BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78711_g1_i1 len=1881 path=[1:0-1880]

Length=1881
                                                                      Score     E

ref|XP_009758170.1|  PREDICTED: cytochrome P450 704B1                   890   0.0      
ref|XP_011070985.1|  PREDICTED: cytochrome P450 704B1                   883   0.0      
ref|XP_006366710.1|  PREDICTED: cytochrome P450 704C1-like              882   0.0      
ref|XP_009629443.1|  PREDICTED: cytochrome P450 704B1                   878   0.0      
ref|XP_004228374.1|  PREDICTED: cytochrome P450 704B1                   875   0.0      
gb|ACD10924.1|  cytochrome P450                                         873   0.0      Capsicum annuum
ref|XP_011017522.1|  PREDICTED: cytochrome P450 704B1                   870   0.0      
ref|XP_008221727.1|  PREDICTED: cytochrome P450 704B1                   870   0.0      
ref|XP_007225718.1|  hypothetical protein PRUPE_ppa004298mg             870   0.0      
ref|XP_008389448.1|  PREDICTED: cytochrome P450 704B1                   870   0.0      
emb|CDP00359.1|  unnamed protein product                                868   0.0      
ref|XP_010683141.1|  PREDICTED: cytochrome P450 704B1                   866   0.0      
ref|XP_010102176.1|  Cytochrome P450 704C1                              863   0.0      
gb|KDP41226.1|  hypothetical protein JCGZ_15633                         863   0.0      
ref|XP_006391009.1|  hypothetical protein EUTSA_v10018405mg             855   0.0      
ref|XP_002522465.1|  cytochrome P450, putative                          854   0.0      Ricinus communis
ref|XP_004298418.1|  PREDICTED: cytochrome P450 704C1-like              853   0.0      
ref|XP_010651872.1|  PREDICTED: cytochrome P450 704B1                   852   0.0      
ref|XP_006475855.1|  PREDICTED: cytochrome P450 704C1-like              851   0.0      
gb|KDO80235.1|  hypothetical protein CISIN_1g035880mg                   851   0.0      
ref|XP_006450915.1|  hypothetical protein CICLE_v10010274mg             850   0.0      
ref|XP_004138991.1|  PREDICTED: cytochrome P450 704C1-like              850   0.0      
gb|KGN61391.1|  hypothetical protein Csa_2G108690                       849   0.0      
ref|XP_002887239.1|  oxygen binding protein                             847   0.0      
ref|XP_007046039.1|  Cytochrome P450, family 704, subfamily B, po...    847   0.0      
ref|XP_007046038.1|  Cytochrome P450, family 704, subfamily B, po...    847   0.0      
ref|XP_009105494.1|  PREDICTED: cytochrome P450 704B1                   843   0.0      
emb|CDY40931.1|  BnaC06g30690D                                          843   0.0      
gb|KFK41374.1|  hypothetical protein AALP_AA2G122000                    842   0.0      
ref|NP_177109.3|  cytochrome P450, family 704, subfamily B, polyp...    839   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044484.1|  PREDICTED: cytochrome P450 704B1                   837   0.0      
gb|EYU28779.1|  hypothetical protein MIMGU_mgv1a004727mg                836   0.0      
gb|AJD25236.1|  cytochrome P450 CYP704B37                               833   0.0      
ref|XP_006302101.1|  hypothetical protein CARUB_v10020091mg             834   0.0      
ref|XP_008441698.1|  PREDICTED: cytochrome P450 704B1                   833   0.0      
ref|XP_010258425.1|  PREDICTED: cytochrome P450 704B1                   829   0.0      
ref|XP_010551418.1|  PREDICTED: cytochrome P450 704B1                   824   0.0      
ref|XP_003611900.1|  Cytochrome P450                                    825   0.0      
ref|XP_010511987.1|  PREDICTED: cytochrome P450 704B1                   822   0.0      
ref|XP_003609660.1|  Cytochrome P450                                    822   0.0      
ref|XP_010470937.1|  PREDICTED: cytochrome P450 704B1-like              820   0.0      
ref|XP_007135410.1|  hypothetical protein PHAVU_010G126900g             819   0.0      
ref|XP_004510551.1|  PREDICTED: cytochrome P450 704C1-like              818   0.0      
ref|XP_010415594.1|  PREDICTED: cytochrome P450 704B1-like              817   0.0      
ref|XP_003528679.1|  PREDICTED: cytochrome P450 704C1-like              813   0.0      
gb|KHN01450.1|  Cytochrome P450 704C1                                   807   0.0      
emb|CBI31936.3|  unnamed protein product                                801   0.0      
gb|EPS61936.1|  hypothetical protein M569_12857                         794   0.0      
gb|KCW86574.1|  hypothetical protein EUGRSUZ_B03209                     791   0.0      
ref|XP_008778343.1|  PREDICTED: cytochrome P450 704B1                   790   0.0      
ref|XP_004985563.1|  PREDICTED: cytochrome P450 704C1-like isofor...    791   0.0      
dbj|BAC43393.1|  unknown protein                                        786   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABK28457.1|  unknown                                                 786   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004985564.1|  PREDICTED: cytochrome P450 704C1-like isofor...    789   0.0      
dbj|BAK08270.1|  predicted protein                                      779   0.0      
ref|XP_002465796.1|  hypothetical protein SORBIDRAFT_01g045960          776   0.0      Sorghum bicolor [broomcorn]
ref|XP_002312255.2|  cytochrome P450 family protein                     773   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001130648.1|  male sterile26                                     768   0.0      Zea mays [maize]
ref|XP_003558727.1|  PREDICTED: cytochrome P450 704B1                   763   0.0      
gb|ACG35470.1|  cytochrome P450 CYP704B12v2                             762   0.0      Zea mays [maize]
gb|AAL84318.1|AC073556_35  putative plant cytochrome P-450 protein      758   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY88702.1|  hypothetical protein OsI_10177                          758   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMT08626.1|  Cytochrome P450 704C1                                   757   0.0      
ref|XP_010917078.1|  PREDICTED: cytochrome P450 704B1                   733   0.0      
ref|XP_009413465.1|  PREDICTED: cytochrome P450 704B1                   733   0.0      
gb|EAZ25728.1|  hypothetical protein OsJ_09563                          713   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADG34845.1|  cytochrome P450 protein                                 662   0.0      
ref|XP_001764611.1|  predicted protein                                  627   0.0      
ref|XP_001764503.1|  predicted protein                                  595   0.0      
ref|XP_002963764.1|  hypothetical protein SELMODRAFT_80659              588   0.0      
ref|XP_002974848.1|  hypothetical protein SELMODRAFT_101765             588   0.0      
ref|XP_006827309.1|  hypothetical protein AMTR_s00010p00266280          568   0.0      
ref|XP_002978645.1|  hypothetical protein SELMODRAFT_418431             533   3e-180   
ref|XP_002981144.1|  hypothetical protein SELMODRAFT_113735             522   4e-176   
ref|XP_002982626.1|  hypothetical protein SELMODRAFT_116539             519   6e-175   
ref|XP_001768338.1|  predicted protein                                  512   7e-172   
ref|XP_002988354.1|  hypothetical protein SELMODRAFT_127881             508   3e-170   
ref|XP_002979701.1|  hypothetical protein SELMODRAFT_111270             507   2e-169   
gb|ACN41008.1|  unknown                                                 504   2e-168   Picea sitchensis
ref|XP_002980994.1|  hypothetical protein SELMODRAFT_113847             496   1e-165   
ref|XP_002974847.1|  hypothetical protein SELMODRAFT_414990             491   5e-164   
ref|XP_002982474.1|  hypothetical protein SELMODRAFT_116579             491   3e-163   
ref|XP_006651077.1|  PREDICTED: cytochrome P450 704C1-like              483   4e-163   
ref|XP_002963763.1|  hypothetical protein SELMODRAFT_405166             484   3e-161   
ref|XP_002974639.1|  hypothetical protein SELMODRAFT_101746             474   2e-157   
ref|XP_002963351.1|  hypothetical protein SELMODRAFT_80855              472   2e-156   
sp|Q50EK3.1|C04C1_PINTA  RecName: Full=Cytochrome P450 704C1; Alt...    467   2e-154   Pinus taeda
ref|XP_002976944.1|  hypothetical protein SELMODRAFT_151517             461   8e-152   
ref|XP_002980688.1|  hypothetical protein SELMODRAFT_112911             457   3e-150   
ref|XP_007052012.1|  Cytochrome P450 family protein                     455   8e-150   
ref|XP_007052009.1|  Cytochrome P450 family protein isoform 1           448   4e-147   
ref|XP_007052008.1|  Cytochrome P450 family protein                     442   7e-145   
ref|XP_006445219.1|  hypothetical protein CICLE_v10019805mg             441   3e-144   
gb|KHF99845.1|  Cytochrome P450 protein                                 439   1e-143   
gb|KCW44361.1|  hypothetical protein EUGRSUZ_L02168                     439   2e-143   
gb|KDO85879.1|  hypothetical protein CISIN_1g010681mg                   438   2e-143   
ref|XP_011093193.1|  PREDICTED: cytochrome P450 704C1-like              438   2e-143   
ref|XP_010041418.1|  PREDICTED: cytochrome P450 704C1-like              437   3e-143   
ref|XP_010053880.1|  PREDICTED: cytochrome P450 704C1-like              435   4e-142   
gb|EAY95236.1|  hypothetical protein OsI_17053                          435   4e-142   Oryza sativa Indica Group [Indian rice]
ref|XP_010054890.1|  PREDICTED: cytochrome P450 704C1-like              435   4e-142   
ref|XP_010934568.1|  PREDICTED: cytochrome P450 704C1-like              436   5e-142   
ref|XP_010272641.1|  PREDICTED: cytochrome P450 704C1-like              435   5e-142   
gb|KDO85880.1|  hypothetical protein CISIN_1g010681mg                   434   6e-142   
ref|XP_002320074.1|  hypothetical protein POPTR_0014s06820g             434   7e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010056271.1|  PREDICTED: cytochrome P450 704C1-like              434   1e-141   
ref|NP_001053615.1|  Os04g0573900                                       433   2e-141   Oryza sativa Japonica Group [Japonica rice]
gb|ABK94777.1|  unknown                                                 433   3e-141   Populus trichocarpa [western balsam poplar]
ref|XP_010056273.1|  PREDICTED: cytochrome P450 704C1-like              432   6e-141   
ref|XP_002270428.2|  PREDICTED: cytochrome P450 704C1-like isofor...    431   7e-141   Vitis vinifera
ref|XP_010662358.1|  PREDICTED: cytochrome P450 704C1-like isofor...    431   8e-141   
ref|XP_007134454.1|  hypothetical protein PHAVU_010G048700g             432   1e-140   
ref|XP_010662357.1|  PREDICTED: cytochrome P450 704C1-like isofor...    431   1e-140   
ref|XP_006857967.1|  hypothetical protein AMTR_s00069p00176780          431   1e-140   
ref|XP_009389623.1|  PREDICTED: cytochrome P450 704C1-like              432   1e-140   
ref|XP_010662355.1|  PREDICTED: cytochrome P450 704C1-like isofor...    431   1e-140   
ref|XP_010662356.1|  PREDICTED: cytochrome P450 704C1-like isofor...    431   1e-140   
ref|XP_006576393.1|  PREDICTED: cytochrome P450 704C1-like              431   2e-140   
gb|AAZ39646.1|  cytochrome P450 monooxygenase                           430   2e-140   Petunia x hybrida [garden petunia]
emb|CBI24485.3|  unnamed protein product                                430   2e-140   
ref|XP_010662354.1|  PREDICTED: cytochrome P450 704C1-like isofor...    431   3e-140   
ref|XP_003521549.1|  PREDICTED: cytochrome P450 704C1-like isoform 1    430   4e-140   
gb|KHN04083.1|  Cytochrome P450 704C1                                   428   1e-139   
ref|XP_008809790.1|  PREDICTED: cytochrome P450 704C1 isoform X2        428   2e-139   
ref|XP_009776441.1|  PREDICTED: cytochrome P450 704C1-like isofor...    428   2e-139   
gb|KDP27731.1|  hypothetical protein JCGZ_19708                         431   2e-139   
emb|CDP17799.1|  unnamed protein product                                428   2e-139   
ref|XP_011034662.1|  PREDICTED: cytochrome P450 704C1-like              427   4e-139   
ref|XP_008809789.1|  PREDICTED: cytochrome P450 704C1 isoform X1        427   5e-139   
ref|XP_011034689.1|  PREDICTED: cytochrome P450 704C1-like isofor...    427   8e-139   
ref|XP_010934572.1|  PREDICTED: cytochrome P450 704C1-like              427   8e-139   
ref|XP_010056272.1|  PREDICTED: cytochrome P450 704C1-like              426   1e-138   
gb|KHG09033.1|  Cytochrome P450 protein                                 426   2e-138   
ref|XP_010692303.1|  PREDICTED: cytochrome P450 704C1-like              426   2e-138   
ref|XP_006339516.1|  PREDICTED: cytochrome P450 704C1-like              425   3e-138   
ref|XP_010933916.1|  PREDICTED: cytochrome P450 704C1-like isofor...    426   3e-138   
ref|XP_010277455.1|  PREDICTED: cytochrome P450 704C1-like              425   4e-138   
ref|XP_009389611.1|  PREDICTED: cytochrome P450 704C1-like              425   5e-138   
ref|XP_009593544.1|  PREDICTED: cytochrome P450 704C1-like isofor...    425   5e-138   
ref|XP_007038505.1|  Cytochrome P450 704C1                              432   1e-137   
ref|XP_010056270.1|  PREDICTED: cytochrome P450 704C1-like              424   1e-137   
emb|CBI38796.3|  unnamed protein product                                424   1e-137   
ref|XP_009776440.1|  PREDICTED: cytochrome P450 704C1-like isofor...    424   1e-137   
emb|CBI38797.3|  unnamed protein product                                424   1e-137   
ref|XP_010061882.1|  PREDICTED: cytochrome P450 704C1-like              424   1e-137   
ref|XP_002270628.3|  PREDICTED: cytochrome P450 704C1-like              424   1e-137   Vitis vinifera
ref|XP_002320072.1|  hypothetical protein POPTR_0014s06790g             424   1e-137   Populus trichocarpa [western balsam poplar]
ref|XP_008803291.1|  PREDICTED: cytochrome P450 704C1-like              423   1e-137   
emb|CBI38795.3|  unnamed protein product                                423   2e-137   
ref|XP_002270673.2|  PREDICTED: cytochrome P450 704C1                   424   2e-137   Vitis vinifera
ref|XP_010109079.1|  Cytochrome P450 704C1                              424   2e-137   
ref|XP_004231178.1|  PREDICTED: cytochrome P450 704C1-like isofor...    424   2e-137   
ref|XP_010058448.1|  PREDICTED: cytochrome P450 704C1-like              422   3e-137   
emb|CAN60189.1|  hypothetical protein VITISV_002118                     423   3e-137   Vitis vinifera
ref|XP_008777389.1|  PREDICTED: cytochrome P450 704C1-like              423   3e-137   
ref|XP_002270594.3|  PREDICTED: cytochrome P450 704C1                   423   4e-137   Vitis vinifera
ref|XP_008777682.1|  PREDICTED: cytochrome P450 704C1-like              423   5e-137   
ref|XP_004229925.2|  PREDICTED: cytochrome P450 704C1-like              422   6e-137   
gb|KCW90796.1|  hypothetical protein EUGRSUZ_A02863                     420   7e-137   
ref|XP_004976569.1|  PREDICTED: cytochrome P450 704C1-like              422   8e-137   
ref|XP_001781614.1|  predicted protein                                  421   1e-136   
ref|XP_010933914.1|  PREDICTED: cytochrome P450 704C1-like isofor...    421   1e-136   
gb|KCW72915.1|  hypothetical protein EUGRSUZ_E01356                     419   2e-136   
gb|EYU25719.1|  hypothetical protein MIMGU_mgv1a024571mg                420   2e-136   
ref|XP_009593543.1|  PREDICTED: cytochrome P450 704C1-like isofor...    421   3e-136   
ref|XP_006339779.1|  PREDICTED: cytochrome P450 704C1-like              420   4e-136   
ref|XP_009379287.1|  PREDICTED: cytochrome P450 704C1-like              419   4e-136   
ref|NP_001065111.1|  Os10g0525000                                       420   5e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010934571.1|  PREDICTED: cytochrome P450 704C1-like              419   8e-136   
ref|XP_006652670.1|  PREDICTED: cytochrome P450 704C1-like              419   8e-136   
gb|KCW78249.1|  hypothetical protein EUGRSUZ_D02437                     417   9e-136   
gb|KCW78252.1|  hypothetical protein EUGRSUZ_D02439                     417   9e-136   
ref|XP_008669003.1|  PREDICTED: cytochrome P450 704C1-like              418   1e-135   
ref|XP_008343023.1|  PREDICTED: cytochrome P450 704C1-like              418   1e-135   
ref|XP_008777558.1|  PREDICTED: cytochrome P450 704C1-like isofor...    419   2e-135   
ref|XP_011101147.1|  PREDICTED: cytochrome P450 704C1-like              419   2e-135   
ref|XP_006468806.1|  PREDICTED: cytochrome P450 704C1-like isofor...    418   3e-135   
ref|XP_006421783.1|  hypothetical protein CICLE_v10004720mg             418   3e-135   
ref|XP_008777680.1|  PREDICTED: cytochrome P450 704C1-like isofor...    418   3e-135   
ref|XP_010934570.1|  PREDICTED: cytochrome P450 704C1-like              418   4e-135   
ref|XP_010092871.1|  Cytochrome P450 704C1                              417   5e-135   
ref|XP_009400465.1|  PREDICTED: cytochrome P450 704C1-like              416   8e-135   
ref|XP_009593545.1|  PREDICTED: cytochrome P450 704C1-like              416   1e-134   
gb|KDO65334.1|  hypothetical protein CISIN_1g012536mg                   414   1e-134   
ref|XP_003627670.1|  Cytochrome P450                                    416   2e-134   
ref|XP_011030004.1|  PREDICTED: cytochrome P450 704C1-like              417   3e-134   
ref|XP_008343043.1|  PREDICTED: cytochrome P450 704C1                   415   3e-134   
ref|XP_010544373.1|  PREDICTED: cytochrome P450 704C1-like isofor...    415   3e-134   
ref|XP_011094593.1|  PREDICTED: cytochrome P450 704C1                   415   3e-134   
ref|XP_006339777.1|  PREDICTED: cytochrome P450 704C1-like              414   4e-134   
ref|XP_010413066.1|  PREDICTED: cytochrome P450 704C1-like              414   5e-134   
ref|NP_182075.1|  cytochrome P450, family 704, subfamily A, polyp...    414   5e-134   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28729.1|  hypothetical protein JCGZ_14500                         414   5e-134   
ref|XP_010255770.1|  PREDICTED: cytochrome P450 704C1-like isofor...    416   6e-134   
ref|XP_002880182.1|  CYP704A2                                           414   7e-134   
ref|XP_009379286.1|  PREDICTED: cytochrome P450 704C1-like              414   7e-134   
ref|XP_010255771.1|  PREDICTED: cytochrome P450 704C1-like isofor...    415   1e-133   
ref|XP_002275114.1|  PREDICTED: cytochrome P450 704C1                   414   1e-133   Vitis vinifera
ref|XP_009776442.1|  PREDICTED: cytochrome P450 704C1-like              413   2e-133   
ref|XP_003627676.1|  Cytochrome P450                                    413   2e-133   
ref|XP_006339778.1|  PREDICTED: cytochrome P450 704C1-like              412   2e-133   
gb|AHF22080.1|  CYP704A87                                               413   3e-133   
ref|XP_007219030.1|  hypothetical protein PRUPE_ppa004495mg             412   3e-133   
ref|XP_009393311.1|  PREDICTED: cytochrome P450 704C1-like isofor...    412   5e-133   
ref|XP_006339781.1|  PREDICTED: cytochrome P450 704C1-like              411   6e-133   
emb|CDX74746.1|  BnaA05g04920D                                          412   6e-133   
ref|XP_009133730.1|  PREDICTED: cytochrome P450 704C1-like              411   7e-133   
emb|CDY60682.1|  BnaCnng36830D                                          412   1e-132   
ref|XP_009143150.1|  PREDICTED: cytochrome P450 704C1-like              411   1e-132   
gb|KDP28728.1|  hypothetical protein JCGZ_14499                         410   1e-132   
ref|NP_001169224.1|  putative cytochrome P450 superfamily protein       411   2e-132   Zea mays [maize]
ref|XP_009400464.1|  PREDICTED: cytochrome P450 704C1-like              410   2e-132   
ref|XP_003574226.1|  PREDICTED: cytochrome P450 704C1-like isofor...    410   2e-132   
ref|XP_011034716.1|  PREDICTED: cytochrome P450 704C1 isoform X2        410   3e-132   
gb|KFK37343.1|  hypothetical protein AALP_AA4G244100                    406   3e-132   
ref|XP_008237027.1|  PREDICTED: cytochrome P450 704C1-like              409   4e-132   
ref|XP_003528922.1|  PREDICTED: cytochrome P450 704C1 isoform 1         409   4e-132   
ref|XP_011034707.1|  PREDICTED: cytochrome P450 704C1 isoform X1        409   4e-132   
ref|XP_006397734.1|  hypothetical protein EUTSA_v10001408mg             409   7e-132   
gb|KFK37344.1|  hypothetical protein AALP_AA4G244200                    409   8e-132   
ref|XP_002511745.1|  cytochrome P450, putative                          409   9e-132   Ricinus communis
ref|XP_011076303.1|  PREDICTED: cytochrome P450 704C1-like              408   1e-131   
ref|XP_003581548.1|  PREDICTED: cytochrome P450 704C1-like              408   1e-131   
ref|XP_006339519.1|  PREDICTED: cytochrome P450 704C1-like              408   2e-131   
emb|CDP03436.1|  unnamed protein product                                408   2e-131   
ref|XP_007219038.1|  hypothetical protein PRUPE_ppa004579mg             407   3e-131   
gb|KHN04093.1|  Cytochrome P450 704C1                                   407   4e-131   
ref|XP_002465041.1|  hypothetical protein SORBIDRAFT_01g031080          407   4e-131   Sorghum bicolor [broomcorn]
ref|XP_009393320.1|  PREDICTED: cytochrome P450 704C1-like isofor...    407   5e-131   
ref|XP_008232704.1|  PREDICTED: cytochrome P450 704C1                   407   5e-131   
ref|XP_004983864.1|  PREDICTED: cytochrome P450 704C1-like              407   5e-131   
ref|XP_010518171.1|  PREDICTED: cytochrome P450 704C1-like              407   5e-131   
ref|XP_011091066.1|  PREDICTED: cytochrome P450 704C1-like              407   6e-131   
ref|XP_004229915.2|  PREDICTED: cytochrome P450 704C1-like              406   6e-131   
gb|EAY79269.1|  hypothetical protein OsI_34384                          405   7e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_006445220.1|  hypothetical protein CICLE_v10023337mg             407   8e-131   
ref|XP_006490953.1|  PREDICTED: cytochrome P450 704C1-like isofor...    406   9e-131   
gb|AAM12494.1|AC074232_21  cytochrome P450-like protein                 405   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007220949.1|  hypothetical protein PRUPE_ppa026124mg             405   1e-130   
emb|CDM81564.1|  unnamed protein product                                412   1e-130   
ref|NP_001141345.1|  uncharacterized protein LOC100273436               406   1e-130   Zea mays [maize]
gb|AAP54707.2|  Cytochrome P450 family protein, expressed               405   1e-130   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006339520.1|  PREDICTED: cytochrome P450 704C1-like              405   1e-130   
ref|XP_008232706.1|  PREDICTED: cytochrome P450 704C1-like isofor...    405   1e-130   
