...    170   7e-49   
ref|XP_006367104.1|  PREDICTED: basic form of pathogenesis-relate...    171   7e-49   
ref|XP_006393183.1|  hypothetical protein EUTSA_v10011955mg             170   8e-49   
ref|NP_001105399.1|  pathogenesis related protein4 precursor            170   9e-49   
ref|XP_006345692.1|  PREDICTED: pathogenesis-related leaf protein...    169   9e-49   
gb|ABA34056.1|  pathogenesis-related protein 1                          169   1e-48   
gb|ABA34062.1|  pathogenesis-related protein 1                          169   1e-48   
ref|XP_002459310.1|  hypothetical protein SORBIDRAFT_02g002150          170   1e-48   
ref|XP_010040969.1|  PREDICTED: pathogenesis-related protein 1-like     169   1e-48   
ref|XP_010500562.1|  PREDICTED: pathogenesis-related leaf protein...    169   1e-48   
ref|XP_010467245.1|  PREDICTED: pathogenesis-related protein 1-like     169   1e-48   
ref|XP_010065835.1|  PREDICTED: pathogenesis-related protein PR-1...    169   1e-48   
gb|ABA34077.1|  pathogenesis-related protein 1                          169   2e-48   
gb|ABA34063.1|  pathogenesis-related protein 1                          169   2e-48   
gb|ABA34055.1|  pathogenesis-related protein 1                          169   2e-48   
ref|XP_003545771.1|  PREDICTED: pathogenesis-related protein PR-1...    169   2e-48   
ref|XP_010461858.1|  PREDICTED: pathogenesis-related leaf protein...    169   2e-48   
ref|XP_006367095.1|  PREDICTED: basic form of pathogenesis-relate...    169   2e-48   
ref|XP_008455062.1|  PREDICTED: pathogenesis-related protein 1-like     169   2e-48   
ref|XP_006367089.1|  PREDICTED: pathogenesis-related protein 1A1-...    169   2e-48   
gb|ABA34066.1|  pathogenesis-related protein 1                          168   3e-48   
emb|CDY46098.1|  BnaA03g52700D                                          168   4e-48   
ref|XP_010478439.1|  PREDICTED: pathogenesis-related leaf protein...    168   4e-48   
ref|XP_008236223.1|  PREDICTED: pathogenesis-related protein 1-like     168   5e-48   
emb|CDO97323.1|  unnamed protein product                                168   5e-48   
ref|NP_001234128.1|  pathogenesis-related protein 1A1 precursor         168   5e-48   
gb|AEJ88253.1|  putative pathogenesis-related protein 1                 167   6e-48   
ref|XP_003557607.1|  PREDICTED: pathogenesis-related protein PRB1...    167   6e-48   
ref|XP_004168739.1|  PREDICTED: basic form of pathogenesis-relate...    167   6e-48   
gb|ACJ62494.1|  pathogenesis-related protein class I                    167   6e-48   
gb|KGN43831.1|  hypothetical protein Csa_7G070254                       167   6e-48   
ref|XP_010065838.1|  PREDICTED: pathogenesis-related protein 1-like     167   7e-48   
gb|KGN48339.1|  hypothetical protein Csa_6G483242                       167   7e-48   
gb|ABA34079.1|  pathogenesis-related protein 1                          167   7e-48   
gb|AFK35640.1|  unknown                                                 168   7e-48   
gb|ABK55610.1|  pathogenesis-related protein PR1c                       167   7e-48   
gb|KDP37598.1|  hypothetical protein JCGZ_06941                         167   7e-48   
ref|XP_006486819.1|  PREDICTED: pathogenesis-related protein 1-like     167   8e-48   
ref|XP_002313936.2|  pathogenesis-related family protein                167   8e-48   
ref|XP_003545772.1|  PREDICTED: basic form of pathogenesis-relate...    167   8e-48   
ref|XP_010488899.1|  PREDICTED: pathogenesis-related protein 1          167   9e-48   
gb|KCW63509.1|  hypothetical protein EUGRSUZ_G01140                     167   9e-48   
ref|XP_004136924.1|  PREDICTED: basic form of pathogenesis-relate...    167   1e-47   
ref|XP_003593453.1|  Pathogenesis-related protein 1a                    167   1e-47   
gb|AFK37568.1|  unknown                                                 167   1e-47   
ref|XP_008455065.1|  PREDICTED: pathogenesis-related leaf protein...    167   1e-47   
ref|XP_010052998.1|  PREDICTED: basic form of pathogenesis-relate...    167   1e-47   
ref|XP_006306376.1|  hypothetical protein CARUB_v10012281mg             167   1e-47   
ref|NP_179068.1|  pathogenesis-related protein 1                        167   1e-47   
gb|KFK39972.1|  hypothetical protein AALP_AA3G313200                    166   1e-47   
ref|XP_010065837.1|  PREDICTED: pathogenesis-related protein 1A-like    167   1e-47   
gb|ABK28181.1|  unknown                                                 167   1e-47   
gb|AEX55228.1|  pathogenesis-related protein 1                          167   1e-47   
ref|XP_008370577.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    167   1e-47   
ref|XP_004136929.1|  PREDICTED: pathogenesis-related protein 1-like     166   2e-47   
ref|XP_010467244.1|  PREDICTED: pathogenesis-related protein 1-like     166   2e-47   
ref|XP_010052996.1|  PREDICTED: pathogenesis-related protein 1-like     166   2e-47   
ref|XP_004138862.1|  PREDICTED: basic form of pathogenesis-relate...    166   2e-47   
gb|AGO62049.1|  pathogenesis-related protein 1                          165   2e-47   
gb|AFK38989.1|  unknown                                                 166   2e-47   
prf||1803521A  pathogenesis-related protein 1                           165   2e-47
ref|XP_004152970.1|  PREDICTED: basic form of pathogenesis-relate...    166   2e-47   
gb|AEH25626.1|  pathogenesis-related protein 1-11                       166   2e-47   
ref|XP_004968783.1|  PREDICTED: pathogenesis-related protein PRMS...    166   2e-47   
gb|KFK39965.1|  hypothetical protein AALP_AA3G312200                    166   3e-47   
dbj|BAK01044.1|  predicted protein                                      166   3e-47   
gb|KCW63526.1|  hypothetical protein EUGRSUZ_G01161                     165   3e-47   
ref|XP_010065842.1|  PREDICTED: pathogenesis-related protein 1-like     166   3e-47   
gb|KCW77204.1|  hypothetical protein EUGRSUZ_D01555                     165   3e-47   
gb|AEH25637.1|  pathogenesis-related protein 1-22                       166   3e-47   
ref|NP_001064278.1|  Os10g0191300                                       166   3e-47   
ref|XP_010911073.1|  PREDICTED: pathogenesis-related protein PRB1...    166   4e-47   
ref|XP_006369711.1|  Pathogenesis-related family protein                166   4e-47   
gb|KCW63515.1|  hypothetical protein EUGRSUZ_G01148                     166   4e-47   
gb|ACU15426.1|  unknown                                                 166   4e-47   
ref|XP_004168740.1|  PREDICTED: basic form of pathogenesis-relate...    165   4e-47   
ref|XP_010943437.1|  PREDICTED: pathogenesis-related protein 1B-like    166   5e-47   
ref|XP_007041425.1|  Pathogenesis-related protein 1                     165   5e-47   
ref|NP_179064.1|  pathogenesis-related protein 1                        165   5e-47   
ref|XP_004485656.1|  PREDICTED: pathogenesis-related protein 1B-like    165   5e-47   
ref|XP_010488898.1|  PREDICTED: pathogenesis-related protein 1-like     165   5e-47   
ref|XP_003557605.1|  PREDICTED: pathogenesis-related protein 1-like     165   5e-47   
gb|KFK35951.1|  hypothetical protein AALP_AA4G059500                    165   6e-47   
gb|KFK39973.1|  hypothetical protein AALP_AA3G313300                    164   6e-47   
ref|XP_003543105.1|  PREDICTED: basic form of pathogenesis-relate...    165   6e-47   
ref|XP_006299028.1|  hypothetical protein CARUB_v10015165mg             165   6e-47   
ref|XP_010065836.1|  PREDICTED: pathogenesis-related protein 1-like     165   7e-47   
gb|KCW44084.1|  hypothetical protein EUGRSUZ_L02505                     164   8e-47   
ref|XP_010041202.1|  PREDICTED: basic form of pathogenesis-relate...    164   9e-47   
ref|XP_006299640.1|  hypothetical protein CARUB_v10015827mg             164   9e-47   
ref|XP_002522066.1|  STS14 protein precursor, putative                  164   1e-46   
ref|XP_003545775.1|  PREDICTED: basic form of pathogenesis-relate...    165   1e-46   
ref|XP_010517582.1|  PREDICTED: pathogenesis-related protein 1-like     164   1e-46   
ref|XP_008236224.1|  PREDICTED: pathogenesis-related leaf protein...    164   1e-46   
gb|ADP69172.1|  pathogenesis related protein-1                          164   1e-46   
ref|XP_010052997.1|  PREDICTED: pathogenesis-related protein 1-like     164   1e-46   
ref|XP_010054707.1|  PREDICTED: basic form of pathogenesis-relate...    164   2e-46   
ref|XP_004136928.1|  PREDICTED: pathogenesis-related protein 1C-like    164   2e-46   
ref|XP_010029887.1|  PREDICTED: pathogenesis-related protein PR-1...    164   2e-46   
gb|KCW56841.1|  hypothetical protein EUGRSUZ_I02509                     164   2e-46   
ref|XP_010530682.1|  PREDICTED: pathogenesis-related protein 1A-like    164   2e-46   
ref|XP_010042397.1|  PREDICTED: basic form of pathogenesis-relate...    163   2e-46   
gb|EEE54618.1|  hypothetical protein OsJ_01863                          163   2e-46   
ref|XP_010943479.1|  PREDICTED: pathogenesis-related protein PRB1...    163   3e-46   
ref|XP_004983398.1|  PREDICTED: pathogenesis-related protein PRMS...    164   3e-46   
ref|XP_010068342.1|  PREDICTED: basic form of pathogenesis-relate...    163   3e-46   
ref|XP_004170276.1|  PREDICTED: basic form of pathogenesis-relate...    163   3e-46   
gb|AFK93502.1|  pathogenesis related protein 1 isoform 3                163   3e-46   
ref|XP_002270128.1|  PREDICTED: pathogenesis-related leaf protein 4     163   3e-46   
ref|XP_006661674.1|  PREDICTED: pathogenesis-related protein PRB1...    163   4e-46   
ref|XP_002436405.1|  hypothetical protein SORBIDRAFT_10g001940          163   4e-46   
ref|XP_008454501.1|  PREDICTED: basic form of pathogenesis-relate...    163   4e-46   
ref|XP_006658252.1|  PREDICTED: pathogenesis-related protein PRB1...    163   4e-46   
gb|AFK93500.1|  pathogenesis related protein 1 isoform 1                163   4e-46   
ref|XP_010065846.1|  PREDICTED: pathogenesis-related protein 1-like     163   4e-46   
dbj|BAN09077.1|  pathogenesis related protein-1.2                       163   5e-46   
gb|KFK30004.1|  hypothetical protein AALP_AA7G205200                    163   5e-46   
emb|CDY69373.1|  BnaCnng63210D                                          162   5e-46   
emb|CAA88618.1|  type-1 pathogenesis-related protein                    163   5e-46   
emb|CDY68267.1|  BnaA06g37750D                                          162   5e-46   
ref|XP_010054710.1|  PREDICTED: pathogenesis-related leaf protein...    164   6e-46   
ref|XP_009605694.1|  PREDICTED: pathogenesis-related leaf protein...    162   6e-46   
ref|XP_002300292.2|  Pathogenesis-related family protein                162   6e-46   
gb|AEH25629.1|  pathogenesis-related protein 1-14                       162   6e-46   
ref|XP_008455071.1|  PREDICTED: basic form of pathogenesis-relate...    162   6e-46   
ref|XP_004230668.1|  PREDICTED: pathogenesis-related leaf protein...    162   7e-46   
gb|AEH25625.1|  pathogenesis-related protein 1-10                       162   7e-46   
ref|XP_010065834.1|  PREDICTED: pathogenesis-related protein 1-like     162   7e-46   
gb|KCW63528.1|  hypothetical protein EUGRSUZ_G01163                     161   8e-46   
gb|AEH25633.1|  pathogenesis-related protein 1-18                       162   9e-46   
ref|XP_007200682.1|  hypothetical protein PRUPE_ppa016942mg             162   9e-46   
gb|EYU18353.1|  hypothetical protein MIMGU_mgv1a023502mg                161   1e-45   
gb|KCW63507.1|  hypothetical protein EUGRSUZ_G01138                     161   1e-45   
emb|CDY69090.1|  BnaAnng29270D                                          161   1e-45   
ref|XP_010691520.1|  PREDICTED: pathogenesis-related protein 1C-like    162   1e-45   
ref|XP_002869194.1|  hypothetical protein ARALYDRAFT_491308             161   1e-45   
gb|KHN19054.1|  Basic form of pathogenesis-related protein 1            161   1e-45   
gb|ACQ41879.1|  pathogenisis-related protein 1.1                        161   1e-45   
emb|CAA07474.1|  pathogenisis-related protein 1.2                       162   2e-45   
ref|XP_010068331.1|  PREDICTED: protein PRY2-like                       169   2e-45   
gb|AEH25632.1|  pathogenesis-related protein 1-17                       162   2e-45   
ref|XP_011030266.1|  PREDICTED: basic form of pathogenesis-relate...    161   2e-45   
ref|XP_010053002.1|  PREDICTED: basic form of pathogenesis-relate...    161   2e-45   
ref|XP_010065853.1|  PREDICTED: basic form of pathogenesis-relate...    161   2e-45   
gb|EMT00919.1|  Pathogenesis-related protein PRB1-2                     164   2e-45   
ref|XP_010065832.1|  PREDICTED: pathogenesis-related protein 1-like     161   2e-45   
ref|XP_002273355.1|  PREDICTED: basic form of pathogenesis-relate...    161   2e-45   
ref|XP_006367090.1|  PREDICTED: pathogenesis-related protein 1-like     161   2e-45   
ref|XP_011030276.1|  PREDICTED: basic form of pathogenesis-relate...    161   2e-45   
gb|EMS61770.1|  Pathogenesis-related protein 1                          160   2e-45   
gb|ACB45874.1|  pathogen-related protein 1                              160   2e-45   
emb|CDO97324.1|  unnamed protein product                                161   2e-45   
ref|XP_010052995.1|  PREDICTED: basic form of pathogenesis-relate...    160   2e-45   
ref|XP_002465112.1|  hypothetical protein SORBIDRAFT_01g032200          161   2e-45   
ref|XP_003593363.1|  Pathogenesis-related protein 1B                    161   3e-45   
ref|XP_006412320.1|  hypothetical protein EUTSA_v10027447mg             160   3e-45   
gb|KCW63502.1|  hypothetical protein EUGRSUZ_G01132                     160   3e-45   
ref|XP_008798893.1|  PREDICTED: pathogenesis-related protein 1B-like    161   3e-45   
ref|XP_010053000.1|  PREDICTED: pathogenesis-related protein 1-like     161   3e-45   
ref|XP_004136922.1|  PREDICTED: basic form of pathogenesis-relate...    160   3e-45   
ref|XP_003561249.1|  PREDICTED: pathogenesis-related protein 1-like     161   3e-45   
ref|XP_007148306.1|  hypothetical protein PHAVU_006G197400g             160   3e-45   
gb|ABA41593.1|  pathogenesis-related protein                            160   3e-45   
ref|XP_004136921.1|  PREDICTED: basic form of pathogenesis-relate...    160   3e-45   
ref|XP_010488897.1|  PREDICTED: pathogenesis-related protein 1-like     160   3e-45   
gb|KCW77208.1|  hypothetical protein EUGRSUZ_D01560                     160   3e-45   
emb|CAE51954.1|  putative basic PR1                                     160   4e-45   
sp|Q05968.1|PR1_HORVU  RecName: Full=Pathogenesis-related protein...    160   4e-45   
gb|KGN62936.1|  hypothetical protein Csa_2G381380                       160   4e-45   
gb|AEH25620.1|  pathogenesis-related protein 1-5                        160   4e-45   
ref|XP_010052992.1|  PREDICTED: basic form of pathogenesis-relate...    160   5e-45   
ref|XP_010065843.1|  PREDICTED: pathogenesis-related protein 1-like     160   5e-45   
gb|AEZ52390.1|  pathogenesis-related protein 1                          160   5e-45   
ref|XP_009147855.1|  PREDICTED: pathogenesis-related leaf protein 6     160   5e-45   
emb|CDX89632.1|  BnaC03g45460D                                          160   6e-45   
gb|KDP37597.1|  hypothetical protein JCGZ_06940                         167   6e-45   
ref|XP_002891554.1|  hypothetical protein ARALYDRAFT_474142             160   6e-45   
gb|KCW63519.1|  hypothetical protein EUGRSUZ_G01152                     159   7e-45   
ref|XP_009136246.1|  PREDICTED: pathogenesis-related protein 1-like     159   8e-45   
emb|CDX93140.1|  BnaA03g38620D                                          159   9e-45   
ref|XP_010270442.1|  PREDICTED: basic form of pathogenesis-relate...    159   9e-45   
ref|XP_008382391.1|  PREDICTED: pathogenesis-related protein 1A-like    159   1e-44   
gb|KCW44547.1|  hypothetical protein EUGRSUZ_L01945                     160   1e-44   
gb|KCW77194.1|  hypothetical protein EUGRSUZ_D01543                     158   1e-44   
gb|ACQ41880.1|  pathogenisis-related protein 1.1                        159   1e-44   
ref|NP_001238168.1|  PR1a precursor                                     159   1e-44   
ref|NP_197985.2|  Cysteine-rich secretory proteins, Antigen 5, an...    159   1e-44   
gb|AAD40121.1|AF149413_2  contains similarity to SCP-like extrace...    159   1e-44   
ref|XP_010052994.1|  PREDICTED: basic form of pathogenesis-relate...    159   1e-44   
ref|XP_011002613.1|  PREDICTED: basic form of pathogenesis-relate...    159   1e-44   
gb|ABR18381.1|  unknown                                                 159   1e-44   
ref|XP_004138861.1|  PREDICTED: basic form of pathogenesis-relate...    158   2e-44   
ref|XP_008455068.1|  PREDICTED: basic form of pathogenesis-relate...    159   2e-44   
dbj|BAL63012.1|  pathogenesis-related protein 1-1a                      157   2e-44   
gb|AHE81248.1|  pathogenesis-related protein 1-5                        159   2e-44   
gb|AAL84768.1|AF475286_1  pathogenesis-related protein 1-1a             157   2e-44   
gb|ACJ62559.1|  pathogenesis-related maize seed protein                 158   2e-44   
ref|XP_011016555.1|  PREDICTED: basic form of pathogenesis-relate...    158   2e-44   
gb|ABA34024.1|  pathogenesis-related maize seed protein                 158   3e-44   
ref|XP_002885924.1|  predicted protein                                  158   3e-44   
pdb|1CFE|A  Chain A, P14a, Nmr, 20 Structures                           157   3e-44   
gb|AID60095.1|  CAP superfamily protein                                 158   3e-44   
emb|CBI25103.3|  unnamed protein product                                157   4e-44   
emb|CDO97326.1|  unnamed protein product                                157   4e-44   
ref|XP_009346545.1|  PREDICTED: pathogenesis-related protein 1A-like    157   5e-44   
ref|XP_009788194.1|  PREDICTED: pathogenesis-related leaf protein...    157   5e-44   
emb|CDX69000.1|  BnaC01g04530D                                          158   5e-44   
ref|XP_003593357.1|  Pathogenesis-related protein 1a                    162   5e-44   
ref|XP_003593361.1|  Pathogenesis-related protein 1a                    157   8e-44   
ref|XP_008657154.1|  PREDICTED: pathogenesis-related protein PRB1...    157   8e-44   
emb|CDX72421.1|  BnaC07g44430D                                          157   9e-44   
ref|XP_006355294.1|  PREDICTED: LOW QUALITY PROTEIN: pathogenesis...    157   1e-43   
ref|XP_010095626.1|  hypothetical protein L484_003727                   156   1e-43   



>ref|XP_009769213.1| PREDICTED: pathogenesis-related protein 1C [Nicotiana sylvestris]
 sp|P09042.3|PR1C_TOBAC RecName: Full=Pathogenesis-related protein 1C; Short=PR-1C; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35666.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 130/168 (77%), Gaps = 7/168 (4%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            F ++SS FL   L+L + +   C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+
Sbjct  6    FSQMSSFFLVSTLLLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQN  65

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YASQ + DC+L+HS   QYGEN+A G  +  LTA  AV+MWV E+QYY H +N+C    G
Sbjct  66   YASQLAADCNLVHSHG-QYGENLAWGSGD-FLTAAKAVEMWVNEKQYYAHDSNTC--AQG  121

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS++VGCARVQC+NG GY V+CNY PPGN IG+SPY
Sbjct  122  QVCGHYTQVVWRNSVRVGCARVQCNNG-GYIVSCNYDPPGNVIGKSPY  168



>emb|CAA31010.1| PR1c preprotein [Nicotiana tabacum]
Length=163

 Score =   207 bits (526),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 130/168 (77%), Gaps = 7/168 (4%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            F ++SS FL   L+L + +   C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+
Sbjct  1    FSQMSSFFLVSTLLLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YASQ + DC+L+HS   QYGEN+A G  +  LTA  AV+MWV E+QYY H +N+C    G
Sbjct  61   YASQLAADCNLVHSHG-QYGENLAWGSGD-FLTAAKAVEMWVNEKQYYAHDSNTC--AQG  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS++VGCARVQC+NG GY V+CNY PPGN IG+SPY
Sbjct  117  QVCGHYTQVVWRNSVRVGCARVQCNNG-GYIVSCNYDPPGNVIGKSPY  163



>emb|CAA29023.1| PR-1c protein [Nicotiana tabacum]
Length=161

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 129/166 (78%), Gaps = 7/166 (4%)
 Frame = +3

Query  66   KISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            ++SS FL   L+L + +   C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YA
Sbjct  1    QMSSFFLVSTLLLFLIISHSCHAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYA  60

Query  240  SQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            SQ + DC+L+HS   QYGEN+A G  +  LTA  AV+MWV E+QYY H +N+C    G+ 
Sbjct  61   SQLAADCNLVHSHG-QYGENLAWGSGD-FLTAAKAVEMWVNEKQYYAHDSNTC--AQGQV  116

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CGHYTQVVWRNS++VGCARVQC+NG GY V+CNY PPGN IG+SPY
Sbjct  117  CGHYTQVVWRNSVRVGCARVQCNNG-GYIVSCNYDPPGNVIGKSPY  161



>ref|XP_004955414.1| PREDICTED: pathogenesis-related protein 1-like [Setaria italica]
Length=168

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQD++D HNAAR+ VGV P++WD+ V A+A+SYA+QR+GDC+L HS    YGEN
Sbjct  24   CAAQNSQQDFVDLHNAARSDVGVGPVSWDDNVAAFARSYAAQRAGDCALQHSSGSGYGEN  83

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            I  GG     +A  AV +WVAE+Q+YDH +NSC+AP G+SCGHYTQVVWR+S  +GCAR 
Sbjct  84   IFVGGAGADWSASDAVGLWVAEKQWYDHGSNSCSAPAGQSCGHYTQVVWRDSTAIGCART  143

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C+NG G F+TCNY+PPGN++GQSPY
Sbjct  144  VCNNG-GVFITCNYNPPGNFVGQSPY  168



>emb|CAA30017.1| unnamed protein product [Nicotiana tabacum]
Length=168

 Score =   202 bits (514),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YASQ + DC+L+HS   QYGEN
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG-QYGEN  86

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +A G  +  +TA  AV+MWV E+QYYDH +N+C    G+ CGHYTQVVWRNS++VGCARV
Sbjct  87   LAEGSGD-FMTAAKAVEMWVNEKQYYDHDSNTC--AQGQVCGHYTQVVWRNSVRVGCARV  143

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QC+NG GY VTCNY PPGNY G+SPY
Sbjct  144  QCNNG-GYVVTCNYDPPGNYRGESPY  168



>gb|ADN43432.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   201 bits (512),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++   +   C AQNS QDY+D+HNAARA VGV PITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDSHNAARAQVGVGPITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGENIA G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENIAWG--SPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC NG G+FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARVQCDNG-GWFVTCNYDPPGNYVGQRPY  161



>gb|ADN43433.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   201 bits (511),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS      ++ L +   C AQNS QDY+DAHNAARA VGV P+TW+  V AYAQ+
Sbjct  1    MGLFKISLALXVGLMGLALAHTCCAQNSLQDYVDAHNAARAQVGVGPMTWNNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDCSL+HSG   YGENIA G    SLT+  AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCSLVHSGG-PYGENIAWG--SPSLTSTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC NG G+FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARVQCDNG-GWFVTCNYDPPGNYVGQRPY  161



>dbj|BAA14220.1| PR1a protein precursor [Nicotiana tabacum]
 prf||1501385A pathogenesis related protein PR1a
Length=168

 Score =   201 bits (511),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 120/146 (82%), Gaps = 5/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YASQ + DC+L+HS   QYGEN
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG-QYGEN  86

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +A G  +  +TA  AV+MWV E+QYYDH +N+C+   G+ CGHYTQVVWRNS++VGCARV
Sbjct  87   LAEGSGD-FMTAAKAVEMWVDEKQYYDHDSNTCSQ--GQVCGHYTQVVWRNSVRVGCARV  143

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QC+NG GY V+CNY PPGNY G+SPY
Sbjct  144  QCNNG-GYVVSCNYDPPGNYRGESPY  168



>gb|ADN43435.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   201 bits (510),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L   + L +   C AQNS QDY+DAHNAARA VGV P+TW+  V AYAQ+
Sbjct  1    MGLFKISLALLVGPMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGPMTWNNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGENIA G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENIAWG--SPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+F+TCNY PPGNY+GQ PY
Sbjct  115  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFITCNYDPPGNYVGQRPY  161



>gb|ADN43437.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=161

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++   +   C AQNS QDY+D HNAARA VGV PITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGENIA G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENIAWG--SPSLTGTDAVNMWVGEKPNYDYNSNSCF---G  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC NG G+FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARVQCDNG-GWFVTCNYDPPGNYVGQRPY  161



>ref|XP_009610821.1| PREDICTED: pathogenesis-related protein 1B [Nicotiana tomentosiformis]
 sp|P07053.1|PR1B_TOBAC RecName: Full=Pathogenesis-related protein 1B; Short=PR-1B; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA35665.1| unnamed protein product [Nicotiana tabacum]
 dbj|BAA14221.1| PR1b protein precursor [Nicotiana tabacum]
 emb|CAA27183.1| PR-1b precursor; (aa -30-138) [Nicotiana tabacum]
 prf||1203245A protein 1b,pathogenesis related
Length=168

 Score =   201 bits (510),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 127/173 (73%), Gaps = 10/173 (6%)
 Frame = +3

Query  54   MGFLKIS---SLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVE  218
            MGF   S   S FL   L+L + +     AQNSQQDYLDAHN ARA VGV+P+TWD  V 
Sbjct  1    MGFFLFSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVA  60

Query  219  AYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSC  398
            AYAQ+Y SQ + DC+L+HS   QYGEN+A G  +  +TA  AV+MWV E+QYYDH +N+C
Sbjct  61   AYAQNYVSQLAADCNLVHSHG-QYGENLAQGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC  118

Query  399  NAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
                G+ CGHYTQVVWRNS++VGCARV+C+NG GY V+CNY PPGN IGQSPY
Sbjct  119  --AQGQVCGHYTQVVWRNSVRVGCARVKCNNG-GYVVSCNYDPPGNVIGQSPY  168



>emb|CAA31008.1| PR1a preprotein [Nicotiana tabacum]
Length=165

 Score =   201 bits (510),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YASQ + DC+L+HS   QYGEN
Sbjct  25   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG-QYGEN  83

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +A G  +  +TA  AV+MWV E+QYYDH +N+C    G+ CGHYTQVVWRNS++VGCARV
Sbjct  84   LAEGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVCGHYTQVVWRNSVRVGCARV  140

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QC+NG GY V+CNY PPGNY G+SPY
Sbjct  141  QCNNG-GYVVSCNYDPPGNYRGESPY  165



>sp|P08299.1|PR1A_TOBAC RecName: Full=Pathogenesis-related protein 1A; Short=PR-1A; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA31233.1| unnamed protein product [Nicotiana tabacum]
 emb|CAA29392.1| PR-1a precursor (AA -30 to 138) [Nicotiana tabacum]
 emb|CAA29660.1| PR1a precursor (AA -30 to -1) [Nicotiana tabacum]
Length=168

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YASQ + DC+L+HS   QYGEN
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG-QYGEN  86

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +A G  +  +TA  AV+MWV E+QYYDH +N+C    G+ CGHYTQVVWRNS++VGCARV
Sbjct  87   LAEGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVCGHYTQVVWRNSVRVGCARV  143

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QC+NG GY V+CNY PPGNY G+SPY
Sbjct  144  QCNNG-GYVVSCNYDPPGNYRGESPY  168



>gb|AAB05225.1| pathogenesis-related protein-1 [Nicotiana glutinosa]
Length=168

 Score =   201 bits (510),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 128/176 (73%), Gaps = 9/176 (5%)
 Frame = +3

Query  30   SIIQRRKKMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDE  209
            + I   +   FL +S+  L  I+       C AQNSQQDYL+AHN ARA VGV+P+TWD+
Sbjct  2    AFILFSQMPSFLLVSTFLLFLIISHS----CHAQNSQQDYLNAHNTARADVGVEPLTWDD  57