ref|XP_010508159.1|  PREDICTED: cytochrome P450 704C1-like              405   1e-130   
ref|XP_007217935.1|  hypothetical protein PRUPE_ppa004947mg             404   2e-130   
ref|XP_002320071.1|  cytochrome P450 family protein                     405   2e-130   Populus trichocarpa [western balsam poplar]
gb|KDO85878.1|  hypothetical protein CISIN_1g035793mg                   405   2e-130   
ref|XP_008438128.1|  PREDICTED: cytochrome P450 704C1-like              404   3e-130   
ref|XP_010092868.1|  Cytochrome P450 704C1                              410   3e-130   
ref|XP_006339521.1|  PREDICTED: cytochrome P450 704C1-like              405   3e-130   
gb|AJD25235.1|  cytochrome P450 CYP704A99                               404   3e-130   
ref|XP_010508196.1|  PREDICTED: cytochrome P450 704C1-like              405   3e-130   
ref|XP_003627673.1|  Cytochrome P450                                    404   4e-130   
emb|CDY53882.1|  BnaA03g56840D                                          404   5e-130   
ref|XP_003592376.1|  Cytochrome P450 monooxygenase CYP704G9             404   5e-130   
ref|NP_001182854.1|  putative cytochrome P450 superfamily protein       402   5e-130   
ref|XP_007219027.1|  hypothetical protein PRUPE_ppa004476mg             404   5e-130   
ref|XP_006655746.1|  PREDICTED: cytochrome P450 704C1-like              404   5e-130   
ref|XP_010234933.1|  PREDICTED: cytochrome P450 704C1-like isofor...    404   6e-130   
ref|XP_010692306.1|  PREDICTED: cytochrome P450 704C1                   404   6e-130   
ref|XP_003561125.1|  PREDICTED: cytochrome P450 704C1-like              404   9e-130   
ref|XP_004964417.1|  PREDICTED: cytochrome P450 704C1-like              404   1e-129   
ref|XP_010506505.1|  PREDICTED: cytochrome P450 704C1-like isofor...    402   2e-129   
ref|XP_009133729.1|  PREDICTED: cytochrome P450 704C1-like              402   2e-129   
gb|KFK36430.1|  hypothetical protein AALP_AA4G123100                    402   3e-129   
ref|XP_004231179.1|  PREDICTED: cytochrome P450 704C1-like              402   4e-129   
ref|XP_006348044.1|  PREDICTED: cytochrome P450 704C1-like              402   5e-129   
gb|ABC59094.1|  cytochrome P450 monooxygenase CYP704G9                  401   5e-129   Medicago truncatula
ref|XP_004508543.1|  PREDICTED: cytochrome P450 704C1-like              401   5e-129   
ref|XP_004976552.1|  PREDICTED: cytochrome P450 704C1-like              401   5e-129   
ref|XP_004306891.1|  PREDICTED: cytochrome P450 704C1-like              401   7e-129   
ref|XP_007134455.1|  hypothetical protein PHAVU_010G048800g             401   7e-129   
gb|EMT18793.1|  Cytochrome P450 704C1                                   402   1e-128   
ref|XP_004133898.1|  PREDICTED: cytochrome P450 704C1-like              400   1e-128   
ref|XP_008232705.1|  PREDICTED: cytochrome P450 704C1-like isofor...    400   2e-128   
ref|XP_010506464.1|  PREDICTED: cytochrome P450 704C1-like              400   2e-128   
ref|XP_002446966.1|  hypothetical protein SORBIDRAFT_06g025990          399   3e-128   Sorghum bicolor [broomcorn]
ref|NP_001056685.1|  Os06g0129900                                       399   4e-128   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010092869.1|  Cytochrome P450 704C1                              400   5e-128   
ref|XP_003627672.1|  Cytochrome P450                                    399   6e-128   
ref|XP_002446967.1|  hypothetical protein SORBIDRAFT_06g026000          399   6e-128   
gb|AJD25234.1|  cytochrome P450 CYP704A98                               399   6e-128   
ref|XP_010110158.1|  Cytochrome P450 704C1                              399   7e-128   
ref|XP_010518137.1|  PREDICTED: cytochrome P450 704C1-like              398   8e-128   
ref|XP_004306890.1|  PREDICTED: cytochrome P450 704C1-like              398   9e-128   
ref|XP_003627669.1|  Cytochrome P450 monooxygenase CYP704G7             398   9e-128   
ref|XP_003636830.1|  Cytochrome P450 monooxygenase CYP704G7             398   9e-128   
gb|KHN04574.1|  Cytochrome P450 704C1                                   398   9e-128   
ref|XP_002465039.1|  hypothetical protein SORBIDRAFT_01g031060          398   1e-127   
ref|XP_006662533.1|  PREDICTED: cytochrome P450 704C1-like              398   1e-127   
ref|XP_008232728.1|  PREDICTED: uncharacterized protein LOC103331840    413   1e-127   
ref|XP_004155805.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    397   1e-127   
ref|XP_004510930.1|  PREDICTED: cytochrome P450 704C1-like              398   1e-127   
ref|XP_010529445.1|  PREDICTED: cytochrome P450 704C1-like isofor...    398   1e-127   
ref|XP_002437749.1|  hypothetical protein SORBIDRAFT_10g001880          398   1e-127   
gb|AAC31835.1|  putative cytochrome P450                                397   2e-127   
ref|XP_001760399.1|  predicted protein                                  398   2e-127   
gb|EMT16459.1|  Cytochrome P450 704C1                                   397   2e-127   
ref|XP_004229916.2|  PREDICTED: cytochrome P450 704C1-like              397   3e-127   
dbj|BAK06758.1|  predicted protein                                      397   3e-127   
ref|NP_850427.1|  cytochrome P450, family 704, subfamily A, polyp...    396   4e-127   
ref|XP_007143336.1|  hypothetical protein PHAVU_007G063800g             397   4e-127   
ref|XP_004309257.1|  PREDICTED: cytochrome P450 704C1-like              397   4e-127   
ref|XP_003528924.1|  PREDICTED: cytochrome P450 704C1-like              396   4e-127   
ref|XP_004496648.1|  PREDICTED: cytochrome P450 704C1-like              396   6e-127   
ref|XP_003627663.1|  Cytochrome P450 monooxygenase CYP704G7             396   6e-127   
gb|EEC67338.1|  hypothetical protein OsI_34388                          397   7e-127   
emb|CDM84753.1|  unnamed protein product                                396   7e-127   
gb|AET02139.2|  cytochrome P450 family protein                          396   7e-127   
gb|EMT28423.1|  Cytochrome P450 704C1                                   396   9e-127   
gb|EYU25023.1|  hypothetical protein MIMGU_mgv1a004800mg                395   9e-127   
ref|XP_004308440.1|  PREDICTED: cytochrome P450 704C1-like              395   1e-126   
ref|XP_002880183.1|  CYP704A1                                           394   1e-126   
ref|XP_007152374.1|  hypothetical protein PHAVU_004G124700g             395   2e-126   
ref|XP_003636308.1|  Cytochrome P450                                    395   2e-126   
ref|XP_008354751.1|  PREDICTED: cytochrome P450 704C1-like              394   3e-126   
ref|XP_004976553.1|  PREDICTED: cytochrome P450 704C1-like              394   3e-126   
gb|KCW72918.1|  hypothetical protein EUGRSUZ_E01359                     391   3e-126   
ref|XP_009379284.1|  PREDICTED: cytochrome P450 704C1-like              394   3e-126   
ref|XP_008354750.1|  PREDICTED: cytochrome P450 704C1-like              394   3e-126   
gb|EMS55452.1|  Cytochrome P450 86B1                                    392   5e-126   
gb|EYU32019.1|  hypothetical protein MIMGU_mgv1a018012mg                393   9e-126   
ref|NP_001183394.1|  uncharacterized protein LOC100501810               393   9e-126   
ref|XP_004964419.1|  PREDICTED: cytochrome P450 704C1-like              393   1e-125   
ref|XP_010662453.1|  PREDICTED: cytochrome P450 704C1-like              392   2e-125   
ref|XP_004309254.1|  PREDICTED: cytochrome P450 704C1-like              392   2e-125   
ref|XP_010109078.1|  Cytochrome P450 704C1                              390   2e-125   
gb|AFW72704.1|  putative cytochrome P450 superfamily protein            393   2e-125   
ref|XP_001782495.1|  predicted protein                                  392   4e-125   
gb|ABC59095.1|  cytochrome P450 monooxygenase CYP704G7                  391   4e-125   
gb|AGT16153.1|  hypothetical protein SHCRBa_046_L16_R_20                389   4e-125   
gb|ACG38359.1|  cytochrome P450 CYP86A35                                392   5e-125   
gb|KDO85882.1|  hypothetical protein CISIN_1g010681mg                   389   5e-125   
ref|XP_004306889.1|  PREDICTED: cytochrome P450 704C1-like              391   7e-125   
emb|CDM81563.1|  unnamed protein product                                391   7e-125   
ref|NP_001065112.2|  Os10g0525200                                       390   9e-125   
emb|CDM84754.1|  unnamed protein product                                390   1e-124   
ref|XP_004510931.1|  PREDICTED: cytochrome P450 704C1-like              390   1e-124   
ref|XP_010089087.1|  Cytochrome P450 86A2                               391   2e-124   
gb|AAP54710.2|  Cytochrome P450 family protein                          390   2e-124   
ref|XP_004306892.1|  PREDICTED: cytochrome P450 704C1-like              390   2e-124   
gb|ABG66204.1|  Cytochrome P450 family protein, expressed               385   6e-124   
gb|ACF78954.1|  unknown                                                 379   6e-124   
ref|XP_004309258.1|  PREDICTED: cytochrome P450 704C1-like              388   7e-124   
ref|XP_010054889.1|  PREDICTED: cytochrome P450 704C1-like              386   9e-124   
gb|KFK37342.1|  hypothetical protein AALP_AA4G244100                    387   1e-123   
emb|CDP17798.1|  unnamed protein product                                387   2e-123   
ref|XP_008661694.1|  PREDICTED: putative cytochrome P450 superfam...    387   2e-123   
ref|XP_002318861.2|  hypothetical protein POPTR_0012s14170g             387   2e-123   
ref|XP_004252175.2|  PREDICTED: cytochrome P450 704C1-like              387   2e-123   
ref|XP_004309256.1|  PREDICTED: cytochrome P450 704C1-like              387   2e-123   
ref|XP_008438136.1|  PREDICTED: cytochrome P450 704C1-like isofor...    387   2e-123   
ref|XP_004306897.1|  PREDICTED: cytochrome P450 704C1-like              387   3e-123   
ref|XP_004133900.1|  PREDICTED: cytochrome P450 704C1-like              386   4e-123   
ref|XP_010255320.1|  PREDICTED: cytochrome P450 86A8                    388   4e-123   
ref|XP_002275806.1|  PREDICTED: cytochrome P450 86A7                    387   5e-123   
ref|XP_004308443.1|  PREDICTED: cytochrome P450 704C1-like              386   5e-123   
ref|XP_006468807.1|  PREDICTED: cytochrome P450 704C1-like isofor...    382   7e-123   
ref|XP_002452782.1|  hypothetical protein SORBIDRAFT_04g032410          387   8e-123   
gb|EAZ31703.1|  hypothetical protein OsJ_15852                          383   8e-123   
gb|EYU25718.1|  hypothetical protein MIMGU_mgv1a025848mg                381   1e-122   
emb|CAN80040.1|  hypothetical protein VITISV_037194                     387   2e-122   
ref|XP_008373994.1|  PREDICTED: cytochrome P450 86A8-like               385   2e-122   
ref|XP_009389165.1|  PREDICTED: cytochrome P450 86B1-like               385   2e-122   
gb|EMT31268.1|  Cytochrome P450 704C1                                   386   3e-122   
ref|XP_006662532.1|  PREDICTED: cytochrome P450 704C1-like              382   3e-122   
gb|EAY94753.1|  hypothetical protein OsI_16533                          379   5e-122   
gb|KCW78251.1|  hypothetical protein EUGRSUZ_D02439                     380   6e-122   
ref|XP_009402078.1|  PREDICTED: cytochrome P450 86A8-like               384   7e-122   
ref|XP_008438137.1|  PREDICTED: cytochrome P450 704C1-like isofor...    383   9e-122   
emb|CDP12038.1|  unnamed protein product                                384   9e-122   
gb|EMT32710.1|  Cytochrome P450 704C1                                   382   9e-122   
ref|XP_009797232.1|  PREDICTED: cytochrome P450 86A8-like               384   1e-121   
emb|CDY66201.1|  BnaA09g51710D                                          384   1e-121   
ref|XP_010053250.1|  PREDICTED: cytochrome P450 86A7                    383   3e-121   
ref|XP_009375001.1|  PREDICTED: cytochrome P450 86A8                    382   3e-121   
emb|CDY07223.1|  BnaCnng02380D                                          383   4e-121   
ref|XP_011036497.1|  PREDICTED: cytochrome P450 86A8-like               382   5e-121   
ref|XP_006652635.1|  PREDICTED: cytochrome P450 86A4-like               382   6e-121   
gb|AGT16154.1|  hypothetical protein SHCRBa_046_L16_R_150               380   6e-121   
emb|CDM81559.1|  unnamed protein product                                381   6e-121   
ref|XP_010650931.1|  PREDICTED: cytochrome P450 86A1                    380   7e-121   
ref|XP_009407697.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    381   8e-121   
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like               381   1e-120   
ref|XP_008457385.1|  PREDICTED: cytochrome P450 86A1                    380   1e-120   
ref|XP_009400636.1|  PREDICTED: cytochrome P450 704C1-like              377   1e-120   
ref|XP_009128484.1|  PREDICTED: cytochrome P450 86A2                    381   1e-120   
ref|XP_004309255.1|  PREDICTED: cytochrome P450 704C1-like              379   1e-120   
ref|XP_008797199.1|  PREDICTED: cytochrome P450 86B1-like               381   1e-120   
ref|XP_004309261.1|  PREDICTED: cytochrome P450 704C1-like              379   1e-120   
gb|KFK30625.1|  hypothetical protein AALP_AA6G006200                    381   1e-120   
gb|EPS61958.1|  hypothetical protein M569_12832                         379   2e-120   
ref|XP_003538960.2|  PREDICTED: cytochrome P450 86B1-like               381   2e-120   
ref|XP_009407623.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    382   3e-120   
ref|XP_009111490.1|  PREDICTED: cytochrome P450 86A2                    380   3e-120   
emb|CBI38794.3|  unnamed protein product                                375   4e-120   
ref|XP_002523775.1|  cytochrome P450, putative                          380   4e-120   
ref|XP_009349722.1|  PREDICTED: cytochrome P450 704C1-like              378   5e-120   
ref|XP_002320802.1|  cytochrome P450 family protein                     380   5e-120   
ref|XP_009343521.1|  PREDICTED: cytochrome P450 704C1-like              378   5e-120   
ref|XP_007016155.1|  Cytochrome P450, family 86, subfamily A, pol...    378   5e-120   
ref|XP_006394587.1|  hypothetical protein EUTSA_v10003923mg             380   6e-120   
ref|XP_002988762.1|  hypothetical protein SELMODRAFT_128482             378   6e-120   
emb|CDY61911.1|  BnaC07g49710D                                          379   8e-120   
gb|ABZ80831.1|  CYP86A32 fatty acid omega-hydroxylase                   378   8e-120   
ref|XP_008437294.1|  PREDICTED: cytochrome P450 86A7                    378   9e-120   
ref|XP_006348042.1|  PREDICTED: cytochrome P450 704C1-like              377   1e-119   
ref|XP_004229934.1|  PREDICTED: cytochrome P450 86A8-like               378   1e-119   
emb|CDP11007.1|  unnamed protein product                                379   1e-119   
ref|NP_176558.1|  cytochrome P450, family 86, subfamily A, polype...    378   1e-119   
ref|XP_003521880.1|  PREDICTED: cytochrome P450 86A8-like               378   1e-119   
ref|XP_010275632.1|  PREDICTED: cytochrome P450 86A8-like               379   1e-119   
ref|NP_001064901.2|  Os10g0486100                                       379   1e-119   
emb|CDX90044.1|  BnaA10g00380D                                          378   2e-119   
ref|XP_006647656.1|  PREDICTED: cytochrome P450 86A2-like               377   2e-119   
gb|AAL59025.1|AC087182_8  putative cytochrome P450 protein              379   2e-119   
ref|NP_001047674.1|  Os02g0666500                                       377   2e-119   
ref|XP_003627566.1|  Cytochrome P450 fatty acid omega-hydroxylase       378   2e-119   
ref|XP_004143898.1|  PREDICTED: cytochrome P450 86A2-like               377   2e-119   
ref|XP_002986290.1|  fatty acid omega-hydroxylase                       377   2e-119   
gb|EYU32135.1|  hypothetical protein MIMGU_mgv1a003916mg                378   2e-119   
gb|AJD25208.1|  cytochrome P450 CYP86A92                                377   2e-119   
ref|XP_009397933.1|  PREDICTED: cytochrome P450 86A2-like               377   2e-119   
ref|XP_010423121.1|  PREDICTED: cytochrome P450 86B1-like               377   2e-119   
ref|XP_002310074.1|  hypothetical protein POPTR_0007s07700g             378   2e-119   
ref|XP_006396237.1|  hypothetical protein EUTSA_v10028550mg             378   3e-119   
ref|XP_002875027.1|  CYP86A2                                            378   3e-119   
ref|XP_010934156.1|  PREDICTED: cytochrome P450 704C1-like              380   3e-119   
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like               378   3e-119   
ref|XP_010043449.1|  PREDICTED: cytochrome P450 86A1                    376   3e-119   
ref|XP_011006771.1|  PREDICTED: cytochrome P450 86B1-like               377   4e-119   
ref|XP_009136378.1|  PREDICTED: cytochrome P450 86B1                    377   4e-119   
ref|XP_006339587.1|  PREDICTED: cytochrome P450 86A2-like               377   4e-119   
ref|XP_004241175.1|  PREDICTED: cytochrome P450 86A1                    376   4e-119   
emb|CDY02213.1|  BnaA03g39540D                                          377   4e-119   
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                   377   4e-119   
ref|XP_008777681.1|  PREDICTED: cytochrome P450 704C1-like isofor...    374   4e-119   
ref|XP_010685596.1|  PREDICTED: cytochrome P450 86A1                    376   5e-119   
ref|XP_006397782.1|  hypothetical protein EUTSA_v10001389mg             377   5e-119   
gb|ACG33785.1|  cytochrome P450 CYP86A36                                377   5e-119   
gb|EMT14997.1|  Cytochrome P450 86A2                                    377   5e-119   
ref|XP_002882043.1|  CYP86A8                                            376   6e-119   
ref|XP_010491450.1|  PREDICTED: cytochrome P450 86B1-like               377   6e-119   
gb|AAG17470.1|AF123610_9  cytochrome P450                               376   6e-119   
ref|XP_008238919.1|  PREDICTED: cytochrome P450 86A8                    376   7e-119   
ref|XP_004976485.1|  PREDICTED: cytochrome P450 86A2-like               376   8e-119   
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like               377   8e-119   
ref|XP_009119710.1|  PREDICTED: cytochrome P450 86A4                    377   9e-119   
ref|XP_007135090.1|  hypothetical protein PHAVU_010G099900g             375   1e-118   
ref|XP_009629836.1|  PREDICTED: cytochrome P450 86A8                    376   1e-118   
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg             377   1e-118   
ref|XP_010087951.1|  Cytochrome P450 86A2                               376   1e-118   
ref|NP_001130939.1|  uncharacterized protein LOC100192044               375   1e-118   
ref|XP_010533650.1|  PREDICTED: cytochrome P450 86A7                    375   1e-118   
ref|XP_010544374.1|  PREDICTED: cytochrome P450 704C1-like isofor...    374   1e-118   
ref|XP_004298810.1|  PREDICTED: cytochrome P450 86A2-like               375   1e-118   
ref|XP_002892051.1|  CYP86A4                                            376   2e-118   
gb|AAL75903.1|  AT4g00360/A_IG005I10_21                                 376   2e-118   
ref|NP_171666.1|  cytochrome P450, family 86, subfamily A, polype...    376   2e-118   
ref|NP_191946.1|  cytochrome P450 86A2                                  376   2e-118   
emb|CDY15167.1|  BnaC05g00460D                                          375   2e-118   
ref|NP_182121.1|  cytochrome P450, family 86, subfamily A, polype...    375   2e-118   
ref|XP_006418437.1|  hypothetical protein EUTSA_v10007350mg             375   2e-118   
ref|XP_004510774.1|  PREDICTED: cytochrome P450 86A2-like               375   2e-118   
dbj|BAC42067.1|  unknown protein                                        375   2e-118   
emb|CBI24484.3|  unnamed protein product                                374   2e-118   
ref|XP_011072860.1|  PREDICTED: cytochrome P450 86A7                    375   2e-118   
gb|ACL53124.1|  unknown                                                 374   2e-118   
emb|CDO99497.1|  unnamed protein product                                374   2e-118   
ref|XP_004970620.1|  PREDICTED: cytochrome P450 86A1-like               375   2e-118   
ref|XP_010419577.1|  PREDICTED: cytochrome P450 86A2-like isoform X1    375   2e-118   
ref|XP_002456654.1|  hypothetical protein SORBIDRAFT_03g040250          375   2e-118   
gb|KFK25188.1|  hypothetical protein AALP_AA8G078400                    375   3e-118   
ref|XP_007209896.1|  hypothetical protein PRUPE_ppa004078mg             374   3e-118   
ref|XP_010454600.1|  PREDICTED: cytochrome P450 86B1-like               375   3e-118   
gb|AAM65207.1|  putative cytochrome P450                                374   3e-118   
dbj|BAJ86471.1|  predicted protein                                      375   3e-118   
ref|XP_010067001.1|  PREDICTED: cytochrome P450 86B1-like               375   3e-118   
ref|XP_010426970.1|  PREDICTED: cytochrome P450 86A2                    375   3e-118   
ref|XP_008777559.1|  PREDICTED: cytochrome P450 704C1-like isofor...    372   3e-118   
ref|XP_010452805.1|  PREDICTED: cytochrome P450 86B1 isoform X1         374   4e-118   
ref|XP_006290052.1|  hypothetical protein CARUB_v10003687mg             375   4e-118   
gb|ACN27732.1|  unknown                                                 374   4e-118   
ref|NP_001275219.1|  CYP86A33 fatty acid omega-hydroxylase              374   4e-118   
ref|XP_002509820.1|  cytochrome P450, putative                          374   5e-118   
ref|NP_001141372.1|  uncharacterized protein LOC100273463               374   5e-118   
ref|XP_009398006.1|  PREDICTED: cytochrome P450 86B1-like               374   7e-118   
ref|XP_009143197.1|  PREDICTED: cytochrome P450 86A8                    374   7e-118   
ref|XP_006391721.1|  hypothetical protein EUTSA_v10023410mg             373   8e-118   
gb|AHD25487.1|  cytochrome-P450 monooxygenase CYP86                     374   8e-118   
ref|XP_009118821.1|  PREDICTED: cytochrome P450 86A4                    374   8e-118   
gb|KDP46522.1|  hypothetical protein JCGZ_08494                         372   8e-118   
ref|XP_008389072.1|  PREDICTED: cytochrome P450 86B1-like               375   8e-118   
ref|XP_011082379.1|  PREDICTED: cytochrome P450 86A1                    373   8e-118   
ref|XP_006445018.1|  hypothetical protein CICLE_v10019633mg             373   9e-118   
dbj|BAJ87689.1|  predicted protein                                      374   1e-117   
ref|XP_010933917.1|  PREDICTED: cytochrome P450 704C1-like isofor...    372   1e-117   
gb|AFW68533.1|  putative cytochrome P450 superfamily protein            373   1e-117   
dbj|BAJ88802.1|  predicted protein                                      373   1e-117   



>ref|XP_009758170.1| PREDICTED: cytochrome P450 704B1 [Nicotiana sylvestris]
Length=519

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/516 (83%), Positives = 463/516 (90%), Gaps = 2/516 (0%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             ME L L + LI+  W+FIH L QR   GP  WP+IGA +EQ  N+ RMHDWLV YLA S 
Sbjct  1     MEILTLFVCLIL-SWIFIHGLRQRNRKGPIHWPIIGAGLEQWVNFDRMHDWLVKYLAQSP  59

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +VVVP   TTYTYIAHPDNVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQ
Sbjct  60    TVVVPTWSTTYTYIAHPDNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQ  119

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RKTAS EFASKNLRDF+TVVFRDY+LKLF IL QAS  N++VDMQDLLMRMTLDSICKVG
Sbjct  120   RKTASFEFASKNLRDFNTVVFRDYTLKLFNILIQASFNNKEVDMQDLLMRMTLDSICKVG  179

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FGVEIGTL PNLPEN FA+AFDAAN+IVTLRFIDPLW+IKKFLN+GSEAILDQSI+T+DD
Sbjct  180   FGVEIGTLDPNLPENSFAQAFDAANVIVTLRFIDPLWRIKKFLNIGSEAILDQSIKTVDD  239

Query  1050  FTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             FTYSVIRKRKAEIE    NEK +K DILSRFIELGKDPENN+ DKSLRDIVLNFVIAGRD
Sbjct  240   FTYSVIRKRKAEIEAAPTNEK-IKQDILSRFIELGKDPENNMTDKSLRDIVLNFVIAGRD  298

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTATTLSWAIYMIMTHE VAEKL++EL+S+EE+RAKEENV LH Y ++DPES+NQRA+QF
Sbjct  299   TTATTLSWAIYMIMTHEHVAEKLYAELKSLEEIRAKEENVSLHHYDAEDPESVNQRAIQF  358

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
             AGLLNYD++ KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT++KAGGMVTYVPYS
Sbjct  359   AGLLNYDSLGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKLKAGGMVTYVPYS  418

Query  510   MGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             MGRM YNWG DAA F P+RWLKDGVFQNASPFKFTAFQ GPRICLGKDSAYLQMKMALAI
Sbjct  419   MGRMGYNWGSDAALFNPDRWLKDGVFQNASPFKFTAFQGGPRICLGKDSAYLQMKMALAI  478

Query  330   LCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             LCRF+KFKLV GH V YRMMT+LSMAHGLKLTVS R
Sbjct  479   LCRFYKFKLVPGHQVMYRMMTILSMAHGLKLTVSVR  514



>ref|XP_011070985.1| PREDICTED: cytochrome P450 704B1 [Sesamum indicum]
Length=529

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/523 (78%), Positives = 471/523 (90%), Gaps = 4/523 (1%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  1594
             ++ T ++ L +++F W+FIHRL QR   GP++WP +GA++EQ+ NY RMHDW+V YL+ S
Sbjct  7     NLSTFIITLSIMLFSWIFIHRLKQRNSKGPKTWPFLGAAIEQLVNYDRMHDWMVEYLSQS  66

Query  1593  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  1414
              +VVVPMPFTTYTYIA P NVEHVL+TNF NYPKGEVYHSYMEVLLGDGIFNADGELWRK
Sbjct  67    RTVVVPMPFTTYTYIADPANVEHVLRTNFSNYPKGEVYHSYMEVLLGDGIFNADGELWRK  126

Query  1413  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  1234
             QRKTAS EFASKNLRDFSTVVFR+YSLKLF IL  AS  NQ++DMQ+LLMRMTLDSICKV
Sbjct  127   QRKTASFEFASKNLRDFSTVVFREYSLKLFDILCHASYSNQEIDMQELLMRMTLDSICKV  186

Query  1233  GFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             GFGVEIGTL P+LP+N+FAKAFD AN IVTLRFIDPLWK+KKF NVGSEA+LDQSI+TID
Sbjct  187   GFGVEIGTLVPDLPDNQFAKAFDMANTIVTLRFIDPLWKVKKFFNVGSEAVLDQSIKTID  246

Query  1053  DFTYSVIRKRKAEIEETQ---KNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
             DFT+SVI++RKAEIEET+   K+EK +KHDILSRFIEL +DP++N+ DKSLRD+VLNFVI
Sbjct  247   DFTFSVIKRRKAEIEETEGINKDEK-VKHDILSRFIELSRDPQSNMTDKSLRDVVLNFVI  305

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AGRDTTATTL+WAIYMIMTH+DVA+KL+SEL+  EE RA+EE + L +Y  ++PES NQ+
Sbjct  306   AGRDTTATTLAWAIYMIMTHKDVADKLYSELKRFEEDRAEEEGISLIKYHKENPESFNQK  365

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
             AMQFAGLL YD++ KLYYLH+V+TETLRLYPAVPQDPKGI++DDVLPDGT+VKAGGMVTY
Sbjct  366   AMQFAGLLGYDSIGKLYYLHAVITETLRLYPAVPQDPKGIIQDDVLPDGTKVKAGGMVTY  425

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             VPY+MGRMEYNWGPDAASF PERWLKDG+FQN+SPFKFTAFQAGPRICLGKDSAYLQMKM
Sbjct  426   VPYAMGRMEYNWGPDAASFDPERWLKDGIFQNSSPFKFTAFQAGPRICLGKDSAYLQMKM  485

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRTHN  214
             ALAILCRF++FKL+ GH V YRMMT+LSMAHGLKLTVS R  +
Sbjct  486   ALAILCRFYEFKLLPGHLVAYRMMTILSMAHGLKLTVSRRQQD  528



>ref|XP_006366710.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=513

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/514 (82%), Positives = 459/514 (89%), Gaps = 3/514 (1%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             L+  L  ++  W FI+   Q+   GP +WP++GA +EQ  N+ RMHDWLV YLA S +VV
Sbjct  3     LLTFLACLVLSWKFINTYRQKNKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLAQSPTVV  62

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VP   TTYTYIAHP NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  63    VPAMTTTYTYIAHPTNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQRKT  122

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFASKNLRDF+TVVFRDYSLKLF IL QAS  N+ VDMQDLLMRMTLDSICKVGFGV
Sbjct  123   ASFEFASKNLRDFNTVVFRDYSLKLFNILNQASFKNEHVDMQDLLMRMTLDSICKVGFGV  182

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTL PNLPEN FAKAFDAAN+IVTLRFIDPLWKIK+FLN+GSEAILDQSI+ IDDFTY
Sbjct  183   EIGTLNPNLPENSFAKAFDAANVIVTLRFIDPLWKIKQFLNIGSEAILDQSIKKIDDFTY  242

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
             SVIRKRKAE+E    N K  KHDILSRFIELGKDPENNI DKSLRDIVLNFVIAGRDTTA
Sbjct  243   SVIRKRKAELE---TNGKINKHDILSRFIELGKDPENNITDKSLRDIVLNFVIAGRDTTA  299

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
             TTLSWAIYMIMTHE VAEKL++EL+S+E++RAKEENV LHQY ++DPES++ RA+QFAGL
Sbjct  300   TTLSWAIYMIMTHEHVAEKLYAELKSLEQVRAKEENVSLHQYDAEDPESVDSRAIQFAGL  359

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             LNYD+++KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT++KAGGMVTYVPYSMGR
Sbjct  360   LNYDSLSKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKLKAGGMVTYVPYSMGR  419

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             MEYNWG DAASF PERWLKDGVFQNASPFKFTAFQ GPRICLGKDSAYLQMKMALAILCR
Sbjct  420   MEYNWGSDAASFNPERWLKDGVFQNASPFKFTAFQGGPRICLGKDSAYLQMKMALAILCR  479

Query  321   FFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             F+KFKLV GH V+YRMMT+LSM HGLKLTVS R+
Sbjct  480   FYKFKLVPGHLVKYRMMTILSMEHGLKLTVSLRS  513



>ref|XP_009629443.1| PREDICTED: cytochrome P450 704B1 [Nicotiana tomentosiformis]
Length=510

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/518 (81%), Positives = 463/518 (89%), Gaps = 9/518 (2%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKG-GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  1594
             ME L L + L++  W+FIH L Q+K   GP  WP+IGA +EQ  N+ RMHDWLV YLA S
Sbjct  1     MEILTLFVCLVL-SWIFIHGLRQQKNRKGPIHWPIIGAGLEQWVNFDRMHDWLVKYLAQS  59

Query  1593  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  1414
              +VVVP   TTYTYIAHPDNVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DG+LWRK
Sbjct  60    PTVVVPTWSTTYTYIAHPDNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGDLWRK  119

Query  1413  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  1234
             QRKTAS EFASKNLRDF+TVVFRDY+LKLF IL QAS  N++VDMQDLLMRMTLDSICKV
Sbjct  120   QRKTASFEFASKNLRDFNTVVFRDYTLKLFNILIQASFNNKEVDMQDLLMRMTLDSICKV  179

Query  1233  GFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             GFGVEIGTL PNLPEN FA+AFDAAN+IVTLRFIDPLW+IKKFLN+GSEAILDQSIRT+D
Sbjct  180   GFGVEIGTLDPNLPENSFAQAFDAANVIVTLRFIDPLWRIKKFLNIGSEAILDQSIRTVD  239

Query  1053  DFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGR  874
             DFTYSVIRKRKAEIE    NEK +K DILSRF+ELGKDPENN+ DKSLRDIVLNFVIAGR
Sbjct  240   DFTYSVIRKRKAEIEAAPTNEK-IKQDILSRFVELGKDPENNMTDKSLRDIVLNFVIAGR  298

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTATTLSWAIYMIMTHE VAEKL++EL+S+      EENV LHQY ++DPES+N+RA+Q
Sbjct  299   DTTATTLSWAIYMIMTHEHVAEKLYAELKSL------EENVSLHQYDAEDPESVNRRAIQ  352

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FAGLLNYD++ KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT++KAGGMVTYVPY
Sbjct  353   FAGLLNYDSLGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKLKAGGMVTYVPY  412

Query  513   SMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             SMGRMEYNWG DAASF PERWLKDGVFQNASPFKFTAFQ GPRICLGKDSAYLQMKMALA
Sbjct  413   SMGRMEYNWGSDAASFNPERWLKDGVFQNASPFKFTAFQGGPRICLGKDSAYLQMKMALA  472

Query  333   ILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             ILCRF+KFKLV GH V+YRMMT+LSMAHGLKLTVS R+
Sbjct  473   ILCRFYKFKLVPGHPVKYRMMTILSMAHGLKLTVSVRS  510



>ref|XP_004228374.1| PREDICTED: cytochrome P450 704B1 [Solanum lycopersicum]
Length=513

 Score =   875 bits (2262),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/504 (83%), Positives = 453/504 (90%), Gaps = 3/504 (1%)
 Frame = -1

Query  1731  CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  1552
              W FI+   Q+   GP +WP++GA +EQ  N+ RMHDWLV YLA S +VVVP   TTYTY
Sbjct  13    SWKFINTYRQKNKKGPINWPIVGAGLEQWVNFDRMHDWLVEYLAQSPTVVVPAMTTTYTY  72

Query  1551  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  1372
             IAHP NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQRKTAS EFASKNL
Sbjct  73    IAHPTNVEHVLKTNFDNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFASKNL  132

Query  1371  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP  1192
             RDF+TVVFRDYSLKLF IL QASL N+ VDMQDLLMRMTLDSICKVGFGVEIGTL PNLP
Sbjct  133   RDFNTVVFRDYSLKLFNILNQASLKNEHVDMQDLLMRMTLDSICKVGFGVEIGTLNPNLP  192

Query  1191  ENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
             EN FAKAFDAAN+IVTLRFIDPLWKIK+FLN+GSEAILDQSI+ IDDFTYSVIRKRKAE+
Sbjct  193   ENSFAKAFDAANVIVTLRFIDPLWKIKQFLNIGSEAILDQSIKKIDDFTYSVIRKRKAEL  252

Query  1011  EETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMI  832
             E    N+K  KHDILSRFIELGKDPENNI DKSLRDIVLNFVIAGRDTTATTLSWAIYMI
Sbjct  253   E---TNDKINKHDILSRFIELGKDPENNITDKSLRDIVLNFVIAGRDTTATTLSWAIYMI  309

Query  831   MTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLY  652
             MTHE VAEKL++EL+S+E++RAKEENV LHQY ++D  S + RA+QFAGLLNYD+++KLY
Sbjct  310   MTHEHVAEKLYAELKSLEQVRAKEENVTLHQYDTEDHVSADSRAIQFAGLLNYDSLSKLY  369

Query  651   YLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAA  472
             YLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT++KAGGMVTYVPYSMGRMEYNWG DAA
Sbjct  370   YLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKLKAGGMVTYVPYSMGRMEYNWGSDAA  429

Query  471   SFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH  292
             SF PERWLKDGVFQNASPFKFTAFQ GPRICLGKDSAYLQMKMALAILCRF+KFKLV GH
Sbjct  430   SFNPERWLKDGVFQNASPFKFTAFQGGPRICLGKDSAYLQMKMALAILCRFYKFKLVPGH  489

Query  291   SVEYRMMTVLSMAHGLKLTVSPRT  220
              V+YRMMT+LSM HGLKLTVS R+
Sbjct  490   LVKYRMMTILSMEHGLKLTVSLRS  513



>gb|ACD10924.1| cytochrome P450 [Capsicum annuum]
Length=513

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/504 (82%), Positives = 452/504 (90%), Gaps = 3/504 (1%)
 Frame = -1

Query  1731  CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  1552
              W FI    Q+   GP +WP+IGA +EQ  N+ RMHDWLV YL+ S +VVVP   TTYTY
Sbjct  13    SWTFIKTFRQKIKKGPINWPIIGAGLEQWVNFDRMHDWLVEYLSQSPTVVVPSMTTTYTY  72

Query  1551  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  1372
             IAHP NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQRKTAS EFASKNL
Sbjct  73    IAHPTNVEHVLKTNFYNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFASKNL  132

Query  1371  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP  1192
             RDF+T+VFRDYSLKLF IL QAS  ++QVDMQDLLMRMTLDSICKVGFGVEIGTL PNLP
Sbjct  133   RDFNTIVFRDYSLKLFKILNQASFKSEQVDMQDLLMRMTLDSICKVGFGVEIGTLDPNLP  192