Query  210  QVEAYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHAT  389
            +V AYAQ+Y SQ + DC+L+ S   QYGEN+A G  +  +TA  AV+MWV E+QYYDH +
Sbjct  58   EVAAYAQNYVSQLAADCNLVTSHG-QYGENLAMGSGD-FMTAAKAVEMWVDEKQYYDHGS  115

Query  390  NSCNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            N C    G+ CGHYTQVVWRNS++VGCARVQC+NG GY V+CNY PPGN++GQSPY
Sbjct  116  NHC--AQGQVCGHYTQVVWRNSVRVGCARVQCNNG-GYVVSCNYDPPGNFVGQSPY  168



>gb|ADN43436.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++   +   C AQNS QDY+D HNAARA VGV PITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENIAWG--SPSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  115  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  161



>gb|AEL99925.1| pathogenesis-related protein 1 [Nicotiana benthamiana]
Length=160

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 119/146 (82%), Gaps = 5/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YASQ + DC+L+HS   QYGEN
Sbjct  20   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG-QYGEN  78

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +A G  +  +TA  AV+MWV E+QYYDH +N+C    G+ CGHYTQVVWRNS++VGCARV
Sbjct  79   LAEGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVCGHYTQVVWRNSVRVGCARV  135

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QC+NG GY V+CNY PPGNY G+SPY
Sbjct  136  QCNNG-GYVVSCNYDPPGNYRGESPY  160



>emb|CDP12737.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   200 bits (509),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 122/168 (73%), Gaps = 6/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KISS    C ++L M     AQNSQQDYLD HNAARA V V PI WD+++ AYAQ+
Sbjct  1    MGSFKISSAIF-CFVLLAMFWPSRAQNSQQDYLDVHNAARAQVNVGPIAWDDRLAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC L+HSG   YGEN+AAG  +   TA++AV++WV E+QYYD+ +NSC    G
Sbjct  60   YATQRMNDCQLMHSGG-PYGENLAAGSGD--FTARAAVNLWVNERQYYDYGSNSCTQ--G  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + C HYTQVVWRNS + GCARVQC+N   +FV C+Y PPGNYIGQ PY
Sbjct  115  KECRHYTQVVWRNSARTGCARVQCTNSPSWFVICSYDPPGNYIGQRPY  162



>emb|CAA29022.1| PR-1b protein [Nicotiana tabacum]
Length=164

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 126/168 (75%), Gaps = 7/168 (4%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            F ++ S FL   L+L + +     AQNSQQDYLDAHN ARA VGV+P+TWD  V AYAQ+
Sbjct  2    FSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQN  61

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            Y SQ + DC+L+HS   QYGEN+A G  +  +TA  AV+MWV E+QYYDH +N+C    G
Sbjct  62   YVSQLAADCNLVHSHG-QYGENLAQGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC--AQG  117

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS++VGCARV+C+NG GY V+CNY PPGN IGQSPY
Sbjct  118  QVCGHYTQVVWRNSVRVGCARVKCNNG-GYVVSCNYDPPGNVIGQSPY  164



>gb|ADN43434.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++   +   C AQNS QDY+D HNAA+A VGV PITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAAQAQVGVGPITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGENIA G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENIAWG--SPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+F+TCNY PPGNY+GQ PY
Sbjct  115  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFITCNYDPPGNYVGQRPY  161



>ref|XP_009605825.1| PREDICTED: pathogenesis-related protein 1B-like [Nicotiana tomentosiformis]
Length=177

 Score =   199 bits (506),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 127/173 (73%), Gaps = 10/173 (6%)
 Frame = +3

Query  54   MGFLKIS---SLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVE  218
            MGF+  S   S FL   L+L + +     AQNSQQDYLDAHN ARA V V+P+TWD+ V 
Sbjct  1    MGFVLFSQMPSFFLVSTLLLFLIISHSSHAQNSQQDYLDAHNTARADVAVEPLTWDDDVA  60

Query  219  AYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSC  398
            AYAQ+Y SQ + DC+L+HS   QYGEN+A G  +  +TA  AV+MWV E+QYYD+ +N+C
Sbjct  61   AYAQNYVSQLAADCNLVHSHG-QYGENLAQGSGD-FMTAAKAVEMWVDEKQYYDYDSNTC  118

Query  399  NAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
                G+ CGHYTQVVWRNS++VGCARVQC NG GY V+CNY PPGN IGQSP+
Sbjct  119  --AEGQVCGHYTQVVWRNSVRVGCARVQCDNG-GYVVSCNYDPPGNVIGQSPF  168



>ref|XP_009803803.1| PREDICTED: pathogenesis-related protein 1C-like [Nicotiana sylvestris]
Length=184

 Score =   199 bits (506),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 131/173 (76%), Gaps = 10/173 (6%)
 Frame = +3

Query  54   MGFLKIS---SLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVE  218
            MGF+  S   S FL   L+L + +   C AQNS QDYLDAHN ARA VGV+P+TWD+QV 
Sbjct  1    MGFVLFSQMPSFFLVSTLLLFLIISLSCGAQNSPQDYLDAHNTARADVGVEPLTWDDQVA  60

Query  219  AYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSC  398
            AYAQ+YASQ + DC L+HS   QYGEN+A G  +  +TA  AV+MWV E+QYYDH +N+C
Sbjct  61   AYAQNYASQLAADCMLVHSHG-QYGENLAWGSGD-FMTAAKAVEMWVNEKQYYDHDSNTC  118

Query  399  NAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
                G+ CGHYTQVVWRNS++VGCARVQC++G GY V+CNY PPGN++GQSPY
Sbjct  119  --AQGQVCGHYTQVVWRNSVRVGCARVQCNDG-GYVVSCNYDPPGNFVGQSPY  168



>ref|XP_009798466.1| PREDICTED: pathogenesis-related protein 1A [Nicotiana sylvestris]
Length=168

 Score =   198 bits (504),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 118/146 (81%), Gaps = 5/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNSQQDYLDAHN ARA VGV+P+TWD+QV AYAQ+YASQ + DC+L+HS   QYGEN
Sbjct  28   CRAQNSQQDYLDAHNTARADVGVEPLTWDDQVAAYAQNYASQLAADCNLVHSHG-QYGEN  86

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +A G  +  +TA  AV+MWV E+QYYDH +N+C    G+ CGHYTQVVW NS++VGCARV
Sbjct  87   LAEGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVCGHYTQVVWHNSVRVGCARV  143

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QC+NG GY V+CNY PPGNY G+SPY
Sbjct  144  QCNNG-GYVVSCNYDPPGNYRGESPY  168



>gb|EEC81457.1| hypothetical protein OsI_24759 [Oryza sativa Indica Group]
 gb|EEE66502.1| hypothetical protein OsJ_22957 [Oryza sativa Japonica Group]
Length=149

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENI  302
            AQNS QD++D HNAARA VGV P++WD+ V AYA+SYA+QR GDC L HS S  +YGENI
Sbjct  5    AQNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENI  64

Query  303  AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
              G      TA SAV  WV+E+Q+YDH +NSC+AP G SCGHYTQVVWR+S  +GCARV 
Sbjct  65   FWGSAGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVV  124

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C    G F+TCNYSPPGN++GQSPY
Sbjct  125  CDGDLGVFITCNYSPPGNFVGQSPY  149



>ref|XP_011002601.1| PREDICTED: pathogenesis-related protein 1-like [Populus euphratica]
Length=162

 Score =   197 bits (501),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 6/164 (4%)
 Frame = +3

Query  66   KISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQ  245
            KIS  F   I+ L + L   AQ++ QDYLDAHNAARAAVGV P+TWD  V+AYAQ+YA+Q
Sbjct  5    KISLAFFTLIITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQ  64

Query  246  RSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCG  425
            R+GDC+L+HSG   YGEN+A    +  L+   AV MWV E+ YYD+++NSC A  G+ CG
Sbjct  65   RAGDCNLVHSGG-PYGENLAWSSAD--LSGTDAVKMWVDEKAYYDYSSNSCAA--GQQCG  119

Query  426  HYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            HYTQVVWRNS ++GCA+V+CS G G F+ CNY PPGNY+GQ PY
Sbjct  120  HYTQVVWRNSARLGCAKVKCSTG-GTFIGCNYDPPGNYVGQKPY  162



>ref|XP_002274371.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN80994.1| hypothetical protein VITISV_042545 [Vitis vinifera]
Length=161

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY+DAHNAARA VGV  ITW++ V AYAQ+
Sbjct  1    MGLCKISMALLVGLMGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HSG   YGEN+A G    SLT   AV++WV E+ YYD+ +NSC    G
Sbjct  61   YANQRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKPYYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>gb|KDP37606.1| hypothetical protein JCGZ_06949 [Jatropha curcas]
Length=163

 Score =   197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 7/169 (4%)
 Frame = +3

Query  51   KMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            K+ F K S   L  ++ L + L   +Q+ QQDYLDAHN ARAAVGV P++WD+ V AYAQ
Sbjct  2    KLSF-KNSLFPLFALINLALILPIQSQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQ  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YASQR+GDC+L+HSG   YGEN+A    E  L+   AV MWV E+ YYD+ +NSC+  P
Sbjct  61   NYASQRAGDCNLVHSGG-PYGENLAWSSAE--LSGTDAVKMWVDEKAYYDYDSNSCS--P  115

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ CGHYTQVVWR+S++VGCA+V+CSNG G FVTCNY PPGNY+GQ PY
Sbjct  116  GQMCGHYTQVVWRDSVRVGCAKVRCSNG-GTFVTCNYDPPGNYVGQKPY  163



>emb|CDO97325.1| unnamed protein product [Coffea canephora]
Length=162

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 127/168 (76%), Gaps = 6/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS L L   ++L +     AQNSQQDY+DAHNAARA VGV PI WD+ V AYAQ+
Sbjct  1    MGSPKIS-LALVSFILLAIFWPSRAQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HSG + YGEN+A G  +  LT + AV++WV+E+QYYD+ +N+C    G
Sbjct  60   YANQRINDCNLVHSGGR-YGENLAEGSGD--LTGRDAVNLWVSEKQYYDYNSNTC--AQG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S+++GCARVQC+N   +FV C+Y PPGNY+GQ PY
Sbjct  115  QQCGHYTQVVWRDSVRLGCARVQCTNNGWWFVICSYDPPGNYVGQRPY  162



>emb|CAA36790.1| unnamed protein product [Nicotiana tabacum]
Length=184

 Score =   197 bits (500),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/173 (61%), Positives = 130/173 (75%), Gaps = 10/173 (6%)
 Frame = +3

Query  54   MGFLKIS---SLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVE  218
            MGF+  S   S FL   L+L + +   C AQNS QDYLDAHN ARA VGV+P+TWD+QV 
Sbjct  1    MGFVLFSQMPSFFLVSTLLLFLIISLSCGAQNSPQDYLDAHNTARADVGVEPLTWDDQVA  60

Query  219  AYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSC  398
            AYAQ+YASQ + DC L+HS   QYGEN+A G  +  +TA  AV+MWV E+QYYDH +N+C
Sbjct  61   AYAQNYASQLAADCMLVHSHG-QYGENLAWGSGD-FMTAAKAVEMWVNEKQYYDHDSNTC  118

Query  399  NAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
                G+ CGHYTQVVWRNS++VGCAR QC++G GY V+CNY PPGN++GQSPY
Sbjct  119  --AQGQVCGHYTQVVWRNSVRVGCARAQCNSG-GYVVSCNYDPPGNFVGQSPY  168



>gb|EAZ02649.1| hypothetical protein OsI_24760 [Oryza sativa Indica Group]
 gb|EAZ38569.1| hypothetical protein OsJ_22958 [Oryza sativa Japonica Group]
Length=149

 Score =   196 bits (497),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 111/145 (77%), Gaps = 1/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENI  302
            AQNS QDY+DAHNAAR+ VGV P++WD+ V AYA+SYA+QR GDC+L HS S  +YGENI
Sbjct  5    AQNSAQDYVDAHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGGKYGENI  64

Query  303  AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
              G      TA SAV  WVAE+Q+YDH +NSC+AP G SCGHYTQVVW NS  +GCARV 
Sbjct  65   FWGSAGGDWTAASAVSSWVAEKQWYDHDSNSCSAPAGSSCGHYTQVVWSNSTAIGCARVV  124

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C N  G F+TCNYSPPGN  G+SPY
Sbjct  125  CDNSLGVFITCNYSPPGNVDGESPY  149



>gb|ADN43415.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   196 bits (497),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C+L L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AVD+WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVDLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  160



>ref|XP_008798890.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Phoenix 
dactylifera]
Length=166

 Score =   196 bits (497),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 123/170 (72%), Gaps = 6/170 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   + S F A +LV+       AQNS  D+++AHNAAR AVGV P++W+  V +YA+ 
Sbjct  1    MGSSSLISFFCATVLVMAHATL--AQNSPDDFVNAHNAAREAVGVGPVSWNTTVASYAKD  58

Query  234  YASQRSGDCSLIHSGSQQYG--ENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            YA+QR GDC LIHS S  YG  EN+  GG  +  TAK AVD+WV E+QYYD+ +NSC+AP
Sbjct  59   YANQRKGDCQLIHSDSISYGYGENLFIGGGPD-FTAKDAVDLWVGEKQYYDYDSNSCSAP  117

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            PG+SCGHYTQVVWR+S  VGCAR+QC + +G F+TCNYSPPGN   + PY
Sbjct  118  PGQSCGHYTQVVWRDSTGVGCARIQC-DSSGTFITCNYSPPGNVERKRPY  166



>gb|ADN43439.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   195 bits (496),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY+DAHNAARA VGV  ITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGLALAHTCCAQNSAQDYVDAHNAARAQVGVGSITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HSG  +YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YANQRISDCNLVHSGG-RYGENLAKGSP--SLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>emb|CAA31009.1| PR1b preprotein [Nicotiana tabacum]
Length=153

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = +3

Query  93   ILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIH  272
            +L L +     AQNSQQDYLDAHN ARA VGV+P+TWD  V AYAQ+Y SQ + DC+L+H
Sbjct  4    LLFLIISHSSHAQNSQQDYLDAHNTARADVGVEPLTWDNGVAAYAQNYVSQLAADCNLVH  63

Query  273  SGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRN  452
            S   QYGEN+A G  +  +TA  AV+MWV E+QYYDH +N+C    G+ CGHYTQVVWRN
Sbjct  64   SHG-QYGENLAQGSGD-FMTAAKAVEMWVDEKQYYDHDSNTC--AQGQVCGHYTQVVWRN  119

Query  453  SLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            S++VGCARV+C+NG GY V+CNY PPGN IGQSPY
Sbjct  120  SVRVGCARVKCNNG-GYVVSCNYDPPGNVIGQSPY  153



>ref|NP_001058815.1| Os07g0129200 [Oryza sativa Japonica Group]
 dbj|BAC84842.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAD31924.1| PR-1 type pathogenesis-related protein PR-1a [Oryza sativa Japonica 
Group]
 dbj|BAF20729.1| Os07g0129200 [Oryza sativa Japonica Group]
 gb|ABK55608.1| pathogenesis-related protein PR1a [Oryza sativa Indica Group]
Length=168

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENIA  305
            QNS QD++D HNAARA VGV P++WD+ V AYA+SYA+QR GDC L HS S  +YGENI 
Sbjct  25   QNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIF  84

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G      TA SAV  WV+E+Q+YDH +NSC+AP G SCGHYTQVVWR+S  +GCARV C
Sbjct  85   WGSAGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVC  144

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
                G F+TCNYSPPGN++GQSPY
Sbjct  145  DGDLGVFITCNYSPPGNFVGQSPY  168



>gb|AAG44566.1|AF251277_1 acidic PR-1 type pathogenesis-related protein PR-1a [Oryza sativa 
Japonica Group]
 emb|CAC03571.1| PR1a protein [Oryza sativa Japonica Group]
Length=168

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENIA  305
            QNS QD++D HNAARA VGV P++WD+ V AYA+SYA+QR GDC L HS S  +YGENI 
Sbjct  25   QNSAQDFVDPHNAARADVGVGPVSWDDTVAAYAESYAAQRQGDCKLEHSDSGGKYGENIF  84

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G      TA SAV  WV+E+Q+YDH +NSC+AP G SCGHYTQVVWR+S  +GCARV C
Sbjct  85   WGSPGGDWTAASAVSAWVSEKQWYDHGSNSCSAPEGSSCGHYTQVVWRDSTAIGCARVVC  144

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
                G F+TCNYSPPGN++GQSPY
Sbjct  145  DGDLGVFITCNYSPPGNFVGQSPY  168



>gb|EMT11012.1| Pathogenesis-related protein PRMS [Aegilops tauschii]
Length=166

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENI  302
            AQNS QD++D HNAARA VGV P+TWD+ V AYAQ+YA QR GDC LIH+   + YGEN+
Sbjct  23   AQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENL  82

Query  303  AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
              GG     TA  AV  WV+E+QYYDH +NSC+AP G+SCGHYTQVVWR+S  +GCARV 
Sbjct  83   FGGGG-TQWTAADAVSSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVV  141

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C +G G F+ C+Y+PPGNY+GQSPY
Sbjct  142  CDSGDGVFIICSYNPPGNYVGQSPY  166



>sp|Q41359.1|PR1_SAMNI RecName: Full=Pathogenesis-related protein PR-1 type; Flags: 
Precursor [Sambucus nigra]
 emb|CAA87071.1| pathogenesis-related protein, PR-1 type [Sambucus nigra]
Length=167

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QDY+DAHNAAR+AV V P+TWDE V A+A+ YA  R+GDC L+HSG  +YGEN+A
Sbjct  28   AQNSPQDYVDAHNAARSAVNVGPVTWDESVAAFARQYAQSRAGDCRLVHSGDPRYGENLA  87

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G     LT ++AVDMWVAE+  Y+  TN+C   PG+ CGHYTQVVWRNS+++GCARV+C
Sbjct  88   FGSGF-ELTGRNAVDMWVAERNDYNPNTNTC--APGKVCGHYTQVVWRNSVRIGCARVRC  144

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            +NGA +F+TCNYSPPGNY GQ PY
Sbjct  145  NNGA-WFITCNYSPPGNYAGQRPY  167



>ref|NP_001058816.1| Os07g0129300 [Oryza sativa Japonica Group]
 gb|AAM45439.1|AF306651_1 pathogenesis-related protein 1 [Oryza sativa]
 dbj|BAC84723.1| pathogenesis-related protein 1 [Oryza sativa Japonica Group]
 dbj|BAF20730.1| Os07g0129300 [Oryza sativa Japonica Group]
Length=165

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENIA  305
            QNS QDY+DAHNAAR+ VGV P++WD+ V AYA+SYA+QR GDC+L HS S  +YGENI 
Sbjct  22   QNSAQDYVDAHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGGKYGENIF  81

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G      TA SAV  WVAE+Q+YDH +NSC+AP G SCGHYTQVVW NS  +GCARV C
Sbjct  82   WGSAGGDWTAASAVSSWVAEKQWYDHDSNSCSAPAGSSCGHYTQVVWSNSTAIGCARVVC  141

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
             N  G F+TCNYSPPGN  G+SPY
Sbjct  142  DNSLGVFITCNYSPPGNVDGESPY  165



>ref|XP_002522071.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40271.1| STS14 protein precursor, putative [Ricinus communis]
Length=164

 Score =   194 bits (494),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 126/169 (75%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLW-CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MG LKIS + ++ ++ L + +  C AQNSQQDYLDAHNAARA VGV  I WD  V  YAQ
Sbjct  1    MGSLKISQVLVSLLMGLALVVHPCHAQNSQQDYLDAHNAARAQVGVANIVWDNTVATYAQ  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+ R GDC+L+HS S  YGEN+A  G  +SLT  +AV++WVAE+ YY++ +NSC    
Sbjct  61   NYANSRIGDCNLVHS-SGSYGENLAK-GSSSSLTGTAAVNLWVAEKPYYNYTSNSCTG--  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ C HYTQVVW  S+++GCARVQC+NG  +FVTCNY PPGNYIGQ PY
Sbjct  117  GQQCLHYTQVVWSKSVRLGCARVQCTNG-WWFVTCNYDPPGNYIGQKPY  164



>gb|ADN43419.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C+L L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  160



>ref|XP_006486822.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MGF K SSL L CIL L + L   AQ+S QDY++AHNAARA VGV P+TWD++V +YAQ+
Sbjct  1    MGFSKNSSLPLFCILGLALILSSHAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGEN+A       L+   AV MWV E+  YD+ +N+C    G
Sbjct  61   YANQRKGDCNLVHSGG-PYGENLAW--SSAGLSGTDAVKMWVNEKADYDYNSNTC--AEG  115

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GCA+V C+N  G F+ CNY PPGN++G+ PY
Sbjct  116  KVCGHYTQVVWRNSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>gb|ADN43416.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   194 bits (492),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C+L L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CVLGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+F+TCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFITCNYDPPGNYVGQRPY  160



>gb|ADN43438.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 121/168 (72%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY+DAHNAARA VGV  ITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGLALAHTCRAQNSAQDYVDAHNAARARVGVGSITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HSG  +YGEN A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YANQRISDCNLVHSGG-RYGENPAKGSP--SLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCAR QC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARAQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>ref|XP_002273788.2| PREDICTED: pathogenesis-related protein 1 [Vitis vinifera]
Length=197

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 129/182 (71%), Gaps = 10/182 (5%)
 Frame = +3

Query  18   IISNSII--QRRKKMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQ  191
            ++ NS+   QR +KMG  + S L L C + L +   C AQNS QDYL+AHN ARA VGV 
Sbjct  24   VLINSLTSHQRNQKMGLCR-SPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVG  82

Query  192  PITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQ  371
            P++WD  V AYAQ+YA+QR GDC+L+HSG   YGEN+A G    SLT   AV++WV E+ 
Sbjct  83   PMSWDNTVAAYAQNYANQRIGDCNLVHSGG-PYGENLAWGSP--SLTGTDAVNLWVGEKS  139

Query  372  YYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQS  551
             YD+ +NSC    G  CGHYTQVVW  S+++GCARVQC+NG G+FVTCNY P GNYIGQ 
Sbjct  140  NYDYNSNSC---VGGQCGHYTQVVWSKSVRLGCARVQCNNG-GWFVTCNYDPRGNYIGQR  195

Query  552  PY  557
            PY
Sbjct  196  PY  197



>gb|ADN43417.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   193 bits (490),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 126/168 (75%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C++ L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+++NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYSSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+F+TCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFITCNYDPPGNYVGQRPY  160



>gb|ADN43428.1| pathogenesis-related protein 1 [Vitis shuttleworthii]
Length=160

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C++ L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CLVGLSLVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  160



>ref|XP_002273416.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 gb|ADN43420.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43421.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43422.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43423.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43424.1| pathogenesis-related protein 1 [Vitis vinifera]
 gb|ADN43425.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=160

 Score =   192 bits (488),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C++ L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  160



>gb|ADN43431.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++   +   C AQNS QDY+D HNAARA VGV PITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGENIA G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENIAWG--SPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVV RNS+++GCARVQC NG G+FVTCNY P GNY+GQ PY
Sbjct  115  GECGHYTQVVRRNSVRLGCARVQCDNG-GWFVTCNYDPLGNYVGQRPY  161



>gb|AEH25622.1| pathogenesis-related protein 1-7 [Triticum aestivum]
 gb|AHE81250.1| pathogenesis-related protein 1-7 [Triticum aestivum]
 gb|AHE81271.1| pathogenesis-related protein 1-7 [Triticum aestivum]
Length=165

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 119/166 (72%), Gaps = 2/166 (1%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYAS  242
            ++ S+  +  ++ L   +   AQNS+QD++DAHNAARA VG+  +TWD  V A+AQ YA 
Sbjct  1    MEYSTKLVVLLVALMSAMAVTAQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYAD  60

Query  243  QRSGDCSLIHS-GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            QR GDC LIH+   + YGEN+  GG     TA  AV+ WV+E+QYYDH +N+C+AP GES
Sbjct  61   QRRGDCQLIHTPDGRPYGENLYGGGG-TEWTATDAVNSWVSEKQYYDHDSNTCSAPEGES  119

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CGHYTQVVWR+S  +GCARV C +G G F+ C+Y+PPGN+ G SPY
Sbjct  120  CGHYTQVVWRDSTAIGCARVVCDSGDGVFIICSYNPPGNFPGVSPY  165



>gb|ABK94784.1| unknown [Populus trichocarpa]
 gb|ABK96093.1| unknown [Populus trichocarpa]
Length=161

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +3

Query  66   KISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQ  245
            KIS  F   ++ L + L   AQ++ QDYLDAHNAARAAVGV P+TWD  V+AYAQ+YA+Q
Sbjct  5    KISLAFFT-LITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQ  63

Query  246  RSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCG  425
            R+GDC+L+HSG   YGENIA    +  L+   AV MWV E+ YYD+ +NSC A  G+ CG
Sbjct  64   RAGDCNLVHSGG-PYGENIAWSSAD--LSGTDAVKMWVDEKAYYDYNSNSCAA--GQQCG  118

Query  426  HYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            HYTQVVWRNS ++GCA+V+CS G G F+ CNY PPGNY+GQ PY
Sbjct  119  HYTQVVWRNSARLGCAKVKCSTG-GTFIGCNYDPPGNYVGQKPY  161



>gb|ADN43418.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43426.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 125/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS +F+ C++ L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGLFKISLVFI-CLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+F+TCNY PPGNY+GQ PY
Sbjct  114  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFITCNYDPPGNYVGQRPY  160



>ref|XP_010943450.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Elaeis 
guineensis]
Length=166

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 121/170 (71%), Gaps = 6/170 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   + S F  C + L M     AQNS  D+++AHNAAR AVGV P++WD  V +YA+ 
Sbjct  1    MGSSSLISFF--CTMALVMAHATLAQNSPDDFVNAHNAAREAVGVGPVSWDTTVASYAED  58

Query  234  YASQRSGDCSLIHS--GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            YA+QR GDC LIHS   S  YGEN+  GG  +  TAK+AVD+WV EQQYYD+ +NSC+AP
Sbjct  59   YANQRKGDCQLIHSDASSHGYGENLFWGGGPDH-TAKNAVDLWVGEQQYYDYGSNSCSAP  117

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+SCGHYTQVVW++S  +GCARVQC +G   F+TCNYSP GN  GQ PY
Sbjct  118  QGQSCGHYTQVVWKDSTSIGCARVQCDSG-DTFITCNYSPAGNIDGQRPY  166



>ref|XP_006379156.1| pathogenesis-related family protein [Populus trichocarpa]
 gb|ERP56953.1| pathogenesis-related family protein [Populus trichocarpa]
Length=161

 Score =   192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +3

Query  66   KISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQ  245
            KIS  F   ++ L + L   AQ++ QDYLDAHNAARAAVGV P+TWD  V+AYAQ+YA+Q
Sbjct  5    KISLAFFT-LITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQ  63

Query  246  RSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCG  425
            R+GDC+LIHSG   YGEN+A    +  L+   AV MWV E+ YYD+ +NSC A  G+ CG
Sbjct  64   RAGDCNLIHSGG-PYGENLAWSSAD--LSGTDAVKMWVDEKAYYDYNSNSCAA--GQQCG  118

Query  426  HYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            HYTQVVWRNS ++GCA+V+CS G G F+ CNY PPGNY+GQ PY
Sbjct  119  HYTQVVWRNSARLGCAKVKCSTG-GTFIGCNYDPPGNYVGQKPY  161



>ref|XP_007148303.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
 gb|ESW20297.1| hypothetical protein PHAVU_006G197100g [Phaseolus vulgaris]
Length=166

 Score =   191 bits (485),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 128/171 (75%), Gaps = 8/171 (5%)
 Frame = +3

Query  51   KMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            KMG  K+S   L+ + ++ +G    AQ+S  DY++ HNAAR+ VGV  I WD  V ++AQ
Sbjct  2    KMGLCKLSFFALSVLGLVIVGDVVYAQDSIADYVNEHNAARSQVGVPNIVWDNTVASFAQ  61

Query  231  SYASQRSGDCSLIHS-GSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNA  404
            +YA+QR GDC+LIHS G  +YGEN+A + GD   L+ K AV +WV E+QYYD+ +NSC A
Sbjct  62   NYANQRQGDCNLIHSGGGGKYGENLAKSSGD---LSGKDAVKLWVDEKQYYDYNSNSCAA  118

Query  405  PPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              G+ CGHYTQVVWRNS++VGCA+V+CSNG G F+TCNYSPPGNY+GQ PY
Sbjct  119  --GQQCGHYTQVVWRNSVRVGCAKVRCSNG-GTFITCNYSPPGNYVGQKPY  166



>ref|XP_002459696.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
 gb|EER96217.1| hypothetical protein SORBIDRAFT_02g008970 [Sorghum bicolor]
Length=169

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQN+ QD+++ HN+ RA VGV  +TW+  V AYAQSYA+QR+GDC L+HSG   YGEN+ 
Sbjct  27   AQNTAQDFVNLHNSPRADVGVGSVTWNTTVAAYAQSYANQRAGDCRLVHSGGP-YGENLF  85

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G    +  A  AV  WVAE+QYYDHATN+C+AP G+SCGHYTQVVWR S  +GCARV C
Sbjct  86   WGSAGYAWAASDAVGSWVAEKQYYDHATNTCSAPSGQSCGHYTQVVWRASTAIGCARVVC  145

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            SN AG F+ CNY PPGN IGQSPY
Sbjct  146  SNNAGVFIVCNYYPPGNVIGQSPY  169