Query  1191  ENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
             EN FAKAFDAAN+IVTLRFIDPLWKIK+FLN+GSEAILDQSIR IDDFTYSVIRKRKAEI
Sbjct  193   ENSFAKAFDAANVIVTLRFIDPLWKIKQFLNIGSEAILDQSIRKIDDFTYSVIRKRKAEI  252

Query  1011  EETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMI  832
             E    N+K  KHDILSRFIELGKDPENN+ DKSLRDIVLNFVIAGRDTTATTLSWA+YMI
Sbjct  253   E---TNDKINKHDILSRFIELGKDPENNVTDKSLRDIVLNFVIAGRDTTATTLSWAVYMI  309

Query  831   MTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLY  652
             MTHE VAEKL++EL S+E++RAKEEN+LLHQY ++DPES+N R +QFA LLNYD++ KLY
Sbjct  310   MTHEHVAEKLYAELMSLEQVRAKEENMLLHQYDAEDPESVNSRVIQFAWLLNYDSLGKLY  369

Query  651   YLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAA  472
             YLH+++TETLRLYPAVPQDPKGILEDDVLPDGT++KAGGMVTYVPYSMGRMEYNWG DAA
Sbjct  370   YLHALITETLRLYPAVPQDPKGILEDDVLPDGTKLKAGGMVTYVPYSMGRMEYNWGSDAA  429

Query  471   SFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH  292
             SF PERWLKDGVFQNASPFKFTAFQ GPRICLGKDSAYLQMKMALAILCRF+KFKLV GH
Sbjct  430   SFNPERWLKDGVFQNASPFKFTAFQGGPRICLGKDSAYLQMKMALAILCRFYKFKLVPGH  489

Query  291   SVEYRMMTVLSMAHGLKLTVSPRT  220
              V+YRMMT+LSM HGLKLTVS R+
Sbjct  490   PVKYRMMTILSMEHGLKLTVSLRS  513



>ref|XP_011017522.1| PREDICTED: cytochrome P450 704B1 [Populus euphratica]
Length=534

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/517 (79%), Positives = 459/517 (89%), Gaps = 4/517 (1%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             +VL L  ++  W+FIHR +QR+  GP++WP +GA++EQ  NY RMHDWLV YL+   +VV
Sbjct  19    MVLLLACMVLSWIFIHRWNQRQKKGPKTWPTVGAAIEQFMNYNRMHDWLVKYLSELRTVV  78

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  79    VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  138

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFAS+NLRDFSTVVFR+YSLKL +IL+QAS  NQ+V+MQ LLMRMTLDSICKVGFGV
Sbjct  139   ASFEFASRNLRDFSTVVFREYSLKLSSILSQASFHNQEVEMQGLLMRMTLDSICKVGFGV  198

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTLAP+LP+N FA+AFD ANIIVTLRFIDPLWK+KKFLNVGSEA+LD+SI+ +DDFTY
Sbjct  199   EIGTLAPSLPDNLFAQAFDTANIIVTLRFIDPLWKVKKFLNVGSEALLDKSIKIVDDFTY  258

Query  1041  SVIRKRKAEIEE---TQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             S+IRKRKAEIEE   T KN K MKHDILSRFIELG+DPE+N+ DKSLRD+VLNFVIAGRD
Sbjct  259   SMIRKRKAEIEEGRGTGKNNK-MKHDILSRFIELGEDPESNLTDKSLRDVVLNFVIAGRD  317

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTATTLSWAIYM+MTH  VAEKL+SEL+  EE RAKEENV LHQ + +DPES +QRAMQ+
Sbjct  318   TTATTLSWAIYMVMTHNHVAEKLYSELKIFEEDRAKEENVKLHQINPEDPESFSQRAMQY  377

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
             AG L YD++ +L YLH+V+TETLRLYPAVPQDPKGI EDDVLPDGT+VKAGGMVTYVPYS
Sbjct  378   AGFLTYDSLGRLSYLHAVITETLRLYPAVPQDPKGIREDDVLPDGTKVKAGGMVTYVPYS  437

Query  510   MGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             MGRMEYNWGPDAASFKPERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA+
Sbjct  438   MGRMEYNWGPDAASFKPERWLKDGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAL  497

Query  330   LCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             LCRFF F LV  HSVEYRMMT LSMAHGLKL ++ ++
Sbjct  498   LCRFFSFSLVPNHSVEYRMMTTLSMAHGLKLRIARKS  534



>ref|XP_008221727.1| PREDICTED: cytochrome P450 704B1 [Prunus mume]
Length=534

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/511 (80%), Positives = 459/511 (90%), Gaps = 3/511 (1%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             L  ++  W+ +HR SQ+   GP++WP++GA++EQ+ NY RMHDWLV YL+ S SVVVPMP
Sbjct  25    LVCMVLSWIIVHRWSQKNQKGPKTWPLVGAAIEQLMNYDRMHDWLVKYLSESNSVVVPMP  84

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
             FTTYTYIA P NVEHVLK NF NYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS E
Sbjct  85    FTTYTYIADPANVEHVLKINFANYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASFE  144

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             FASKNLRDFSTVVFRDYSLKL  IL+QA    QQVDMQ+LLMRMTLDSICKVGFGVEIGT
Sbjct  145   FASKNLRDFSTVVFRDYSLKLHAILSQA-FEGQQVDMQELLMRMTLDSICKVGFGVEIGT  203

Query  1209  LAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIR  1030
             LAPNLP+N FAKAFD ANIIVTLRFIDPLW+IK++LNVGSEA+LD+SI+ IDDFTYSVIR
Sbjct  204   LAPNLPDNHFAKAFDTANIIVTLRFIDPLWRIKRYLNVGSEALLDKSIKIIDDFTYSVIR  263

Query  1029  KRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
             +RKAEI+E  +N ++  MKHD+LSRFIELG+DPE+ + DKSLRD+VLNFVIAGRDTTATT
Sbjct  264   RRKAEIKEAGQNSENNKMKHDLLSRFIELGEDPESKLTDKSLRDVVLNFVIAGRDTTATT  323

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSWAIYMIM+H  VAEKL+SEL+++EE RA+EE V L QY ++D ES NQR  QFAGLLN
Sbjct  324   LSWAIYMIMSHSHVAEKLYSELKTLEEDRAREEKVSLVQYDTEDLESFNQRVTQFAGLLN  383

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
             YD++ +LYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSMGRME
Sbjct  384   YDSLGRLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSMGRME  443

Query  495   YNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFF  316
             YNWGPDAASFKP+RWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF+
Sbjct  444   YNWGPDAASFKPDRWLKDGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFY  503

Query  315   KFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             KF LV GH VEYRMMT+LSMAHGLKLTV+ R
Sbjct  504   KFTLVPGHPVEYRMMTILSMAHGLKLTVARR  534



>ref|XP_007225718.1| hypothetical protein PRUPE_ppa004298mg [Prunus persica]
 gb|EMJ26917.1| hypothetical protein PRUPE_ppa004298mg [Prunus persica]
Length=517

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/509 (80%), Positives = 459/509 (90%), Gaps = 3/509 (1%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             L  ++  W+ +HR SQ+   GP++WP++GA++EQ+ NY RMHDWLV YL+ S SVVVPMP
Sbjct  2     LVCMVLSWIIVHRWSQKNKKGPKTWPLVGAAIEQLMNYDRMHDWLVKYLSESNSVVVPMP  61

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
             FTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS E
Sbjct  62    FTTYTYIADPANVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASFE  121

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             FASKNLRDFSTVVFRDYSLKL  IL+QA    QQVDMQ+LLMRMTLDSICKVGFGVEIGT
Sbjct  122   FASKNLRDFSTVVFRDYSLKLHAILSQA-FEGQQVDMQELLMRMTLDSICKVGFGVEIGT  180

Query  1209  LAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIR  1030
             LAPNLP+N FAKAFD ANIIVTLRFIDPLW+IK++LNVGSEA+LD+SI+ IDDFTYSVIR
Sbjct  181   LAPNLPDNHFAKAFDTANIIVTLRFIDPLWRIKRYLNVGSEALLDKSIKIIDDFTYSVIR  240

Query  1029  KRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
             +RKAEI+E  +N ++  MKHD+LSRF+ELG+DPE+ + DKSLRD+VLNFVIAGRDTTATT
Sbjct  241   RRKAEIKEAGQNSENNKMKHDLLSRFVELGEDPESKLTDKSLRDVVLNFVIAGRDTTATT  300

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSWAIYMI++H  VAEKL+SEL+++EE RA+EE V L QY ++D ES NQR  QFAGLLN
Sbjct  301   LSWAIYMIISHSHVAEKLYSELKTLEEDRAREEKVSLLQYDTEDLESFNQRVTQFAGLLN  360

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
             YD++ +LYYLH+V+TETLRLYPAVPQDPKGIL+DDVLPDGT+VKAGGMVTYVPYSMGRME
Sbjct  361   YDSLGRLYYLHAVITETLRLYPAVPQDPKGILDDDVLPDGTKVKAGGMVTYVPYSMGRME  420

Query  495   YNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFF  316
             YNWGPDAASFKPERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF+
Sbjct  421   YNWGPDAASFKPERWLKDGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFY  480

Query  315   KFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             KF LV GH VEYRMMT+LSMAHGLKLTV+
Sbjct  481   KFTLVPGHPVEYRMMTILSMAHGLKLTVA  509



>ref|XP_008389448.1| PREDICTED: cytochrome P450 704B1 [Malus domestica]
Length=531

 Score =   870 bits (2248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/520 (79%), Positives = 466/520 (90%), Gaps = 3/520 (1%)
 Frame = -1

Query  1776  SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  1597
             SS + L + L +++  W+FIHR SQR   GP++WP++GA++EQ TNY RMHDWLV YL+ 
Sbjct  13    SSQDGLFMVLCMVL-SWIFIHRWSQRNKKGPKTWPLVGAAIEQFTNYDRMHDWLVKYLSE  71

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
             S SVVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVY SYMEVLLGDGIFN DGELWR
Sbjct  72    SNSVVVPMPFTTYTYIADPANVEHVLKTNFANYPKGEVYRSYMEVLLGDGIFNVDGELWR  131

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
             KQRKTAS EFASKNLRDFSTVVFRDYSLKL +IL++AS   QQVDMQ+LLMRMTLDSICK
Sbjct  132   KQRKTASFEFASKNLRDFSTVVFRDYSLKLHSILSRASFQGQQVDMQELLMRMTLDSICK  191

Query  1236  VGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTI  1057
             VGFGVEIGTLAPNLP+N FAKAFD ANIIVTLRFIDPLW+IK++LNVGSEA+LD+SI+TI
Sbjct  192   VGFGVEIGTLAPNLPDNHFAKAFDTANIIVTLRFIDPLWRIKRYLNVGSEALLDKSIKTI  251

Query  1056  DDFTYSVIRKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
             DDFTYSVIR+RKAEI+ETQ++ ++  MKHD+LSRFIELGKD E+++ DKSLRD+VLNFVI
Sbjct  252   DDFTYSVIRRRKAEIKETQQSSENNKMKHDLLSRFIELGKDSESDLTDKSLRDVVLNFVI  311

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AGRDTTATTLSWAIYM+MTH  VAEKL+SEL++ EE +A+EE V L  Y +++ E  N+R
Sbjct  312   AGRDTTATTLSWAIYMVMTHPHVAEKLYSELKTFEEDQAREEKVSLLPYDTENLELFNRR  371

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               QFAGLL+YD++ KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTY
Sbjct  372   VAQFAGLLSYDSLGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTY  431

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             VPYSMGRMEYNWGPDAASFKPERWLK+G FQNASPFKFTAFQAGPRICLGKDSAYLQMKM
Sbjct  432   VPYSMGRMEYNWGPDAASFKPERWLKEGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  491

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             ALAILCRF+ F LV GH V+YRMMT+LSMAHGLKLT++ R
Sbjct  492   ALAILCRFYTFTLVPGHPVQYRMMTILSMAHGLKLTIARR  531



>emb|CDP00359.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/524 (77%), Positives = 465/524 (89%), Gaps = 4/524 (1%)
 Frame = -1

Query  1770  METLV-LALGLIMFCWVFIHRLSQRK-GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  1597
             ME L+ +A  +I+  WV IHRL QR   G P++WP++GA++EQ+ NY +MHDW++ YLA 
Sbjct  1     MEILIFVACMVILVSWVLIHRLKQRNVKGCPKTWPLVGAAIEQLLNYDQMHDWILKYLAR  60

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
             S +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKG+ YHSYMEVLLG+GIFN DGELWR
Sbjct  61    SRTVVVPMPFTTYTYIADPTNVEHVLKTNFGNYPKGDTYHSYMEVLLGNGIFNVDGELWR  120

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
             KQRKTAS EFAS+NLRDFSTVVFR+YSLKL  IL++AS   Q++DMQ+LLMRMTLDSICK
Sbjct  121   KQRKTASFEFASRNLRDFSTVVFREYSLKLSEILSKASHQKQEIDMQELLMRMTLDSICK  180

Query  1236  VGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTI  1057
             VGFG EIGTLAP LP+NRFA+AFD ANIIVTLRFIDPLWKIKKFLNVGSEA+LDQSI+ I
Sbjct  181   VGFGAEIGTLAPELPDNRFAQAFDTANIIVTLRFIDPLWKIKKFLNVGSEAVLDQSIKII  240

Query  1056  DDFTYSVIRKRKAEIEETQKNEK--SMKHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
             DDFTYSVIR+RKAE+EE Q   K   +KHDILSRFIEL KDP+N++ DKSLRD+VLNFVI
Sbjct  241   DDFTYSVIRRRKAELEEAQGANKDAKIKHDILSRFIELSKDPDNHMTDKSLRDVVLNFVI  300

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AGRDTTATTLSWAIYMIMTHEDVAEK++ EL+++EE RAKEEN++L  Y  DD ES N+R
Sbjct  301   AGRDTTATTLSWAIYMIMTHEDVAEKIYEELKTLEESRAKEENIILQPYQRDDFESFNKR  360

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
              MQFAGLLNY+++ +L+YLH+V+TETLRLYPAVPQDPKGILEDD+LPDGTRVKAGGMVTY
Sbjct  361   VMQFAGLLNYESLGRLFYLHAVITETLRLYPAVPQDPKGILEDDILPDGTRVKAGGMVTY  420

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             VPYSMGRMEYNWGPDAASFKPERWLK+G FQ+ASPFKFTAFQAGPRICLGKDSAYLQMKM
Sbjct  421   VPYSMGRMEYNWGPDAASFKPERWLKEGCFQSASPFKFTAFQAGPRICLGKDSAYLQMKM  480

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRTHNP  211
             ALAILCRF++FKL+ GH V+YRMMT+LSMAHGLK++VS     P
Sbjct  481   ALAILCRFYRFKLIPGHVVKYRMMTILSMAHGLKVSVSRHPEAP  524



>ref|XP_010683141.1| PREDICTED: cytochrome P450 704B1 [Beta vulgaris subsp. vulgaris]
Length=539

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/513 (80%), Positives = 454/513 (88%), Gaps = 2/513 (0%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             ++L    + F W+FIHRLSQR   GP++WP+IGA++EQ  NY  MHDWLV YL+   +VV
Sbjct  24    ILLVACCMGFSWLFIHRLSQRNKLGPKTWPLIGAALEQFMNYDNMHDWLVEYLSKCRTVV  83

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGEVY SYMEVLLGDGIFNADGE WRKQRKT
Sbjct  84    VPMPFTTYTYIADPSNVEHVLKTNFVNYPKGEVYQSYMEVLLGDGIFNADGESWRKQRKT  143

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFASKNLRDFSTVVFR+YSLKLFTIL++AS  N+ VDMQ+LLMRMTLDSICKVGFGV
Sbjct  144   ASFEFASKNLRDFSTVVFREYSLKLFTILSEASFENRSVDMQELLMRMTLDSICKVGFGV  203

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTLAP+LPEN FA+AFD ANIIVTLRFIDPLWKIKKFLNVGSEA+L +SI+ IDDFTY
Sbjct  204   EIGTLAPDLPENSFARAFDTANIIVTLRFIDPLWKIKKFLNVGSEALLSESIKIIDDFTY  263

Query  1041  SVIRKRKAEIEETQK--NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDT  868
             SVIR+RK+EIEE ++  N   MKHDILSRFIELG+DPE+N  +KSLRDIVLNFVIAGRDT
Sbjct  264   SVIRRRKSEIEEAKRDSNAIKMKHDILSRFIELGEDPESNTTEKSLRDIVLNFVIAGRDT  323

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTLSWAIYMIM+H+ VAEKL+ EL+++EE RA EENV L +   DD  S N+R  QFA
Sbjct  324   TATTLSWAIYMIMSHQSVAEKLYQELKALEEERAIEENVELIECDIDDTVSFNKRVSQFA  383

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
              LL YD++AKLYYLH+VVTETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSM
Sbjct  384   QLLTYDSLAKLYYLHAVVTETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSM  443

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRMEYNWGPDAA FKPERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL
Sbjct  444   GRMEYNWGPDAADFKPERWLKDGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  503

Query  327   CRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             CRF+ FKLV GH ++YRMMT+LSMAHGLKLTVS
Sbjct  504   CRFYTFKLVAGHPIKYRMMTILSMAHGLKLTVS  536



>ref|XP_010102176.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXB92426.1| Cytochrome P450 704C1 [Morus notabilis]
Length=565

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/505 (79%), Positives = 454/505 (90%), Gaps = 2/505 (0%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             VL +   +  W+ IHR SQR   GP++WP++GA++EQ+TNY RMHDW+V YL+ S SVVV
Sbjct  21    VLVIACAILSWILIHRWSQRNKKGPKTWPLVGAAIEQLTNYDRMHDWIVPYLSESKSVVV  80

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
             PMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKTA
Sbjct  81    PMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKTA  140

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFST+VFR+YS KL  IL+QAS   Q VDMQ+LLMRMTLDSICKVGFGVE
Sbjct  141   SFEFASKNLRDFSTIVFREYSQKLHAILSQASFHGQVVDMQELLMRMTLDSICKVGFGVE  200

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTLAP LP+NRF++AFDAANIIVTLRFIDPLW+IK+FLNVGSEA+L++SI+TIDDFTYS
Sbjct  201   IGTLAPELPDNRFSQAFDAANIIVTLRFIDPLWRIKRFLNVGSEALLEKSIKTIDDFTYS  260

Query  1038  VIRKRKAEIEETQKNEK--SMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTT  865
             VI +RKAEI+E + + +   MKHDILSRFIELG+DPE+N+ DKSLRD+VLNFVIAGRDTT
Sbjct  261   VIHRRKAEIKEARGSSRDNKMKHDILSRFIELGEDPESNLTDKSLRDVVLNFVIAGRDTT  320

Query  864   ATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAG  685
             ATTLSWAIYMIMTH  VAEKL+SEL+S+EE +A+EENV L +Y+++DP S N+RA QFAG
Sbjct  321   ATTLSWAIYMIMTHSHVAEKLYSELKSLEEDQAREENVSLREYNAEDPVSFNERARQFAG  380

Query  684   LLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMG  505
             LLNYD++ +LYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSMG
Sbjct  381   LLNYDSLGRLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSMG  440

Query  504   RMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             RMEYNWGPDAASFKPERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKM LAILC
Sbjct  441   RMEYNWGPDAASFKPERWLKDGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMTLAILC  500

Query  324   RFFKFKLVEGHSVEYRMMTVLSMAH  250
             RF+KF LV GH V+YRMMT+LSMAH
Sbjct  501   RFYKFILVPGHRVDYRMMTILSMAH  525



>gb|KDP41226.1| hypothetical protein JCGZ_15633 [Jatropha curcas]
Length=516

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/512 (79%), Positives = 452/512 (88%), Gaps = 3/512 (1%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             +  +    +F+H+  +R   GPR+WP+IGA++EQ  NY RMHDWLV YL+   +VVVPMP
Sbjct  6     IACLALSCIFLHQWRKRNKKGPRTWPIIGAAIEQFMNYDRMHDWLVAYLSELRTVVVPMP  65

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
             FTTYTYIA P +VEHVLKTNF NYPKGE YHSYMEVLLGDGIFNADGELWR+QRKTAS E
Sbjct  66    FTTYTYIADPASVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNADGELWRRQRKTASFE  125

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             FASKNLRDFST+VFR+YSLKL +IL+ AS  NQ++DMQ+LLMRMTLDSICKVGFGVEIG 
Sbjct  126   FASKNLRDFSTIVFREYSLKLSSILSNASFQNQEIDMQELLMRMTLDSICKVGFGVEIGA  185

Query  1209  LAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIR  1030
             LAPNLP+N FA+AFDAANIIVTLRFIDPLWKIKKFLNVGSEA+LD+SI+ IDDFTYSVI 
Sbjct  186   LAPNLPDNCFAQAFDAANIIVTLRFIDPLWKIKKFLNVGSEALLDKSIKIIDDFTYSVIY  245

Query  1029  KRKAEIEETQK--NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
             KRKAEIE  +K  +EK  KHDILSRFIELG+DPENN  DKSLRD+VLNFVIAGRDTTATT
Sbjct  246   KRKAEIEAARKIGHEKG-KHDILSRFIELGEDPENNFTDKSLRDVVLNFVIAGRDTTATT  304

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSWAIYMIMTH D+AEKL+ EL++ EE RAKEENV+L Q+  DD ES  QR MQ+AGLL 
Sbjct  305   LSWAIYMIMTHNDIAEKLYMELKTFEEERAKEENVMLLQFDLDDLESFTQRIMQYAGLLT  364

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
             YD++ KLYYLH+VVTETLRLYPAVPQDPKGI+EDD+LPDGTRVKAGGMVTYVPYSMGRME
Sbjct  365   YDSLGKLYYLHAVVTETLRLYPAVPQDPKGIMEDDILPDGTRVKAGGMVTYVPYSMGRME  424

Query  495   YNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFF  316
             YNWGPDAASFKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKM LAILCRFF
Sbjct  425   YNWGPDAASFKPERWLKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKMTLAILCRFF  484

Query  315   KFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             KF LV  H V+YRMMT LSMAHGLKL VS R+
Sbjct  485   KFHLVPNHPVKYRMMTTLSMAHGLKLRVSRRS  516



>ref|XP_006391009.1| hypothetical protein EUTSA_v10018405mg [Eutrema salsugineum]
 gb|ESQ28295.1| hypothetical protein EUTSA_v10018405mg [Eutrema salsugineum]
Length=519

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/518 (77%), Positives = 456/518 (88%), Gaps = 3/518 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             ++ + L  ++  W+F+HR  QRK  GP++WP++GA++EQ+TN+ RMHDWLV YL +S +V
Sbjct  2     SIWIVLACMVTSWIFLHRWGQRKQRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLFTIL QAS  +QQVDMQ+LLMRMT DSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFTILCQASFNDQQVDMQELLMRMTQDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP+LPENRFAKAFD ANIIVTLRFIDPLWK+KKFLN+GSEA+L +SI+ +DDFT
Sbjct  182   VEIGTLAPDLPENRFAKAFDTANIIVTLRFIDPLWKLKKFLNIGSEALLGKSIKVVDDFT  241

Query  1044  YSVIRKRKAEIEETQK---NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGR  874
             YSVIR+RKAEI ETQK   N   +KHDILSRFIE+  DPE+   +KSLRDIVLNFVIAGR
Sbjct  242   YSVIRRRKAEILETQKSPANNNKVKHDILSRFIEISDDPESKETEKSLRDIVLNFVIAGR  301

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTATTL+WAIYMIM HE VAEKL SEL+ +E  +A+E    LH Y ++D +S N+R  Q
Sbjct  302   DTTATTLTWAIYMIMMHEQVAEKLCSELKELEREKAEETKTPLHHYDTEDFKSFNERVTQ  361

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FAGLLNYD++ KL+YLH+VVTETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTYVPY
Sbjct  362   FAGLLNYDSLGKLHYLHAVVTETLRLYPAVPQDPKGVLEDDILPNGTKVKAGGMVTYVPY  421

Query  513   SMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             SMGRMEYNWG DAASFKPERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA+A
Sbjct  422   SMGRMEYNWGSDAASFKPERWLKDGTFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAMA  481

Query  333   ILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             ILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   ILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  519



>ref|XP_002522465.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39957.1| cytochrome P450, putative [Ricinus communis]
Length=536

 Score =   854 bits (2207),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/513 (78%), Positives = 452/513 (88%), Gaps = 2/513 (0%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             +VL +  ++  W+FI+R +QR   GP+SWP++GA++EQ+TNY RMHDWLV YL+   +VV
Sbjct  21    MVLMIACLVLSWMFIYRWTQRNKKGPKSWPIVGAAIEQLTNYDRMHDWLVEYLSELRTVV  80

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DG+LWRKQRKT
Sbjct  81    VPMPFTTYTYIADPTNVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGDLWRKQRKT  140

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFASKNLRDFST VFR+Y+LKL +IL+ AS  N+++DMQ+L MR+TLDSICKVGFGV
Sbjct  141   ASFEFASKNLRDFSTTVFREYTLKLSSILSHASFHNKEIDMQELFMRLTLDSICKVGFGV  200

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTLAP+LP+N FA+AFD ANIIVTLRFIDPLWK+KKFLNVGSEA+L++SI+ IDDFTY
Sbjct  201   EIGTLAPDLPDNCFAQAFDTANIIVTLRFIDPLWKVKKFLNVGSEALLEKSIKIIDDFTY  260

Query  1041  SVIRKRKAEIEETQK--NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDT  868
             SVI +RKAE+EE +K  N   +KHDILSRFIELG+DP+NN+ DKSLRDIVLNFVIAGRDT
Sbjct  261   SVIHRRKAEVEEARKTRNNNKVKHDILSRFIELGEDPDNNLTDKSLRDIVLNFVIAGRDT  320

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTLSWAIYMIMT+  VAE L+ EL+++EE RAKEENV L Q   DDPES  QR +Q+A
Sbjct  321   TATTLSWAIYMIMTNNHVAENLFMELKTLEEERAKEENVTLLQIDLDDPESFTQRLVQYA  380

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
              LL YD+  KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSM
Sbjct  381   ELLTYDSFGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSM  440

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRMEYNWGPDAASFKPERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKM LAIL
Sbjct  441   GRMEYNWGPDAASFKPERWLKDGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMTLAIL  500

Query  327   CRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             CRFFKF LV  H V+YRMMT+LSMAHGLKL V+
Sbjct  501   CRFFKFDLVSNHPVQYRMMTILSMAHGLKLRVT  533



>ref|XP_004298418.1| PREDICTED: cytochrome P450 704C1-like [Fragaria vesca subsp. 
vesca]
Length=538

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/516 (78%), Positives = 455/516 (88%), Gaps = 2/516 (0%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             L L  ++  W+ IHR SQR   GP++WP++GA++EQ+ NY RMHDWLV YL+ S SVVVP
Sbjct  22    LMLACMVLSWIVIHRWSQRNRKGPKTWPLVGAAIEQLVNYHRMHDWLVKYLSESNSVVVP  81

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFTTYTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFN+DGE WRKQRKTAS
Sbjct  82    MPFTTYTYIADPANVEHVLKTNFANYPKGEVYQSYMQVLLGDGIFNSDGEHWRKQRKTAS  141

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFSTVVFRDYSLKL +IL++AS    QVD+Q+LLMRMTLDSICKVGFGVEI
Sbjct  142   FEFASKNLRDFSTVVFRDYSLKLHSILSRASFQGLQVDIQELLMRMTLDSICKVGFGVEI  201

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTLAPNLP+N+FA+AFD ANIIVT RFIDPLWKIKKFLN+G+EA+LD+S++TIDDFTYSV
Sbjct  202   GTLAPNLPDNKFAQAFDTANIIVTYRFIDPLWKIKKFLNLGTEALLDKSMKTIDDFTYSV  261

Query  1035  IRKRKAEIEETQK--NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
             IRKRK+EI+E Q+  ++  MKHDILSRFIELG+DPE+N+ DKSLRDIVLNFVIAGRDTTA
Sbjct  262   IRKRKSEIKEAQQSADKNLMKHDILSRFIELGEDPESNLTDKSLRDIVLNFVIAGRDTTA  321

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
             TTLSWAIYMIMTH +VAEKL  EL+++EE  A+EE V L QY  +D ES NQR  QFAGL
Sbjct  322   TTLSWAIYMIMTHPEVAEKLHMELKTLEEALAREEKVPLLQYDKEDLESFNQRVKQFAGL  381

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L+YD++ +LYYLH+V+TETLRLYPAVPQDPKGILEDD+LPDGT+VKAGGMVTYVPYSMGR
Sbjct  382   LSYDSLGRLYYLHAVITETLRLYPAVPQDPKGILEDDILPDGTKVKAGGMVTYVPYSMGR  441

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             MEYNWG DAASFKPERWLKDG F NASPFKFTAFQAGPRICLGKDSAYLQMKM LAILCR
Sbjct  442   MEYNWGADAASFKPERWLKDGSFLNASPFKFTAFQAGPRICLGKDSAYLQMKMVLAILCR  501

Query  321   FFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRTHN  214
             FF F LV GH +EYRMMT+LSM HGLK+ V+ R+ +
Sbjct  502   FFTFTLVPGHPIEYRMMTILSMKHGLKINVARRSSD  537



>ref|XP_010651872.1| PREDICTED: cytochrome P450 704B1 [Vitis vinifera]
Length=529

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/514 (77%), Positives = 455/514 (89%), Gaps = 1/514 (0%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             +L L   +  W+ IHR SQR   GP++WP++GA++EQ+ NY RMHDWLV YL+ S +V V
Sbjct  16    ILMLACTVLTWIAIHRWSQRHTKGPKTWPLVGAAIEQLINYDRMHDWLVKYLSKSRTVAV  75

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
             PMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWR+QRKTA
Sbjct  76    PMPFTTYTYIADPANVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNVDGELWRRQRKTA  135

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFST+VFR+YSLKL  IL++AS  N++VDMQDLLMRMTLDSICKVGFGVE
Sbjct  136   SFEFASKNLRDFSTIVFREYSLKLSAILSEASFHNREVDMQDLLMRMTLDSICKVGFGVE  195

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTLAPNLPEN FA+AFD ANIIVTLRFIDPLWKIKKFLNVGSE++LD+SI+ IDDFTYS
Sbjct  196   IGTLAPNLPENCFARAFDTANIIVTLRFIDPLWKIKKFLNVGSESLLDKSIKVIDDFTYS  255

Query  1038  VIRKRKAEIEETQK-NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
             VIR RKAEI++ +K ++  +KHDILSRFIELG++PE+N+ DKSLRD+VLNFVIAGRDTTA
Sbjct  256   VIRTRKAEIDQARKSHDDKIKHDILSRFIELGENPESNLTDKSLRDVVLNFVIAGRDTTA  315

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
             TTLSWA+YM+M H  VA+KL+SEL++ EE RAKE+ + L  Y  +D +S NQR  QFA L
Sbjct  316   TTLSWAVYMMMAHAHVADKLYSELKTFEEDRAKEDKISLLHYDIEDSKSFNQRVTQFARL  375

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L YD++ +L+YLH+V+TETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR
Sbjct  376   LTYDSLGRLHYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  435

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             MEYNWGPDA  FKPERWLK+G FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA+A+LCR
Sbjct  436   MEYNWGPDATLFKPERWLKEGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAIALLCR  495

Query  321   FFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             FFKF LV+GH V+YRMMT+LSMA+GLK+TVS R+
Sbjct  496   FFKFNLVQGHIVKYRMMTILSMANGLKVTVSRRS  529



>ref|XP_006475855.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis]
Length=518

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/516 (78%), Positives = 451/516 (87%), Gaps = 3/516 (1%)
 Frame = -1

Query  1758  VLALGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             +L L   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RMHDWLV YL+   +VV
Sbjct  3     MLMLACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYLSELKTVV  62

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  63    VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  122

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFASKNLRDFST VFR+YSLKL +ILTQAS  NQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  123   ASFEFASKNLRDFSTKVFREYSLKLSSILTQASCHNQEIDMQELLMRMTLDSICKVGFGV  182

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTLAPNLP+NRFA+AFD ANIIVTLRFIDPLWKIK+FL++GSEA+LD+SI+ IDDFTY
Sbjct  183   EIGTLAPNLPDNRFAQAFDTANIIVTLRFIDPLWKIKRFLHLGSEALLDKSIKVIDDFTY  242

Query  1041  SVIRKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDT  868
             SVI++RKAEI+E ++      +K+DIL+RFIEL +DPE+N+ DKSLRD+VLNFVIAGRDT
Sbjct  243   SVIKRRKAEIQEARETSDGTKIKYDILTRFIELSEDPESNLTDKSLRDVVLNFVIAGRDT  302

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTL+W +YM MTH  VAEKL+SEL++ E  RAKEE   L QY  +D ES NQR  QFA
Sbjct  303   TATTLTWGVYMAMTHNHVAEKLYSELKAFEADRAKEEKASLVQYDKEDLESFNQRVTQFA  362

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
             GLLNYD+M KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSM
Sbjct  363   GLLNYDSMGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSM  422

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL
Sbjct  423   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  482

Query  327   CRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             CRFFKFKLV  H V+YRMMT+LSM HGLKLTV  R+
Sbjct  483   CRFFKFKLVPDHPVKYRMMTILSMEHGLKLTVERRS  518



>gb|KDO80235.1| hypothetical protein CISIN_1g035880mg [Citrus sinensis]
Length=530

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/516 (78%), Positives = 451/516 (87%), Gaps = 3/516 (1%)
 Frame = -1

Query  1758  VLALGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             +L L   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RMHDWLV YL+   +VV
Sbjct  15    MLMLACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYLSELKTVV  74

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  75    VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  134

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFASKNLRDFST VFR+YSLKL +ILTQAS  NQ++DMQ+LLMRMTLDSICKVGFGV
Sbjct  135   ASFEFASKNLRDFSTKVFREYSLKLSSILTQASCHNQEIDMQELLMRMTLDSICKVGFGV  194

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTLAPNLP+NRFA+AFD ANIIVTLRFIDPLWKIK+FL++GSEA+LD+SI+ IDDFTY
Sbjct  195   EIGTLAPNLPDNRFAQAFDTANIIVTLRFIDPLWKIKRFLHLGSEALLDKSIKVIDDFTY  254

Query  1041  SVIRKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDT  868
             SVI++RKAEI+E ++      +K+DIL+RFIEL +DPE+N+ DKSLRD+VLNFVIAGRDT
Sbjct  255   SVIKRRKAEIQEARETSDGTKIKYDILTRFIELSEDPESNLTDKSLRDVVLNFVIAGRDT  314

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTL+W +YM MTH  VAEKL+SEL++ E  RAKEE   L QY  +D ES NQR  QFA
Sbjct  315   TATTLTWGVYMAMTHNHVAEKLYSELKAFEADRAKEEKASLVQYDKEDLESFNQRVTQFA  374

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
             GLLNYD+M KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSM
Sbjct  375   GLLNYDSMGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSM  434

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL
Sbjct  435   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  494

Query  327   CRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             CRFFKFKLV  H V+YRMMT+LSM HGLKLTV  R+
Sbjct  495   CRFFKFKLVPDHPVKYRMMTILSMEHGLKLTVERRS  530



>ref|XP_006450915.1| hypothetical protein CICLE_v10010274mg [Citrus clementina]
 gb|ESR64155.1| hypothetical protein CICLE_v10010274mg [Citrus clementina]
Length=514

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/513 (78%), Positives = 450/513 (88%), Gaps = 3/513 (1%)
 Frame = -1

Query  1749  LGLIMFCWVF-IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM  1573
             +   +  W+  IH  SQ+   GP++WP +GA++EQ+ NY RMHDWLV YL+   +VVVPM
Sbjct  2     VACTVLSWILLIHWWSQKNQRGPKTWPFVGAAIEQLMNYDRMHDWLVNYLSELKTVVVPM  61

Query  1572  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  1393
             PFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKTAS 
Sbjct  62    PFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKTASF  121

Query  1392  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIG  1213
             EFASKNLRDFST VFR+YSLKL +ILTQAS  NQ++DMQ+LLMRMTLDSICKVGFGVEIG
Sbjct  122   EFASKNLRDFSTKVFREYSLKLSSILTQASCHNQEIDMQELLMRMTLDSICKVGFGVEIG  181

Query  1212  TLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVI  1033
             TLAPNLP+NRFA+AFD ANIIVTLRFIDPLWKIK+FL++GSEA+LD+SI+ IDDFTYSVI
Sbjct  182   TLAPNLPDNRFAQAFDTANIIVTLRFIDPLWKIKRFLHLGSEALLDKSIKVIDDFTYSVI  241

Query  1032  RKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             ++RKAEI+E ++      +K+DIL+RFIEL +DPE+N+ DKSLRD+VLNFVIAGRDTTAT
Sbjct  242   KRRKAEIQEARETSDGTKIKYDILTRFIELSEDPESNLTDKSLRDVVLNFVIAGRDTTAT  301

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             TL+W +YM MTH  VAEKL+SEL++ E  RAKEE V L QY  +D ES NQR  QFAGLL
Sbjct  302   TLTWGVYMAMTHNHVAEKLYSELKAFEADRAKEEKVSLVQYDKEDLESFNQRVTQFAGLL  361

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
             NYD+M KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSMGRM
Sbjct  362   NYDSMGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSMGRM  421

Query  498   EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
             EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF
Sbjct  422   EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  481

Query  318   FKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             FKFKLV  H V+YRMMT+LSM HGLKLTV  R+
Sbjct  482   FKFKLVPDHPVKYRMMTILSMEHGLKLTVERRS  514



>ref|XP_004138991.1| PREDICTED: cytochrome P450 704C1-like [Cucumis sativus]
 ref|XP_004170943.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 704C1-like [Cucumis 
sativus]
Length=534

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/534 (75%), Positives = 464/534 (87%), Gaps = 7/534 (1%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLAL-GLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYG  1633
             ++S+ L+ S +  LVL +  +I  CW+ I HR +QRK    GP++WP++GA++EQ  NY 
Sbjct  1     MRSSNLRRSGVVALVLVMIAIISACWIIIVHRWNQRKKMRRGPKTWPIVGAAIEQFVNYH  60

Query  1632  RMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLG  1453
             RMHDW++GYL    +VVVPMPFTTYTYIA P NV+H+LKTNF NYPKG+VYHSYMEVLLG
Sbjct  61    RMHDWILGYLNLYRTVVVPMPFTTYTYIADPANVQHILKTNFANYPKGDVYHSYMEVLLG  120

Query  1452  DGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQD  1273
             DGIFN DGELWRKQRKTAS EFASKNLRDFST+VFRDY LKL TILT+ASLLNQQ+DMQ+
Sbjct  121   DGIFNVDGELWRKQRKTASFEFASKNLRDFSTLVFRDYGLKLSTILTRASLLNQQIDMQE  180

Query  1272  LLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVG  1093
             LLMRMTLDSICKVGFGVEIG+LAPNLPEN+FAKAFD AN+IVTLRFIDPLWKIK+FLN+G
Sbjct  181   LLMRMTLDSICKVGFGVEIGSLAPNLPENKFAKAFDTANMIVTLRFIDPLWKIKRFLNLG  240

Query  1092  SEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNE---KSMKHDILSRFIELGKDPENNIN  922
             SEA+LD+SI+TIDDFTYSVI  RK EI+E Q        MKHDILSRFIELG+DP N   
Sbjct  241   SEALLDKSIKTIDDFTYSVIATRKKEIQEAQTTHTDPNKMKHDILSRFIELGEDPNNKFT  300

Query  921   DKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLH  742
             DKSLRDIVLNFVIAGRDTTA TLSW+IYM+MTH DV++KL+SEL+S EE RAKE ++ L 
Sbjct  301   DKSLRDIVLNFVIAGRDTTAATLSWSIYMLMTHSDVSQKLYSELKSFEEERAKEHSISLL  360

Query  741   QYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLP  562
             QY  +D +S + R +QF+ LLNYD++A+L+YLH++VTETLRLYPAVPQDPKGILEDDVLP
Sbjct  361   QYQPNDIQSFDTRVVQFSQLLNYDSLARLHYLHAIVTETLRLYPAVPQDPKGILEDDVLP  420

Query  561   DGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRI  382
             DGT+V+AGGMVTYVPYSMGRMEYNWG DA SFKPERWLK G+FQN SPFKFTAFQAGPRI
Sbjct  421   DGTKVRAGGMVTYVPYSMGRMEYNWGYDATSFKPERWLKQGIFQNESPFKFTAFQAGPRI  480

Query  381   CLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             C+GKDSAYLQMKM LAILCRF+KF LV GH V+YRMMT+LSMA+GLK+TV+PR+
Sbjct  481   CMGKDSAYLQMKMTLAILCRFYKFSLVSGHRVDYRMMTILSMANGLKVTVAPRS  534