>ref|XP_010691525.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score =   191 bits (485),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 7/161 (4%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
             F A + +  M   C AQNS QDY++AHNAARAAVGV  I WD+QV A+AQ YA+QR  D
Sbjct  13   FFFATLALFHM---CHAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKAD  69

Query  258  CSLIHS-GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            C+L HS G  +YGENIAAG     LT  SAV +WV E+ +Y++ +N+C    G+ CGHYT
Sbjct  70   CALRHSGGGGRYGENIAAGPAGVFLTGASAVKLWVDEKAFYNYNSNTC--ASGKVCGHYT  127

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWRNS ++GCARVQC+NG G FVTCNYSPPGNY GQ PY
Sbjct  128  QVVWRNSNRLGCARVQCNNG-GIFVTCNYSPPGNYNGQKPY  167



>gb|KDP37611.1| hypothetical protein JCGZ_06954 [Jatropha curcas]
Length=163

 Score =   191 bits (484),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 125/169 (74%), Gaps = 7/169 (4%)
 Frame = +3

Query  51   KMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            K+ F K S   L  ++ L + L   +Q+ QQDYLDAHN AR AVGV P++WD+ V AYAQ
Sbjct  2    KLSF-KNSLFPLFALINLALILPIQSQDQQQDYLDAHNQARTAVGVGPLSWDDTVAAYAQ  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+QR+GDC+L+HSG   YGEN+A    E  L+   AV MWV E+ YYD+ +NSC+  P
Sbjct  61   NYANQRAGDCNLVHSGG-PYGENLAWSSAE--LSGTDAVKMWVDEKAYYDYDSNSCS--P  115

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ CGHYTQVVW +S++VGCA+V+CSNG G F+TCNY PPGNY+GQ PY
Sbjct  116  GQMCGHYTQVVWSSSVRVGCAKVRCSNG-GTFITCNYDPPGNYVGQKPY  163



>ref|XP_010691524.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score =   191 bits (484),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 118/161 (73%), Gaps = 8/161 (5%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
             F A + +  M   C AQNS QDY++AHNAARAAVGV  I WD+QV A+AQ YA+QR  D
Sbjct  13   FFFATLALFHM---CHAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFAQQYANQRKAD  69

Query  258  CSLIHS-GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            C+L HS G  +YGENIA      S+T  +AV +WV E+ +Y++ TN+C    G+ CGHYT
Sbjct  70   CALRHSGGGGRYGENIAVSSGS-SMTGTAAVKLWVDEKAFYNYNTNTC--ASGKVCGHYT  126

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWRNS ++GCARVQC+NG G FVTCNYSPPGNYIGQ PY
Sbjct  127  QVVWRNSNRLGCARVQCNNG-GVFVTCNYSPPGNYIGQKPY  166



>dbj|BAF95881.1| putative pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=160

 Score =   190 bits (483),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 121/168 (72%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  + S L L C + L +   C AQNS QDYL+AHN ARA VGV P++WD  V AYAQ+
Sbjct  1    MGLCR-SPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGEN+A G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHSGG-PYGENLAWG--SPSLTGTDAVNMWVGEKSNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCAR+QC+ G G+FVTCNY P GNYIGQ PY
Sbjct  114  GQCGHYTQVVWRNSVRLGCARIQCNKG-GWFVTCNYDPRGNYIGQRPY  160



>gb|AGK89727.1| pathogenesis-related 1 protein [Coffea canephora]
Length=162

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 6/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS L L   ++L +      QNSQQDY+DAHNAARA VGV PI WD+ V AYAQ+
Sbjct  1    MGSPKIS-LALFSFILLAIFWPSRTQNSQQDYVDAHNAARAQVGVGPIAWDDTVAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L HS  + YGEN+A GG +   T + AV++WV+E+QYYD+ +N+C    G
Sbjct  60   YANQRINDCNLEHSDGR-YGENLAEGGGD--FTGRDAVNLWVSEKQYYDYNSNTC--AQG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GCARVQC+N   +FV C+Y PPGNY GQ PY
Sbjct  115  QQCGHYTQVVWRNSVRLGCARVQCTNNGWWFVICSYDPPGNYDGQRPY  162



>gb|AAZ94265.1| pathogenesis-related 1a [Triticum monococcum]
Length=167

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QD++D HNAARA VGV P+TWD+ V AYAQ+YA QR GDC L+HSG Q YGENI 
Sbjct  24   AQNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGGQ-YGENIY  82

Query  306  AG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             G G     TA  AV  WV+E+QYYDH +NSC+AP  +SC HYTQVVWR+S  +GCARV 
Sbjct  83   GGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQVVWRDSTAIGCARVV  142

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C  G G F+ C+Y+PPGNY GQSPY
Sbjct  143  CDGGDGLFIICSYNPPGNYNGQSPY  167



>gb|ADN43427.1| pathogenesis-related protein 1 [Vitis vinifera]
Length=159

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MGF KIS +F+ C++ L +     AQNSQQDYL+AHN ARA VGV  +TW+  V +YAQ+
Sbjct  1    MGF-KISLVFI-CLVGLALVHTSCAQNSQQDYLNAHNTARAQVGVGSMTWNNTVASYAQN  58

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS +  YGENIA G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  59   YANQRIGDCNLVHS-NGPYGENIAWG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  113  GKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  159



>gb|ADN43429.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 123/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  +L L +   C AQNS QDY+DAHNAARA VGV  ITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLLGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HSG   YGEN+A G    SLT   AV++WV E+ YYD+ +NSC    G
Sbjct  61   YANQRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKSYYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECGHYTQVVWRNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>gb|KDP37603.1| hypothetical protein JCGZ_06946 [Jatropha curcas]
Length=157

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 115/144 (80%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            +Q+ QQDYLDAHN ARAAVGV P++WD+ V AYAQ+YASQR+GDC+L+HSG   YGEN+A
Sbjct  20   SQDQQQDYLDAHNQARAAVGVGPLSWDDTVAAYAQNYASQRAGDCNLVHSGG-PYGENLA  78

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
                E  L+   AV MWV E+ YYD+ +NSC+  PG+ CGHYTQVVW +S++VGCA+V+C
Sbjct  79   WSSAE--LSGTDAVKMWVDEKAYYDYDSNSCS--PGQMCGHYTQVVWSSSVRVGCAKVRC  134

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            SNG G FVTCNY PPGNY+GQ PY
Sbjct  135  SNG-GTFVTCNYDPPGNYVGQKPY  157



>ref|XP_006486820.1| PREDICTED: pathogenesis-related protein 1-like [Citrus sinensis]
Length=163

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MGF K SSL L CIL L + L   AQ+S QDY++AHNAARA VGV P+TWD++V +YAQ+
Sbjct  1    MGFSKNSSLPLFCILGLALILSSHAQDSPQDYVNAHNAARAQVGVGPVTWDDRVASYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGEN+A       L+   AV +WV E+  Y + +N+C A  G
Sbjct  61   YANQRKGDCNLVHSGG-PYGENLAW--SSAGLSGTDAVKLWVNEKADYHYNSNTCAA--G  115

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR S+++GCA+V C+N  G F+ CNY PPGN++G+ PY
Sbjct  116  KVCGHYTQVVWRKSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>ref|XP_002274275.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
Length=161

 Score =   189 bits (480),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 121/168 (72%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY++AHN ARA VGV  +TWD+ V  YAQ+
Sbjct  1    MGLCKISLPLLVGLMGLALAHTCYAQNSPQDYVNAHNTARAQVGVGSMTWDDTVATYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGEN+A G    SLT   AV+MWVAE+ YYD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHSGG-PYGENLAWG--SPSLTGTDAVNMWVAEKPYYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVW NS+++GCARVQC++G G+FVTCNY PPGNY GQ PY
Sbjct  115  GECRHYTQVVWSNSVRLGCARVQCNSG-GWFVTCNYDPPGNYQGQHPY  161



>ref|XP_007041421.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Theobroma cacao]
 gb|EOX97252.1| CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 
1 protein) superfamily protein [Theobroma cacao]
Length=159

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 118/162 (73%), Gaps = 6/162 (4%)
 Frame = +3

Query  72   SSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
            S L LAC++++   L   A+  +Q++LDA N ARA V V+P+ WD QV AYAQ YA+QR 
Sbjct  4    SKLALACLIIVSFALPSLAKTLKQEFLDAQNEARAEVNVEPMAWDAQVAAYAQEYANQRI  63

Query  252  GDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
             DC L+HSG   YGENIA G D+  L+   AV MWV E+ YYDH +N+C +  G+ C HY
Sbjct  64   ADCDLVHSGG-PYGENIAWGSDD--LSVADAVKMWVDEKVYYDHGSNTCAS--GQVCAHY  118

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWRNS+++GCA+V+C NG G F+TCNY PPGNYIG++PY
Sbjct  119  TQVVWRNSVRLGCAKVRCDNG-GTFITCNYDPPGNYIGETPY  159



>gb|AHA56682.1| pathogenesis related protein [Camellia sinensis]
Length=162

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 116/161 (72%), Gaps = 5/161 (3%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL L C++ L +     AQNSQQDYL+AHNAARA VGV P+TWD  V AYAQ YAS R G
Sbjct  7    SLALVCLMSLVLVHPSYAQNSQQDYLNAHNAARAQVGVGPMTWDNNVAAYAQRYASSRMG  66

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC+L+HSG   YGEN+A G    S T  + V++WV E+ YYD+ +NSC     + C HYT
Sbjct  67   DCNLVHSGG-PYGENLAEG--NGSFTGTAGVNLWVGEKPYYDYNSNSCVGR--KECRHYT  121

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWRNS+++GCARVQC+N   +FV C+Y PPGNYIGQ PY
Sbjct  122  QVVWRNSVRLGCARVQCTNNGWWFVICSYDPPGNYIGQRPY  162



>gb|AEH25624.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 2/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENIA  305
            QNS QD++D HNAARA VGV P+TWD+ V AYAQ+YA QR GDC LIH+   + YGEN+ 
Sbjct  24   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  83

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             GG     TA  AV+ WV+E+QYYDH +NSC+AP G+SCGHYTQVVWR+S  +GCARV C
Sbjct  84   -GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVC  142

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
             +    F+ C+Y+PPGNY+GQSPY
Sbjct  143  DSSDDVFIICSYNPPGNYVGQSPY  166



>ref|XP_006422714.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
 gb|ESR35954.1| hypothetical protein CICLE_v10029431mg [Citrus clementina]
Length=163

 Score =   189 bits (479),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MGF K SSL L CIL L + L   AQ+  QDY++AHNAARA VGV P+TWD++V +YAQ+
Sbjct  1    MGFSKNSSLPLFCILGLALILSSHAQDLPQDYVNAHNAARAQVGVGPVTWDDRVASYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R GDC+L+HSG   YGEN+A       L+   AV +WV E+  YD+ +N+C A  G
Sbjct  61   YANKRKGDCNLVHSGG-PYGENLAW--SSAGLSGTDAVKLWVNEKADYDYNSNTCAA--G  115

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR S+++GCA+V C+N  G F+ CNY PPGN++G+ PY
Sbjct  116  KVCGHYTQVVWRKSVRIGCAKVTCNNNKGTFIGCNYDPPGNFVGEKPY  163



>ref|XP_011092473.1| PREDICTED: pathogenesis-related leaf protein 6-like [Sesamum 
indicum]
Length=162

 Score =   188 bits (478),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 122/165 (74%), Gaps = 7/165 (4%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYAS  242
            + ++  F A   +L+    C AQNS QDY+ AHNAARA VGV PI WDE+V A+A++Y +
Sbjct  5    ILVALFFFAIATILQYSS-CHAQNSPQDYVSAHNAARAQVGVGPIAWDEKVAAFARNYVN  63

Query  243  QRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESC  422
            QR GDC+L+HS ++ YGEN+A G  E   T ++AV++WV E+ +YD+++NSC    G  C
Sbjct  64   QRIGDCNLVHSTNRPYGENLAKGSGE--FTGRAAVELWVREKPFYDYSSNSC---VGGEC  118

Query  423  GHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             HYTQVVWRNS++VGCAR +C+NG  +F++CNY PPGNYIGQ PY
Sbjct  119  LHYTQVVWRNSVRVGCARARCNNG-WWFISCNYDPPGNYIGQRPY  162



>gb|AHE81273.1| pathogenesis-related protein 1-9, partial [Triticum aestivum]
Length=162

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 2/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENIA  305
            QNS QD++D HNAARA VGV P+TWD+ V AYAQ+YA QR GDC LIH+   + YGEN+ 
Sbjct  20   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  79

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             GG     TA  AV+ WV+E+QYYDH +NSC+AP G+SCGHYTQVVWR+S  +GCARV C
Sbjct  80   -GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVC  138

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
             +    F+ C+Y+PPGNY+GQSPY
Sbjct  139  DSSDDVFIICSYNPPGNYVGQSPY  162



>gb|AHE81252.1| pathogenesis-related protein 1-9 [Triticum aestivum]
Length=166

 Score =   188 bits (478),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 2/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENIA  305
            QNS QD++D HNAARA VGV P+TWD+ V AYAQ+YA QR GDC LIH+   + YGEN+ 
Sbjct  24   QNSPQDFVDPHNAARADVGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  83

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             GG     TA  AV+ WV+E+QYYDH +NSC+AP G+SCGHYTQVVWR+S  +GCARV C
Sbjct  84   -GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVC  142

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
             +    F+ C+Y+PPGNY+GQSPY
Sbjct  143  DSSDDVFIICSYNPPGNYVGQSPY  166



>gb|AEM36335.1| pathogenesis-related protein [Vitis quinquangularis]
Length=160

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 118/168 (70%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  + S L L C + L +   C AQNS QDYL+AHN ARA VGV P++WD  V AYAQ+
Sbjct  1    MGLCR-SPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA QR GDC+L+HSG   YGEN+A G    SLT   AV++WV E+  YDH +NSC    G
Sbjct  60   YAKQRIGDCNLVHSGG-PYGENLARG--SPSLTGTDAVNLWVGEKSNYDHNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVW  S+ +GCARVQC+NG G+FVTCNY P GN +GQSPY
Sbjct  114  GQCGHYTQVVWSKSVHLGCARVQCNNG-GWFVTCNYDPRGNIVGQSPY  160



>ref|XP_004230669.1| PREDICTED: pathogenesis-related leaf protein 6 [Solanum lycopersicum]
Length=164

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 123/170 (72%), Gaps = 8/170 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGL--WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            M   K SS  L C ++L   L  +CDAQNSQ DYL+ HN+AR+ VGV  ITW+  +E YA
Sbjct  1    MALFK-SSNVLICFIILAFVLPYYCDAQNSQTDYLNTHNSARSQVGVGAITWNTTLENYA  59

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            Q+YA+QR  DC+L+HS    YGENIA G     +T  +AV++WV E+ YYD+ +NSC   
Sbjct  60   QNYANQRISDCNLVHSNG-PYGENIAKGSGS-FMTGTAAVNLWVGEKPYYDYNSNSCTG-  116

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ C HYTQVVW+NS+++GCARVQC+NG  +FVTCNY+PPGNYIGQ PY
Sbjct  117  -GKECRHYTQVVWKNSIQLGCARVQCTNGW-WFVTCNYNPPGNYIGQRPY  164



>ref|XP_010527028.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Tarenaya 
hassleriana]
Length=164

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 119/169 (70%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M F K S   +  +L L M     AQ+S QDY++AHN ARA VGV P++WD  V A+AQ+
Sbjct  1    MIFPKFSGTLIMALLALVMAQTLQAQDSPQDYVNAHNRARAEVGVGPVSWDNTVAAFAQN  60

Query  234  YASQRSGDCSLIHS-GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA QR+GDC LIHS G  +YGEN+A       LT   AV +WV E+  YD+ +N+C   P
Sbjct  61   YARQRAGDCRLIHSGGGGRYGENLAM--STGGLTGVDAVALWVNEKVDYDYNSNTCR--P  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ CGHYTQVVWRN++++GCA+V+C++G G F+TCNY PPGNY+GQ PY
Sbjct  117  GKVCGHYTQVVWRNTVRIGCAKVRCNSG-GTFITCNYDPPGNYVGQKPY  164



>ref|XP_010691522.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
 emb|CAP66260.1| pathogenesis-related protein 1a [Beta vulgaris]
Length=168

 Score =   187 bits (476),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 119/162 (73%), Gaps = 8/162 (5%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
             F A + + +M   C AQNS QDY++AHN ARAAVGV  I WD+QV A+AQ YA QR GD
Sbjct  13   FFFATLALAQM---CHAQNSPQDYVNAHNDARAAVGVGNIQWDDQVAAFAQQYADQRKGD  69

Query  258  CSLIHSGSQ-QYGENIAAG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            C L HSG   +YGEN+A G G    LTA +AV MWVAE+  YD+ +N+C +  G+ CGHY
Sbjct  70   CVLQHSGGGGRYGENLAGGSGPGLVLTATTAVQMWVAEKADYDYNSNTCAS--GKVCGHY  127

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWR+S+++GCARVQC NG G FVTCNY PPGN++GQ PY
Sbjct  128  TQVVWRDSVRLGCARVQCDNG-GIFVTCNYDPPGNFVGQKPY  168



>gb|AEH25634.1| pathogenesis-related protein 1-19 [Triticum aestivum]
 gb|AHE81262.1| pathogenesis-related protein 1-19 [Triticum aestivum]
 gb|AHE81283.1| pathogenesis-related protein 1-19 [Triticum aestivum]
Length=167

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 107/145 (74%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QD++D HNAARA VGV P+TWD+ V AYAQ YA QR GDC L+HSG Q YGENI 
Sbjct  24   AQNSPQDFVDPHNAARANVGVGPVTWDDNVAAYAQKYAEQRRGDCQLVHSGGQ-YGENIY  82

Query  306  AG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             G G     TA  AV  WV+E+QYYDH +NSC+AP  +SC HYTQVVWR+S  +GCARV 
Sbjct  83   GGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQVVWRDSTAIGCARVV  142

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C  G G F+ C+Y+PPGNY G SPY
Sbjct  143  CDGGDGLFIICSYNPPGNYEGVSPY  167



>ref|XP_008651988.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Zea mays]
 tpg|DAA59477.1| TPA: hypothetical protein ZEAMMB73_881711 [Zea mays]
Length=167

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 117/170 (69%), Gaps = 5/170 (3%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M +     + LA  L +     C AQNS QD+++ HNAARAAVGV P++WDE V A+A+S
Sbjct  1    MEYSSTRVVCLALALAMVAVTPCAAQNSPQDFVNPHNAARAAVGVGPVSWDENVAAFARS  60

Query  234  YASQRSGDCSLIHSGS--QQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            YA+QR GDC L+HSG     YGENI  GG   +  A  AV +WV E+Q YD+ +NSC A 
Sbjct  61   YAAQRQGDCKLVHSGGGPNHYGENIFWGGGS-AWKASDAVGLWVGEKQNYDYNSNSCAA-  118

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ CGHYTQVVWR S  +GCARV C+NG G F+TCNY+PPGN+ GQ PY
Sbjct  119  -GKVCGHYTQVVWRKSTAIGCARVVCNNGGGVFITCNYNPPGNFRGQRPY  167



>emb|CAN77102.1| hypothetical protein VITISV_021166 [Vitis vinifera]
 emb|CBI25100.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 120/168 (71%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  + S L L C + L +   C AQNS QDYL+AHN ARA VGV P++WD  V AYAQ+
Sbjct  1    MGLCR-SPLALLCFMGLALAHICCAQNSPQDYLNAHNTARAQVGVGPMSWDNTVAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANQRIGDCNLVHSGG-PYGENLAWG--SPSLTGTDAVNLWVGEKSNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVW  S+++GCARVQC+NG G+FVTCNY P GNYIGQ PY
Sbjct  114  GQCGHYTQVVWSKSVRLGCARVQCNNG-GWFVTCNYDPRGNYIGQRPY  160



>gb|AHE81280.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QD++D HNAARA +GV P+TWD+ V AYAQ+YA QR GDC L+HSG Q YGENI 
Sbjct  24   AQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGGQ-YGENIY  82

Query  306  AG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             G G     TA  AV  WV+E+QYYDH +NSC+AP  +SC HYTQVVWR+S  +GCARV 
Sbjct  83   GGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQVVWRDSTAIGCARVV  142

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C  G G F+ C+Y+PPGNY G SPY
Sbjct  143  CDGGDGLFIICSYNPPGNYEGVSPY  167



>gb|AHE81259.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QD++D HNAARA +GV P+TWD+ V AYAQ+YA QR GDC L+HSG Q YGENI 
Sbjct  24   AQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGGQ-YGENIY  82

Query  306  AG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             G G     TA  AV  WV+E+QYYDH +NSC+AP  +SC HYTQVVWR+S  +GCARV 
Sbjct  83   GGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQVVWRDSTAIGCARVV  142

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C  G G F+ C+Y+PPGNY G SPY
Sbjct  143  CDGGDGLFIICSYNPPGNYEGVSPY  167



>gb|AEH25631.1| pathogenesis-related protein 1-16 [Triticum aestivum]
Length=167

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QD++D HNAARA +GV P+TWD+ V AYAQ+YA QR GDC L+HSG Q YGENI 
Sbjct  24   AQNSPQDFVDPHNAARADMGVGPVTWDDNVAAYAQNYAEQRRGDCQLVHSGGQ-YGENIY  82

Query  306  AG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             G G     TA  AV  WV+E+QYYDH +NSC+AP  +SC HYTQVVWR+S  +GCARV 
Sbjct  83   GGRGGGADWTAADAVQAWVSEKQYYDHGSNSCSAPADKSCLHYTQVVWRDSTAIGCARVV  142

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C  G G F+ C+Y+PPGNY G SPY
Sbjct  143  CDGGDGLFIICSYNPPGNYEGVSPY  167



>gb|EMS62872.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=166

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 109/144 (76%), Gaps = 2/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENIA  305
            QNS QD++D HNAARA  GV P+TWD+ V AYAQ+YA QR GDC LIH+   + YGEN+ 
Sbjct  24   QNSPQDFVDPHNAARADAGVGPVTWDDNVAAYAQNYAEQRRGDCQLIHTPDGRPYGENLF  83

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             GG     TA  AV+ WV+E+QYYDH +NSC+AP G+SCGHYTQVVWR+S  +GCARV C
Sbjct  84   -GGSGTQWTAADAVNSWVSEKQYYDHGSNSCSAPEGDSCGHYTQVVWRDSTAIGCARVVC  142

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
             +    F+ C+Y+PPGNY+GQSPY
Sbjct  143  DSSDDVFIICSYNPPGNYVGQSPY  166



>ref|XP_010270273.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nelumbo 
nucifera]
Length=167

 Score =   187 bits (474),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 123/170 (72%), Gaps = 11/170 (6%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            MG+ ++    LA +L++  GLW    AQNS QDYL+AHNAARA VGV P+ WD  V AYA
Sbjct  1    MGWCRLE---LALVLLISFGLWHVSQAQNSPQDYLNAHNAARAQVGVGPMRWDNNVAAYA  57

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            ++YA+QR  DC+L+HSG   YGEN+A G    + T   AV++WV E+ +YD+ +NSC   
Sbjct  58   RNYANQRIRDCNLVHSGGGLYGENLAKG--SGAFTGVDAVNLWVKEKPFYDYNSNSC---  112

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G  C HYTQVVWR+S+++GCARV+C+NG  +FVTCNY PPGN+IG+ PY
Sbjct  113  IGGQCLHYTQVVWRDSVRLGCARVRCNNGW-FFVTCNYDPPGNFIGERPY  161



>ref|XP_010941969.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 122/167 (73%), Gaps = 7/167 (4%)
 Frame = +3

Query  63   LKISSLF--LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            +K S+L   LAC + L M     AQNS QD++ AHNAARAAVGV P++WD  V AYAQ+Y
Sbjct  1    MKFSNLTFALACAMFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGPVSWDNTVAAYAQNY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A+QR GDC L+HSG   YGEN+  G      TA  AV++WV+E+Q+YD++TN+C A  G+
Sbjct  61   ANQRIGDCQLVHSGG-PYGENLFWGSGR-EYTAADAVNLWVSEKQWYDYSTNTCAA--GK  116

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVWR+S  +GCARV+C++GA  F+ CNY PPGN +GQ PY
Sbjct  117  VCGHYTQVVWRDSTHIGCARVKCNSGA-IFIICNYKPPGNIVGQRPY  162



>ref|XP_010245650.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=163

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 115/165 (70%), Gaps = 9/165 (5%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYAS  242
            L+ + LFL  + +    + C AQ+S +DYL AHN  R+ VGV P+TWD +V AYA +YAS
Sbjct  8    LEFAHLFLLVLTLFH--VLCHAQDSPEDYLHAHNIVRSEVGVGPLTWDSKVAAYAHNYAS  65

Query  243  QRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESC  422
            QR GDC L HS    YGENIA GGD        AV MW +E+QYYD+A+NSC    G  C
Sbjct  66   QRIGDCKLEHS-DGPYGENIAGGGD--PFPGVDAVKMWASEKQYYDYASNSC---IGGEC  119

Query  423  GHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            GHYTQVVWRNS+++GCA+V C+NG G F+ CNY PPGNYIG+ PY
Sbjct  120  GHYTQVVWRNSVRLGCAKVHCNNG-GIFIICNYDPPGNYIGERPY  163



>gb|ADN43430.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   186 bits (472),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS      ++   +   C AQNS QDY+D HNAARA VGV PITW++ V AYAQ+
Sbjct  1    MGLFKISLALXVGLMGFALAHTCCAQNSPQDYVDPHNAARAQVGVGPITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GD +L+HSG   YGENIA G    SLT   AV+MWV E+  YD+ +NSC    G
Sbjct  61   YANQRIGDRNLVHSGG-PYGENIAWG--SPSLTGTDAVNMWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVV RNS+++GCARVQC NG G+FVTCNY P GNY+GQ PY
Sbjct  115  GECGHYTQVVRRNSVRLGCARVQCDNG-GWFVTCNYDPLGNYVGQRPY  161



>ref|XP_002274105.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=176

 Score =   186 bits (472),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KISS  +   + L +     AQNS QD+LDAHN ARA VGV P++WD  V AYAQ+
Sbjct  1    MGLCKISSSLVVGFMGLVLAHISYAQNSPQDFLDAHNVARAEVGVGPMSWDNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            Y +QR GDC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YTNQRIGDCNLVHSGG-PYGENLAWGSP--SLTGIDAVNLWVGEKTNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQV+WRNSL++GCAR QC++G G+FVTCNY PPGNY+GQ P+
Sbjct  115  GECRHYTQVIWRNSLRLGCARAQCNSG-GWFVTCNYDPPGNYVGQRPF  161



>ref|XP_003631695.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN83925.1| hypothetical protein VITISV_002104 [Vitis vinifera]
 emb|CBI25102.3| unnamed protein product [Vitis vinifera]
Length=176

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KISS  +   + L +     AQNS QD+LDAHNAARA VGV+ +TW++ V AYAQ+
Sbjct  1    MGLCKISSSLVVGFMGLVLAHISYAQNSPQDFLDAHNAARAEVGVESMTWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC+L+HS S  YGENIA G    SLT   AV+MWV E+ YYD+ +NSC    G
Sbjct  61   YANQRIGDCNLVHS-SGPYGENIAWG--TPSLTGTDAVNMWVGEKPYYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C  Y +V+WRNSL +GCARVQC+ G G+FVTCNY PPGNY+GQ P+
Sbjct  115  GECLQYIKVIWRNSLHLGCARVQCNTG-GWFVTCNYDPPGNYVGQRPF  161



>gb|ADB54822.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=176

 Score =   186 bits (472),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KISS  +   + L +     AQNS QD+LDAHN  RA VGV P++WD  V AYAQ+
Sbjct  1    MGLCKISSSLVVGFMGLVLAHISYAQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            Y +QR GDC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YTNQRIGDCNLVHSGG-PYGENLAWGSP--SLTGIDAVNLWVGEKINYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQV+WRNSL++GCARVQC NG G+F+TCNY PPGNY+GQ P+
Sbjct  115  GECLHYTQVIWRNSLRLGCARVQCDNG-GWFITCNYDPPGNYMGQRPF  161



>gb|ADN43442.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   185 bits (470),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  +L L +   C AQNS QDY+DAHNAARA VGV  ITW++ V AYAQ+
Sbjct  1    MGLFKISLALLVGLLGLALAHTCCAQNSPQDYVDAHNAARAQVGVGSITWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HSG   YGEN+A G    SLT   AV++WV E+ YYD+ +NSC    G
Sbjct  61   YANQRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKPYYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CG YTQVVWRNS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECGLYTQVVWRNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>ref|XP_010691521.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=166

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 8/171 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            M   K  + F+ C  +  + L+  C AQNS QDY++AHNAARAAVGV  I WD+QV A+A
Sbjct  1    MNLTKNLASFI-CFFLATLALFHVCHAQNSPQDYVNAHNAARAAVGVGNIQWDDQVAAFA  59

Query  228  QSYASQRSGDCSLIHS-GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNA  404
            Q YA++R GDC+L HS G  +YGEN+AA    +SLT   +V +WV E+  Y++ +N+C  
Sbjct  60   QEYANERKGDCALRHSGGGGRYGENLAA-STGSSLTGTESVKLWVDEKVDYNYDSNNC--  116

Query  405  PPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              G+ CGHYTQVVWRNS+++GCARVQC NG G FVTCNY PPGNYIGQ PY
Sbjct  117  ASGKVCGHYTQVVWRNSVRLGCARVQCDNG-GVFVTCNYDPPGNYIGQKPY  166



>ref|XP_004955412.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Setaria 
italica]
Length=163

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNS QD++  HNAARAAVGV P++W++ V A+A+S+A++R+GDC L+HS    YGEN
Sbjct  22   CAAQNSPQDFVKLHNAARAAVGVGPVSWNDNVAAFARSWAAKRAGDCRLVHSRGSGYGEN  81

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            +  GG     +A  AV +WVAE+Q+YDH +NSC A  G+ CGHYTQVVWR S  +GCARV
Sbjct  82   L-FGGSGADWSASDAVGLWVAEKQWYDHGSNSCAA--GKVCGHYTQVVWRASTAIGCARV  138

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C+NG G F+TCNYSPPGNY GQSPY
Sbjct  139  VCNNG-GIFITCNYSPPGNYAGQSPY  163



>gb|AFK36478.1| unknown [Lotus japonicus]
Length=164

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MGF K++   + C+L L   +    Q+S+ DYL+AHNAAR+AV V  + WD+ V A+AQ+
Sbjct  1    MGFSKVTLSLIMCVLCLGHYV-VYGQDSRADYLNAHNAARSAVNVPNLVWDDTVAAFAQN  59

Query  234  YASQRSGDCSLIHSGSQ-QYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+QR GDC L+HSG   +YGEN+A G  +  L+   AV +WV E+  YD+ +NSC    
Sbjct  60   YANQRKGDCKLVHSGGGGRYGENLAWG--KPDLSGTGAVKLWVDEKANYDYNSNSC--AS  115

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ CGHYTQVVW+NS+++GCA+V+C NG G F+TCNY PPGNY+GQ PY
Sbjct  116  GKQCGHYTQVVWKNSMRLGCAKVKCDNGGGTFITCNYDPPGNYVGQKPY  164



>emb|CBI25093.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 122/172 (71%), Gaps = 13/172 (8%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGL--WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            MGF K    FL  I +    L  +  AQ+S QDY+DAHNAARA VGVQPITW+E V AYA
Sbjct  1    MGFHK----FLLAIYIFGSALAHFSLAQSSPQDYVDAHNAARAQVGVQPITWNETVAAYA  56

Query  228  QSYASQRSGD-CSLIHSGSQQYGENIAAG-GDENSLTAKSAVDMWVAEQQYYDHATNSCN  401
            + YAS R  + CS+ HSG   YGEN+A G G   SLT   AV++WV E+  YD+ +NSC 
Sbjct  57   RRYASSRVAEQCSMEHSGG-PYGENLAEGYGSIGSLTGTDAVNLWVGEKPNYDYNSNSC-  114

Query  402  APPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
               G  CGHYTQVVWRNS+++GCARVQC+NG G+FVTCNY PPGNY+GQ PY
Sbjct  115  --VGGKCGHYTQVVWRNSVRLGCARVQCNNG-GWFVTCNYDPPGNYVGQRPY  163



>ref|XP_006367096.1| PREDICTED: pathogenesis-related leaf protein 6-like [Solanum 
tuberosum]
Length=164

 Score =   185 bits (469),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 124/170 (73%), Gaps = 8/170 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGL-WCDAQNSQQDYLDAHNAARAAV-GVQPITWDEQVEAYA  227
            M   K S++ L C ++L   L +CDAQNSQ DYL+ HN+AR+ V GV  ITW+  +E YA
Sbjct  1    MALFKASNV-LICFIILAFVLPYCDAQNSQTDYLNTHNSARSQVTGVSAITWNTTLENYA  59

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            Q+YA+QR  DC+L+HS    YGENIA G     +T  +AV++WV E+ YYD+ +NSC   
Sbjct  60   QTYANQRISDCNLVHSNGP-YGENIAKGSGS-FMTGTAAVNLWVGEKPYYDYNSNSCTG-  116

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ C HYTQVVW+NS+++GCARVQC+NG  +FVTCNY+PPGNYIGQ PY
Sbjct  117  -GKECRHYTQVVWKNSIQLGCARVQCTNG-WWFVTCNYNPPGNYIGQRPY  164



>ref|XP_004246724.1| PREDICTED: pathogenesis-related leaf protein 4 [Solanum lycopersicum]
 emb|CAA04881.1| pathogenesis-related protein [Solanum lycopersicum]
Length=160

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 124/168 (74%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   +S L + C++VL +   CDAQNS QDYL+ HN ARA VGV P++WD  +E+ AQS
Sbjct  1    MGLFNMSLLLMTCLMVLAIFHSCDAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQS  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSGS   GEN+A GG +   T ++AV++WV+E+  Y++ TN C +  G
Sbjct  61   YANSRAGDCNLIHSGS---GENLAKGGGD--FTGRAAVELWVSEKPNYNYDTNECVS--G  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S+++GC R  C++G  +F++CNY P GN++GQ PY
Sbjct  114  KMCGHYTQVVWRDSVRLGCGRALCNDGW-WFISCNYDPVGNWVGQRPY  160



>ref|XP_009787159.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana sylvestris]
Length=179

 Score =   185 bits (469),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 121/166 (73%), Gaps = 7/166 (4%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCD-AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            +  S+  +AC +   +      AQNS QDYL+AHNAAR  VGV P+TWD +V A+AQ+YA
Sbjct  1    MGYSTTLVACFITFAILFPSSQAQNSPQDYLNAHNAARRRVGVGPMTWDNRVAAFAQNYA  60

Query  240  SQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            +QR+GDC + HSG   YGEN+AA   +  L A  AV MWV E+Q+YD+ +NSC A  G+ 
Sbjct  61   NQRAGDCRMQHSGG-PYGENLAAAFPQ--LNAAGAVKMWVDEKQFYDYNSNSCAA--GKV  115

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  116  CGHYTQVVWRNSVRLGCARVRCNNG-WYFITCNYDPPGNWRGQRPY  160



>ref|XP_002273546.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CAN74267.1| hypothetical protein VITISV_000653 [Vitis vinifera]
 emb|CBI25096.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  K     +  I +L +     AQNSQQDYLD HNAARA VGV+P+TWD+ V AYA+ 
Sbjct  1    MGLCKRELALICFIGILALVHPSHAQNSQQDYLDVHNAARADVGVEPMTWDDNVAAYARD  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YASQRSGDC+++HS    YGEN+A G  +   TA  A ++WV E+  YD+ +NSC    G
Sbjct  61   YASQRSGDCNMVHSNG-PYGENLAMGSGD--FTATDAANLWVGEKSNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+ +GCARVQC+NG  +FV+CNYSP GN IGQ PY
Sbjct  115  GECGHYTQVVWRNSVSLGCARVQCNNGW-WFVSCNYSPQGNIIGQHPY  161



>gb|AHW81904.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 119/169 (70%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  +IS   + CIL L +   C AQ + QD+LD HN ARA VGV P+TWD+ V AYA++
Sbjct  1    MGLSRISLALVICILGLGVIELCYAQTTPQDFLDPHNRARAKVGVGPMTWDDSVAAYARN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+QR GDC L+HSG   YGENIA + GD   L+A  AV MWVAE+  YD+ +N+C    
Sbjct  61   YANQRQGDCKLVHSGG-PYGENIAWSSGD---LSAAGAVGMWVAEKSLYDYYSNTCVGRN  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
               C HYTQVVWR S ++GCA+V+C++G G FV CNY+PPGNYIGQ PY
Sbjct  117  PMGCLHYTQVVWRKSTRLGCAKVRCNSG-GSFVICNYNPPGNYIGQRPY  164



>gb|AHA43767.1| pathogenesis related protein 1 isoform 4 [Morus alba var. multicaulis]
 gb|AHW81905.1| pathogenesis-related protein [Morus alba var. atropurpurea]
Length=171

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 119/169 (70%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  +IS   + CIL L +   C AQ + QD+LD HN ARA VGV P+TWD+ V AYA++
Sbjct  1    MGLSRISLALVICILGLGVIELCYAQTTPQDFLDPHNRARAKVGVGPMTWDDSVAAYARN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+QR GDC L+HSG   YGENIA + GD   L+A  AV MWVAE+  YD+ +N+C    
Sbjct  61   YANQRQGDCKLVHSGG-PYGENIAWSSGD---LSAAGAVGMWVAEKSLYDYYSNTCVGQN  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
               C HYTQVVWR S ++GCA+V+C++G G FV CNY+PPGNYIGQ PY
Sbjct  117  PMGCLHYTQVVWRKSTRLGCAKVRCNSG-GSFVICNYNPPGNYIGQRPY  164



>ref|XP_008652242.1| PREDICTED: pathogenesis-related protein 1-like [Zea mays]
 tpg|DAA60242.1| TPA: hypothetical protein ZEAMMB73_897468 [Zea mays]
Length=171

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 108/143 (76%), Gaps = 1/143 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIAA  308
            QN+ QD+++ HN+ RA VGV  + W+  V AYAQSYA+QR+GDC L+HSG   YGEN+  
Sbjct  30   QNTAQDFVNLHNSPRADVGVGNVAWNTTVAAYAQSYANQRAGDCRLVHSGGP-YGENLFW  88

Query  309  GGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQCS  488
            G    + TA +AV  W AE+QYY+HATN+C+AP G+SCGHYTQ+VWR S  +GCARV CS
Sbjct  89   GSAGYAWTASNAVGSWAAEKQYYNHATNTCSAPSGQSCGHYTQLVWRASTAIGCARVVCS  148

Query  489  NGAGYFVTCNYSPPGNYIGQSPY  557
            N AG F+ CNY PPGN IGQSPY
Sbjct  149  NNAGVFIICNYYPPGNVIGQSPY  171



>gb|KDP35900.1| hypothetical protein JCGZ_09872 [Jatropha curcas]
Length=160

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 120/160 (75%), Gaps = 6/160 (4%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            L L C++ + + +   AQ+S QDY++AHN ARAAVGV P+TWD  V AYA++YA++  GD
Sbjct  7    LPLICLMSVTLIIPLHAQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANRHIGD  66

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C L+HSG   YGEN+A  G    L+  +AV +WV E+ +Y++ +N+C A  G+ CGHYTQ
Sbjct  67   CRLVHSGG-PYGENLA--GSSGYLSGTAAVKLWVDEKAFYNYNSNTCAA--GKVCGHYTQ  121

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWRNS+++GCA+V+C+NG G F+TCNY PPGNY+GQ PY
Sbjct  122  VVWRNSVRIGCAKVKCNNG-GTFITCNYDPPGNYVGQRPY  160



>ref|XP_006367094.1| PREDICTED: pathogenesis-related leaf protein 6-like [Solanum 
tuberosum]
Length=164

 Score =   184 bits (466),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAV-GVQPITWDEQVEAYAQ  230
            M   K S++ +  I+   +  +CDAQNSQ DYL+ HN+AR+ V GV  ITW+  +E YAQ
Sbjct  1    MALFKASNVVICFIIFAFVLPYCDAQNSQTDYLNTHNSARSQVTGVSAITWNTTLENYAQ  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+QR  DC+L+HS    YGENIA G     +T  +AV++WV E+ YYD+ +NSC    
Sbjct  61   TYANQRISDCNLVHSNGP-YGENIAKGSGS-FMTGTAAVNLWVGEKPYYDYNSNSCTG--  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ C HYTQVVW+NS+++GCARVQC+NG  +FVTCNY+PPGNYIGQ PY
Sbjct  117  GKECRHYTQVVWKNSIQLGCARVQCTNG-WWFVTCNYNPPGNYIGQRPY  164



>ref|XP_010088980.1| hypothetical protein L484_013560 [Morus notabilis]
 gb|EXB37195.1| hypothetical protein L484_013560 [Morus notabilis]
Length=171

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M   +IS   + CIL L +   C AQN+ QD+L  HN ARA VGV P+TWD+ V AYAQ 
Sbjct  1    MALSRISLALIMCILGLGVTESCCAQNTPQDFLTPHNRARAEVGVGPMTWDDSVAAYAQR  60

Query  234  YASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+QR GDC LIHS S  YGEN+A + GD   L+A  AV MWVAE+  YDH +N C    
Sbjct  61   YANQRRGDCKLIHS-SGPYGENLAWSSGD---LSAAGAVKMWVAEKSLYDHNSNKCVGKN  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
               C HYTQVVWR+S ++GCA+V+C++G G FV CNY+PPGNYIGQ PY
Sbjct  117  PMGCLHYTQVVWRDSTRLGCAKVRCNSG-GSFVICNYNPPGNYIGQWPY  164



>ref|XP_004955413.1| PREDICTED: pathogenesis-related protein 1-like [Setaria italica]
Length=170

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGEN  299
            C AQNS QDY+D HNAAR+ VGV P+TWD+ V AYAQSYA+QR GDC+L+HSG   YGEN
Sbjct  26   CAAQNSPQDYVDPHNAARSDVGVGPVTWDDTVAAYAQSYAAQRQGDCALVHSGGP-YGEN  84

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
            I  G      +A  AV  WV+E+Q+YDH +NSC+AP G+SCGHYTQVVWR+S  VGCARV
Sbjct  85   IFWGSAGADWSAADAVGSWVSEKQWYDHGSNSCSAPEGQSCGHYTQVVWRDSTAVGCARV  144

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C N  G F+TCNY+PPGN +GQSPY
Sbjct  145  VCDNDGGVFITCNYNPPGNVVGQSPY  170



>ref|XP_002274307.1| PREDICTED: pathogenesis-related leaf protein 6 [Vitis vinifera]
Length=161

 Score =   183 bits (464),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY++AHNAARA VGV  +TW++ V AYAQ+
Sbjct  1    MGLCKISLPLLVGLMGLALAHVCCAQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R  DC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YANKRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVW NS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECLHYTQVVWSNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>ref|NP_001234358.1| PR1 protein precursor [Solanum lycopersicum]
 gb|ACB88202.1| PR1 protein [Solanum lycopersicum]
Length=179

 Score =   184 bits (466),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 122/168 (73%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG+  I+   + C L   +     AQNS QDYL+AHNAAR  VGV P+TWD ++ A+AQ+
Sbjct  1    MGYSNIA--LIICFLTFAIFHSSQAQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQN  58

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR+GDC + HSG   YGEN+AA   +  L A  AV MWV E+Q+Y++ +N+C A  G
Sbjct  59   YANQRAGDCRMQHSGG-PYGENLAAAFPQ--LNAAGAVKMWVDEKQWYNYNSNTCQA--G  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  114  KVCGHYTQVVWRNSVRLGCARVRCNNG-WYFITCNYDPPGNWRGQRPY  160



>ref|XP_010941967.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   182 bits (463),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 123/168 (73%), Gaps = 9/168 (5%)
 Frame = +3

Query  63   LKISSLF--LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            +K S+L   LAC + L M     AQNS QD++ AHNAARAAVGV P++WD+ V AYAQ+Y
Sbjct  1    MKFSNLTFALACAVFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGPVSWDDTVAAYAQNY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            A+QR GDC L+HSG   YGEN+  G G E   TA  AV+ WV+E+Q+YD+ TN+C A  G
Sbjct  61   ANQRIGDCKLVHSGG-PYGENLFWGLGKE--YTAADAVNSWVSEKQWYDYNTNTCAA--G  115

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S  +GCARV C++GA  F+ CNY+PPGN +G+ PY
Sbjct  116  KVCGHYTQVVWRDSTHIGCARVTCNSGA-IFIICNYNPPGNIVGERPY  162



>gb|ADB54823.1| pathogenesis-related protein 1 [Vitis pseudoreticulata]
Length=161

 Score =   182 bits (462),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 116/168 (69%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KISS  +   + L +     AQNS QD+LDAHN  RA VGV P++WD  V AYAQ+
Sbjct  1    MGLCKISSSLVVGFMGLVLAHISYAQNSAQDFLDAHNVPRAEVGVGPMSWDNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            Y +QR GDC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YTNQRIGDCNLVHSGG-PYGENLAWG--SPSLTGTDAVNLWVGEKSNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              CGHYTQVVWRNS+++GCARVQC+ G G+ V CNY P GNYIGQ PY
Sbjct  115  GQCGHYTQVVWRNSVRLGCARVQCNKG-GWLVACNYDPRGNYIGQRPY  161



>gb|AAK30143.1|AF348141_1 pathogenesis-related protein PR-1 precursor [Capsicum annuum]
 gb|AAC06244.2| basic PR-1 protein precursor [Capsicum annuum]
 gb|AAU20808.1| basic PR-1 protein precursor [Capsicum annuum]
Length=179

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 120/168 (71%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   I+   + C +   +     AQNS QDYL+AHNAAR  VGV P+TWD ++ A+AQ+
Sbjct  1    MGHSNIA--LIVCFITFAIFHSTQAQNSPQDYLNAHNAARRQVGVGPMTWDNRLAAFAQN  58

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC + HSG   YGEN+AA   +  L A  AV MWV E+Q+Y++ +NSC   PG
Sbjct  59   YANQRIGDCRMQHSGG-PYGENLAAAFPQ--LNAAGAVKMWVNEKQWYNYNSNSC--APG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  114  KVCGHYTQVVWRNSVRLGCARVRCNNG-WYFITCNYDPPGNWRGQRPY  160



>ref|XP_002313935.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
 gb|EEE87890.2| hypothetical protein POPTR_0009s08660g [Populus trichocarpa]
Length=160

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 117/164 (71%), Gaps = 7/164 (4%)
 Frame = +3

Query  66   KISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQ  245
            KIS  F   ++ L + L   AQ++ QDYLDAHN ARAAVGV P+TWD  V+AYAQ+YA+Q
Sbjct  4    KISLAFFT-LITLSLILPSRAQDNPQDYLDAHNTARAAVGVGPLTWDTTVQAYAQNYANQ  62

Query  246  RSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCG  425
            R+GDC+L+HSG   YGENIA    +  L+   AV MWV E  YYD+ +NSC +  G+ CG
Sbjct  63   RAGDCNLVHSGG-PYGENIAWSSAD--LSGTDAVKMWVDEMAYYDYNSNSCAS--GQQCG  117

Query  426  HYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            HYTQVVW NS+ +GCA+V CS G G F+ CNY PPGN +GQ PY
Sbjct  118  HYTQVVWGNSVSLGCAKVTCSAG-GTFIVCNYDPPGNVVGQKPY  160



>ref|XP_006486832.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Citrus 
sinensis]
Length=164

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 122/170 (72%), Gaps = 11/170 (6%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGL-----WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            +K+SS+ LA  +     L        AQNS QDYLDAHN+ARAAV V  I W++ V AYA
Sbjct  1    MKMSSISLALAICFMGSLALLIQTSHAQNSPQDYLDAHNSARAAVYVPNIIWNDTVAAYA  60

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            Q+Y++ R  DC+L+HSG   YGENIA G    + T  +AV +WVAE+  Y+++TN+C A 
Sbjct  61   QNYSNSRIADCNLVHSGG-PYGENIAKG--SGTFTGTAAVSLWVAEKANYNYSTNTCAA-  116

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ CGHYTQVVWRNS++VGCARVQCSNG  +FVTC+Y PPGNYIGQ PY
Sbjct  117  -GKVCGHYTQVVWRNSIRVGCARVQCSNG-WWFVTCSYDPPGNYIGQKPY  164



>ref|XP_009388943.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = +3

Query  84   LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCS  263
            L C + L M     AQNS QD++DAHN+ARAAVGV P++WD+ V AYAQ+YA+QR GDC 
Sbjct  10   LVCAMALAMACTTLAQNSPQDFVDAHNSARAAVGVGPVSWDDNVAAYAQNYANQRIGDCQ  69

Query  264  LIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVV  443
            L+HSG   YGEN+  GG     T   AV+ WV E+QYYD+ +NSC    G+ CGHYTQVV
Sbjct  70   LVHSGG-PYGENL-FGGSSTEFTGIDAVNSWVDEKQYYDYDSNSC--ADGQVCGHYTQVV  125

Query  444  WRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            W++S  +GCARVQC NG G F+ CNY+P GN +G+ PY
Sbjct  126  WQDSTAIGCARVQCDNG-GIFIICNYNPAGNIVGERPY  162



>ref|XP_004136927.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 ref|XP_004155418.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cucumis sativus]
 gb|KGN43832.1| hypothetical protein Csa_7G070253 [Cucumis sativus]
Length=164

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 113/156 (72%), Gaps = 5/156 (3%)
 Frame = +3

Query  90   CILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLI  269
            C+L   M     AQ+S QD+LDAHN ARA  GV+P+ WDE V ++A  YA+QR  DCSL+
Sbjct  14   CVLTFFMLPSSLAQDSPQDFLDAHNTARAQDGVEPVQWDETVASFALQYANQRINDCSLV  73

Query  270  HSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWR  449
            HSG   YGENIA G  +  L+  +AV+MWV E+++YD+ +N+C A     CGHYTQVVWR
Sbjct  74   HSGGP-YGENIAWGMPD--LSGTAAVEMWVNEKEFYDYGSNTCAA--SRVCGHYTQVVWR  128

Query  450  NSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            NS+++GCA+V C+N  G F+TCNY PPGN++GQ PY
Sbjct  129  NSVRIGCAKVICTNNGGTFITCNYDPPGNFVGQRPY  164



>gb|AHE81270.1| pathogenesis-related protein 1-6 [Triticum aestivum]
Length=168

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENI  302
            AQNS+QD++DAHNAARA VG+  +TWD  V A+AQ YA QR GDC LIH+   + YGEN+
Sbjct  23   AQNSEQDFVDAHNAARADVGLGEVTWDPTVAAFAQDYADQRRGDCQLIHTPDGRPYGENL  82

Query  303  -AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
               GG     TA  AV+ WV+E+QYYDH +N+C+AP GESCGHYTQVVWR+S  +GCARV
Sbjct  83   YGGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTQVVWRDSTGIGCARV  142

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C +G G F+ C+Y+PPGN+ G SPY
Sbjct  143  VCDSGDGVFIICSYNPPGNFPGVSPY  168



>gb|AEH25621.1| pathogenesis-related protein 1-6 [Triticum aestivum]
 gb|AHE81249.1| pathogenesis-related protein 1-6 [Triticum aestivum]
Length=168

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 2/146 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENI  302
            AQNS+QD++DAHNAARA VG+  +TWD  V A+AQ YA QR GDC LIH+   + YGEN+
Sbjct  23   AQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGRPYGENL  82

Query  303  -AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
               GG     TA  AV+ WV+E+QYYDH +N+C+AP GESCGHYTQVVWR+S  +GCARV
Sbjct  83   YGGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTQVVWRDSTGIGCARV  142

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C +G G F+ C+Y+PPGN+ G SPY
Sbjct  143  VCDSGDGVFIICSYNPPGNFPGVSPY  168



>ref|XP_004504945.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Cicer arietinum]
Length=163

 Score =   181 bits (459),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 119/169 (70%), Gaps = 7/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGL-WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            M F    S F + +++L +G    +AQNS QDYL+AHN ARA VGV  ITWD  V  YA 
Sbjct  1    MSFYNSFSRF-SLVIILSLGFSLTNAQNSPQDYLNAHNIARAQVGVANITWDNTVATYAL  59

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+ R GDC+L+HS S  YGEN+A  G   S T  +AV++WV E+QYYD+ TNSC    
Sbjct  60   NYANSRIGDCNLVHS-SGSYGENLAK-GSSGSFTGITAVNLWVNEKQYYDYNTNSC--IN  115

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  C HYTQVVWRNS+++GCARVQC+NG  +FVTCNY PPGN IGQ PY
Sbjct  116  GGQCLHYTQVVWRNSVRLGCARVQCNNGW-WFVTCNYDPPGNCIGQKPY  163



>ref|XP_009788195.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
sylvestris]
Length=177

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 121/169 (72%), Gaps = 11/169 (7%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWC-DAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MGFL   +  +AC +   + +    AQNS QDYL+ HNAAR  VGV P+TWD ++ AYAQ
Sbjct  1    MGFL---TTIVACFITFAILIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQ  57

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+QR GDC +IHS    YGEN+AA   +  L A  AV MWV E+++YD+ +NSC    
Sbjct  58   NYANQRIGDCGMIHSHG-PYGENLAAAFPQ--LNAAGAVKMWVDEKRFYDYNSNSC---V  111

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  CGHYTQVVWRNS+++GCARV+C+NG  +F+TCNY PPGN+IGQ P+
Sbjct  112  GGVCGHYTQVVWRNSVRLGCARVRCNNGW-FFITCNYDPPGNFIGQRPF  159



>ref|NP_188603.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 dbj|BAB02556.1| pathogenesis-related protein-like [Arabidopsis thaliana]
 gb|ABN04774.1| At3g19690 [Arabidopsis thaliana]
 gb|AEE76276.1| putative pathogenesis-related protein [Arabidopsis thaliana]
Length=161

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M  LK + LFL  I +    L   A++ QQ +L+AHN AR  VG+ P+ WD++V AYA S
Sbjct  1    MSLLKTNILFLLAIALFYGSL---AEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAAS  57

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HS    +GENIA    E  ++A+ A +MW+ E+QYYD+ +N+CN P G
Sbjct  58   YANQRINDCALVHSNGP-FGENIAMSSGE--MSAEDAAEMWINEKQYYDYDSNTCNDPNG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             +C HYTQVVW+N++++GCA+V C++G G F+TCNY PPGNYIG+ P+
Sbjct  115  GTCLHYTQVVWKNTVRLGCAKVVCNSG-GTFITCNYDPPGNYIGEKPF  161



>ref|XP_010266628.1| PREDICTED: pathogenesis-related protein 1A-like [Nelumbo nucifera]
Length=162

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 117/168 (70%), Gaps = 6/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M F ++       I+ + +     AQ+S Q+YLDAHNAARA VGV  +TWD+ V AYAQS
Sbjct  1    MAFCRLGIFLFFLIMGIGLVHVSRAQDSHQNYLDAHNAARAEVGVDALTWDDTVAAYAQS  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R+ DC+ +HSG + YGEN+A  G   SL+A  AV++WV E+QYYDH +NSC     
Sbjct  61   YANKRADDCTRVHSG-EPYGENLA--GSTGSLSATDAVNLWVGEKQYYDHNSNSCIGE--  115

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + C HYTQVVWR S +VGCA+VQC+NG G FV CNY P GN +G+ PY
Sbjct  116  QECRHYTQVVWRKSFRVGCAKVQCNNG-GTFVICNYDPAGNVVGELPY  162



>ref|NP_001043089.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|AAB49685.1| pathogenesis-related protein class 1 [Oryza sativa Indica Group]
 dbj|BAB84468.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAC10793.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05003.1| Os01g0382000 [Oryza sativa Japonica Group]
 gb|ABK55609.1| pathogenesis-related protein PR1b [Oryza sativa Indica Group]
Length=164

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 107/145 (74%), Gaps = 3/145 (2%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENI  302
            AQNS QDY+  HNAARAAVGV P+TWD  V+A+A++YASQRSGDCSLIHS ++   GEN+
Sbjct  22   AQNSPQDYVRLHNAARAAVGVGPVTWDTSVQAFAENYASQRSGDCSLIHSSNRNNLGENL  81

Query  303  AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
              G      TA SAV  WV E+  YD+A+NSC    G+ CGHYTQVVWR S  +GCARV 
Sbjct  82   FWGSAGGDWTAASAVQSWVGEKSDYDYASNSC--AQGKVCGHYTQVVWRASTSIGCARVV  139

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            CSNG G F+TCNY P GN++GQ PY
Sbjct  140  CSNGRGVFITCNYKPAGNFVGQRPY  164



>ref|XP_010530683.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 119/164 (73%), Gaps = 8/164 (5%)
 Frame = +3

Query  69   ISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQR  248
            + +L LA  LVL +     AQ+  QD++DAHN ARAAVGV PI WDE V AYA+ YA++R
Sbjct  1    MKTLILAMALVLALVAHTRAQDRPQDFVDAHNRARAAVGVGPIRWDETVAAYARDYANRR  60

Query  249  SGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCG  425
             GDC L+HS S  YGENIA + GD   ++  SAV MWV E+  Y++ TN+C A  G+ CG
Sbjct  61   RGDCRLVHS-SGPYGENIAWSSGD---MSGVSAVQMWVNEKADYNYNTNTCRA--GKVCG  114

Query  426  HYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            HYTQVVWR S+++GCA+V+C+NG G F+TCNY PPGN+ G+ PY
Sbjct  115  HYTQVVWRKSVRLGCAKVRCNNG-GTFITCNYDPPGNFNGERPY  157



>ref|XP_006644187.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Oryza brachyantha]
Length=168

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 117/170 (69%), Gaps = 4/170 (2%)
 Frame = +3

Query  54   MGFLKISSLFLACI-LVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MG  K++++FL  +     M L   AQNS QDY+  HNAARAAVGV P+TWD  V+A+A+
Sbjct  1    MGVPKLATIFLLGLPRAAAMALPSQAQNSPQDYVRLHNAARAAVGVGPVTWDPSVQAFAE  60

Query  231  SYASQRSGDCSLIHSGSQ-QYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            SYA QR+GDC LIHS ++   GEN+  G      TA  AV++WV E+  Y++A+NSC A 
Sbjct  61   SYARQRAGDCRLIHSPNRDNLGENLFWGSAGKDWTAADAVNLWVGEKGDYNYASNSCAA-  119

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ CGHYTQVVWR S  +GCARV C+ G G F+TCNY P GN+ GQ PY
Sbjct  120  -GKVCGHYTQVVWRASTAIGCARVVCNEGRGVFITCNYKPAGNFNGQRPY  168



>gb|KDP37600.1| hypothetical protein JCGZ_06943 [Jatropha curcas]
Length=148

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 112/144 (78%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQ+S QDY++AHN ARAAVGV P+TWD  V AYA++YA+Q  GDC L+HSG   YGEN+A
Sbjct  11   AQDSPQDYVNAHNTARAAVGVGPVTWDNTVAAYARNYANQHIGDCRLVHSGG-PYGENLA  69