>gb|KGN61391.1| hypothetical protein Csa_2G108690 [Cucumis sativus]
Length=556

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/534 (75%), Positives = 464/534 (87%), Gaps = 7/534 (1%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLAL-GLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYG  1633
             ++S+ L+ S +  LVL +  +I  CW+ I HR +QRK    GP++WP++GA++EQ  NY 
Sbjct  23    MRSSNLRRSGVVALVLVMIAIISACWIIIVHRWNQRKKMRRGPKTWPIVGAAIEQFVNYH  82

Query  1632  RMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLG  1453
             RMHDW++GYL    +VVVPMPFTTYTYIA P NV+H+LKTNF NYPKG+VYHSYMEVLLG
Sbjct  83    RMHDWILGYLNLYRTVVVPMPFTTYTYIADPANVQHILKTNFANYPKGDVYHSYMEVLLG  142

Query  1452  DGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQD  1273
             DGIFN DGELWRKQRKTAS EFASKNLRDFST+VFRDY LKL TILT+ASLLNQQ+DMQ+
Sbjct  143   DGIFNVDGELWRKQRKTASFEFASKNLRDFSTLVFRDYGLKLSTILTRASLLNQQIDMQE  202

Query  1272  LLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVG  1093
             LLMRMTLDSICKVGFGVEIG+LAPNLPEN+FAKAFD AN+IVTLRFIDPLWKIK+FLN+G
Sbjct  203   LLMRMTLDSICKVGFGVEIGSLAPNLPENKFAKAFDTANMIVTLRFIDPLWKIKRFLNLG  262

Query  1092  SEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNE---KSMKHDILSRFIELGKDPENNIN  922
             SEA+LD+SI+TIDDFTYSVI  RK EI+E Q        MKHDILSRFIELG+DP N   
Sbjct  263   SEALLDKSIKTIDDFTYSVIATRKKEIQEAQTTHTDPNKMKHDILSRFIELGEDPNNKFT  322

Query  921   DKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLH  742
             DKSLRDIVLNFVIAGRDTTA TLSW+IYM+MTH DV++KL+SEL+S EE RAKE ++ L 
Sbjct  323   DKSLRDIVLNFVIAGRDTTAATLSWSIYMLMTHSDVSQKLYSELKSFEEERAKEHSISLL  382

Query  741   QYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLP  562
             QY  +D +S + R +QF+ LLNYD++A+L+YLH++VTETLRLYPAVPQDPKGILEDDVLP
Sbjct  383   QYQPNDIQSFDTRVVQFSQLLNYDSLARLHYLHAIVTETLRLYPAVPQDPKGILEDDVLP  442

Query  561   DGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRI  382
             DGT+V+AGGMVTYVPYSMGRMEYNWG DA SFKPERWLK G+FQN SPFKFTAFQAGPRI
Sbjct  443   DGTKVRAGGMVTYVPYSMGRMEYNWGYDATSFKPERWLKQGIFQNESPFKFTAFQAGPRI  502

Query  381   CLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             C+GKDSAYLQMKM LAILCRF+KF LV GH V+YRMMT+LSMA+GLK+TV+PR+
Sbjct  503   CMGKDSAYLQMKMTLAILCRFYKFSLVSGHRVDYRMMTILSMANGLKVTVAPRS  556



>ref|XP_002887239.1| oxygen binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63498.1| oxygen binding protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/518 (75%), Positives = 457/518 (88%), Gaps = 3/518 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2     SLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  NQQVDMQ+LL+RMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKNQQVDMQELLLRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP LPEN FAKAFD ANIIVTLRFIDPLWK+KKFLN+GSEA+L +SI+ ++DFT
Sbjct  182   VEIGTLAPELPENHFAKAFDTANIIVTLRFIDPLWKLKKFLNIGSEALLGKSIKVVNDFT  241

Query  1044  YSVIRKRKAEIEETQK---NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGR  874
             YSVIR+RKAE+ E QK   N  ++KHDILSRFIE+  DP++   +KSLRDIVLNFVIAGR
Sbjct  242   YSVIRRRKAELLEAQKSPTNNNTVKHDILSRFIEISDDPDSKETEKSLRDIVLNFVIAGR  301

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTATT++WAIYMIM +E+VAEKL+SEL+ +E+  A++ N  LHQY ++D  S N+R  Q
Sbjct  302   DTTATTVTWAIYMIMMNENVAEKLYSELKELEKESAEQTNTSLHQYDTEDFSSFNERVTQ  361

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTYVPY
Sbjct  362   FAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTYVPY  421

Query  513   SMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             SMGRMEYNWG DAA FKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA+A
Sbjct  422   SMGRMEYNWGSDAALFKPERWLKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAMA  481

Query  333   ILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             ILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   ILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  519



>ref|XP_007046039.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
2 [Theobroma cacao]
 gb|EOY01871.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
2 [Theobroma cacao]
Length=537

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/514 (77%), Positives = 452/514 (88%), Gaps = 4/514 (1%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             +L L  ++  W+F +R +QR   GP++WP IGAS+EQ  NY RMHDWLV YL+ S +VVV
Sbjct  21    MLMLACMVVSWIFTYRWNQRNRKGPKTWPFIGASIEQFMNYDRMHDWLVKYLSKSKTVVV  80

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
             PMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELW+KQRKTA
Sbjct  81    PMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWKKQRKTA  140

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFSTVVFR+YSLKL +IL QAS  N ++DMQDLLMRMTLDSICKVGFGVE
Sbjct  141   SFEFASKNLRDFSTVVFREYSLKLHSILNQASFSNLEIDMQDLLMRMTLDSICKVGFGVE  200

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTLAP+LP+N FA+AFD ANIIVTLRF+DPLW++K+FLNVGSEA+L +SI+ ID+FTY+
Sbjct  201   IGTLAPSLPDNCFAQAFDTANIIVTLRFVDPLWRLKRFLNVGSEALLGKSIKVIDEFTYN  260

Query  1038  VIRKRKAEIEETQKNEKS----MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             VIR+RKAEI ET+   K+    +KHDILSRFIEL +DPE+N+ DKSLRD+VLNFVIAGRD
Sbjct  261   VIRRRKAEINETRDTCKTSKNQIKHDILSRFIELSEDPESNLTDKSLRDVVLNFVIAGRD  320

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTATTL+WAIYMIM H +VAE+L+SEL++ EE +A+EE + L  +  +DPES N+RA QF
Sbjct  321   TTATTLTWAIYMIMRHANVAERLYSELKAFEEEQAREEKISLLPFDVEDPESFNRRAAQF  380

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
             AGLLNYD++ +LYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS
Sbjct  381   AGLLNYDSLGRLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  440

Query  510   MGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             MGRMEYNWGPDAASFKPERWLK+G FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI
Sbjct  441   MGRMEYNWGPDAASFKPERWLKEGYFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  500

Query  330   LCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
              CRFFKF+LV  H V YRMMT+LSM HGLKLT++
Sbjct  501   ACRFFKFRLVPDHPVNYRMMTILSMEHGLKLTIA  534



>ref|XP_007046038.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
1 [Theobroma cacao]
 gb|EOY01870.1| Cytochrome P450, family 704, subfamily B, polypeptide 1 isoform 
1 [Theobroma cacao]
Length=535

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/512 (77%), Positives = 452/512 (88%), Gaps = 2/512 (0%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             +L L  ++  W+F +R +QR   GP++WP IGAS+EQ  NY RMHDWLV YL+ S +VVV
Sbjct  21    MLMLACMVVSWIFTYRWNQRNRKGPKTWPFIGASIEQFMNYDRMHDWLVKYLSKSKTVVV  80

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
             PMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELW+KQRKTA
Sbjct  81    PMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWKKQRKTA  140

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFSTVVFR+YSLKL +IL QAS  N ++DMQDLLMRMTLDSICKVGFGVE
Sbjct  141   SFEFASKNLRDFSTVVFREYSLKLHSILNQASFSNLEIDMQDLLMRMTLDSICKVGFGVE  200

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTLAP+LP+N FA+AFD ANIIVTLRF+DPLW++K+FLNVGSEA+L +SI+ ID+FTY+
Sbjct  201   IGTLAPSLPDNCFAQAFDTANIIVTLRFVDPLWRLKRFLNVGSEALLGKSIKVIDEFTYN  260

Query  1038  VIRKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTT  865
             VIR+RKAEI ET+   K+  +KHDILSRFIEL +DPE+N+ DKSLRD+VLNFVIAGRDTT
Sbjct  261   VIRRRKAEINETRDTCKTSKIKHDILSRFIELSEDPESNLTDKSLRDVVLNFVIAGRDTT  320

Query  864   ATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAG  685
             ATTL+WAIYMIM H +VAE+L+SEL++ EE +A+EE + L  +  +DPES N+RA QFAG
Sbjct  321   ATTLTWAIYMIMRHANVAERLYSELKAFEEEQAREEKISLLPFDVEDPESFNRRAAQFAG  380

Query  684   LLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMG  505
             LLNYD++ +LYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMG
Sbjct  381   LLNYDSLGRLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMG  440

Query  504   RMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             RMEYNWGPDAASFKPERWLK+G FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI C
Sbjct  441   RMEYNWGPDAASFKPERWLKEGYFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIAC  500

Query  324   RFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             RFFKF+LV  H V YRMMT+LSM HGLKLT++
Sbjct  501   RFFKFRLVPDHPVNYRMMTILSMEHGLKLTIA  532



>ref|XP_009105494.1| PREDICTED: cytochrome P450 704B1 [Brassica rapa]
 emb|CDX95930.1| BnaA07g28010D [Brassica napus]
Length=519

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/518 (75%), Positives = 456/518 (88%), Gaps = 3/518 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             ++ + L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL +S +V
Sbjct  2     SMWIVLACMLTSWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLF+IL QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFSILCQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP+LPENRFAKAFD ANIIVTLRFIDPLWK+KK+LN+GSEA+L +SI+ +DDFT
Sbjct  182   VEIGTLAPDLPENRFAKAFDTANIIVTLRFIDPLWKMKKYLNIGSEALLGKSIKVVDDFT  241

Query  1044  YSVIRKRKAEIEETQK---NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGR  874
             YS+IR+RK EI E QK   N   MKHDILSRFIE+  DP++   +KSLRDIVLNFVIAGR
Sbjct  242   YSMIRRRKTEILEAQKSPSNNIKMKHDILSRFIEISDDPDSKSTEKSLRDIVLNFVIAGR  301

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTATTL+WAIYMIM +E VAEKL SEL+ +E  +A+E N  L QY ++D +S N+R  Q
Sbjct  302   DTTATTLTWAIYMIMMNEHVAEKLCSELQELEREKAEETNTPLRQYDTEDFKSFNERVTQ  361

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FAG+L+YD++ KL+YLH+VVTETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTYVPY
Sbjct  362   FAGMLSYDSLGKLHYLHAVVTETLRLYPAVPQDPKGVLEDDILPNGTKVKAGGMVTYVPY  421

Query  513   SMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             SMGRMEYNWG DAA+FKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA+A
Sbjct  422   SMGRMEYNWGSDAATFKPERWLKDGMFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAMA  481

Query  333   ILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             ILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   ILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  519



>emb|CDY40931.1| BnaC06g30690D [Brassica napus]
Length=519

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/518 (76%), Positives = 455/518 (88%), Gaps = 3/518 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             ++ + L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL +S +V
Sbjct  2     SMWIVLACMVTSWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYDSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLF+IL QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFSILCQASSKDQQVDMQELLMRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP LPENRFAKAFD ANIIVTLRFIDPLWKIKK+LN+GSEA+L +SI+ +DDFT
Sbjct  182   VEIGTLAPELPENRFAKAFDTANIIVTLRFIDPLWKIKKYLNIGSEALLGKSIKVVDDFT  241

Query  1044  YSVIRKRKAEIEETQK---NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGR  874
             YS+IR+RKAEI E QK   N   MKHDILSRFIE+  DP++   +KSLRDIVLNFVIAGR
Sbjct  242   YSMIRRRKAEILEAQKSPSNNTKMKHDILSRFIEISDDPDSKSTEKSLRDIVLNFVIAGR  301

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTATTL+WAIYMIM +E VAEKL SEL+ +E  +A+E N  L QY ++D +S N+R  Q
Sbjct  302   DTTATTLTWAIYMIMMNEHVAEKLCSELQELEREKAEETNTPLRQYDTEDFKSFNERVTQ  361

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FAG+L+YD++ KL+YLH+VVTETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTYVPY
Sbjct  362   FAGMLSYDSLGKLHYLHAVVTETLRLYPAVPQDPKGVLEDDILPNGTKVKAGGMVTYVPY  421

Query  513   SMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             SMGRMEYNWG DAA FKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA+A
Sbjct  422   SMGRMEYNWGSDAAMFKPERWLKDGMFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAMA  481

Query  333   ILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             ILCRF++F LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   ILCRFYRFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  519



>gb|KFK41374.1| hypothetical protein AALP_AA2G122000 [Arabis alpina]
Length=517

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/516 (76%), Positives = 452/516 (88%), Gaps = 2/516 (0%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             +++ L  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDW+V YL +S +VV
Sbjct  2     MLMVLACMLISWIFLHRWGQRNKRGPKTWPLVGAAIEQLTNFDRMHDWIVEYLYDSRTVV  61

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN+DG+LWRKQRKT
Sbjct  62    VPMPFTTYTYIADPINVEHVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGDLWRKQRKT  121

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFASKNLRDFSTVVF++YSL LF+IL QAS  +QQVDMQ+LLMRMTLDSICKVGFGV
Sbjct  122   ASFEFASKNLRDFSTVVFKEYSLMLFSILCQASFRDQQVDMQELLMRMTLDSICKVGFGV  181

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTLAP+LPENRFAKAFD ANIIVTLRFIDPLWK KKFLN+GSEA+L +SI+ +DDFTY
Sbjct  182   EIGTLAPDLPENRFAKAFDMANIIVTLRFIDPLWKFKKFLNMGSEALLGKSIKVVDDFTY  241

Query  1041  SVIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDT  868
             SVIRKRKAEI E QK+     MKHDILSRFIE+  DPE+   +KSLRDIVLNFVIAGRDT
Sbjct  242   SVIRKRKAEIFEAQKSPTNNKMKHDILSRFIEISDDPESKATEKSLRDIVLNFVIAGRDT  301

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTL+WAIYMIM +E VAEKL  EL+ +E  RA+E N  LH Y ++D +S N+R  QFA
Sbjct  302   TATTLTWAIYMIMVNEYVAEKLCLELQELERERAQETNTSLHHYDTEDFKSFNERVTQFA  361

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
             GLLNY+++ KL+YLH+VVTETLRLYPAVPQDPKG+LEDD+LP+GT+VKAG MVTYVPYSM
Sbjct  362   GLLNYESLGKLHYLHAVVTETLRLYPAVPQDPKGVLEDDILPNGTKVKAGDMVTYVPYSM  421

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRMEYNWG DA+SFKPERWLKDG+FQNASPFKFT FQAGPRICLGKDSAYLQMKMA+AIL
Sbjct  422   GRMEYNWGSDASSFKPERWLKDGIFQNASPFKFTVFQAGPRICLGKDSAYLQMKMAMAIL  481

Query  327   CRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             CRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   CRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  517



>ref|NP_177109.3| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9C788.1|C70B1_ARATH RecName: Full=Cytochrome P450 704B1 [Arabidopsis thaliana]
 gb|AAG60111.1|AC073178_22 cytochrome P450, putative [Arabidopsis thaliana]
 gb|AEE34933.1| cytochrome P450, family 704, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=524

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/523 (75%), Positives = 454/523 (87%), Gaps = 8/523 (2%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             +L L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2     SLCLVIACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLFTIL+QAS   QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQELLMRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP LPEN FAKAFD ANIIVTLRFIDPLWK+KKFLN+GSEA+L +SI+ ++DFT
Sbjct  182   VEIGTLAPELPENHFAKAFDTANIIVTLRFIDPLWKMKKFLNIGSEALLGKSIKVVNDFT  241

Query  1044  YSVIRKRKAEIEETQ--------KNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNF  889
             YSVIR+RKAE+ E Q         N   +KHDILSRFIE+  DP++   +KSLRDIVLNF
Sbjct  242   YSVIRRRKAELLEAQISPTNNNNNNNNKVKHDILSRFIEISDDPDSKETEKSLRDIVLNF  301

Query  888   VIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLN  709
             VIAGRDTTATTL+WAIYMIM +E+VAEKL+SEL+ +E+  A+  N  LHQY ++D  S N
Sbjct  302   VIAGRDTTATTLTWAIYMIMMNENVAEKLYSELQELEKESAEATNTSLHQYDTEDFNSFN  361

Query  708   QRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMV  529
             ++  +FAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMV
Sbjct  362   EKVTEFAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMV  421

Query  528   TYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
             TYVPYSMGRMEYNWG DAA FKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM
Sbjct  422   TYVPYSMGRMEYNWGSDAALFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  481

Query  348   KMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             KMA+AILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   KMAMAILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  524



>ref|XP_010044484.1| PREDICTED: cytochrome P450 704B1 [Eucalyptus grandis]
Length=533

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/508 (77%), Positives = 450/508 (89%), Gaps = 2/508 (0%)
 Frame = -1

Query  1740  IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  1561
             ++  W+ IHR +QR   GP++WP++GA++EQ  NY RMHDWLV YL+   +VVVPMPFTT
Sbjct  25    VIVSWIIIHRWNQRNKNGPKTWPLVGAAIEQFMNYERMHDWLVEYLSKMRTVVVPMPFTT  84

Query  1560  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  1381
             YTYIA P+NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE WRKQRKTAS EFAS
Sbjct  85    YTYIADPENVEHVLKTNFANYPKGEVYHSYMEVLLGDGIFNVDGESWRKQRKTASFEFAS  144

Query  1380  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP  1201
             KNLRDFSTVVFR+YSLKL +IL+QAS  N++VDMQ+LLMRMTLDSICKVGFGVEIGTLAP
Sbjct  145   KNLRDFSTVVFREYSLKLSSILSQASFGNKEVDMQELLMRMTLDSICKVGFGVEIGTLAP  204

Query  1200  NLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRK  1021
             +LP+N FA++FDAANIIVT RFIDPLW+IKKFLNVGSEA+LD++I+ IDDFTY VIRKRK
Sbjct  205   DLPDNCFAQSFDAANIIVTFRFIDPLWRIKKFLNVGSEALLDKAIKVIDDFTYCVIRKRK  264

Query  1020  AEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             AE+E   K+  +  MKHDILSRFIELG D E+N+ DKSLRDIVLNFVIAGRDTTATTLSW
Sbjct  265   AEVEAACKSREDAKMKHDILSRFIELGNDLESNLTDKSLRDIVLNFVIAGRDTTATTLSW  324

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
             +IYMIMTH+++A+K++SELE++E  +A+EE V L  Y+ DD +S NQR  QFA LL YD 
Sbjct  325   SIYMIMTHQNIAKKIYSELETLERDQAREEQVSLLPYNVDDLKSFNQRVSQFAKLLTYDA  384

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + KL+YLH+V+TETLRLYPAVPQDPKG+L+DD+LPDGT+VKAGGMVTYVPYSMGRMEYNW
Sbjct  385   LGKLHYLHAVITETLRLYPAVPQDPKGVLKDDILPDGTKVKAGGMVTYVPYSMGRMEYNW  444

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             GPDAA FKPERWLK+G FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF++FK
Sbjct  445   GPDAALFKPERWLKEGFFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFYEFK  504

Query  306   LVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             LV  H VEYRMMT+LSM HGL+LT++ R
Sbjct  505   LVPDHPVEYRMMTILSMKHGLRLTIARR  532



>gb|EYU28779.1| hypothetical protein MIMGU_mgv1a004727mg [Erythranthe guttata]
Length=512

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/517 (76%), Positives = 457/517 (88%), Gaps = 5/517 (1%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             M+T+ + + +++  W+ IHR++QR+G GP++WP +GA++EQ+ NY RMHDW++ YL+ S 
Sbjct  1     MQTIAVFVCMLL-SWILIHRMNQRRGKGPKTWPFLGAALEQLINYDRMHDWILNYLSQSR  59

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +VVVPMPFTTYTYIA P +VEHVLKTNF NYPKG+VYHSYMEVLLGDGIFN DGELWRKQ
Sbjct  60    TVVVPMPFTTYTYIADPADVEHVLKTNFSNYPKGDVYHSYMEVLLGDGIFNVDGELWRKQ  119

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RKTAS EFASKNLRDFSTVVFR+YSLKL +IL+QASL N Q+DMQ+LLMRMTLDSICKVG
Sbjct  120   RKTASFEFASKNLRDFSTVVFREYSLKLSSILSQASLNNHQLDMQELLMRMTLDSICKVG  179