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
              G    L+  +AV +WV E+ +YD+ +N+C A  G+ CGHYTQVVWRNS+++GCA+V+C
Sbjct  70   --GSSGDLSDPAAVKLWVDEKAFYDYNSNTCAA--GKVCGHYTQVVWRNSVRIGCAKVKC  125

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            +NG G F+TCNY PPGNY+GQ PY
Sbjct  126  NNG-GTFITCNYDPPGNYVGQRPY  148



>ref|XP_006422718.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|ESR35958.1| hypothetical protein CICLE_v10029873mg [Citrus clementina]
 gb|KDO37560.1| hypothetical protein CISIN_1g048073mg [Citrus sinensis]
Length=164

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 122/170 (72%), Gaps = 11/170 (6%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGL-----WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            +K+SS+ LA  +     L        AQNS QDYLDAHN+ARAAV V  I W++ V AYA
Sbjct  1    MKMSSISLALAICFMGSLALLIQTSHAQNSPQDYLDAHNSARAAVYVPNIIWNDTVAAYA  60

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            Q+Y++ R  DC+L+HSG   YGEN+A G    + T  +AV +WVAE+  Y+++TN+C A 
Sbjct  61   QNYSNSRIADCNLVHSGG-PYGENLAKG--SGTFTGTAAVSLWVAEKANYNYSTNTCAA-  116

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ CGHYTQVVWRNS++VGCARVQCSNG  +FVTC+Y PPGNYIGQ PY
Sbjct  117  -GKVCGHYTQVVWRNSIRVGCARVQCSNG-WWFVTCSYDPPGNYIGQKPY  164



>ref|XP_010530686.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=157

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 116/163 (71%), Gaps = 6/163 (4%)
 Frame = +3

Query  69   ISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQR  248
            + +L L   LVL +     AQ+  QDY+DAHN ARA VGV PI WDE V AYA+ YA+QR
Sbjct  1    MKTLILVIALVLALVGPMRAQDQPQDYVDAHNQARAEVGVGPIEWDETVAAYARDYANQR  60

Query  249  SGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGH  428
             GDCSL HS S  YGENIA GG +  L+  +AV MWV E+  YD+ TN+C A  G+ CGH
Sbjct  61   RGDCSLTHS-SGPYGENIAWGGGD--LSGTAAVKMWVDEKADYDYNTNTCRA--GKQCGH  115

Query  429  YTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            YTQ+VWR+S+++GCA+V C +G G F+TCNY P GN+IGQ PY
Sbjct  116  YTQIVWRDSVRLGCAKVTCDDG-GTFITCNYDPRGNFIGQWPY  157



>ref|XP_006367091.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=179

 Score =   181 bits (460),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 121/168 (72%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG+  I+   + C L+  +     AQNS QDYL+ HNAAR  VGV P+TWD ++ A+AQ+
Sbjct  1    MGYSNIA--LIICFLIFAIFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQN  58

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR+GDC + HSG   YGEN+AA   +  L A  AV MW  E+Q+Y++ +N+C A  G
Sbjct  59   YANQRAGDCRMQHSGG-PYGENLAAAFPQ--LNAAGAVKMWFDEKQWYNYNSNTCQA--G  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  114  KVCGHYTQVVWRNSVRLGCARVRCNNG-WYFITCNYDPPGNWRGQRPY  160



>gb|AFK39516.1| unknown [Lotus japonicus]
Length=164

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 120/169 (71%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MGF K++   + C+L L   +    Q+S+ DYL+AHNAAR+AV V  + WD+ V A+AQ+
Sbjct  1    MGFSKVTLSLIMCVLCLGHYV-VYGQDSRADYLNAHNAARSAVNVPNLVWDDTVAAFAQN  59

Query  234  YASQRSGDCSLIHSGSQ-QYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+QR GDC L+HSG   +YGEN+A G  +  L+   AV +WV E+  YD+ +NSC    
Sbjct  60   YANQRKGDCKLVHSGGGGRYGENLAWG--KPDLSGTGAVKLWVDEKANYDYNSNSC--AS  115

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+  GHYTQVVW+NS+++GCA+V+C NG G F+TCNY PPGNY+GQ PY
Sbjct  116  GKQRGHYTQVVWKNSMRLGCAKVKCDNGGGTFITCNYDPPGNYVGQKPY  164



>gb|AFK93503.1| pathogenesis related protein 1 isoform 4 [Ficus pumila var. awkeotsang]
Length=169

 Score =   181 bits (459),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 114/168 (68%), Gaps = 5/168 (3%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  +IS   + CIL L +   C AQ+S QD+L  HN ARA VGV P+TWDE V AYA+ 
Sbjct  1    MGLSRISLALIMCILGLAVLESCRAQDSPQDFLAPHNRARAEVGVGPMTWDESVAAYARD  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R GDC LIHSG   YGENIA G  +  L+A  AV MWVAE+  YD+  N C   P 
Sbjct  61   YANRRKGDCKLIHSGG-PYGENIAWGSGD--LSAARAVGMWVAEKSLYDYNNNKCIGDP-  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVWR S ++GCA+V+C +G G F+ CNY+PPGNY GQ PY
Sbjct  117  WGCLHYTQVVWRKSTRLGCAKVRCVSG-GTFIICNYNPPGNYKGQRPY  163



>gb|AFM77011.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=154

 Score =   180 bits (457),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 113/144 (78%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQ++ QDYL++HNAARAAVGV P+TWD++V  YAQ+YA+Q  GDC+L+HSG   YGEN+A
Sbjct  17   AQDTPQDYLNSHNAARAAVGVGPLTWDDKVAGYAQNYANQHVGDCNLVHSGG-PYGENLA  75

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
                + S TA  AVDMWVAE+  YD+ +NSC    G+ CGHYTQVVWRNS +VGCA+V+C
Sbjct  76   MSTGDMSGTA--AVDMWVAEKADYDYESNSC--ADGKVCGHYTQVVWRNSARVGCAKVRC  131

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            S+G G F+ CNY PPGNY+GQ PY
Sbjct  132  SSG-GTFIGCNYDPPGNYVGQKPY  154



>gb|AEH25623.1| pathogenesis-related protein 1-8 [Triticum aestivum]
 gb|AHE81251.1| pathogenesis-related protein 1-8 [Triticum aestivum]
 gb|AHE81272.1| pathogenesis-related protein 1-8 [Triticum aestivum]
Length=168

 Score =   181 bits (458),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS-GSQQYGENI-  302
            QNS+QD++DAHNAARA VG+  +TWD  V A+AQ YA QR GDC LIH+   + YGEN+ 
Sbjct  24   QNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGRPYGENLY  83

Query  303  AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
              GG     TA  AV+ WV+E+QYYDH +N+C+AP GESCGHYTQVVWR+S  +GCARV 
Sbjct  84   GGGGGGTEWTATDAVNSWVSEKQYYDHDSNTCSAPEGESCGHYTQVVWRDSTAIGCARVV  143

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C +G G F+ C+Y+PPGN+ G SPY
Sbjct  144  CDSGDGVFIICSYNPPGNFPGVSPY  168



>gb|EMS35766.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=166

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 110/145 (76%), Gaps = 2/145 (1%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENI-  302
            AQNS+QD++DAHNAARA VG+  +TWD  V A+AQ YA QR GDC L+HSG Q YGEN+ 
Sbjct  23   AQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLVHSGGQ-YGENLY  81

Query  303  AAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
              GG     TA  AV+ WV+E+QYYDH++NSC+AP  +SC HYTQVVWR+S  +GCARV 
Sbjct  82   GGGGGGTGWTAMDAVNSWVSEKQYYDHSSNSCSAPADKSCLHYTQVVWRDSTAIGCARVV  141

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C +G G F+ C+Y+PPGN+ G SPY
Sbjct  142  CDSGDGVFIICSYNPPGNFPGVSPY  166



>emb|CAA70070.1| PR protein [Solanum lycopersicum]
Length=168

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 122/165 (74%), Gaps = 9/165 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   +S L + C++VL +   CDAQNS QDYL+ HN ARA VGV P++WD  +E+ AQS
Sbjct  1    MGLFNMSLLLMTCLMVLAIFHSCDAQNSPQDYLEVHNDARAQVGVGPMSWDADLESRAQS  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSGS   GEN+A GG +   T ++AV++WV+E+  Y++ TN C +  G
Sbjct  61   YANSRAGDCNLIHSGS---GENLAKGGGD--FTGRAAVELWVSEKPNYNYDTNECVS--G  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQ  548
            + CGHYTQVVWR+S+++GC R  C++  G+F++CNY P GN++GQ
Sbjct  114  KMCGHYTQVVWRDSVRLGCGRALCND--GWFISCNYDPVGNWVGQ  156



>ref|XP_010088981.1| hypothetical protein L484_013561 [Morus notabilis]
 gb|EXB37196.1| hypothetical protein L484_013561 [Morus notabilis]
Length=171

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  +IS   + CIL L +   C AQ + QD+L  HN ARA VGV P+TWD+ V AYA++
Sbjct  1    MGLSRISLALVICILGLGVIELCYAQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+QR GDC L+HSG   YGENIA + GD   L+A  AV MWVAE+  YD+ +N C    
Sbjct  61   YANQRQGDCKLVHSGG-PYGENIAWSSGD---LSAAGAVGMWVAEKSLYDYYSNKCVGQN  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
               C HYTQVVWR S ++GCA+V+C++G G FV CNY+PPGNYIGQ PY
Sbjct  117  PMGCLHYTQVVWRKSTRLGCAKVRCNSG-GSFVICNYNPPGNYIGQRPY  164



>ref|XP_009605697.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
tomentosiformis]
Length=163

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 6/161 (4%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            S  L C ++L       AQNSQ DYL AHN+AR+ VGV  ITWD  +  YAQ+YA+QR G
Sbjct  9    STLLICFIILAFAFPSHAQNSQTDYLAAHNSARSQVGVSAITWDTTLANYAQNYANQRIG  68

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC+L+HS    YGEN+A G    S T  +AV++WVAE+ YYD+  N C    G  C HYT
Sbjct  69   DCNLVHSNG-PYGENLAKG--TGSFTGTAAVNLWVAEKPYYDYTNNYCTG--GNQCLHYT  123

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWRNS++VGCAR QC+NG  +FV C+Y PPGNY+GQ PY
Sbjct  124  QVVWRNSVRVGCARAQCNNG-WWFVICSYDPPGNYVGQRPY  163



>emb|CAD38277.1| pathogenesis related protein isoform b2 [Solanum phureja]
Length=159

 Score =   180 bits (456),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 120/168 (71%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS LF+ C++VL +   CDAQNS QDYL  HN ARA VGV P++WD  + A AQ+
Sbjct  1    MGLFNISWLFI-CLMVLSIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLAARAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R GDC+LIHSG+   GEN+A GG +   T + AV +WV+E+  Y++ TN C    G
Sbjct  60   YANSRIGDCNLIHSGA---GENLAKGGGD--YTGRRAVQLWVSEKPNYNYDTNQC--ASG  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GC R +C+NG  +F++CNY P GNY+GQ PY
Sbjct  113  KMCGHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNYVGQRPY  159



>ref|XP_006387932.1| hypothetical protein POPTR_0473s00220g [Populus trichocarpa]
 gb|ERP46846.1| hypothetical protein POPTR_0473s00220g [Populus trichocarpa]
Length=145

 Score =   179 bits (455),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 23/164 (14%)
 Frame = +3

Query  66   KISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQ  245
            KIS  F   ++ L + L   AQ++ QDYLDAHNAARAAVGV P+TWD  V+AYAQ+YA+Q
Sbjct  5    KISLAFFT-LITLSLILPSRAQDNPQDYLDAHNAARAAVGVGPLTWDTTVQAYAQNYANQ  63

Query  246  RSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCG  425
            R+GDC+L+HSG+                    AV MWV E+ YYD+ +NSC A  G+ CG
Sbjct  64   RAGDCNLVHSGTD-------------------AVKMWVDEKAYYDYNSNSCAA--GQQCG  102

Query  426  HYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            HYTQVVWRNS ++GCA+V+CS G G F+ CNY PPGNY+GQ PY
Sbjct  103  HYTQVVWRNSARLGCAKVKCSTG-GTFIGCNYDPPGNYVGQKPY  145



>ref|XP_004955945.1| PREDICTED: pathogenesis-related protein PRMS-like [Setaria italica]
Length=172

 Score =   180 bits (457),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS-GDCSLIHSGSQQYGENIA  305
            QN+ QD+++ HN+ RA VGV  +TW+  V AYAQ+YA+QR+ GDC L+HSG   YGEN+ 
Sbjct  30   QNTAQDFVNLHNSPRADVGVVIVTWNATVAAYAQNYATQRAAGDCRLVHSGGP-YGENLF  88

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G    +  A  AV  WVAE+QYY+HATN+C+APPG+SCGHYTQVVWR S  +GCAR  C
Sbjct  89   WGSAGYAWAASDAVGSWVAEKQYYNHATNTCSAPPGKSCGHYTQVVWRASTALGCARAVC  148

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            SN AG F+ CNYSP GN +GQSPY
Sbjct  149  SNNAGVFIVCNYSPRGNIVGQSPY  172



>ref|XP_006848057.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
 gb|ERN09638.1| hypothetical protein AMTR_s00029p00197310 [Amborella trichopoda]
Length=165

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 117/162 (72%), Gaps = 5/162 (3%)
 Frame = +3

Query  72   SSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
            S   L  +  + M   C AQNS QDYL+ HNAAR  + V P+TWD+ V A+AQ+YA+QR+
Sbjct  9    SLTLLVVLCTMGMVHLCHAQNSPQDYLNPHNAARTRLNVGPLTWDDNVAAFAQNYANQRA  68

Query  252  GDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
             DC+LIHSG   YGEN+  GG     +A  AV+ WV E+  YD+ +N+C A  G+ CGHY
Sbjct  69   RDCNLIHSGG-PYGENL-FGGSGADFSAADAVNAWVNEKADYDYNSNTCAA--GKQCGHY  124

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWRNS+++GCA+V+C+NG G F+TCNY+PPGN+IGQ PY
Sbjct  125  TQVVWRNSVRLGCAKVRCNNG-GIFITCNYNPPGNFIGQKPY  165



>ref|XP_008796970.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = +3

Query  63   LKISSLFLA--CILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            +K SSL LA  C + L M     AQNS QD++ AHNAARAAVGV  ++WD+ V AYAQ+Y
Sbjct  1    MKFSSLTLALACAMFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A+QR  DC L HSG   YGEN+  GG     TA  AV+ WV E+Q+YD+ TN+C A  G 
Sbjct  61   ANQRISDCQLKHSGG-PYGENL-FGGSGADFTAADAVNSWVDEKQWYDYNTNTCAA--GH  116

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVWR+S  +GCARV C++GA  F+ C+Y PPGN++GQ PY
Sbjct  117  ECGHYTQVVWRDSTNIGCARVTCNSGA-IFIICDYKPPGNFVGQRPY  162



>ref|XP_008346349.1| PREDICTED: pathogenesis-related protein 1-like [Malus domestica]
Length=161

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 122/170 (72%), Gaps = 11/170 (6%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            MG   IS   LA + +L   L     AQ++ QDYL++HNAARAAVGV P+TWD+ V  YA
Sbjct  1    MGLCNIS---LALLFILGSALIQSSHAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYA  57

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            Q+YA+Q  GDC+L+HSG   YGEN+A    + S TA  AVD+WVAE+  Y + +NSC A 
Sbjct  58   QNYANQHVGDCNLVHSGG-PYGENLAMSTGDMSGTA--AVDLWVAEKADYSYESNSCAA-  113

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G+ CGHYTQVVWRNS +VGCA+V+CS+G G F+ CNY PPGNY+G+ PY
Sbjct  114  -GKVCGHYTQVVWRNSARVGCAKVRCSSG-GTFIGCNYDPPGNYVGEKPY  161



>ref|XP_009397726.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Musa acuminata 
subsp. malaccensis]
Length=240

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 118/173 (68%), Gaps = 4/173 (2%)
 Frame = +3

Query  39   QRRKKMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVE  218
            +R + MG    +S  + C L L M     AQN+QQD +DAHN+ARAAVGV P++WD+ + 
Sbjct  45   KRERGMGSSNHASALVVCALALAMACTAVAQNTQQDGVDAHNSARAAVGVGPVSWDDDIA  104

Query  219  AYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSC  398
            +YAQ +A++R  DC L+HSG   YGEN+   G  ++ T   AV+ W+AE+QYYD+  NSC
Sbjct  105  SYAQKFANKRVTDCQLVHSGG-PYGENL-FWGTGSAFTLTDAVNTWIAEKQYYDYENNSC  162

Query  399  NAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
                G+ C HYTQVVW+N+  +GCAR QCS+G G F+ C+YSP GN +GQ PY
Sbjct  163  --ADGQVCRHYTQVVWQNTTAIGCARTQCSDGNGIFILCDYSPAGNLVGQRPY  213



>gb|AFK64734.1| pathogenesis related protein 1a, partial [Cydonia oblonga]
Length=153

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 118/160 (74%), Gaps = 10/160 (6%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            ++L  +L+        AQ++ QDYL++HNAARAAVGV P+TWD+ V  YAQ+YA+Q  GD
Sbjct  4    VYLGSVLIQSS----HAQDAPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQNYANQHVGD  59

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C+L+HSG   YGEN+A    + S TA  AVDMWVAE+  YD+ +NSC    G+ CGHYTQ
Sbjct  60   CNLVHSGG-PYGENLAMSTGDMSGTA--AVDMWVAEKADYDYESNSC--ADGKVCGHYTQ  114

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWRNS +VGCA+V+CS+G G F+ CNY PPGNY+GQ PY
Sbjct  115  VVWRNSARVGCAKVRCSSG-GTFIGCNYDPPGNYVGQKPY  153



>emb|CAD38276.1| pathogenesis related protein isoform b1 [Solanum phureja]
Length=159

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L C+++L +   CDAQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIS-LLLTCLMILAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSG+   GEN+A G  +   T ++AV +WV E+  Y++ TN C    G
Sbjct  60   YANSRTGDCNLIHSGA---GENLAKGSGD--FTGRAAVQLWVGEKPNYNYGTNQC--ASG  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GC R +C+NG  +F++CNY P GNY+GQ PY
Sbjct  113  QVCGHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNYVGQRPY  159



>ref|XP_004289701.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 119/163 (73%), Gaps = 7/163 (4%)
 Frame = +3

Query  75   SLFLA--CILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQR  248
            +LF+A  C++ L       AQNSQQDYL+AHN ARA VGV  I WD  V AYAQ+YA+ R
Sbjct  2    ALFVAFLCLIGLAAVHPSHAQNSQQDYLNAHNTARAHVGVANIIWDSTVAAYAQNYANSR  61

Query  249  SGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGH  428
              DC+L+HSG   YGEN+A  G  ++LT  +AV++WVAE+ YY++ +NSC    G+ C H
Sbjct  62   IADCNLVHSGG-PYGENLAK-GSSSALTGTAAVNLWVAEKPYYNYTSNSCTG--GQQCLH  117

Query  429  YTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            YTQVVW NS+++GCARVQC+N   +FVTCNY PPGNY+GQ PY
Sbjct  118  YTQVVWANSIRLGCARVQCTN-TWWFVTCNYDPPGNYVGQLPY  159



>gb|ADD97801.1| pathogenesis-related protein 1 [Musa ABB Group]
Length=163

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 117/168 (70%), Gaps = 8/168 (5%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCD---AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            ++ S+  LA +  + + + C    AQNS QD++  HNAARAAVGV P++WD  V AYAQ+
Sbjct  1    MRSSNPALAMLCTVALAMACTSTLAQNSPQDFVSPHNAARAAVGVGPVSWDSTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC L+HSG   YGENI +G   +  TA  AV+ WV+E+Q YD+ +N C   P 
Sbjct  61   YANQRKADCQLVHSGG-PYGENIFSGSGRD-YTAADAVNAWVSEKQDYDYNSNKC--APN  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S  +GC RV+C+NG G F+TCNY PPGNY GQ PY
Sbjct  117  KVCGHYTQVVWRSSTAIGCGRVRCNNG-GIFITCNYKPPGNYAGQRPY  163



>ref|NP_001234523.1| pathogenesis-related leaf protein 4 precursor [Solanum lycopersicum]
 sp|Q04108.1|PR04_SOLLC RecName: Full=Pathogenesis-related leaf protein 4; Short=P4; 
Flags: Precursor [Solanum lycopersicum]
 gb|AAA03615.1| pathogenesis-related protein P4 [Solanum lycopersicum]
 emb|CAA09671.1| pathogenesis-related protein PR1a (P4) [Solanum lycopersicum]
Length=159

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 122/168 (73%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L C++VL +   C+AQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIS-LLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSG+   GEN+A GG +   T ++AV +WV+E+  Y++ATN C    G
Sbjct  60   YANSRAGDCNLIHSGA---GENLAKGGGD--FTGRAAVQLWVSERPDYNYATNQCVG--G  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GC R +C+NG  +F++CNY P GN++G+ PY
Sbjct  113  KMCGHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWVGERPY  159



>ref|XP_010252393.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nelumbo nucifera]
Length=167

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 118/167 (71%), Gaps = 8/167 (5%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLWCD-AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            F    S     I+ L  GL    AQ+S QDY++AHNAARA VGV  +TWD++V AYAQ Y
Sbjct  8    FCNPKSALFFLIIGLAAGLHVSLAQDSPQDYINAHNAARAEVGVGSMTWDDKVAAYAQQY  67

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A+QR GDC+L+HSG   YGEN+AA     SL+   AV MWV E+QYYD+ +NSC+   G 
Sbjct  68   ANQRIGDCALVHSGG-PYGENLAAA--MPSLSGTDAVKMWVDEKQYYDYNSNSCS---GG  121

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C HYTQVVWR+S+++GCA+V C+NG   FVTCNY PPGNY+GQ PY
Sbjct  122  ECLHYTQVVWRDSVRLGCAKVHCNNGWD-FVTCNYDPPGNYVGQRPY  167



>ref|NP_001234314.1| pathogenesis-related leaf protein 6 precursor [Solanum lycopersicum]
 sp|P04284.2|PR06_SOLLC RecName: Full=Pathogenesis-related leaf protein 6; Short=P6; 
AltName: Full=Ethylene-induced protein P1; AltName: Full=P14; 
AltName: Full=P14A; AltName: Full=PR protein; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA48672.1| P1(p14) protein [Solanum lycopersicum]
 gb|AAA03616.1| pathogenesis-related protein P6 [Solanum lycopersicum]
 emb|CAA70042.1| PR protein [Solanum lycopersicum]
Length=159

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 121/168 (72%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L C++VL +   C+AQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIS-LLLTCLMVLAIFHSCEAQNSPQDYLAVHNDARAQVGVGPMSWDANLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSG+   GEN+A GG +   T ++AV +WV+E+  Y++ATN C    G
Sbjct  60   YANSRAGDCNLIHSGA---GENLAKGGGD--FTGRAAVQLWVSERPSYNYATNQCVG--G  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + C HYTQVVWRNS+++GC R +C+NG  +F++CNY P GN+IGQ PY
Sbjct  113  KKCRHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWIGQRPY  159



>ref|XP_010941968.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   178 bits (452),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 118/167 (71%), Gaps = 7/167 (4%)
 Frame = +3

Query  63   LKISSLF--LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            +K S+L   LAC + L M     AQNS QD++ AHNAARAAVGV P++WD  V AYAQ+Y
Sbjct  1    MKFSNLTFALACAMFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGPVSWDNTVAAYAQNY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A+QR GDC L+HSG   YGEN+  G      TA  AV+ WV+E+Q+YD+ TN+C A  G+
Sbjct  61   ANQRIGDCQLVHSGG-PYGENLFWGSGR-EYTAADAVNSWVSEKQWYDYNTNTCAA--GK  116

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVWR+S  +GCARV+C++GA  F+ CNY P GN  GQ PY
Sbjct  117  VCGHYTQVVWRDSTHIGCARVKCNSGA-IFIICNYKPRGNIAGQRPY  162



>ref|XP_006412319.1| hypothetical protein EUTSA_v10026438mg [Eutrema salsugineum]
 gb|ESQ53772.1| hypothetical protein EUTSA_v10026438mg [Eutrema salsugineum]
Length=163

 Score =   178 bits (452),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 121/167 (72%), Gaps = 8/167 (5%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            F    +L LA  + L   +   AQ+S QDYLDAHN ARAAVGV P+ WDE+V AYA+ YA
Sbjct  4    FNPFQNLILATTIFLVFVVSLRAQDSPQDYLDAHNKARAAVGVGPLRWDERVAAYARDYA  63

Query  240  SQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            +QR GDC+L HS S  YGENIA + GD   ++   A++MWV E+  Y++ +N+C +  G+
Sbjct  64   NQRRGDCALQHS-SGPYGENIAWSSGD---MSGVQAINMWVNEKVDYNYGSNTCAS--GK  117

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVWRNS+++GCA+V+C+NG   F+TCNY PPGN+IGQ PY
Sbjct  118  VCGHYTQVVWRNSVRMGCAKVRCNNGQT-FITCNYDPPGNFIGQWPY  163



>ref|XP_007201612.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
 gb|EMJ02811.1| hypothetical protein PRUPE_ppa019807mg [Prunus persica]
Length=157

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNSQQDYL+AHN AR  VGV  ITWD  VEAYAQ+YA+ R+ DC+L+HS    YGEN+A
Sbjct  20   AQNSQQDYLNAHNVAREQVGVPNITWDSTVEAYAQNYANSRAADCNLVHSNG-TYGENLA  78

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G    S T  SAV++WVAE+  Y++ +NSC    G+ C HYTQVVW+NS+++GCARV+C
Sbjct  79   EG--SGSFTGTSAVNLWVAEKPNYNYTSNSCVG--GQQCLHYTQVVWKNSVRLGCARVKC  134

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            SNG  +FVTCNY PPGNY+GQ PY
Sbjct  135  SNGL-WFVTCNYDPPGNYVGQRPY  157



>ref|XP_009605696.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Nicotiana tomentosiformis]
Length=179

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 120/166 (72%), Gaps = 7/166 (4%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCD-AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            +  S+  +AC +   +      AQNS QDYL+ HNAAR  VGV P+TWD ++ A+AQ+YA
Sbjct  1    MGYSTTLVACFITFAILFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYA  60

Query  240  SQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            +QR+GDC + HSG   YGEN+AA   +  L A  AV MWV E+Q+Y++ +N+C A  G+ 
Sbjct  61   NQRAGDCRMQHSGG-PYGENLAAAYPQ--LHAAGAVKMWVDEKQFYNYNSNTCAA--GKV  115

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  116  CGHYTQVVWRNSVRLGCARVRCNNG-WYFITCNYDPPGNWRGQRPY  160



>emb|CAB58263.1| pathogenesis related protein PR-1 [Solanum tuberosum]
Length=159

 Score =   178 bits (451),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L C++VL +   CDAQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIS-LLLTCLMVLAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSG+   GEN+A G  +   T ++AV +WV E+  Y++ TN C    G
Sbjct  60   YANSRTGDCNLIHSGA---GENLAKGSGD--FTGRAAVQLWVGEKPNYNYGTNQC--ASG  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GC R +C+NG  +F++CNY P GN++GQ PY
Sbjct  113  QVCGHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWVGQRPY  159



>ref|NP_001275095.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
 ref|XP_006345693.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 ref|XP_006345695.1| PREDICTED: pathogenesis-related leaf protein 4-like [Solanum 
tuberosum]
 gb|AAL01594.1| pathogenesis-related protein 1b precursor [Solanum tuberosum]
Length=159

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L C++VL +   CDAQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIS-LLLTCLMVLAIFHSCDAQNSPQDYLAVHNDARAQVGVGPMSWDAGLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSG+   GEN+A G  +   T ++AV +WV E+  Y++ TN C    G
Sbjct  60   YANSRTGDCNLIHSGA---GENLAKGTGD--FTGRAAVQLWVGEKPNYNYGTNQC--ASG  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GC R +C+NG  +F++CNY P GN++GQ PY
Sbjct  113  QVCGHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWVGQRPY  159



>ref|XP_009135645.1| PREDICTED: pathogenesis-related protein 1 [Brassica rapa]
Length=168

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 125/175 (71%), Gaps = 10/175 (6%)
 Frame = +3

Query  36   IQRRKKMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQV  215
            + +R K   L + ++ L+C  +L       AQ+ +Q++L+AHN AR  VGV+P+ WDE+V
Sbjct  3    LVKRLKPSILLLFAIALSCNFILPSL----AQDWKQEFLEAHNEARHEVGVEPLVWDEEV  58

Query  216  EAYAQSYASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATN  392
              YA SYA+QR  DC+++HS    +GENIA + GD   ++A+ A +MW+ E++YYD+ +N
Sbjct  59   AGYASSYANQRVSDCAMVHSNGP-FGENIAWSSGD---MSAEDASEMWIDEKKYYDYDSN  114

Query  393  SCNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            +CN P G +C HYTQVVWRNSL++GCA+V C++G G F+TCNY PPGNY G+ PY
Sbjct  115  TCNDPNGGTCLHYTQVVWRNSLRLGCAKVVCNSG-GTFITCNYDPPGNYNGEKPY  168



>gb|AFR90191.1| pathogenesis-related protein 1a [Salsola ferganica]
Length=166

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 117/166 (70%), Gaps = 7/166 (4%)
 Frame = +3

Query  66   KISSLFLACIL-VLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYAS  242
            K +++ L  IL  + +   C AQNS QDY++AHNAARAAVGV  I WD ++ AYAQ YA+
Sbjct  6    KFATIALCFILATVTLAQMCHAQNSPQDYVNAHNAARAAVGVGKIQWDGKLAAYAQQYAN  65

Query  243  QRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESC  422
            QR GDC+L HSG   YGENIA GG     T + AV MWVAE+  Y++ +N+C A   + C
Sbjct  66   QRKGDCALKHSGG-PYGENIAVGGGP--FTGRDAVKMWVAEKANYNYNSNTCAA--NKVC  120

Query  423  GHYTQVVWRNSLKVGCARVQCSNGA-GYFVTCNYSPPGNYIGQSPY  557
            GHYTQVVWR S++VGCARV C++G   YFV C+Y P GNY+GQ PY
Sbjct  121  GHYTQVVWRKSVRVGCARVPCNSGPYSYFVICSYDPRGNYVGQKPY  166



>sp|P11670.1|PRB1_TOBAC RecName: Full=Basic form of pathogenesis-related protein 1; Short=PRP 
1; Flags: Precursor [Nicotiana tabacum]
 emb|CAA32228.1| PRP 1 precursor (AA -23 to 154) [Nicotiana tabacum]
 prf||1807333A pathogenesis-related protein 1
Length=177

 Score =   178 bits (452),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 120/169 (71%), Gaps = 11/169 (7%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWC-DAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MGFL   +  +AC +   + +    AQNS QDYL+ HNAAR  VGV P+TWD ++ AYAQ
Sbjct  1    MGFL---TTIVACFITFAILIHSSKAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAYAQ  57

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+QR GDC +IHS    YGEN+AA   +  L A  AV MWV E+++YD+ +NSC    
Sbjct  58   NYANQRIGDCGMIHSHG-PYGENLAAAFPQ--LNAAGAVKMWVDEKRFYDYNSNSC---V  111

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  CGHYTQVVWRNS+++GCARV+ +NG  +F+TCNY PPGN+IGQ P+
Sbjct  112  GGVCGHYTQVVWRNSVRLGCARVRSNNGW-FFITCNYDPPGNFIGQRPF  159



>emb|CAA47374.1| prb-1b [Nicotiana tabacum]
Length=179

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 119/166 (72%), Gaps = 7/166 (4%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCD-AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            +  S+  +AC +   +      AQNS QDYL+ HNAAR  VGV P+TWD ++ A+AQ+YA
Sbjct  1    MGYSTTLVACFITFAILFHSSQAQNSPQDYLNPHNAARRQVGVGPMTWDNRLAAFAQNYA  60

Query  240  SQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            +QR+GDC + HSG   YGEN+AA   +  L A  AV MWV E+Q+Y++ +N+C A  G  
Sbjct  61   NQRAGDCRMQHSGG-PYGENLAAAYPQ--LHAAGAVKMWVDEKQFYNYNSNTCAA--GNV  115

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  116  CGHYTQVVWRNSVRLGCARVRCNNG-WYFITCNYDPPGNWRGQRPY  160



>ref|XP_006367092.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=178

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 110/144 (76%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNS QDYL+ HN AR  VGV P+ WD ++ A+AQ+YA+QR GDC + HSG   YGEN+A
Sbjct  20   AQNSPQDYLNPHNEARRQVGVGPMAWDNRLAAFAQNYANQRIGDCRMQHSGG-PYGENLA  78

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
            AG  +  L A  AV MWV E+Q+YD+ +NSC   PG+ CGHYTQVVWRNS+++GCARV+C
Sbjct  79   AGFPQ--LNAAGAVKMWVDEKQWYDYNSNSCQ--PGKVCGHYTQVVWRNSVRLGCARVRC  134

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            +NG   F+TCNY PPGN+IGQ P+
Sbjct  135  NNGWD-FITCNYDPPGNWIGQRPF  157



>ref|XP_008372945.1| PREDICTED: pathogenesis-related protein 1-like [Malus domestica]
 gb|ABC47922.1| pathogenesis-related protein 1a [Malus domestica]
Length=161

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L  IL   +     AQ++ QDYL +HN ARAAVGV P+TWD++V  YAQ+
Sbjct  1    MGLCNIS-LALLFILGSVLIQSSHAQDTPQDYLKSHNDARAAVGVGPLTWDDKVAGYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+Q  GDC+L+HSG   YGEN+A    + S TA  AVDMWVAE+  Y + +NSC    G
Sbjct  60   YANQHVGDCNLVHSGG-PYGENLAMSTGDMSGTA--AVDMWVAEKADYSYESNSC--ADG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS +VGCA+V+CS+G G F+ CNY PPGNY+GQ PY
Sbjct  115  KVCGHYTQVVWRNSARVGCAKVRCSSG-GTFIGCNYDPPGNYVGQKPY  161



>emb|CAD60273.1| putative pathogenesis related protein 1 precursor [Vitis vinifera]
Length=161

 Score =   177 bits (450),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 120/169 (71%), Gaps = 9/169 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  + S L L C + L +   C AQNS QDY++AHNAARA VGV  ITW++ V AYAQ+
Sbjct  1    MGLCR-SPLALLCFMWLALAHICCAQNSPQDYVNAHNAARAQVGVGSITWNDTVAAYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R  DC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  60   YANKRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPP-GNYIGQSPY  557
              C HYTQVVW NS+++GCARVQC+NG  +FVTCNY PP GNYIGQ PY
Sbjct  114  GECLHYTQVVWSNSVRLGCARVQCNNGW-WFVTCNYDPPRGNYIGQRPY  161



>ref|XP_010904546.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=163

 Score =   177 bits (450),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGL--WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            + ISSL L+ I  + + L     AQNS QD+++ HNAARAAVGV P++W++ V AYAQ Y
Sbjct  1    MGISSLVLSTICAMALALVSISQAQNSPQDFINPHNAARAAVGVGPVSWNDAVAAYAQDY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A++R  DC L+HS    YGENI  GG     TA  AV+ WV+E+QYYD+A+NSC    G+
Sbjct  61   ANKRKADCQLVHSNG-PYGENIFWGGGP-GWTATVAVNDWVSERQYYDYASNSCAV--GQ  116

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVW  S+ +GCARV C NG   F+TCNY PPGNY+G+ PY
Sbjct  117  VCGHYTQVVWAKSVHIGCARVACDNG-DTFITCNYDPPGNYVGERPY  162



>ref|XP_009787160.1| PREDICTED: pathogenesis-related leaf protein 6-like [Nicotiana 
sylvestris]
Length=163

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 109/161 (68%), Gaps = 6/161 (4%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            S  L C ++L       AQNSQ DYL+AHN+AR  VGV  ITWD  +  YAQ+YA+QR G
Sbjct  9    STLLICFIILAFAFPSHAQNSQTDYLNAHNSARTQVGVSAITWDITLANYAQNYANQRIG  68

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC+L+HS    YGEN+A G    S T  +AV+MWVAE+ YYD+  N C    G  C HYT
Sbjct  69   DCNLVHSNG-PYGENLAKG--SGSFTGAAAVNMWVAEKPYYDYTNNCCTT--GNQCLHYT  123

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVW NS++VGCAR QCSNG  +FV C+Y PPGN +GQ PY
Sbjct  124  QVVWSNSVRVGCARAQCSNG-WWFVICSYDPPGNVVGQRPY  163



>dbj|BAC84725.1| putative pathogenesis-related protein 1 [Oryza sativa Japonica 
Group]
Length=156

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +3

Query  153  DAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGENIAAGGDENSL  329
            + HNAAR+ VGV P++WD+ V AYA+SYA+QR GDC+L HS S  +YGENI  G      
Sbjct  21   NPHNAARSDVGVGPVSWDDTVAAYAESYAAQRQGDCALEHSDSGGKYGENIFWGSAGGDW  80

Query  330  TAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFV  509
            TA SAV  WVAE+Q+YDH +NSC+AP G SCGHYTQVVW NS  +GCARV C N  G F+
Sbjct  81   TAASAVSSWVAEKQWYDHDSNSCSAPAGSSCGHYTQVVWSNSTAIGCARVVCDNSHGVFI  140

Query  510  TCNYSPPGNYIGQSPY  557
            TCNYSPPGNY G+ PY
Sbjct  141  TCNYSPPGNYNGKPPY  156



>gb|KDP37604.1| hypothetical protein JCGZ_06947 [Jatropha curcas]
Length=162

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 119/160 (74%), Gaps = 8/160 (5%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            LF+A +L+L +    +AQ + +DYL+AHN ARA VG+ P++WD++V AYAQ+YA+Q   +
Sbjct  11   LFIATVLLLPVPF--NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYANQHVSE  68

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C+L+HS    YGEN+A G  +  L+ + AV MWV E+ YYD+ +NSC   PG+ CGHYTQ
Sbjct  69   CNLVHS-EGPYGENLAWGSGD--LSVEEAVKMWVDEKTYYDYNSNSC--APGQVCGHYTQ  123

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWR S+++GCA+V C+NG G F+ CNY PPGNYIG+ PY
Sbjct  124  VVWRESVRLGCAKVTCTNG-GTFIGCNYDPPGNYIGKRPY  162



>ref|XP_008796972.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Phoenix 
dactylifera]
Length=162

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            +L LAC + L M     AQNS QD++ AHNAARAAVGV  ++WD+ V AYAQ+YA+QR G
Sbjct  7    TLALACAVFLAMAHTTIAQNSPQDFVSAHNAARAAVGVGSVSWDDTVAAYAQNYANQRIG  66

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC L HSG   YGEN+  G   +  TA  AV  WV E+Q+YD+ TN+C    G  CGHYT
Sbjct  67   DCQLKHSGG-PYGENLFWGSGAD-FTAADAVKSWVDEKQWYDYNTNTC--ASGHQCGHYT  122

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWR+S  +GCARV+C++GA  F+ CNY PPGN +GQ PY
Sbjct  123  QVVWRDSTNIGCARVKCNSGA-IFIICNYKPPGNIVGQRPY  162



>ref|XP_009388942.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 114/158 (72%), Gaps = 5/158 (3%)
 Frame = +3

Query  84   LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCS  263
            L C + L M     AQNS QD++DAHN+ARA VGV P++WD+ V AYAQ+YA++R GDC 
Sbjct  10   LVCAMALAMACTTLAQNSPQDFVDAHNSARADVGVGPVSWDDNVAAYAQNYANERIGDCQ  69

Query  264  LIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVV  443
            L+HSG   YGENI  G   +  TA  AV+ WV E+QYYD+ +NSC    G+ CGHYTQVV
Sbjct  70   LVHSGG-PYGENIFWGSGAD-FTAADAVNSWVDEKQYYDYDSNSC--ADGQVCGHYTQVV  125

Query  444  WRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            WR+S  +GCARVQC++GA  F+ CNY+P GN +G+ PY
Sbjct  126  WRDSTAIGCARVQCNSGA-IFIICNYNPAGNIVGKRPY  162



>ref|XP_008798894.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Phoenix 
dactylifera]
Length=162

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            +L L C +   M     AQNS +D++ AHNAARAAV V P++WD  V AYAQ+YA+QR G
Sbjct  7    ALALVCAMAFCMVGTTIAQNSPEDFVSAHNAARAAVNVGPVSWDSTVAAYAQNYANQRIG  66

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC L+HSG   YGEN+  GG    +TA  AV +WV E+Q+Y++ +N+C A  G+ CGHYT
Sbjct  67   DCKLVHSGG-PYGENL-VGGPGAEVTAADAVKLWVGEKQWYNYNSNTCAA--GKVCGHYT  122

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWR S  +GCARV+CS G G F+TCNY P GN +GQ PY
Sbjct  123  QVVWRASTSIGCARVKCS-GGGIFITCNYKPAGNIVGQRPY  162



>ref|XP_003608310.1| F-box/FBD/LRR-repeat protein [Medicago truncatula]
Length=908

 Score =   190 bits (483),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 93/169 (55%), Positives = 116/169 (69%), Gaps = 6/169 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGL-WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            M F    SLF   + +L +   + +AQN  QD++DAHN ARA VGV  ITWD  V  YA 
Sbjct  1    MSFNNTFSLFSLFLTILSLWFSFSNAQNLPQDFVDAHNTARAQVGVANITWDNTVATYAL  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            +YA+ R  DC+L+HS    YGEN+A  G   + T  +AV+MWV E+QYYD+ TNSC    
Sbjct  61   NYANSRKSDCNLVHSNG-PYGENLAK-GSSGTFTGVTAVNMWVNEKQYYDYNTNSC--IN  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  C HYTQVVWRNS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  117  GGQCLHYTQVVWRNSVRLGCARVQCTNG-WWFVTCNYDPPGNYVGQKPY  164



>ref|XP_009378591.1| PREDICTED: pathogenesis-related leaf protein 4-like [Pyrus x 
bretschneideri]
Length=161

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  K +S  L C++ L +     AQNS QDYL+AHNAARA VGV P++WD  +  YAQ 
Sbjct  1    MGLWK-TSFALVCLISLTLLPSSHAQNSPQDYLNAHNAARAQVGVAPLSWDTNLVNYAQR  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R GDC+L+HSG   YGENIA+ G +  L+  +AV+++V+E+  Y++ +N+C A  G
Sbjct  60   YANSRIGDCNLVHSGG-PYGENIASSGGD--LSGTAAVNLFVSEKANYNYYSNTCAA--G  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S ++GCA+V+C+NG G F+ CNY PPGNY GQ PY
Sbjct  115  KMCGHYTQVVWRSSTRLGCAKVRCNNG-GTFIGCNYDPPGNYAGQKPY  161



>dbj|BAD11072.1| pathogenesis-related protein 1 [Capsicum chinense]
Length=161

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 119/166 (72%), Gaps = 9/166 (5%)
 Frame = +3

Query  57   GFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            G   IS L L  +++L +   CDAQNS QDYL+ HN ARA VGV P+TWD  + + AQ+Y
Sbjct  2    GLFNIS-LLLVSLMILAIFHSCDAQNSPQDYLEVHNNARAQVGVGPMTWDAGLASRAQNY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A+ R+GDC+LIHSG    GEN+A GG +   T ++AV++WV E+  Y+H TN C +  G+
Sbjct  61   ANSRTGDCNLIHSGP---GENLAKGGGD--FTGRAAVELWVFEKPNYNHGTNQCAS--GK  113

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSP  554
             CGHYTQVVWRNS+++GC R +C+NG  +F++CNY P GN+ GQSP
Sbjct  114  VCGHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWAGQSP  158



>ref|XP_002522065.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40265.1| STS14 protein precursor, putative [Ricinus communis]
Length=161

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 113/145 (78%), Gaps = 8/145 (6%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQN  QDY++AHNAARAAVGV P+TWD  V AYAQ+YA+QR  DC L+HSG  +YGENIA
Sbjct  24   AQNLPQDYINAHNAARAAVGVGPMTWDNTVAAYAQNYANQRINDCRLVHSGG-RYGENIA  82

Query  306  -AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             + GD   L+  +AV +WV E+ +Y++ +N+C A  G+ CGHYTQVVWRNS+++GCA+V+
Sbjct  83   WSSGD---LSGTAAVKLWVDEKAFYNYNSNTCAA--GQQCGHYTQVVWRNSVRLGCAKVR  137

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C NG G F+TCNY PPGN++ Q PY
Sbjct  138  CRNG-GTFITCNYDPPGNFVNQRPY  161



>gb|ABK41053.2| pathogenesis-related protein 1 [Musa acuminata]
Length=162

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 116/167 (69%), Gaps = 12/167 (7%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            +  L   +L +AC  +L       AQNS QD++  HNAARAAVGV P++WD  V AYAQ+
Sbjct  8    LAMLSAVALAMACTGIL-------AQNSPQDFVSPHNAARAAVGVGPVSWDNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR+ DC L+HSG   YGENI  G   +  TA  AV+ WV+E+QYYD+ +N+C   P 
Sbjct  61   YANQRAADCQLVHSGG-PYGENIFWGSGRD-YTAADAVNAWVSEKQYYDYNSNTC--APN  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSP  554
            + CGHYTQVVWR+S  +GC RV+C++GA  F+ CNY PPGNY+GQ P
Sbjct  117  KVCGHYTQVVWRSSTAIGCGRVRCNSGA-IFIICNYKPPGNYVGQRP  162



>ref|XP_004289700.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Fragaria vesca subsp. vesca]
Length=164

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +3

Query  81   FLACILVLEMGLWCD---AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
             L C +VL + L      AQNS QDY+DAHNAAR  VGV  ITWD+ V AYAQ YA+ RS
Sbjct  7    ILLCFIVLTVVLLVQPSHAQNSPQDYVDAHNAARLRVGVPNITWDDTVAAYAQHYANLRS  66

Query  252  GDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            GDCSL+HS    YGEN+A G    ++T  +AV++W+ E+ YY+H +N C    G  C HY
Sbjct  67   GDCSLVHSHGP-YGENLAYGYGSGAITGVNAVNLWLEEKPYYNHNSNCC---VGGECLHY  122

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQV+W  S+++GCARVQCSN   +FVTCNY PPGNY G+ PY
Sbjct  123  TQVIWHYSIRLGCARVQCSNPGCWFVTCNYDPPGNYYGKRPY  164



>ref|XP_010489949.1| PREDICTED: pathogenesis-related protein 1A-like [Camelina sativa]
Length=161

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M  LK + L L  I +L   L   A++ +Q++L+  N AR AVG+ P+ WD++V AYA S
Sbjct  1    MSLLKTNILLLFAISLLYGSL---AEDLKQEFLEPQNEARNAVGLDPLVWDDEVAAYAAS  57

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+L+HS    +GENIA    E  ++A+ A  MW+ E+QYYD+++N+CN P G
Sbjct  58   YANQRISDCALVHSNGP-FGENIAMSSGE--MSAEDAAGMWINEKQYYDYSSNTCNDPYG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             +C HYTQVVWRN++++GCA+V C NG G F+TCNY PPGNY G++PY
Sbjct  115  GTCLHYTQVVWRNTVRLGCAKVVC-NGGGTFITCNYDPPGNYNGETPY  161



>gb|AAQ19681.1| cytoplasmic small heat shock protein class I [Capsicum frutescens]
Length=158

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   I  L L C++VL +   C AQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIP-LLLVCLIVLAIFHSCHAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDCSLIHSG+   GEN+A GG +   T + AV++WV+E+  Y+HATN C    G
Sbjct  60   YANSRTGDCSLIHSGA---GENLAKGGGD--YTGRRAVELWVSEKPNYNHATNQC---AG  111

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVWRNS+++GC R +C+NG  +F++CNY P GN++GQ PY
Sbjct  112  GECRHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWVGQRPY  158



>ref|XP_002522070.1| STS14 protein precursor, putative [Ricinus communis]
 gb|EEF40270.1| STS14 protein precursor, putative [Ricinus communis]
Length=162

 Score =   176 bits (447),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 8/162 (5%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL L CI+ + +     AQ++QQDYL+AHN+AR  VG+ P+TWD++V +YAQ +A+Q   
Sbjct  7    SLALVCIISIALIFSSHAQDTQQDYLNAHNSARGDVGLGPLTWDDKVASYAQHHANQHKS  66

Query  255  DCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            DCSL+HS    YGEN+A + GD   L+   AV MW+ E+ YYD+ +NSC +  G+ CGHY
Sbjct  67   DCSLVHS-EGPYGENLAWSSGD---LSGTDAVKMWIDEKPYYDYNSNSCAS--GQICGHY  120

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWR+S+++GCA+V C+NG G F+ CNY PPGNYIGQ PY
Sbjct  121  TQVVWRSSVRLGCAKVSCNNG-GTFIGCNYDPPGNYIGQRPY  161



>ref|XP_007148301.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
 gb|ESW20295.1| hypothetical protein PHAVU_006G196900g [Phaseolus vulgaris]
Length=183

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 120/177 (68%), Gaps = 10/177 (6%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGL--WCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            MG   I  L L  IL+    L   CDAQNS QD+L+AHN AR+ VGV P+ WD  V ++A
Sbjct  1    MGLPMIPMLPLVAILLATSTLSQICDAQNSPQDFLNAHNTARSQVGVGPMRWDATVASFA  60

Query  228  QSYASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNA  404
            Q+Y ++  G+C ++HSG   YGEN+A + GD   LTA +AV +WV E+ YYD+ +N+C  
Sbjct  61   QNYVNKLKGNCKMVHSGGP-YGENLAWSSGD---LTATAAVKLWVGEKPYYDYNSNTCV-  115

Query  405  PPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY*I*DFH  575
              G  C HYTQVVWRNS+++GCA+V+C++G    ++CNY PPGNYIGQ P+ I  F 
Sbjct  116  --GGECRHYTQVVWRNSVRLGCAKVRCNDGRATIISCNYDPPGNYIGQRPFDISPFQ  170



>ref|XP_009342365.1| PREDICTED: pathogenesis-related protein 1-like [Pyrus x bretschneideri]
Length=161

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L  IL   +     AQ++ QDYL++HN ARAAVGV P+TWD+ V  YAQ+
Sbjct  1    MGLCNIS-LALLFILGSVLIQSSHAQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+Q  GDC+L+HSG   YGEN+A    + S TA  AVD+WVAE+  Y++ +NSC    G
Sbjct  60   YANQHVGDCNLVHSGG-PYGENLAMSTGDMSGTA--AVDLWVAEKADYNYESNSC--ADG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS +VGCA+V+CS+G G F+ CNY PPGNY+G+ PY
Sbjct  115  KVCGHYTQVVWRNSARVGCAKVRCSSG-GTFIGCNYDPPGNYVGEKPY  161



>ref|XP_009378592.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Pyrus 
x bretschneideri]
Length=161

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L  IL   +     AQ++ QDYL++HNAARAAVGV P+TWD+ V  YAQ+
Sbjct  1    MGLCNIS-LALLFILGSVLIQSSHAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+Q  GDC+L+HSG   YGEN+A    + S TA  AVDMWVAE+  Y++ +NSC    G
Sbjct  60   YANQHVGDCNLVHSGG-PYGENLAMSSVDMSGTA--AVDMWVAEKADYNYESNSC--ADG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS +VGCA+V+CS+G G F+ CNY PPGNY G+ PY
Sbjct  115  KVCGHYTQVVWRNSARVGCAKVRCSSG-GTFIGCNYDPPGNYGGEKPY  161



>gb|AGS80328.1| pathogenesis-related protein 1 [Actinidia eriantha]
Length=173

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 119/169 (70%), Gaps = 8/169 (5%)
 Frame = +3

Query  54   MGFL-KISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MG+L ++SSL LA ++VL M     AQNS QDYL+AHNAARAAVGV PI WD  +  YA+
Sbjct  1    MGWLCRMSSLALASLMVLAMVHSSLAQNSPQDYLNAHNAARAAVGVGPIRWDNNLANYAR  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
             YA+ R  DC+L+HS    YGEN+A G     LT + +V MWV E++YYD+ +NSC    
Sbjct  61   DYANSRIKDCNLVHS-KGPYGENLAKGFP--GLTGRDSVKMWVDEKKYYDYNSNSC---I  114

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  CGHYTQVVW  S++VGCARV+C+NG  +F+ C+Y PPGN  GQ PY
Sbjct  115  GGVCGHYTQVVWSRSVRVGCARVKCTNGW-WFIICSYDPPGNVSGQRPY  162



>ref|XP_006406470.1| hypothetical protein EUTSA_v10022205mg [Eutrema salsugineum]
 gb|ESQ47923.1| hypothetical protein EUTSA_v10022205mg [Eutrema salsugineum]
Length=165

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 123/170 (72%), Gaps = 7/170 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILV-LEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            M  LK + LFL  I +   + +   A++ +QD+L+AHN AR  VG+ P+ WD++V AYA 
Sbjct  1    MSLLKTNILFLFAIAISYSLTVPSLAEDWKQDFLEAHNEARNEVGLSPLVWDDEVAAYAS  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            SYA+QR  DC+++HS    +GENIA + GD   ++A+ A +MW+ E++YYD+ +N+CN P
Sbjct  61   SYANQRISDCAMVHSNGP-FGENIAWSSGD---MSAEDASEMWIDEKKYYDYNSNTCNDP  116

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G +C HYTQVVW+N+L++GCA+V C++G G F+TCNY PPGNYIG  PY
Sbjct  117  NGGTCLHYTQVVWQNTLRLGCAKVVCNSG-GTFITCNYDPPGNYIGVKPY  165



>ref|XP_009398311.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score =   176 bits (446),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 8/168 (5%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCD---AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            ++ S+  LA +  + + + C    AQNS QD++  HNAAR AVGV P++WD  V AYAQ+
Sbjct  1    MRSSNPALAMLCTVALAMACTSTLAQNSPQDFVSPHNAARTAVGVVPVSWDSTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR+ DC L+HSG   YGENI +G   +  TA  A+  WV+E+QYY+H +N C   P 
Sbjct  61   YANQRAADCQLVHSGG-PYGENIFSGFGRD-YTAADAIKYWVSEKQYYNHNSNKC--APN  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S  +GC RV+C++G G F+TCNY PPGN  GQSPY
Sbjct  117  KVCGHYTQVVWRSSTAIGCGRVRCNSG-GIFITCNYKPPGNIEGQSPY  163



>ref|XP_004289697.1| PREDICTED: pathogenesis-related protein 1C-like [Fragaria vesca 
subsp. vesca]
Length=164

 Score =   176 bits (446),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 118/169 (70%), Gaps = 9/169 (5%)
 Frame = +3

Query  51   KMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            KM F  IS   L   + L +     AQ++ QDYLDAHNAARAAVGV P+TWD+QV  +AQ
Sbjct  5    KMSFALIS---LTAAISLALLHSIHAQDTPQDYLDAHNAARAAVGVAPLTWDDQVARFAQ  61

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
             YA+    DC L+HS   QYGEN+A G  +  L+   AV++W+ E+  YD+ +N+C A  
Sbjct  62   DYANTHVDDCQLVHSNG-QYGENLAMGSGD--LSGTDAVNLWIGEKADYDYNSNTCAA--  116

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G+ CGHYTQVVWRNSL VGCA+V+C++G G F+ CNY PPGN++G+ PY
Sbjct  117  GKVCGHYTQVVWRNSLHVGCAKVRCNSG-GTFIGCNYDPPGNWVGEKPY  164



>ref|XP_009335379.1| PREDICTED: LOW QUALITY PROTEIN: basic form of pathogenesis-related 
protein 1 [Pyrus x bretschneideri]
Length=157

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/163 (56%), Positives = 117/163 (72%), Gaps = 9/163 (6%)
 Frame = +3

Query  78   LFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
            + + CI+V+ +G       QNSQQD+L+AHNA RA V V  I WD  V AYAQ+YA+ R 
Sbjct  1    MAVLCIVVMALGQVHPSHTQNSQQDFLNAHNAVRAQVYVPDIVWDNAVAAYAQNYANSRI  60

Query  252  GDCSLIHSGSQ-QYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGH  428
            GDC+L+HS S   YGE +A G    S T  +AV++WVAE+  YD+ +NSC    G+ C H
Sbjct  61   GDCNLVHSNSNGTYGEKLAKG--SGSFTGVAAVNLWVAEKPNYDYNSNSCX---GQQCLH  115

Query  429  YTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            YTQVVW+NS+K+GCARVQC+NG  +FVTCNYSPPGNY+GQ PY
Sbjct  116  YTQVVWKNSVKLGCARVQCTNG-WWFVTCNYSPPGNYVGQRPY  157



>ref|XP_010507919.1| PREDICTED: pathogenesis-related protein 1A-like [Camelina sativa]
Length=161

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 117/168 (70%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M  LK + L L  I +    L   A + +Q++L+  N AR AVG+ P+ WD++V AYA S
Sbjct  1    MSLLKTNILLLFAISLFYGSL---ADDLRQEFLEPQNEARNAVGLDPLVWDDEVAAYAAS  57

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR  DC+LIHS    +GENIA    E  ++A+ A  MW+ E+QYYD+++N+CN P G
Sbjct  58   YANQRISDCALIHSNGP-FGENIAMSSGE--MSAEDAAGMWINEKQYYDYSSNTCNDPNG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             +C HYTQVVWRN++++GCA+V C NG G F+TCNY PPGNY G++PY
Sbjct  115  GTCLHYTQVVWRNTVRLGCAKVVC-NGGGTFITCNYDPPGNYNGETPY  161



>ref|XP_008455064.1| PREDICTED: pathogenesis-related protein PRB1-2-like [Cucumis 
melo]
Length=164

 Score =   176 bits (445),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 114/156 (73%), Gaps = 5/156 (3%)
 Frame = +3

Query  90   CILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLI  269
            C+L   M     AQ+S +D+++AHNAARA VGV P+ WDE+V ++A+ YA+QR  DC L+
Sbjct  14   CVLTFIMLPSSLAQDSPRDFVNAHNAARAQVGVGPVHWDERVASFARQYANQRINDCRLV  73

Query  270  HSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWR  449
            HSG   YGENIA G  +  L+  +AV MWV E+Q+Y++ +N+C A  G+ CGHYTQVVWR
Sbjct  74   HSGGP-YGENIAWGMPD--LSGTAAVQMWVNEKQFYNYGSNTCAA--GKVCGHYTQVVWR  128

Query  450  NSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            NS+++GCA+V+C+N  G F+ CNY P GN IGQ PY
Sbjct  129  NSVRIGCAKVRCTNNRGTFIICNYEPRGNIIGQKPY  164



>ref|XP_010530685.1| PREDICTED: pathogenesis-related protein 1-like [Tarenaya hassleriana]
Length=140

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQ+  QD++DAHN ARA VGV PI WDE V AYA+ YA+QR GDCSL HS S  YGENIA
Sbjct  3    AQDQPQDFVDAHNRARAEVGVGPIEWDETVAAYARDYANQRRGDCSLTHS-SGPYGENIA  61