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FGVEIGTLAPNLP N FA AFD AN+ VTLRFIDP WK+KKF NVGSEA+LD +I+TIDD
Sbjct  180   FGVEIGTLAPNLPHNEFANAFDTANMTVTLRFIDPFWKLKKFFNVGSEAVLDHNIKTIDD  239

Query  1050  FTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             FTYSVIR RK+EI+E   +EK MKHDILSRFIEL KDPEN + DKSLRD+VLNFVIAGRD
Sbjct  240   FTYSVIRTRKSEIQEVDADEK-MKHDILSRFIELSKDPENKMTDKSLRDVVLNFVIAGRD  298

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTATTLSWAIYM+MTH DVA+KL+SEL   EE R KEE       S++D ES ++R  +F
Sbjct  299   TTATTLSWAIYMVMTHADVADKLYSELRKFEEEREKEEGF---SSSNNDQESFDERVSRF  355

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
             AGLL+YD++ KLYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS
Sbjct  356   AGLLSYDSLGKLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  415

Query  510   MGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             MGRM+YNWG DAASFKPERW+KDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI
Sbjct  416   MGRMKYNWGEDAASFKPERWIKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  475

Query  330   LCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             LCRF++F LV+GH V+YRMMT+LSM +GLKLT++ RT
Sbjct  476   LCRFYEFNLVKGHKVKYRMMTILSMENGLKLTITKRT  512



>gb|AJD25236.1| cytochrome P450 CYP704B37 [Salvia miltiorrhiza]
Length=506

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/519 (76%), Positives = 454/519 (87%), Gaps = 15/519 (3%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             M+ LV+++  ++F W+FIHR+ QR   GP++WP +GA+VEQ+ NY  MHDW++ YL  S 
Sbjct  1     MQILVISV-CMLFAWLFIHRVKQRGCKGPKTWPFLGAAVEQLMNYNVMHDWILNYLTASR  59

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +VVVPMPF+TYTYIAHP +VEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGELWRKQ
Sbjct  60    TVVVPMPFSTYTYIAHPADVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGELWRKQ  119

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RKTAS EFASKNLRDFSTVVFR+Y LKL +IL+ AS  NQ VDMQ+LLMRMTLDSICKVG
Sbjct  120   RKTASFEFASKNLRDFSTVVFREYGLKLASILSHASCNNQVVDMQELLMRMTLDSICKVG  179

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FGVEIGTLA +LP+N+FAKAFD+ANI VTLRFIDPLWKIKKFLN+GSEA+LDQ ++ IDD
Sbjct  180   FGVEIGTLAADLPDNQFAKAFDSANITVTLRFIDPLWKIKKFLNMGSEAVLDQDMKIIDD  239

Query  1050  FTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             FTYSVIR+RKAE+EE++  ++ MKHDILSRFIEL KDP+N + DKSLRD+VLNFVIAGRD
Sbjct  240   FTYSVIRRRKAELEESR--DEKMKHDILSRFIELSKDPDNKMTDKSLRDVVLNFVIAGRD  297

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEE--MRAKEENVLLHQYSSDDPESLNQRAM  697
             TTATTL+WAIYM+M+HE VAEKL+SEL   EE  +R KEE          D ES + R +
Sbjct  298   TTATTLTWAIYMVMSHEQVAEKLYSELRRFEEECVRMKEE----------DEESFDNRLV  347

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
              F+GLL+YD++ KLYYLH+V+TETLRLYPAVPQDPKG+LEDDVLP GT+VKAGGMVTYVP
Sbjct  348   HFSGLLSYDSLGKLYYLHAVITETLRLYPAVPQDPKGVLEDDVLPAGTKVKAGGMVTYVP  407

Query  516   YSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             YSMGRMEYNWG DAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL
Sbjct  408   YSMGRMEYNWGSDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  467

Query  336   AILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             AILCRF++FKL++GH V YRMMT+LSM +GLKLTVS R+
Sbjct  468   AILCRFYEFKLLQGHPVNYRMMTILSMENGLKLTVSRRS  506



>ref|XP_006302101.1| hypothetical protein CARUB_v10020091mg [Capsella rubella]
 gb|EOA34999.1| hypothetical protein CARUB_v10020091mg [Capsella rubella]
Length=549

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/549 (72%), Positives = 458/549 (83%), Gaps = 37/549 (7%)
 Frame = -1

Query  1755  LALGLIMFC----WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYS  1588
             ++L LI+ C    W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDW+V YL  S +
Sbjct  1     MSLCLIVACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWIVEYLYESRT  60

Query  1587  VVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQR  1408
             VVVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQR
Sbjct  61    VVVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQR  120

Query  1407  KTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGF  1228
             KTAS EFASKNLRDFSTVVF+DYSLKLF+IL+QAS  +QQVDMQ+LLMRMTLDSICKVGF
Sbjct  121   KTASFEFASKNLRDFSTVVFKDYSLKLFSILSQASFRDQQVDMQELLMRMTLDSICKVGF  180

Query  1227  GVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDF  1048
             GVEIGTLAP LPENRFAKAFD ANIIVTLRFIDPLWK+KKFLN+GSEA+LD+SI+ ++DF
Sbjct  181   GVEIGTLAPELPENRFAKAFDTANIIVTLRFIDPLWKLKKFLNIGSEALLDKSIKVVNDF  240

Query  1047  TYSVIRKRKAEIEETQK---NEK------------------------------SMKHDIL  967
             TYSVIR+RKAE  E QK   N K                               +KHDIL
Sbjct  241   TYSVIRRRKAEFLEAQKHPANNKVRTKIITTQNMYMNLSQSSNIFFSKSYACDQIKHDIL  300

Query  966   SRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELE  787
             SRFIE+  DP++   +KSLRDIVLNFVIAGRDTTATTL+WAIYMIM +E VAEK++SEL+
Sbjct  301   SRFIEISDDPDSKETEKSLRDIVLNFVIAGRDTTATTLTWAIYMIMMNEHVAEKIYSELQ  360

Query  786   SVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPA  607
              +E+ RA+E N  LH   ++D +S N+R  QFAGLLNYD++ KL+YLH+V+TETLRLYPA
Sbjct  361   ELEKERAEETNTPLHHNETEDFDSFNERVTQFAGLLNYDSLGKLHYLHAVLTETLRLYPA  420

Query  606   VPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQN  427
             VPQDPKG+LEDD+LP+GT+VKAGGMVTYVPYSMGRMEYNWG DA+SFKPERWLKDG FQN
Sbjct  421   VPQDPKGVLEDDILPNGTKVKAGGMVTYVPYSMGRMEYNWGSDASSFKPERWLKDGTFQN  480

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHG  247
             ASPFKFTAFQAGPRICLGKDSAYLQMKMA+AILCRF+KF LV  H V+YRMMT+LSMAHG
Sbjct  481   ASPFKFTAFQAGPRICLGKDSAYLQMKMAMAILCRFYKFHLVPNHPVKYRMMTILSMAHG  540

Query  246   LKLTVSPRT  220
             LK+T++ R+
Sbjct  541   LKVTITRRS  549



>ref|XP_008441698.1| PREDICTED: cytochrome P450 704B1 [Cucumis melo]
Length=556

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/534 (73%), Positives = 460/534 (86%), Gaps = 7/534 (1%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLALGLIMFCWVFI-HRLSQRKG--GGPRSWPVIGASVEQMTNYGR  1630
             ++S+ L+ S +  LVL +  I+ CW+ I HR ++RK    GP++WP++GA++EQ  NY R
Sbjct  23    MRSSNLRRSVVVVLVLGVITIVTCWIIIVHRWNERKKMRRGPKTWPIVGAAIEQFVNYHR  82

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             MHDW++GYL    +VVVPMPFTTYTYIA P NV+H+LKTNF NYPKG+VYHSYMEVLLGD
Sbjct  83    MHDWILGYLNLYKTVVVPMPFTTYTYIADPANVQHILKTNFANYPKGDVYHSYMEVLLGD  142

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIFN DGELWRKQRKTAS EFASKNLRDFST+VFRDYSLKL TILT+ASLLNQQ+DMQ+L
Sbjct  143   GIFNVDGELWRKQRKTASFEFASKNLRDFSTLVFRDYSLKLSTILTRASLLNQQLDMQEL  202

Query  1269  LMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGS  1090
             L RMTLDSICKVGFGVEIG+LAPNLPEN+FAKAFD AN+IVTLRFIDPLWKIK+FLN+GS
Sbjct  203   LTRMTLDSICKVGFGVEIGSLAPNLPENKFAKAFDTANMIVTLRFIDPLWKIKRFLNLGS  262

Query  1089  EAILDQSIRTIDDFTYSVIRKRKAEIEETQKN----EKSMKHDILSRFIELGKDPENNIN  922
             EA+LD+SI+ IDDFTYSVI  RK EI+E Q         +KHDILSRFIELG+DP N   
Sbjct  263   EALLDKSIKIIDDFTYSVIATRKKEIQEAQTTPTEPNNKIKHDILSRFIELGEDPNNKFT  322

Query  921   DKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLH  742
             DKSLRD+VLNFVIAGRDTTA TLSW+IYM+MTH DV++KL+SEL+S EE RAKE ++ L 
Sbjct  323   DKSLRDVVLNFVIAGRDTTAATLSWSIYMLMTHSDVSQKLYSELKSFEEERAKEHSISLL  382

Query  741   QYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLP  562
             QY  +D +S  +R +QF+ LLNYD++A+L+YLH+++TETLRLYPAVPQDPKGILEDD+LP
Sbjct  383   QYQPNDIQSFERRVIQFSQLLNYDSLARLHYLHAIITETLRLYPAVPQDPKGILEDDILP  442

Query  561   DGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRI  382
             DGT+V+AGGMVTYVPYSMGRMEYNWGPDA SF PERWLK G+F N SPFKFTAFQAGPRI
Sbjct  443   DGTKVRAGGMVTYVPYSMGRMEYNWGPDATSFNPERWLKQGIFHNESPFKFTAFQAGPRI  502

Query  381   CLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             C+GKDSAYLQMKM LAILCRF+KF LV GH V YRMMT+LSMA+GLK+TV+ R+
Sbjct  503   CMGKDSAYLQMKMTLAILCRFYKFSLVSGHRVNYRMMTILSMANGLKVTVASRS  556



>ref|XP_010258425.1| PREDICTED: cytochrome P450 704B1 [Nelumbo nucifera]
Length=534

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/530 (74%), Positives = 448/530 (85%), Gaps = 5/530 (1%)
 Frame = -1

Query  1803  SVKSNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMH  1624
             S+ S+P   S    + + +   +  WVF+HR +QR   GP++WP++GA++EQ+ NY RMH
Sbjct  8     SISSSPTGYSKGMVVFICM---LISWVFVHRWNQRNMKGPKTWPLVGAAIEQLMNYNRMH  64

Query  1623  DWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGI  1444
             DWLV YL+   +V VPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGI
Sbjct  65    DWLVEYLSELKTVTVPMPFTTYTYIADPVNVEHVLKTNFANYPKGEVYHSYMEVLLGDGI  124

Query  1443  FNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  1264
             FN+DGELWRKQRKTAS EFASKNLRDFST+VFR+Y+LKL  IL+Q S  NQQVDMQ+LLM
Sbjct  125   FNSDGELWRKQRKTASFEFASKNLRDFSTIVFREYALKLSYILSQTSAQNQQVDMQELLM  184

Query  1263  RMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
             RMTLDSICKVGFGVEIG+LAP LPEN FA+AFD ANIIVTLRFIDPLW+IKKFLNVGSEA
Sbjct  185   RMTLDSICKVGFGVEIGSLAPELPENCFARAFDTANIIVTLRFIDPLWRIKKFLNVGSEA  244

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEK--SMKHDILSRFIELGKDPENNINDKSL  910
              LD+SI+TID FTYSVIRKRK EI+E + + K   +KHDILSRFIEL +DP+NN+ DKSL
Sbjct  245   QLDESIKTIDGFTYSVIRKRKXEIQEARVHSKDVKIKHDILSRFIELSEDPDNNLTDKSL  304

Query  909   RDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSS  730
             RD+VLNFVIAGRDTTATTL W IYMIMTH  VA KL+SEL+++EE R KEE + L  Y  
Sbjct  305   RDVVLNFVIAGRDTTATTLCWFIYMIMTHPHVAAKLYSELKAIEEDRXKEEKLCLLPYDP  364

Query  729   DDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTR  550
             +D  S N+R  QFA  L YD++ KL YLH+ +TETLRLYPAVPQDPKGIL+DDVLPDGT+
Sbjct  365   EDHTSFNERVTQFARFLTYDSLGKLSYLHAAITETLRLYPAVPQDPKGILKDDVLPDGTK  424

Query  549   VKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGK  370
             +KAGGMVTYVPYSMGRMEYNWGPDAASFKPERW KDG F N+SPFKFTAFQAGPRICLGK
Sbjct  425   LKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWFKDGFFHNSSPFKFTAFQAGPRICLGK  484

Query  369   DSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             DSAYLQMKM LAILCRFF+F+LV  H V+YRMMT+LSM HGLKLTV+ R+
Sbjct  485   DSAYLQMKMTLAILCRFFEFRLVPNHPVKYRMMTILSMEHGLKLTVTRRS  534



>ref|XP_010551418.1| PREDICTED: cytochrome P450 704B1 [Tarenaya hassleriana]
 ref|XP_010551419.1| PREDICTED: cytochrome P450 704B1 [Tarenaya hassleriana]
Length=519

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/519 (75%), Positives = 447/519 (86%), Gaps = 4/519 (1%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             M   V+   ++M  W+F+HR SQR   GP++WP++GA++EQ+ N+ RMHDWLV YL  S 
Sbjct  1     MSVFVVVACMVM-SWLFLHRWSQRNKKGPKTWPLVGAAIEQLINFDRMHDWLVEYLKVSR  59

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +VVVPMPFTTYTYIA P NVEHVL+TNF NYPKGE YHSYMEVLLGDGIFN+DGE+W+KQ
Sbjct  60    TVVVPMPFTTYTYIADPINVEHVLRTNFSNYPKGETYHSYMEVLLGDGIFNSDGEIWKKQ  119

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RKTAS EFASKNLRDFSTVVFR+YSLKLF+IL QAS  +QQVDMQ+LLMRMTLDSICKVG
Sbjct  120   RKTASFEFASKNLRDFSTVVFREYSLKLFSILCQASFTDQQVDMQELLMRMTLDSICKVG  179

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FGVEIGTLAP+LPENRFA+AFD ANIIVTLRFIDPLWK+KKFLN+G EA+LD+SI+ IDD
Sbjct  180   FGVEIGTLAPDLPENRFAQAFDMANIIVTLRFIDPLWKLKKFLNIGYEAMLDKSIKVIDD  239

Query  1050  FTYSVIRKRKAEIEETQK---NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIA  880
             FTYSVIR+RKAEI + +    N   MKHDILSRFIE+ +DP +   DKSLRD+VLNFVIA
Sbjct  240   FTYSVIRRRKAEISDARNSLDNNNKMKHDILSRFIEISEDPGSESTDKSLRDVVLNFVIA  299

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTATTL+WAIYMI+ HE V+EKL  ELE +E  RAKE  + L Q   +D  S N+R 
Sbjct  300   GRDTTATTLTWAIYMILMHEHVSEKLCMELEELERERAKEAKISLQQCDIEDSNSFNERV  359

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              +FAGLLNYD++ KL YLH+VVTETLRLYPAVPQDPKG+L+DD+LPDGT+VKAGGMVTYV
Sbjct  360   TKFAGLLNYDSLGKLQYLHAVVTETLRLYPAVPQDPKGVLQDDILPDGTQVKAGGMVTYV  419

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
             PYSMGRM+YNWG DA SF PERWLKDG FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA
Sbjct  420   PYSMGRMDYNWGADAESFNPERWLKDGNFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  479

Query  339   LAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             LAILCRFFKF LV+ H V+YRMMT+LSMAHGLK+TVS R
Sbjct  480   LAILCRFFKFSLVQNHPVKYRMMTILSMAHGLKVTVSRR  518



>ref|XP_003611900.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94858.1| cytochrome P450 family protein [Medicago truncatula]
Length=531

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/524 (74%), Positives = 453/524 (86%), Gaps = 7/524 (1%)
 Frame = -1

Query  1782  KVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL  1603
             + ++M  LV+ + +I F W+F+HR SQR   GP++WP +GA++EQ+ NY RMHDWLV Y 
Sbjct  12    RYNNMGGLVILICMI-FSWIFLHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYF  70

Query  1602  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  1423
             + S +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEV+HSYMEVLLG GIFN DGEL
Sbjct  71    SMSKTVVVPMPFTTYTYIADPVNVEHVLKTNFSNYPKGEVFHSYMEVLLGHGIFNVDGEL  130

Query  1422  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  1243
             W++QRKTASLEFAS+NLRDFST VF++Y+LKL TIL+Q+S LNQQ+DMQ+LLMRMTLDSI
Sbjct  131   WKRQRKTASLEFASRNLRDFSTKVFKEYALKLSTILSQSSFLNQQIDMQELLMRMTLDSI  190

Query  1242  CKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIR  1063
             CKVGFGVEIGTL PN P N FA+AFD ANIIVTLRFIDPLWKIKK LN+GSEA L +SI+
Sbjct  191   CKVGFGVEIGTLNPNSPNNSFAQAFDTANIIVTLRFIDPLWKIKKILNLGSEAQLGKSIK  250

Query  1062  TIDDFTYSVIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNF  889
              IDDFTYSVIR+RKAEIE+ +KN  +  MK+DILSRFIELG   EN+  DKSLRD+VLNF
Sbjct  251   IIDDFTYSVIRRRKAEIEDAKKNGQQNQMKNDILSRFIELG---ENHATDKSLRDVVLNF  307

Query  888   VIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQY-SSDDPESL  712
             V+AGRDTTATTLSWAIYM+MTH  VA+KL+ EL++ EE +AKEENV L QY   DDP+  
Sbjct  308   VVAGRDTTATTLSWAIYMVMTHSHVAQKLYLELKTFEENQAKEENVTLPQYDDKDDPKLF  367

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
             NQR +QF+ LLN D++ KL+YLH+V+TETLRLYPAVPQDPKG++EDDVLPDGT++KAGGM
Sbjct  368   NQRVVQFSKLLNKDSLEKLHYLHAVITETLRLYPAVPQDPKGVIEDDVLPDGTKIKAGGM  427

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             VTYVPYSMGRMEYNWGPDAASFKPERW KDGV +N SPFKFTAFQAGPRICLGKDSAYLQ
Sbjct  428   VTYVPYSMGRMEYNWGPDAASFKPERWFKDGVLKNESPFKFTAFQAGPRICLGKDSAYLQ  487

Query  351   MKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             M+M LAILCRF+KF LV  H V+YRMMT+LSMAHGL++TV  R+
Sbjct  488   MRMVLAILCRFYKFNLVPDHQVKYRMMTILSMAHGLRVTVEKRS  531



>ref|XP_010511987.1| PREDICTED: cytochrome P450 704B1 [Camelina sativa]
Length=522

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/521 (75%), Positives = 454/521 (87%), Gaps = 6/521 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             ++ L +  ++  W+F+H   QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2     SMCLVVACMVTSWIFLHIWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP LPENRFAKAFD ANIIVTLRFIDPLWK+KKFLN+GSEA+L +SI+ ++DFT
Sbjct  182   VEIGTLAPELPENRFAKAFDTANIIVTLRFIDPLWKLKKFLNIGSEALLGKSIKVVNDFT  241

Query  1044  YSVIRKRKAEIEETQK-----NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIA  880
             YSVIR+RKAE+ E QK     N   +KHDILSRFIE+  DP++   +KSLRDIVLNFVIA
Sbjct  242   YSVIRRRKAELLEAQKSPANNNNNKIKHDILSRFIEISDDPDSKETEKSLRDIVLNFVIA  301

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKE-ENVLLHQYSSDDPESLNQR  703
             GRDTTATTL+WAIYM+M +EDVAEKL+SEL+ +E  R +E  N     Y ++D +S N+R
Sbjct  302   GRDTTATTLTWAIYMLMMNEDVAEKLYSELQELEREREEETTNTPSRGYETEDFDSFNER  361

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               QFAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTY
Sbjct  362   VTQFAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTY  421

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             VPYSMGRMEYNWG DAASFKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKM
Sbjct  422   VPYSMGRMEYNWGSDAASFKPERWLKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  481

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             A+AILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  482   AMAILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  522