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             GG +  L+  +AV MWV E+  YD+ TN+C A  G+ CGHYTQ+VWRNS+++GCA+V C
Sbjct  62   WGGGD--LSGTAAVKMWVDEKADYDYNTNTCRA--GKQCGHYTQIVWRNSVRLGCAKVTC  117

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
             +G G F+TCNY P GN+IGQ PY
Sbjct  118  DDG-GTFITCNYDPRGNFIGQWPY  140



>ref|XP_007041422.1| Pathogenesis-related protein 1 [Theobroma cacao]
 gb|EOX97253.1| Pathogenesis-related protein 1 [Theobroma cacao]
Length=156

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 119/168 (71%), Gaps = 12/168 (7%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  +IS     C+L L +     AQNS QDYL+AHN+ARA V V P+ WD++V AYA +
Sbjct  1    MGMSRISLAINFCLLGLAI-----AQNSPQDYLNAHNSARARVNVGPMRWDDRVAAYATN  55

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR GDC L+HSG   YGEN+A    +  L+  +AV++WVAE+  YD+ +NSC    G
Sbjct  56   YANQRKGDCRLVHSGG-PYGENLAWSSAD--LSGTAAVNLWVAERPNYDYNSNSC---VG  109

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVWRNS+++GCA+V+C++G G F+TCNY PPGNY+ Q PY
Sbjct  110  GECRHYTQVVWRNSVRLGCAKVRCNSG-GTFITCNYDPPGNYVNQRPY  156



>gb|AAX20041.1| cytoplasmic small heat shock protein class I [Capsicum annuum]
 gb|AHZ65519.1| cytoplasmic small heat shock protein class I [Capsicum annuum 
Conoides Group]
Length=158

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   I  L L C++VL +   C AQNS QDYL  HN ARA VGV P++WD  + + AQ+
Sbjct  1    MGLFNIP-LLLVCLIVLAIFHSCHAQNSPQDYLAVHNNARAQVGVGPMSWDAGLASRAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+LIHSG+   GEN+A GG +   T + AV++WV+E+  Y+HATN C    G
Sbjct  60   YANSRTGDCNLIHSGA---GENLAKGGGD--YTGRRAVELWVSEKPNYNHATNQC---AG  111

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVWRNS+++GC R +C+NG  +F++CNY P GN++GQ PY
Sbjct  112  GECRHYTQVVWRNSVRLGCGRARCNNGW-WFISCNYDPVGNWVGQRPY  158



>gb|AFM76999.1| pathogenesis related protein 1a, partial [Pyrus communis]
Length=153

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQ++ QDYL++HN ARAAVGV P+TWD+ V  YAQ+YA+Q  GDCSL+HSG   YGEN+A
Sbjct  16   AQDTPQDYLNSHNTARAAVGVGPLTWDDNVAGYAQNYANQHVGDCSLVHSGG-PYGENLA  74

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
                + S TA  AVD+WVAE+  Y++ +NSC    G+ CGHYTQVVWRNS +VGCA+V+C
Sbjct  75   MSTGDMSGTA--AVDLWVAEKADYNYESNSC--ADGKVCGHYTQVVWRNSARVGCAKVRC  130

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            S+G G F+ CNY PPGNY+G+ PY
Sbjct  131  SSG-GTFIGCNYDPPGNYVGEKPY  153



>ref|XP_004289699.1| PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca 
subsp. vesca]
Length=162

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 118/169 (70%), Gaps = 8/169 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M   KIS L L  ++ L +     AQNS QDYL+AHN+ARAAVGV  +TWD  + AYAQ 
Sbjct  1    MELSKISILSLISLVALALLHSTHAQNSPQDYLNAHNSARAAVGVGGLTWDPNLAAYAQR  60

Query  234  YASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            YA+   GDC+L+HS +  YGEN+A + GD   L+  SAV++WV E+ YY++ +N+C    
Sbjct  61   YANSHYGDCNLVHS-NGPYGENLAKSSGD---LSGTSAVNLWVGEKAYYNYNSNTC--AS  114

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  CGHYTQVVWR S++VGCARV+C NG G F+ CNY P GNY+GQ PY
Sbjct  115  GRVCGHYTQVVWRKSVRVGCARVKCMNG-GTFIGCNYDPRGNYVGQKPY  162



>gb|ADN43443.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
 gb|ADN43444.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   175 bits (444),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY++AHNAARA VGV  +TW++ V AYAQ+
Sbjct  1    MGLFKISLPLLVGLVGLALAHVCCAQNSPQDYVNAHNAARAQVGVGSMTWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R  DC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YANKRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVW NS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECLHYTQVVWSNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>ref|XP_010691519.1| PREDICTED: pathogenesis-related protein 1A-like [Beta vulgaris 
subsp. vulgaris]
Length=166

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 114/171 (67%), Gaps = 8/171 (5%)
 Frame = +3

Query  54   MGFLKIS--SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            M  +K S     +A +L   + + C AQN+ +DY+  HNAARAAVGV P+ W + V AYA
Sbjct  1    MFIMKTSLPKFAIALVLTTLLHVQCQAQNTPKDYIAVHNAARAAVGVGPLAWSDTVAAYA  60

Query  228  QSYASQRSGDCSLIHSGSQQYGENIAAG-GDENSLTAKSAVDMWVAEQQYYDHATNSCNA  404
            Q YA+QR+ DC L+HS +  YGENIA G G   +L+    V +W+ E+  YD+ +NSC  
Sbjct  61   QQYANQRAADCRLVHSNT-NYGENIAEGYGSYGALSGVDGVKLWINEKSMYDYHSNSCT-  118

Query  405  PPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
                 CGHYTQVVWR S+++GCARV C NG G F+TCNY PPGNYIG+ PY
Sbjct  119  --NGDCGHYTQVVWRESVRLGCARVLCKNG-GAFITCNYDPPGNYIGERPY  166



>gb|EMT26678.1| Pathogenesis-related protein 1 [Aegilops tauschii]
Length=146

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 105/146 (72%), Gaps = 6/146 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHS--GSQQYGEN  299
            AQNS+QD++DAHNAARA VG+  +TWD  V A+AQ YA QR GDC LIH+  G   YG  
Sbjct  5    AQNSEQDFVDAHNAARADVGLGEVTWDATVAAFAQDYADQRRGDCQLIHTPDGRPYYGGG  64

Query  300  IAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARV  479
                      TA  AV+ WV+E+QYYDH +N+C+AP GESCGHYTQVVWR+S  +GCARV
Sbjct  65   GGG----TEWTATDAVNSWVSEKQYYDHDSNTCSAPDGESCGHYTQVVWRDSTAIGCARV  120

Query  480  QCSNGAGYFVTCNYSPPGNYIGQSPY  557
             C +G G F+ C+Y+PPGN+ G SPY
Sbjct  121  VCDSGDGVFIICSYNPPGNFPGVSPY  146



>emb|CDX82282.1| BnaA03g35390D [Brassica napus]
Length=168

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 123/174 (71%), Gaps = 8/174 (5%)
 Frame = +3

Query  36   IQRRKKMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQV  215
            + +R K   L I ++ L+C  +L       AQ+ +Q++L+AHN AR  VGV+P+ W ++V
Sbjct  3    LVKRLKPSILLIFAIALSCNFILPSL----AQDWKQEFLEAHNEARHEVGVEPLVWSDEV  58

Query  216  EAYAQSYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNS  395
             AYA SYA+QR  DC+++HS    +GENIA    +  ++A+ A +MW+ E++YYD+ +N+
Sbjct  59   AAYASSYANQRVSDCAMVHSNGP-FGENIAWSSVD--MSAEDASEMWIDEKKYYDYDSNT  115

Query  396  CNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CN P G +C HYTQVVWRNSL++GCA+V C++G G F+TCNY PPGNY G+ PY
Sbjct  116  CNDPNGGTCLHYTQVVWRNSLRLGCAKVVCNSG-GTFITCNYDPPGNYNGEKPY  168



>ref|XP_003593358.1| Pathogenesis-related protein 1a [Medicago truncatula]
 gb|AES63609.1| CAP, cysteine-rich secretory protein, antigen 5 [Medicago truncatula]
Length=162

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 115/167 (69%), Gaps = 9/167 (5%)
 Frame = +3

Query  69   ISSLFLACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYAS  242
            +SS  L C+L L + +     AQNSQ DY++AHN AR  VGV  I WD  V ++AQ YA+
Sbjct  1    MSSFSLLCVLGLSLIMVHVAHAQNSQSDYVNAHNDARRQVGVANIVWDNTVASFAQDYAN  60

Query  243  QRSGDCSLIHSGSQ-QYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            QR GDC LIHSG   +YGEN+A + GD   ++   AV +WV E+  YD+ +N+C    G+
Sbjct  61   QRKGDCQLIHSGGGGRYGENLAWSSGD---MSGSDAVKLWVNEKADYDYNSNTC--ASGK  115

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVWRNS +VGCA+V+C N  G F+TCNY PPGNY+G+ PY
Sbjct  116  VCGHYTQVVWRNSQRVGCAKVRCDNNRGTFITCNYDPPGNYVGEKPY  162



>ref|XP_010687897.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Beta 
vulgaris subsp. vulgaris]
Length=164

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 112/156 (72%), Gaps = 5/156 (3%)
 Frame = +3

Query  93   ILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIH  272
            + +L +   C AQNS QD++DAHNAARAAV V  I WD+QV AYAQ YA+QR GDC+  H
Sbjct  13   LAILALAQMCYAQNSPQDFVDAHNAARAAVNVGNIQWDDQVAAYAQQYANQRIGDCAGQH  72

Query  273  SGSQQYGENIAAGGDEN-SLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWR  449
            SG   YGENIA GG     L+   AV+MWV+E+  YDH +NSC     + C HYTQVVWR
Sbjct  73   SGG-PYGENIAGGGSGGYELSGIDAVNMWVSEKVNYDHNSNSC--ATNKECRHYTQVVWR  129

Query  450  NSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            +S+++GCARV C++G G FV CNY PPGN+IG SPY
Sbjct  130  DSIRLGCARVLCNSG-GIFVICNYDPPGNFIGSSPY  164



>ref|XP_006367102.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=167

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 6/161 (4%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            S+++AC++   +      QN  Q+YL  HN AR  VGV P+TW+  +  YAQ+YA+QR G
Sbjct  4    SIWVACLITFSIFHSSQGQNCPQNYLIPHNEARRQVGVGPMTWNNSLADYAQNYANQRIG  63

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC +IHS    YGEN+AA   +  L A  AV MWV E+Q+YD  +N+C    GE CGHYT
Sbjct  64   DCGMIHS-QGPYGENLAAAFPD--LNAADAVKMWVDEKQWYDSDSNTCAL--GEVCGHYT  118

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWRNS++VGCA+VQC+NG  YF+TCNY PPGNYIGQ PY
Sbjct  119  QVVWRNSIRVGCAKVQCNNGW-YFITCNYDPPGNYIGQRPY  158



>ref|XP_002313932.2| pathogenesis-related family protein [Populus trichocarpa]
 gb|EEE87887.2| pathogenesis-related family protein [Populus trichocarpa]
Length=160

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 117/168 (70%), Gaps = 8/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M   KI  L L  ++ L +     AQNSQQDYL+AHNAAR+ V V  I WD  V AYA +
Sbjct  1    MAMSKILPL-LVYLVSLALAHPSHAQNSQQDYLNAHNAARSQVTVANIIWDNTVAAYALN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R  DC+L+HS    YGEN+A G    S T  +AV++WVAE+ YYD+A+NSC    G
Sbjct  60   YANSRISDCNLVHSNG-PYGENLAKG--SGSFTGTAAVNLWVAEKPYYDYASNSC---VG  113

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVWRNS++VGCARV+C+NG  +FV+CNY PPGNYIG+ PY
Sbjct  114  GQCLHYTQVVWRNSVRVGCARVKCTNG-WWFVSCNYDPPGNYIGERPY  160



>ref|XP_010525646.1| PREDICTED: pathogenesis-related leaf protein 6-like [Tarenaya 
hassleriana]
Length=163

 Score =   175 bits (443),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 9/166 (5%)
 Frame = +3

Query  69   ISSLFLACILVLEMGLWC---DAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            +  LF   +  + +GL       QN+ Q YL+AHN+AR  VGV  I WD+ V AYAQSYA
Sbjct  4    LGPLFRVAVFAIAIGLQVVVSSGQNTAQGYLNAHNSARTQVGVANIAWDDTVAAYAQSYA  63

Query  240  SQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            + R+ DCSL+HS +  YGEN+A G    S T  +AV++WVAE+ YY++ TNSC    G+ 
Sbjct  64   NSRASDCSLVHS-NGPYGENLAKG--SGSFTGTAAVNLWVAEKLYYNYTTNSCTG--GKQ  118

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            C HYTQVVWR+S+++GCARVQC +G  +FVTCNY PPGNY+G+ PY
Sbjct  119  CLHYTQVVWRDSVRLGCARVQCIDGY-WFVTCNYDPPGNYVGERPY  163



>ref|XP_009342367.1| PREDICTED: pathogenesis-related protein PR-1 type-like [Pyrus 
x bretschneideri]
Length=161

 Score =   175 bits (443),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 120/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   IS L L  IL   +     AQ++ QDYL++HNAARAAVGV P+TWD+ V  YAQ+
Sbjct  1    MGSCNIS-LALLFILGSVLIQSSHAQDTPQDYLNSHNAARAAVGVGPLTWDDNVAGYAQN  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+Q  GDC+L+HSG   YGEN+A    + S TA  AVDMWVAE+  Y++ +NSC    G
Sbjct  60   YANQHVGDCNLVHSGG-PYGENLAMSSVDMSGTA--AVDMWVAEKADYNYESNSC--ADG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS +VGCA+V+CS+G G F+ CNY PPGN +G+ PY
Sbjct  115  KVCGHYTQVVWRNSARVGCAKVRCSSG-GTFIGCNYDPPGNLVGKKPY  161



>ref|XP_008798895.1| PREDICTED: pathogenesis-related protein 1-like [Phoenix dactylifera]
Length=162

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 6/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG   I+ LF+   + L +     AQNS QD+++ HNAARAAVGV P++W+  V AYAQ 
Sbjct  1    MGMSSIA-LFMISAMALAIVPISHAQNSPQDFINPHNAARAAVGVGPVSWNATVAAYAQD  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R  DC L+HS    YGENI  GG     TA  AV+ WV+E+QYYD+A+NSC   P 
Sbjct  60   YANKRKADCELVHSNG-PYGENIFWGGGP-GWTAADAVNDWVSEKQYYDYASNSC--APS  115

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQ VW  S+ +GCARV C NG   F+TCNY PPGNY+G+ PY
Sbjct  116  QVCGHYTQAVWAKSVYIGCARVTCDNG-DTFITCNYDPPGNYVGERPY  162



>ref|XP_006657421.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Oryza brachyantha]
Length=171

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 118/171 (69%), Gaps = 6/171 (4%)
 Frame = +3

Query  63   LKISSLFLACILVLEMG-----LWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            +  SS  L C LV+ +        C AQNS QD++D HNAARA VGV P+TWD+ V AYA
Sbjct  1    MASSSSRLTCCLVVVLAAAMATTTCVAQNSPQDFVDPHNAARADVGVGPVTWDDTVAAYA  60

Query  228  QSYASQRSGDCSLIHSGSQ-QYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNA  404
            Q+YA QR GDC L HS S  +YGENI  G    + +A  AV  WV+E+++YDH +NS  A
Sbjct  61   QAYAEQRRGDCQLRHSDSGGKYGENIFWGSAGAAWSAADAVSSWVSEKEWYDHDSNSWAA  120

Query  405  PPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            P G SCGHYTQVVWR+S  +GCARV C N  G F+TCNYSPPGN+ GQSPY
Sbjct  121  PEGSSCGHYTQVVWRDSTAIGCARVDCDNDLGVFITCNYSPPGNFEGQSPY  171



>emb|CDY22960.1| BnaC03g41090D [Brassica napus]
Length=168

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 125/175 (71%), Gaps = 10/175 (6%)
 Frame = +3

Query  36   IQRRKKMGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQV  215
            + +R K   L + ++ L+C  +L       AQ+ +Q++L+AHN AR  VGV+P+ W ++V
Sbjct  3    LVKRLKPSILLLFAIALSCNFILPSL----AQDWKQEFLEAHNEARHEVGVEPLVWSDEV  58

Query  216  EAYAQSYASQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATN  392
             AYA SYA+QR  DC+++HS    +GENIA + GD   ++A+ A +MW+ E++YYD+ +N
Sbjct  59   AAYASSYANQRVSDCAMVHSNGP-FGENIAWSSGD---MSAEDASEMWIDEKKYYDYDSN  114

Query  393  SCNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            +CN P G +C HYTQVVWRNS+++GCA+V C++G G F+TCNY PPGNY G+ PY
Sbjct  115  TCNDPNGGTCLHYTQVVWRNSIRLGCAKVVCNSG-GTFITCNYDPPGNYNGEKPY  168



>dbj|BAF03626.1| pathogenesis related protein 1 [Eutrema japonicum]
Length=161

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 113/160 (71%), Gaps = 8/160 (5%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            L +   LV  + L   AQ+S QDYL  HN ARAAVGV P+ WD++V A+A+SYA QR GD
Sbjct  10   LLILAALVGAIVLPSKAQDSPQDYLRVHNQARAAVGVGPMQWDDRVAAFARSYADQRRGD  69

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C LIHSG   YGEN+A G  +  L+  SAV+MWV E+  Y++ +N+CN      CGHYTQ
Sbjct  70   CRLIHSGG-PYGENLAWGSSD--LSGISAVNMWVNEKANYNYPSNTCNG----VCGHYTQ  122

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWRNS+++GCA+V+C+NG G  + CNY PPGNY+ Q PY
Sbjct  123  VVWRNSVRLGCAKVRCNNG-GTIIVCNYDPPGNYVNQKPY  161



>ref|XP_009398310.1| PREDICTED: pathogenesis-related protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=163

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 8/168 (5%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCD---AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            ++ S+  LA +  + + + C    AQNS QD++  HNAARAAVGV P++WD  V AYAQ+
Sbjct  1    MRSSNSALAMLFAVALAMACTSALAQNSPQDFVSPHNAARAAVGVGPVSWDNTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+QR+ DC L+HSG   YGENI  G   +  TA  AV+ WV+E+Q YD+ +N C   P 
Sbjct  61   YANQRAADCQLVHSGG-PYGENIFWGSGRD-YTAADAVNAWVSEKQDYDYNSNKC--APN  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWR+S  +GC RV+C++GA  F+ CNY PPGNY+GQ PY
Sbjct  117  KVCGHYTQVVWRSSTAIGCGRVRCNSGA-IFIICNYKPPGNYVGQRPY  163



>ref|XP_011092436.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Sesamum indicum]
Length=159

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 9/168 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            M   K+S L +  ++ L++     AQNS  DYL AHNA RA VGV P+ W+E + AYA+ 
Sbjct  1    MDIPKLSLLSVCLMVALQLAC---AQNSPDDYLKAHNAGRAQVGVPPLAWNETLVAYAED  57

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA +R+GDC++ HS    YGEN+A G  +  + AK AV MW+ E+++YD ATN+C    G
Sbjct  58   YAKKRAGDCAMKHSDG-PYGENLAKGSWD--VNAKEAVQMWLDEKKFYDEATNTCIG--G  112

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            E C HYTQVVWR S  VGCARV+CSNG   FVTCNY PPGNY+G+ PY
Sbjct  113  EPCLHYTQVVWRGSTHVGCARVKCSNG-WTFVTCNYDPPGNYVGERPY  159



>ref|XP_006422719.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
 gb|ESR35959.1| hypothetical protein CICLE_v10029950mg [Citrus clementina]
Length=159

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL + C++ L       AQNSQQDYL AHN ARA+V V P+ WD +V AYAQ+YA+QR G
Sbjct  5    SLAILCLVALATTQLSSAQNSQQDYLRAHNEARASVRVGPMRWDNKVAAYAQNYANQRKG  64

Query  255  DCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            DC L+HSG   YGEN+A + GD   LT  +AV +WV E+  Y++ +N+C    G  C HY
Sbjct  65   DCRLVHSGG-PYGENLAWSSGD---LTGTAAVKLWVDERPKYNYNSNTC---VGGECRHY  117

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWRNS+++GCARV+C+N  G FV C+Y PPGN  G+ PY
Sbjct  118  TQVVWRNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  159



>ref|XP_006657422.1| PREDICTED: pathogenesis-related protein 1-like [Oryza brachyantha]
Length=177

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQ-YGE  296
            C AQN+QQD +D HNAAR+ VGV P+TW++ V AYA++YA +R GDC L HS S   YGE
Sbjct  31   CMAQNTQQDVVDLHNAARSDVGVGPVTWNDTVAAYAEAYAEKRRGDCLLQHSDSSGLYGE  90

Query  297  NIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCAR  476
            N+  G    + T   AV +WVAE+Q+YDHA+NSC+AP G SCGHYTQVVW NS ++GCA 
Sbjct  91   NLFLGSAGGNWTGSDAVALWVAEKQWYDHASNSCSAPAGSSCGHYTQVVWSNSTEIGCAG  150

Query  477  VQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            V C N  G F+TCNYSPPGN  G+SPY
Sbjct  151  VVCDNNLGVFITCNYSPPGNVDGESPY  177



>ref|XP_002265050.1| PREDICTED: basic form of pathogenesis-related protein 1 [Vitis 
vinifera]
 emb|CBI35453.3| unnamed protein product [Vitis vinifera]
Length=161

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 120/169 (71%), Gaps = 9/169 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCD-AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MG  KIS + LAC++   + +    AQNSQQDYL+AHN ARA V V P+TW+  V AYAQ
Sbjct  1    MGLCKIS-VALACLIGSALLVHTSYAQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQ  59

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            SYA+++ GDC+L+HS    YGEN+A G    S T  +AV++WVAE+  YD+ +NSC    
Sbjct  60   SYANKQIGDCNLVHSNG-PYGENLAKG--SGSFTGTAAVNLWVAEKPNYDYNSNSC---V  113

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            G  C HYTQVVWRNS+ +GCAR QC+NG  +++ CNY PPGNYIGQ PY
Sbjct  114  GGECRHYTQVVWRNSVSLGCARAQCNNGW-WYIICNYYPPGNYIGQRPY  161



>ref|XP_008455066.1| PREDICTED: basic form of pathogenesis-related protein 1 [Cucumis 
melo]
Length=164

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 114/168 (68%), Gaps = 16/168 (10%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            + FL  S++F + I          AQ+S QD++DAHNAARA VGV P++WDE V  YAQ 
Sbjct  13   LFFLTSSTIFTSSI----------AQDSPQDFVDAHNAARAQVGVGPVSWDETVANYAQQ  62

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+Q   DC ++HS    YGEN+A    +  L+  +AV MWV E+Q+YD+A+NSC    G
Sbjct  63   YANQHINDCQMVHSNGP-YGENLAWSSAD--LSGTNAVQMWVNEKQFYDYASNSC---VG  116

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQVVW+NS+K+GCA+V+C+N  G F+TCNY P GNY+ Q PY
Sbjct  117  SECRHYTQVVWKNSVKIGCAKVECNNNGGTFITCNYDPSGNYVNQRPY  164



>gb|ABA34060.1| pathogenesis-related protein 1 [Zea mays subsp. parviglumis]
Length=163

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = +3

Query  84   LACILVLEMGLW----CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
            L C+L L M       C AQNS QDY+D HNAARA VGV P++WD+ V AYAQSYA+QR 
Sbjct  5    LPCLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQ  64

Query  252  GDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            GDC LIHSG   YGEN+  G      +A  AV  WV+E+QYYDH TNSC    G+ CGHY
Sbjct  65   GDCQLIHSGG-PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCAE--GQVCGHY  121

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWR+S  +GCARV C N AG F+ C+Y+PPGN +G+SPY
Sbjct  122  TQVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  163



>gb|ADN43441.1| pathogenesis-related protein 1 [Vitis hybrid cultivar]
Length=161

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS   L  ++ L +   C AQNS QDY +AHNAARA VGV  +TW++ V AYAQ+
Sbjct  1    MGLFKISLPLLVGLVGLALAHVCCAQNSPQDYANAHNAARAQVGVGSMTWNDTVAAYAQN  60

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA++R  DC+L+HSG   YGEN+A G    SLT   AV++WV E+  YD+ +NSC    G
Sbjct  61   YANKRISDCNLVHSGG-PYGENLAKG--SGSLTGTDAVNLWVGEKPNYDYNSNSC---VG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
              C HYTQ+VW NS+++GCARVQC+NG  +FVTCNY PPGNY+GQ PY
Sbjct  115  GECLHYTQIVWSNSVRLGCARVQCNNGW-WFVTCNYDPPGNYVGQRPY  161



>dbj|BAO09561.1| pathogenesis-related protein 1, partial [Morus alba]
Length=164

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 113/160 (71%), Gaps = 6/160 (4%)
 Frame = +3

Query  81   FLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDC  260
             + CIL L +   C AQ + QD+L  HN ARA VGV P+TWD+ V AYA++YA+QR GDC
Sbjct  3    LVICILGLGVIELCYAQTTPQDFLAPHNRARAEVGVGPMTWDDSVAAYARNYANQRQGDC  62

Query  261  SLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
             L+HSG   YGENIA + GD   L+A  AV MWVAE+  YD+ +N+C       C HYTQ
Sbjct  63   KLVHSGG-PYGENIAWSSGD---LSAAGAVGMWVAEKSLYDYYSNTCVGQNPMGCLHYTQ  118

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWR S ++GCA+V+C++G G FV CNY+PPGNYIGQ PY
Sbjct  119  VVWRKSTRLGCAKVRCNSG-GSFVICNYNPPGNYIGQRPY  157



>ref|XP_003545770.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Glycine max]
 gb|KHN33604.1| Basic form of pathogenesis-related protein 1 [Glycine soja]
Length=164

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 118/170 (69%), Gaps = 8/170 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACI-LVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            MG  K+S   L  + LV+ +    +AQ+S  DY++AHNAAR+ VGVQ + WD+ V A+AQ
Sbjct  1    MGLCKVSFPVLCVLGLVMIVSHVANAQDSPADYVNAHNAARSEVGVQNLAWDDTVAAFAQ  60

Query  231  SYASQRSGDCSLIHS-GSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAP  407
            +YA+QR GDC LIHS G  QYGEN+A       L+   AV +WV E+  YD+ +NSC   
Sbjct  61   NYANQRKGDCQLIHSGGGGQYGENLAM--STGDLSGTDAVKLWVDEKSNYDYNSNSC---  115

Query  408  PGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             G  C HYTQVVWR+S+++GCA+V C NG G F+TCNY+PPGNY+GQ PY
Sbjct  116  VGGECLHYTQVVWRDSVRLGCAKVACDNG-GTFITCNYAPPGNYVGQRPY  164



>gb|EEC81456.1| hypothetical protein OsI_24758 [Oryza sativa Indica Group]
Length=173

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +3

Query  120  CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQ-QYGE  296
            C AQNS QD++  HNAARA V V    W++ V AYAQ YA+QR GDC L+HS S  +YGE
Sbjct  27   CTAQNSPQDFVSPHNAARANVSVAAAAWNDTVAAYAQGYAAQRQGDCKLVHSDSGGRYGE  86

Query  297  NIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCAR  476
            N+  G    + TA SAV  WV+E+Q+Y+H +NSC+AP G SCGHYTQVVWR+S  +GCAR
Sbjct  87   NLFWGSSGGNWTAASAVSAWVSEKQWYNHTSNSCSAPAGSSCGHYTQVVWRSSTAIGCAR  146

Query  477  VQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            V C+   G F+TCNYSPPGNYIGQSPY
Sbjct  147  VVCNGSLGVFITCNYSPPGNYIGQSPY  173



>ref|XP_008236237.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related leaf protein 
6-like [Prunus mume]
Length=157

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNSQQDYL+AHN AR  VGV  ITWD  VEAYAQ+YA+  + DC+L+HS    YGEN+A
Sbjct  20   AQNSQQDYLNAHNVARKQVGVPNITWDSTVEAYAQNYANSSAADCNLVHSNG-TYGENLA  78

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G    S T  +AV++WVAE+  Y++ +NSC    G+ C HYTQVVW+NS+++GCARVQC
Sbjct  79   KG--SGSFTGTAAVNLWVAEKPNYNYTSNSCVG--GQQCLHYTQVVWKNSVRLGCARVQC  134

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            SNG  +F TCNY PPGNY+GQ PY
Sbjct  135  SNG-WWFATCNYDPPGNYVGQRPY  157



>dbj|BAB78476.1| PR-1 [Solanum torvum]
Length=168

 Score =   174 bits (440),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 113/158 (72%), Gaps = 6/158 (4%)
 Frame = +3

Query  84   LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCS  263
            +AC +   +     AQ  Q+++L+AHNAAR  VGV P+TWD  + AYAQ+YA+QR GDC 
Sbjct  1    VACFITFAIFHSSQAQTPQENFLNAHNAARRRVGVGPMTWDNTLAAYAQNYANQRIGDCM  60

Query  264  LIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVV  443
            + HS    YGEN+AA   +  L A  AV MW  E+Q+YD+ +N+C   PG+ CGHYTQVV
Sbjct  61   MQHSDG-PYGENLAAAFPQ--LNAAGAVKMWEDEKQWYDYNSNTC--APGKVCGHYTQVV  115

Query  444  WRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            WRNS+++GCARV+CS+G   F+TCNY PPGNYIGQ PY
Sbjct  116  WRNSVRLGCARVRCSSG-WVFITCNYDPPGNYIGQRPY  152



>ref|XP_002885324.1| hypothetical protein ARALYDRAFT_898358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61583.1| hypothetical protein ARALYDRAFT_898358 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 113/145 (78%), Gaps = 6/145 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            A++ QQ++L+AHN AR  VG+ P+ WD++V AYA SYA+QR  DC+L+HS    +GENIA
Sbjct  22   AEDLQQEFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDCALVHSNGP-FGENIA  80

Query  306  -AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQ  482
             + GD   + A+ A +MW+ E+QYYD+ +N+CN P G +C HYTQVVW+N++++GCA+V 
Sbjct  81   MSSGD---MPAEDAAEMWINEKQYYDYNSNTCNDPNGGTCLHYTQVVWKNTVRLGCAKVV  137

Query  483  CSNGAGYFVTCNYSPPGNYIGQSPY  557
            C++G G F+TCNY PPGNYIGQ+PY
Sbjct  138  CNSG-GTFITCNYDPPGNYIGQNPY  161



>ref|XP_006409652.1| hypothetical protein EUTSA_v10022888mg [Eutrema salsugineum]
 gb|ESQ51105.1| hypothetical protein EUTSA_v10022888mg [Eutrema salsugineum]
Length=161

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 114/167 (68%), Gaps = 10/167 (6%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
             L    L L   LV  + L   AQ+SQQDY+  HN ARAAVG+ P+ WDE+V A+AQSYA
Sbjct  4    ILYFRFLILLAALVGALVLPSKAQDSQQDYVRVHNEARAAVGLGPVQWDERVSAFAQSYA  63

Query  240  SQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
             QR GDC+L+HS S  YGEN+A + GD   L+   AV++WV E+  YD+ +N+CN     
Sbjct  64   DQRRGDCNLVHS-SGPYGENLAKSSGD---LSGIRAVNLWVDEKASYDYPSNTCNG----  115

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQVVWRNS+K+GC + +C+NG G  + CNY PPGNY+ + PY
Sbjct  116  ECGHYTQVVWRNSVKLGCGKARCNNG-GTIIVCNYDPPGNYVNEKPY  161



>ref|XP_009138211.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
Length=163

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 118/163 (72%), Gaps = 14/163 (9%)
 Frame = +3

Query  72   SSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
            +++FL  I++L       AQ++ QD+LDAHN ARAAVGV P+ WDE V AYAQ YA+QR 
Sbjct  14   TTIFLVFIVLLR------AQDNPQDFLDAHNQARAAVGVDPLAWDETVAAYAQDYANQRR  67

Query  252  GDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGH  428
            GDC+L HS S  YGENIA + GD   ++   AV+MWV EQ  YD+ +N+C +  G+ CGH
Sbjct  68   GDCALEHS-SGPYGENIAWSSGD---MSGVEAVNMWVNEQADYDYGSNTCAS--GKQCGH  121

Query  429  YTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            YTQ+VW+NS+++GCA+V C NG   F+TCNY P GN++GQ PY
Sbjct  122  YTQIVWKNSVRLGCAKVSCDNGQT-FITCNYDPQGNFVGQWPY  163



>gb|EMS56527.1| Pathogenesis-related protein PRMS [Triticum urartu]
Length=164

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 118/167 (71%), Gaps = 5/167 (3%)
 Frame = +3

Query  63   LKISSLFLACILVLE--MGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            ++ S L L  +L +   M   C+AQNS  DY+ AHN ARAAVG+ P+TWD  V AYA SY
Sbjct  1    MEASKLALLVMLAMAAVMSDPCNAQNSPHDYVIAHNVARAAVGLGPVTWDASVAAYAASY  60

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            A QRSGDC L+HS + QYGEN+  G  ++  TA  AV +W  E+  Y++A+NSC A  G+
Sbjct  61   ARQRSGDCKLVHSKAPQYGENLFWGSGKH-WTAAQAVKIWADEKANYNYASNSCAA--GK  117

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQ+VWRNS  +GCAR+ C + AG F+TCNYSPPGNYIGQ PY
Sbjct  118  QCGHYTQIVWRNSTHIGCARLLCDHNAGVFITCNYSPPGNYIGQRPY  164



>ref|NP_195098.1| putative pathogenesis-related protein [Arabidopsis thaliana]
 gb|AAG40056.1|AF324705_1 AT4g33720 [Arabidopsis thaliana]
 gb|AAG42009.1|AF327419_1 putative pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 gb|AAK00381.1|AF339699_1 putative pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 emb|CAA20585.1| pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 emb|CAB80089.1| pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 gb|AAK62632.1| AT4g33720/T16L1_210 [Arabidopsis thaliana]
 gb|AAM65876.1| pathogenesis-related protein 1 precursor, 19.3K [Arabidopsis 
thaliana]
 gb|AAM91069.1| AT4g33720/T16L1_210 [Arabidopsis thaliana]
 gb|AEE86269.1| putative pathogenesis-related protein [Arabidopsis thaliana]
Length=163

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            F    +LFLA    L + +   AQ+S QD+L  HN ARA VGV P+ WDE+V AYA++YA
Sbjct  4    FNSSQNLFLAITFFLVLIVHLKAQDSPQDFLAVHNRARAEVGVGPLRWDEKVAAYARNYA  63

Query  240  SQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGES  419
            +QR GDC++ HS S  YGENIA      S+T  +AVDMWV EQ  YD+ +N+C     + 
Sbjct  64   NQRKGDCAMKHS-SGSYGENIAWS--SGSMTGVAAVDMWVDEQFDYDYDSNTC--AWDKQ  118

Query  420  CGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            CGHYTQVVWRNS ++GCA+V+C+NG   F+TCNY PPGN++G+ PY
Sbjct  119  CGHYTQVVWRNSERLGCAKVRCNNGQT-FITCNYDPPGNWVGEWPY  163



>ref|XP_006422707.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
 gb|ESR35947.1| hypothetical protein CICLE_v10030029mg [Citrus clementina]
Length=159

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL + C++ L       AQNSQQDYL AHN ARA+V V P+ WD +V AYA++YA+QR G
Sbjct  5    SLAILCLVALVTTQLSSAQNSQQDYLRAHNEARASVRVGPMRWDNKVAAYAKNYANQRKG  64

Query  255  DCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            DC L+HSG   YGEN+A + GD   LT  +AV +WV E+  Y++ +N+C    G  C HY
Sbjct  65   DCRLVHSGG-PYGENLAWSSGD---LTGTAAVKLWVDERPKYNYNSNTC---VGGECRHY  117

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWRNS+++GCARV+C+N  G FV C+Y PPGN  G+ PY
Sbjct  118  TQVVWRNSVRLGCARVKCNNNRGTFVICSYDPPGNVAGKRPY  159



>ref|XP_006368144.1| PREDICTED: pathogenesis-related protein 1C-like, partial [Solanum 
tuberosum]
Length=153

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 118/154 (77%), Gaps = 7/154 (5%)
 Frame = +3

Query  60   FLKISSLF-LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSY  236
            F ++ S F LA +LV  + +   + ++QQDYLDAHN ARA+VGV+P TWD+QV AYAQ Y
Sbjct  6    FSQMPSFFHLASVLVFIL-IVSHSCHAQQDYLDAHNTARASVGVEPFTWDDQVAAYAQQY  64

Query  237  ASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            ASQ + DC+L+HS   QYGEN+AAG  +  +TA  AV+MWV E+QYY H +N+C+   G+
Sbjct  65   ASQLATDCNLVHSHG-QYGENLAAGSGD-FMTATKAVEMWVDEKQYYHHDSNTCD--EGQ  120

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCN  518
             CGHYTQVVWRNS+++GCARVQC+NG GY V+CN
Sbjct  121  VCGHYTQVVWRNSVRLGCARVQCNNG-GYVVSCN  153



>ref|XP_010943469.1| PREDICTED: pathogenesis-related protein PRB1-3-like [Elaeis guineensis]
Length=162

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 113/160 (71%), Gaps = 5/160 (3%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
               A  + L M     AQNS +D++  HN+ARAAVGV P++W++ V  YAQ YA+QR+GD
Sbjct  8    FVFAIAVSLGMIHTTIAQNSPEDFVSPHNSARAAVGVGPVSWNDSVAVYAQDYANQRTGD  67

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C L+HS +  YGEN+  GG     TA  AV++WV+E+QY+D+ +N+C    G+ CGHYTQ
Sbjct  68   CQLVHS-NGSYGENL-FGGSGADYTAADAVNLWVSEKQYHDYNSNTC--ADGQMCGHYTQ  123

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWR+S  +GCARV C NG G F+TCNY PPGN++GQ PY
Sbjct  124  VVWRDSTSIGCARVVCDNG-GIFITCNYYPPGNFVGQRPY  162



>gb|AHE81254.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 3/161 (2%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL LA  +   +   C AQN+  D++  HN++RA VGV P+TWD  V  YA SYA+QR  
Sbjct  12   SLVLAFAMAAAITSPCAAQNAPADFVSLHNSSRALVGVGPVTWDTTVANYALSYANQRKA  71

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DCSL+HSG   YGENI  G    + TA SAV MW  E+Q+YD+ATN+C     + CGHYT
Sbjct  72   DCSLVHSGGT-YGENILWGSAGGTWTASSAVTMWTDEKQFYDYATNTC--ATNKVCGHYT  128

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWR+S  +GCARV C +  G F+ CNYSP GN  GQ PY
Sbjct  129  QVVWRSSTSIGCARVVCDSNRGVFIICNYSPRGNIAGQKPY  169



>gb|KDP37607.1| hypothetical protein JCGZ_06950 [Jatropha curcas]
Length=162

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 117/160 (73%), Gaps = 8/160 (5%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            LF+A +L+L +    +AQ + +DYL+AHN ARA VG+ P++WD++V AYAQ+YA+Q   +
Sbjct  11   LFIATVLLLPVPF--NAQQTPEDYLNAHNQARAVVGLGPMSWDKKVAAYAQNYANQHVSE  68

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C+L+HS    YGEN+A G  +  L+ + AV MWV E+ YYD+ +NSC   PG  CGHYTQ
Sbjct  69   CNLVHS-EGPYGENLAWGSGD--LSGEEAVKMWVDEKTYYDYNSNSC--APGRVCGHYTQ  123

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWR S+++G A+V C+NG G F+ CNY PPGNYIG+ PY
Sbjct  124  VVWRESVRLGGAKVTCTNG-GTFIGCNYDPPGNYIGKRPY  162



>ref|XP_008236225.1| PREDICTED: LOW QUALITY PROTEIN: pathogenesis-related protein 
1-like [Prunus mume]
Length=161

 Score =   173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 109/143 (76%), Gaps = 6/143 (4%)
 Frame = +3

Query  129  QNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIAA  308
            Q+S QDYL+AHNAARAAVGVQ +TWD  + AYAQ YA+ R GDC+L+HSG   YGENIA 
Sbjct  25   QDSPQDYLNAHNAARAAVGVQALTWDPNLAAYAQRYANSRKGDCNLVHSGG-PYGENIAK  83

Query  309  GGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQCS  488
               + S TA  AV+++VAE+  YD+ +N+C   P + CGHYTQVVWRNS +VGCA+V+C+
Sbjct  84   SSGDMSGTA--AVNLFVAEKANYDYNSNTC--APNKVCGHYTQVVWRNSARVGCAKVRCN  139

Query  489  NGAGYFVTCNYSPPGNYIGQSPY  557
            NG G F+ CNY P GNYIGQ PY
Sbjct  140  NG-GTFIGCNYDPRGNYIGQKPY  161



>ref|XP_009388944.1| PREDICTED: pathogenesis-related protein 1C-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 109/158 (69%), Gaps = 5/158 (3%)
 Frame = +3

Query  84   LACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCS  263
            L C++ L M     AQNS +D++DAHN ARAAVGV P++WD++V AYA++Y  QR GDC 
Sbjct  10   LVCVMALAMAYTTLAQNSPRDFVDAHNTARAAVGVGPVSWDDKVTAYAENYTKQRIGDCQ  69

Query  264  LIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVV  443
            L+HS    YGEN+  G + +  T   AV  WV E+QYYDH +NSC    G+  GHYTQVV
Sbjct  70   LVHSHG-PYGENLFWGSNTD-YTGIDAVKSWVDEKQYYDHNSNSC--ADGQVSGHYTQVV  125

Query  444  WRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            WR+S  +GCAR QC NG G F+ CNY+P GN  GQSPY
Sbjct  126  WRDSKTIGCARAQCDNG-GIFIICNYNPEGNIEGQSPY  162



>gb|AHE81275.1| pathogenesis-related protein 1-11 [Triticum aestivum]
Length=169

 Score =   173 bits (438),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 3/161 (2%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL LA  +   +   C AQN+  D++  HN++RA VGV P+TWD  V  YA SYA+QR  
Sbjct  12   SLVLAFAMAAAITSPCAAQNAPADFVSLHNSSRALVGVGPVTWDTTVANYALSYANQRKA  71

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DCSL+HSG   YGENI  G    + TA SAV MW  E+Q+YD+ATN+C     + CGHYT
Sbjct  72   DCSLVHSGGT-YGENIFWGSAGGTWTASSAVTMWTDEKQFYDYATNTC--ATNKVCGHYT  128

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWR+S  +GCARV C +  G F+ CNYSP GN  GQ PY
Sbjct  129  QVVWRSSTSIGCARVVCDSNRGVFIICNYSPRGNIAGQKPY  169



>ref|XP_006486833.1| PREDICTED: pathogenesis-related leaf protein 6-like [Citrus sinensis]
Length=159

 Score =   172 bits (437),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 110/162 (68%), Gaps = 8/162 (5%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            SL + C++ L       AQNSQQDYL AHN  RA+V V P+ WD +V AYAQ+YA+QR G
Sbjct  5    SLAILCLVALATTQLSSAQNSQQDYLRAHNETRASVRVGPMRWDNKVAAYAQNYANQRKG  64

Query  255  DCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            DC L+HSG   Y EN+A + GD   LT  +AV +WV E+  Y++ +N+C    G  C HY
Sbjct  65   DCRLVHSGG-PYSENLAWSNGD---LTGMAAVKLWVDERPKYNYNSNTC---VGGECRHY  117

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWRNS+++GC RV+C+N  G FV CNY PPGN  GQ PY
Sbjct  118  TQVVWRNSVRLGCTRVKCNNNRGTFVICNYDPPGNVAGQRPY  159



>ref|NP_001043091.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAB84473.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAC10798.1| putative pathogenesis-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF05005.1| Os01g0382400 [Oryza sativa Japonica Group]
 dbj|BAH00320.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70685.1| hypothetical protein OsI_02026 [Oryza sativa Indica Group]
Length=167

 Score =   172 bits (437),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 109/165 (66%), Gaps = 3/165 (2%)
 Frame = +3

Query  63   LKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYAS  242
            L I SLF+  ++   M    DAQNS QDYL   NAAR+AVGV P++W  +++ +A+ YA 
Sbjct  6    LAICSLFVLAVVAATMFHCSDAQNSPQDYLSPQNAARSAVGVGPMSWSTKLQGFAEDYAR  65

Query  243  QRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESC  422
            QR GDC L HSG   YGENI  G      TA  AV  WV E++YY++A+NSC A  G+ C
Sbjct  66   QRKGDCRLQHSGG-PYGENIFWGSAGADWTAADAVRSWVDEKKYYNYASNSCAA--GKVC  122

Query  423  GHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            GHYTQVVWR+S  VGCARV+C    G F+ CNY P GN +G+ PY
Sbjct  123  GHYTQVVWRDSTNVGCARVRCDANRGIFIICNYEPRGNIVGRRPY  167



>gb|ACJ62489.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = +3

Query  90   CILVLEMGLW----CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            C+L L M       C AQNS QDY+D HNAARA VGV P++WD+ V AYAQ+YA+QR GD
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQNYAAQRQGD  60

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C LIHSG   YGEN+  G      +A  AV  WV+E+QYYDH TNSC    G+ CGHYTQ
Sbjct  61   CKLIHSGG-PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCAE--GQVCGHYTQ  117

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWR+S  +GCARV C N AG F+ C+Y+PPGN +G+SPY
Sbjct  118  VVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>gb|ACJ62461.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62463.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62464.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62465.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62469.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62470.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62472.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62475.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62477.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62480.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62481.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62487.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62490.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62493.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62496.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62497.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62498.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62516.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62521.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62522.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62523.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62525.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62527.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62534.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62536.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62539.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 113/160 (71%), Gaps = 7/160 (4%)
 Frame = +3

Query  90   CILVLEMGLW----CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            C+L L M       C AQNS QDY+D HNAARA VGV P++WD+ V AYAQSYA+QR GD
Sbjct  1    CLLALAMAAIVVAPCTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQGD  60

Query  258  CSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQ  437
            C LIHSG   YGEN+  G      +A  AV  WV+E+QYYDH TNSC    G+ CGHYTQ
Sbjct  61   CKLIHSGG-PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCAE--GQVCGHYTQ  117

Query  438  VVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            VVWR+S  +GCARV C N AG F+ C+Y+PPGN +G+SPY
Sbjct  118  VVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>ref|XP_010517589.1| PREDICTED: pathogenesis-related protein 1-like [Camelina sativa]
Length=161

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 118/169 (70%), Gaps = 9/169 (5%)
 Frame = +3

Query  54   MGFLKISSLFLACI-LVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQ  230
            M F+  S L +  + LV  + L   AQ+S QDYL  HN ARAAVGV P+ WDE V AYA+
Sbjct  1    MNFISFSRLLIVFVALVGALVLPTKAQDSPQDYLRVHNQARAAVGVGPMQWDETVAAYAR  60

Query  231  SYASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPP  410
            SYA+Q  G+C L+HS    YGEN++ G  +  L+  SAV+MWV E+  Y++A+N+CN   
Sbjct  61   SYAAQLRGNCRLVHS-RGPYGENLSWGSSD--LSGVSAVNMWVNEKANYNYASNTCNG--  115

Query  411  GESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
               CGHYTQVVWRNS+K+GCA+V+C+NG G  ++CNYSP GNY+ + PY
Sbjct  116  --VCGHYTQVVWRNSVKLGCAKVRCNNG-GTIISCNYSPRGNYVNEKPY  161



>ref|XP_009138212.1| PREDICTED: pathogenesis-related protein 1-like [Brassica rapa]
 emb|CDY49368.1| BnaA03g50570D [Brassica napus]
Length=163

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 116/167 (69%), Gaps = 8/167 (5%)
 Frame = +3

Query  60   FLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYA  239
            F    +L LA  + L   +   AQ+S QD+LDAHN ARAAVGV P+ WDE V AYA  YA
Sbjct  4    FNPSRNLILATTIFLVFIVPLRAQDSPQDFLDAHNQARAAVGVDPLAWDETVAAYAHDYA  63

Query  240  SQRSGDCSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGE  416
            +QR GDC+L HS S  YGENIA + GD   ++   AV+MWV+EQ  YD+ +N+C +  G+
Sbjct  64   NQRRGDCALEHS-SGPYGENIAWSSGD---MSGVEAVNMWVSEQADYDYGSNTCAS--GK  117

Query  417  SCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
             CGHYTQ+VW+NS ++GCA+V C NG   F+TCNY P GN++GQ PY
Sbjct  118  QCGHYTQIVWKNSARLGCAKVSCDNGQT-FITCNYDPQGNFVGQWPY  163



>gb|AEQ33601.1| pathogenesis-related protein 1a [Malus domestica]
Length=148

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 109/144 (76%), Gaps = 6/144 (4%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQ++ QDYL +HN ARAAVGV P+TWD++V  YAQ+YA+Q  GDC+L+HSG   YGEN+A
Sbjct  11   AQDTPQDYLKSHNDARAAVGVGPLTWDDKVAGYAQNYANQHVGDCNLVHSGG-PYGENLA  69

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
                + S TA  AVDMWVAE+  Y + +NSC    G+ CGHYTQVVWR S +VGCA+V+C
Sbjct  70   MSTGDMSGTA--AVDMWVAEKADYSYESNSC--ADGKVCGHYTQVVWRKSARVGCAKVRC  125

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            S+G G F+ CNY PPGNY+G+ PY
Sbjct  126  SSG-GTFIGCNYDPPGNYVGEKPY  148



>ref|XP_007201285.1| hypothetical protein PRUPE_ppa012617mg [Prunus persica]
 gb|AEV57468.1| pathogensis-related protein 1a, partial [Prunus persica]
 gb|EMJ02484.1| hypothetical protein PRUPE_ppa012617mg [Prunus persica]
Length=161

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KIS  F+ C++ L +     AQ+S QDYL+AHNAARA VGV P+TWD  + AYAQ 
Sbjct  1    MGLSKISFAFV-CLIGLALLQSTGAQDSPQDYLNAHNAARAQVGVAPLTWDPNLVAYAQR  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+ R+GDC+L+HS +  YGENIA       L+  +AV+++V E+  YD+ +N+C A  G
Sbjct  60   YANSRAGDCNLVHS-NGPYGENIAK--STGDLSGTAAVNLFVGEKPDYDYNSNTCAA--G  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRNS+++GCA+ +C+NG G F+ CNY P GN  GQ PY
Sbjct  115  KMCGHYTQVVWRNSVRLGCAKARCTNG-GTFIGCNYDPRGNIRGQRPY  161



>ref|XP_006367093.1| PREDICTED: basic form of pathogenesis-related protein 1-like 
[Solanum tuberosum]
Length=188

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 123/177 (69%), Gaps = 18/177 (10%)
 Frame = +3

Query  54   MGFLKISSL--FLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYA  227
            MG+  I+ +  FL+  ++        AQNS QDYL+ HN AR  VGV P+TWD ++ A+A
Sbjct  1    MGYSNIALIICFLSFAIIFHSS---QAQNSPQDYLNPHNEARRQVGVSPMTWDNRLAAFA  57

Query  228  QSYASQRSGDCS-------LIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHA  386
            Q+YA+QR+GDC        + HSG   YGEN+AAG  +  L A  AV MWV E+Q+Y++ 
Sbjct  58   QNYANQRAGDCRMHYNILLMQHSGG-PYGENLAAGFPQ--LNAAGAVKMWVDEKQWYNYN  114

Query  387  TNSCNAPPGESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            +N+C A  G+ CGHYTQVVWRNS+++GCARV+C+NG  YF+TCNY PPGN+ GQ PY
Sbjct  115  SNTCQA--GKVCGHYTQVVWRNSVRLGCARVRCNNGW-YFITCNYDPPGNWNGQRPY  168



>emb|CAN68901.1| hypothetical protein VITISV_019988 [Vitis vinifera]
Length=150

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 7/144 (5%)
 Frame = +3

Query  126  AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGDCSLIHSGSQQYGENIA  305
            AQNSQQDYL+AHN ARA V V P+TW+  V AYAQSYA+++ GDC+L+HS    YGEN+A
Sbjct  14   AQNSQQDYLNAHNTARAQVSVGPMTWNNTVAAYAQSYANKQIGDCNLVHSNG-PYGENLA  72

Query  306  AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYTQVVWRNSLKVGCARVQC  485
             G    S T  +AV++WVAE+  YD+++NSC    G  C HYTQVVWRNS+ +GCAR QC
Sbjct  73   KG--SGSFTGTAAVNLWVAEKPNYDYSSNSC---VGGECRHYTQVVWRNSVSLGCARAQC  127

Query  486  SNGAGYFVTCNYSPPGNYIGQSPY  557
            +NG  +F+ CNY PPGNYIGQ PY
Sbjct  128  NNGW-WFIICNYYPPGNYIGQRPY  150



>ref|XP_007199955.1| hypothetical protein PRUPE_ppa1027191mg [Prunus persica]
 ref|XP_007199957.1| hypothetical protein PRUPE_ppa1027196mg [Prunus persica]
 gb|EMJ01154.1| hypothetical protein PRUPE_ppa1027191mg [Prunus persica]
 gb|EMJ01156.1| hypothetical protein PRUPE_ppa1027196mg [Prunus persica]
Length=161

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 7/168 (4%)
 Frame = +3

Query  54   MGFLKISSLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQS  233
            MG  KI  L L C+L   +     AQ++ QDY+ AHN ARAAV V P++WDE+++ YAQ 
Sbjct  1    MGLSKIL-LALVCVLGSALLQSTHAQDTPQDYVTAHNNARAAVNVGPLSWDEKLQGYAQD  59

Query  234  YASQRSGDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPG  413
            YA+Q  GDC+L+HSG   YGEN+A    +  L+   AV+MWVAE+  Y++ +N+C    G
Sbjct  60   YANQHIGDCNLVHSGG-PYGENLAMSTAD--LSGTDAVNMWVAEKADYNYDSNTC--ADG  114

Query  414  ESCGHYTQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            + CGHYTQVVWRN+ +VGCA+V+C++G G F+ CNY PPGNY+G+ PY
Sbjct  115  KMCGHYTQVVWRNTARVGCAKVRCNSG-GTFIGCNYDPPGNYVGEKPY  161



>gb|ACJ62499.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62500.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62505.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
 gb|ACJ62507.1| pathogenesis-related protein class I [Zea mays subsp. parviglumis]
Length=157

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 115/161 (71%), Gaps = 7/161 (4%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSG  254
            +L +A I+V      C AQNS QDY+D HNAARA VGV P++WD+ V AYAQSYA+QR G
Sbjct  4    ALAMAAIVVAP----CTAQNSPQDYVDPHNAARADVGVGPVSWDDTVAAYAQSYAAQRQG  59

Query  255  DCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            DC LIHSG   YGEN+  G      +A  AV  WV+E+QYYDH TNSC    G+ CGHYT
Sbjct  60   DCKLIHSGG-PYGENLFWGSAGADWSASDAVGSWVSEKQYYDHDTNSCAE--GQVCGHYT  116

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWR+S  +GCARV C N AG F+ C+Y+PPGN +G+SPY
Sbjct  117  QVVWRDSTAIGCARVVCDNNAGVFIICSYNPPGNVVGESPY  157



>ref|XP_004487816.1| PREDICTED: pathogenesis-related protein 1-like [Cicer arietinum]
Length=199

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 112/161 (70%), Gaps = 7/161 (4%)
 Frame = +3

Query  78   LFLACILVLEMGLWCDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            L L  IL+        AQNS QDYL  HN AR+ VGV PI W   V +YAQ+YA+Q  G+
Sbjct  26   LPLISILISTSTQISHAQNSPQDYLKIHNKARSEVGVGPIYWASTVASYAQNYANQLKGN  85

Query  258  CSLIHSGSQQYGENIA-AGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            C ++HS    YGEN+A + GD   LTA SAV MWV E+QYYD+ TN+C+   G  CGHYT
Sbjct  86   CKMVHSKGP-YGENLAWSSGD---LTATSAVTMWVGEKQYYDYNTNTCSN--GYKCGHYT  139

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVWR+S+++GCA+V+C++G    ++CNY PPGNYIGQ P+
Sbjct  140  QVVWRDSIRLGCAKVKCNDGRSTIISCNYDPPGNYIGQRPF  180



>ref|XP_009335372.1| PREDICTED: pathogenesis-related leaf protein 6-like [Pyrus x 
bretschneideri]
 ref|XP_009346539.1| PREDICTED: pathogenesis-related leaf protein 6-like [Pyrus x 
bretschneideri]
Length=162

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 115/161 (71%), Gaps = 8/161 (5%)
 Frame = +3

Query  84   LACILVLEMGLW--CDAQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRSGD  257
            + CI+V+ +G       QNSQQD+L+AHNA RA V V  I WD  V AYAQ+YA+ R  D
Sbjct  7    VLCIVVMALGQVHPSHTQNSQQDFLNAHNAVRAQVYVPDIVWDNAVAAYAQNYANSRIRD  66

Query  258  CSLIHSGSQ-QYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHYT  434
            C+L+HS S   YGEN+A G    S T  +AV++WVAE+  YD+ +NSC    G+ C HYT
Sbjct  67   CNLVHSNSNGTYGENLAKG--SGSFTGVAAVNLWVAEKPNYDYNSNSCVG--GQQCLHYT  122

Query  435  QVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            QVVW+ S+K+GCARVQC+NG  +FVTCNYSPPGNY+GQ PY
Sbjct  123  QVVWKKSVKLGCARVQCTNG-WWFVTCNYSPPGNYVGQRPY  162



>ref|XP_009605695.1| PREDICTED: basic form of pathogenesis-related protein 1 [Nicotiana 
tomentosiformis]
Length=177

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 113/162 (70%), Gaps = 8/162 (5%)
 Frame = +3

Query  75   SLFLACILVLEMGLWCD-AQNSQQDYLDAHNAARAAVGVQPITWDEQVEAYAQSYASQRS  251
            +  +AC +   +      AQNS QDYL+ HN AR  VGV P+ WD ++ AYAQ+YA+QR 
Sbjct  5    TTLVACFITFAILFHSSQAQNSPQDYLNPHNTARRQVGVGPMIWDNRLAAYAQNYANQRI  64

Query  252  GDCSLIHSGSQQYGENIAAGGDENSLTAKSAVDMWVAEQQYYDHATNSCNAPPGESCGHY  431
            GDC +IHS    YGEN+AA   +  L A  AV MWV E+++YD+ +NSC    G  CGHY
Sbjct  65   GDCGMIHSHG-PYGENLAAAFPQ--LNAAGAVKMWVDEKRFYDYNSNSC---VGGVCGHY  118

Query  432  TQVVWRNSLKVGCARVQCSNGAGYFVTCNYSPPGNYIGQSPY  557
            TQVVWRNS+++GCARV+C+NG  +F+TCNY PPGNY GQ P+
Sbjct  119  TQVVWRNSVRLGCARVRCNNGW-FFITCNYDPPGNYRGQRPF  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1376900468608