>ref|XP_003609660.1| Cytochrome P450 [Medicago truncatula]
 gb|AES91857.1| cytochrome P450 family protein [Medicago truncatula]
Length=516

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/520 (75%), Positives = 450/520 (87%), Gaps = 7/520 (1%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             M  LV+ + +I+  W+F+HR SQR   GP++WP +GA++EQ+ NY RMHDWLV Y + S 
Sbjct  1     MGGLVILICMIV-SWIFLHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYFSMSK  59

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLG GIFN DGELW++Q
Sbjct  60    TVVVPMPFTTYTYIADPVNVEHVLKTNFNNYPKGEVYHSYMEVLLGHGIFNVDGELWKRQ  119

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RKTASLEFAS+NLRDFST VF++Y+LKL TIL+Q+S LNQQ+DMQ+LLMRMTLDSICKVG
Sbjct  120   RKTASLEFASRNLRDFSTKVFKEYALKLSTILSQSSFLNQQIDMQELLMRMTLDSICKVG  179

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FGVEIGTL PN P N FA+AFD ANIIVTLRFIDPLWK+KK LN+GSEA LD+SI+ +DD
Sbjct  180   FGVEIGTLNPNSPNNSFAQAFDTANIIVTLRFIDPLWKMKKILNLGSEAQLDKSIKIVDD  239

Query  1050  FTYSVIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAG  877
             FTYSVIR+RKAEIE+ +KN  +  +K+DILSRFIELG   EN+ +DKSLRD+VLNFVIAG
Sbjct  240   FTYSVIRRRKAEIEDAKKNGQQNQIKNDILSRFIELG---ENHASDKSLRDVVLNFVIAG  296

Query  876   RDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQY-SSDDPESLNQRA  700
             RDTTATTLSWAIYM+MTH  VAEKL+SEL++ EE +AKEENV L Q    DD E  NQR 
Sbjct  297   RDTTATTLSWAIYMVMTHSHVAEKLYSELKTFEENQAKEENVTLPQCDDKDDLELFNQRV  356

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
             +QF+ LLN D++ KL+YLH+V+TETLRLYPAVPQDPKG++EDDVLPDGT++KAGGMVTYV
Sbjct  357   VQFSKLLNKDSLEKLHYLHAVITETLRLYPAVPQDPKGVIEDDVLPDGTKIKAGGMVTYV  416

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
             PYSMGRMEYNWGPDAASFKPERW KDGV +N SPFKFTAFQAGPRICLGKDSAYLQM+M 
Sbjct  417   PYSMGRMEYNWGPDAASFKPERWFKDGVLKNESPFKFTAFQAGPRICLGKDSAYLQMRMV  476

Query  339   LAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             LAI+CRF+KF LV  H V YRMMT+LSMAHGLK+TV  R+
Sbjct  477   LAIMCRFYKFSLVPDHQVRYRMMTILSMAHGLKVTVEKRS  516



>ref|XP_010470937.1| PREDICTED: cytochrome P450 704B1-like [Camelina sativa]
Length=521

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/520 (75%), Positives = 452/520 (87%), Gaps = 5/520 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             ++ L +  ++  W+F+H   QR   GP++WP++GA++EQ+TN+ RMHDWLV YL  S +V
Sbjct  2     SMCLVVACMVTSWIFLHIWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYKSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP LPENRFAKAFD ANIIVTLRFIDPLWK+KKFLN+GSEA+L +SI+ ++DFT
Sbjct  182   VEIGTLAPELPENRFAKAFDTANIIVTLRFIDPLWKLKKFLNIGSEALLGKSIKVVNDFT  241

Query  1044  YSVIRKRKAEIEETQK-----NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIA  880
             YSVIR+RKAE+ E QK     N   +KHDILSRFIE+  DP++   +KSLRDIVLNFVIA
Sbjct  242   YSVIRRRKAELLEAQKSPANNNNNKIKHDILSRFIEISDDPDSKETEKSLRDIVLNFVIA  301

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTATTL+WAIYMIM +E VAEKL+SEL+ +E  R +E +     Y ++D ES N+R 
Sbjct  302   GRDTTATTLTWAIYMIMMNEHVAEKLYSELQELEREREEEIHTPSRHYETEDFESFNERV  361

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              QFAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTYV
Sbjct  362   TQFAGLLNYDSLGKLHYLHAVLTETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTYV  421

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
             PYSMGRMEYNWG DAASFKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKMA
Sbjct  422   PYSMGRMEYNWGSDAASFKPERWLKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  481

Query  339   LAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             +AILCRF+KF LV  H V+YRMMT+LSMAHGLK+TV+ R+
Sbjct  482   MAILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVTRRS  521



>ref|XP_007135410.1| hypothetical protein PHAVU_010G126900g [Phaseolus vulgaris]
 gb|ESW07404.1| hypothetical protein PHAVU_010G126900g [Phaseolus vulgaris]
Length=515

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/519 (75%), Positives = 449/519 (87%), Gaps = 6/519 (1%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             M  LV+ + +++  W+FIHR SQR   GP++WP  GA++EQ+ NY RMHDWLV YL+ S 
Sbjct  1     MGGLVVLICMVV-SWMFIHRWSQRDKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSMSK  59

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +VVVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE W+KQ
Sbjct  60    TVVVPMPFTTYTYIADPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGEPWKKQ  119

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RKTASLEFAS+NLR+FST VFR+Y LKL  IL+QAS+LNQ++DMQ+LLMRMTLDSICKVG
Sbjct  120   RKTASLEFASRNLREFSTKVFREYGLKLSAILSQASILNQEIDMQELLMRMTLDSICKVG  179

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FGVEIG+L+ NLP+N FA AFD ANIIVTLRFIDPLWKIKK L++GSEA L++SI+ +DD
Sbjct  180   FGVEIGSLSSNLPKNSFAHAFDTANIIVTLRFIDPLWKIKKMLSIGSEAQLEKSIKVVDD  239

Query  1050  FTYSVIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAG  877
             FTYSVIRKRKAEIE+ +++  E  MKHDILSRFIELG   E+N  DKSLRDI+LNFVIAG
Sbjct  240   FTYSVIRKRKAEIEDVKRSGQENQMKHDILSRFIELG---ESNATDKSLRDIMLNFVIAG  296

Query  876   RDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAM  697
             RDTTATTLSWAIYM+MTH  VA+KL+ EL+  EE RAKEEN+ L +   +D ES NQR  
Sbjct  297   RDTTATTLSWAIYMVMTHSHVADKLYLELKLFEENRAKEENISLPECDKEDSESFNQRVE  356

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
             +F+ LLN D++ +L+YLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVP
Sbjct  357   KFSRLLNKDSLERLHYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVP  416

Query  516   YSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             YSMGRMEYNWGPDAASF PERW KDGV +N SPFKFTAFQAGPRICLGKDSAYLQM+M L
Sbjct  417   YSMGRMEYNWGPDAASFVPERWFKDGVLKNESPFKFTAFQAGPRICLGKDSAYLQMRMVL  476

Query  336   AILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             AILCRF+KF LV GH+V+YRMMT+LSMAHGLK+T+  R+
Sbjct  477   AILCRFYKFNLVPGHTVKYRMMTILSMAHGLKVTIHKRS  515



>ref|XP_004510551.1| PREDICTED: cytochrome P450 704C1-like [Cicer arietinum]
Length=533

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/520 (74%), Positives = 446/520 (86%), Gaps = 6/520 (1%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  1594
             +M  LV+ + +++  W+ IHR SQR   GP++WP +GA++EQ+ NY RMHDWLV Y + S
Sbjct  18    NMGGLVILICMVV-SWILIHRWSQRNKKGPKTWPFLGAAIEQLMNYDRMHDWLVQYFSKS  76

Query  1593  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  1414
              ++VVPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLG GIFN DGELW+K
Sbjct  77    KTIVVPMPFTTYTYIADPVNVEHVLKTNFNNYPKGEVYHSYMEVLLGHGIFNVDGELWKK  136

Query  1413  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  1234
             QRKTASLEFAS+NLRDFST VF++Y+LKL +IL QAS LNQQ+DMQ+LLMRMTLDSICKV
Sbjct  137   QRKTASLEFASRNLRDFSTKVFKEYALKLSSILCQASFLNQQIDMQELLMRMTLDSICKV  196

Query  1233  GFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             GFGVEIGTL PN P N FA+AFD ANIIVTLRFIDPLWKIKK LN+GSEA LD+SI+ ID
Sbjct  197   GFGVEIGTLNPNSPNNSFAQAFDTANIIVTLRFIDPLWKIKKILNLGSEAQLDKSIKIID  256

Query  1053  DFTYSVIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIA  880
             DFTYSVIR+RKAEIE+ +KN  +  +K+DILSRFIELG    NN ++KSLRD+VLNFVIA
Sbjct  257   DFTYSVIRRRKAEIEDAKKNGQQNQIKNDILSRFIELGG---NNASEKSLRDVVLNFVIA  313

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTATTLSWAIYM+MTH  VAEKL+ EL++ EE +AKEENV L Q   D+P    +R 
Sbjct  314   GRDTTATTLSWAIYMVMTHCHVAEKLYFELKTFEENQAKEENVTLSQCDKDEPGLFKERV  373

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              QF+ LLN D++ +L+YLH+V+TETLRLYPAVPQDPKG++EDDVLPDGT++KAGGMVTYV
Sbjct  374   EQFSKLLNKDSLERLHYLHAVITETLRLYPAVPQDPKGVMEDDVLPDGTKIKAGGMVTYV  433

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
             PYSMGRMEYNWGPDAA FKPERW KDGV QN SPFKFTAFQAGPRICLGKDSAYLQM+M 
Sbjct  434   PYSMGRMEYNWGPDAALFKPERWFKDGVLQNESPFKFTAFQAGPRICLGKDSAYLQMRMV  493

Query  339   LAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             LAILCRF+KF LV GH V+YRMMT+LSMAHGLKLT+  R+
Sbjct  494   LAILCRFYKFNLVAGHPVKYRMMTILSMAHGLKLTIEKRS  533



>ref|XP_010415594.1| PREDICTED: cytochrome P450 704B1-like [Camelina sativa]
Length=522

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/521 (74%), Positives = 452/521 (87%), Gaps = 6/521 (1%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             ++ L +  ++  W+F+HR  QR   GP++WP++GA++EQ+TN+ RMHDWLV YL NS +V
Sbjct  2     SMCLVVACMVTSWIFLHRWGQRNKSGPKTWPLVGAAIEQLTNFDRMHDWLVEYLYNSRTV  61

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGDGIFN+DGELWRKQRK
Sbjct  62    VVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGDGIFNSDGELWRKQRK  121

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVF++YSLKLF IL+QAS  +QQVDMQ+LLMRMTLDSICKVGFG
Sbjct  122   TASFEFASKNLRDFSTVVFKEYSLKLFNILSQASFKDQQVDMQELLMRMTLDSICKVGFG  181

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTLAP LPENRFA AFD ANIIVTLRFIDPLWK+KKFLN+GSEA+L +SI+ ++DFT
Sbjct  182   VEIGTLAPELPENRFAMAFDTANIIVTLRFIDPLWKLKKFLNIGSEALLGKSIKVVNDFT  241

Query  1044  YSVIRKRKAEIEETQK-----NEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIA  880
             YSVIR+RKAE+ E QK     N   +KHDILSRFIE+  DP++   +KSLRDIVLNFVIA
Sbjct  242   YSVIRRRKAELLEAQKSPANNNNNKIKHDILSRFIEISDDPDSKETEKSLRDIVLNFVIA  301

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKE-ENVLLHQYSSDDPESLNQR  703
             GRDTTATTL+WAIYMIM +E VAEKL+SEL+ +E  R +E  N     Y ++D +S N+R
Sbjct  302   GRDTTATTLTWAIYMIMMNEHVAEKLYSELQELEREREEETTNTPSRHYETEDFDSFNER  361

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               QFAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LEDD+LP+GT+VKAGGMVTY
Sbjct  362   VTQFAGLLNYDSLGKLHYLHAVLTETLRLYPAVPQDPKGVLEDDMLPNGTKVKAGGMVTY  421

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             VPYSMGRMEYNWG DAASFKPERWLKDG+FQNASPFKFTAFQAGPRICLGKDSAYLQMKM
Sbjct  422   VPYSMGRMEYNWGSDAASFKPERWLKDGIFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  481

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             A+AILCRF+KF LV  H V+YRMMT+LSMA GLK+TV+ R+
Sbjct  482   AMAILCRFYKFHLVPNHPVKYRMMTILSMADGLKVTVTRRS  522



>ref|XP_003528679.1| PREDICTED: cytochrome P450 704C1-like [Glycine max]
Length=515

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/514 (75%), Positives = 439/514 (85%), Gaps = 9/514 (2%)
 Frame = -1

Query  1743  LIMFC----WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +I+ C    W+FIHR SQR   GP++WP  GA++EQ+ NY RMHDWLV YL+ S ++VVP
Sbjct  5     MILICMVVSWMFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKTIVVP  64

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE W+KQRKTAS
Sbjct  65    MPFTTYTYIADPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGESWKKQRKTAS  124

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
             LEFAS+NLRDFST VF++Y+LKL TIL+Q S LNQ++DMQ+LLMRMTLDSICKVGFGVEI
Sbjct  125   LEFASRNLRDFSTKVFKEYALKLSTILSQVSFLNQEIDMQELLMRMTLDSICKVGFGVEI  184

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTLAPNLPEN FA AFD ANIIVTLRFIDPLWKIKK L++GSEA L +SI+ IDDFTYSV
Sbjct  185   GTLAPNLPENSFAHAFDTANIIVTLRFIDPLWKIKKMLSIGSEAQLGKSIKVIDDFTYSV  244

Query  1035  IRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
             IR+RKAEIE+ +K+  +  MK DILSRFIELG   E N  DKSLRD+VLNFVIAGRDTTA
Sbjct  245   IRRRKAEIEDIKKSGQQNQMKQDILSRFIELG---ERNATDKSLRDVVLNFVIAGRDTTA  301

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
             TTLSWAIYM+MTH  VA+KL+ EL+  EE RAKEEN+   Q   +DPES N+R  QF+ L
Sbjct  302   TTLSWAIYMVMTHAHVADKLYLELKKFEENRAKEENISFPQCDKEDPESFNRRVEQFSRL  361

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             LN D++ KL+YLH+V+TETLRLYPAVPQDPKGILEDD LPDGT++KAGGMVTYVPYSMGR
Sbjct  362   LNKDSLEKLHYLHAVITETLRLYPAVPQDPKGILEDDELPDGTKIKAGGMVTYVPYSMGR  421

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             MEYNWGPDAASF PERW +DGV +  SPFKFTAFQAGPRICLGKDSAYLQM+M LAIL R
Sbjct  422   MEYNWGPDAASFVPERWYRDGVLKTESPFKFTAFQAGPRICLGKDSAYLQMRMVLAILFR  481

Query  321   FFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             F+KF LV GH V+YRMMT+LSMA+GLKLT+  R+
Sbjct  482   FYKFNLVPGHMVKYRMMTILSMAYGLKLTIERRS  515



>gb|KHN01450.1| Cytochrome P450 704C1 [Glycine soja]
Length=501

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/504 (76%), Positives = 434/504 (86%), Gaps = 5/504 (1%)
 Frame = -1

Query  1725  VFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIA  1546
             +FIHR SQR   GP++WP  GA++EQ+ NY RMHDWLV YL+ S ++VVPMPFTTYTYIA
Sbjct  1     MFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKTIVVPMPFTTYTYIA  60

Query  1545  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  1366
              P NVEHVLKTNF NYPKGEVYHSYMEVLLGDGIFN DGE W+KQRKTASLEFAS+NLRD
Sbjct  61    DPANVEHVLKTNFNNYPKGEVYHSYMEVLLGDGIFNVDGEPWKKQRKTASLEFASRNLRD  120

Query  1365  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN  1186
             FST VF++Y+LKL TIL+Q S LNQ++DMQ+LLMRMTLDSICKVGFGVEIGTLAPNLPEN
Sbjct  121   FSTKVFKEYALKLSTILSQVSFLNQEIDMQELLMRMTLDSICKVGFGVEIGTLAPNLPEN  180

Query  1185  RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEE  1006
              FA AFD ANIIVTLRFIDPLWKIKK L++GSEA L +SI+ IDDFTYSVIR+RKAEIE+
Sbjct  181   SFAHAFDTANIIVTLRFIDPLWKIKKMLSIGSEAQLGKSIKVIDDFTYSVIRRRKAEIED  240

Query  1005  TQKN--EKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMI  832
              +K+  +  MK DILSRFIELG   E N  DKSLRD+VLNFVIAGRDTTATTLSWAIYM+
Sbjct  241   IKKSGQQNQMKQDILSRFIELG---ERNATDKSLRDVVLNFVIAGRDTTATTLSWAIYMV  297

Query  831   MTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLY  652
             MTH  VA+KL+ EL+  EE RAKEEN+   Q   +DPES N+R  QF+ LLN D++ KL+
Sbjct  298   MTHAHVADKLYLELKKFEENRAKEENISFPQCDKEDPESFNRRVEQFSRLLNKDSLEKLH  357

Query  651   YLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAA  472
             YLH+V+TETLRLYPAVPQDPKGILEDD LPDGT++KAGGMVTYVPYSMGRMEYNWGPDAA
Sbjct  358   YLHAVITETLRLYPAVPQDPKGILEDDELPDGTKIKAGGMVTYVPYSMGRMEYNWGPDAA  417

Query  471   SFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH  292
             SF PERW +DGV +  SPFKFTAFQAGPRICLGKDSAYLQM+M LAIL RF+KF LV GH
Sbjct  418   SFVPERWYRDGVLKTESPFKFTAFQAGPRICLGKDSAYLQMRMVLAILFRFYKFNLVPGH  477

Query  291   SVEYRMMTVLSMAHGLKLTVSPRT  220
              V+YRMMT+LSMA+GLKLT+  R+
Sbjct  478   MVKYRMMTILSMAYGLKLTIERRS  501



>emb|CBI31936.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/471 (80%), Positives = 425/471 (90%), Gaps = 1/471 (0%)
 Frame = -1

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             MHDWLV YL+ S +V VPMPFTTYTYIA P NVEHVLKTNF NYPKGEVYHSYMEVLLGD
Sbjct  1     MHDWLVKYLSKSRTVAVPMPFTTYTYIADPANVEHVLKTNFANYPKGEVYHSYMEVLLGD  60

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIFN DGELWR+QRKTAS EFASKNLRDFST+VFR+YSLKL  IL++AS  N++VDMQDL
Sbjct  61    GIFNVDGELWRRQRKTASFEFASKNLRDFSTIVFREYSLKLSAILSEASFHNREVDMQDL  120

Query  1269  LMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGS  1090
             LMRMTLDSICKVGFGVEIGTLAPNLPEN FA+AFD ANIIVTLRFIDPLWKIKKFLNVGS
Sbjct  121   LMRMTLDSICKVGFGVEIGTLAPNLPENCFARAFDTANIIVTLRFIDPLWKIKKFLNVGS  180

Query  1089  EAILDQSIRTIDDFTYSVIRKRKAEIEETQK-NEKSMKHDILSRFIELGKDPENNINDKS  913
             E++LD+SI+ IDDFTYSVIR RKAEI++ +K ++  +KHDILSRFIELG++PE+N+ DKS
Sbjct  181   ESLLDKSIKVIDDFTYSVIRTRKAEIDQARKSHDDKIKHDILSRFIELGENPESNLTDKS  240

Query  912   LRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYS  733
             LRD+VLNFVIAGRDTTATTLSWA+YM+M H  VA+KL+SEL++ EE RAKE+ + L  Y 
Sbjct  241   LRDVVLNFVIAGRDTTATTLSWAVYMMMAHAHVADKLYSELKTFEEDRAKEDKISLLHYD  300

Query  732   SDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGT  553
              +D +S NQR  QFA LL YD++ +L+YLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT
Sbjct  301   IEDSKSFNQRVTQFARLLTYDSLGRLHYLHAVITETLRLYPAVPQDPKGILEDDVLPDGT  360

Query  552   RVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLG  373
             RVKAGGMVTYVPYSMGRMEYNWGPDA  FKPERWLK+G FQNASPFKFTAFQAGPRICLG
Sbjct  361   RVKAGGMVTYVPYSMGRMEYNWGPDATLFKPERWLKEGFFQNASPFKFTAFQAGPRICLG  420

Query  372   KDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             KDSAYLQMKMA+A+LCRFFKF LV+GH V+YRMMT+LSMA+GLK+TVS R+
Sbjct  421   KDSAYLQMKMAIALLCRFFKFNLVQGHIVKYRMMTILSMANGLKVTVSRRS  471



>gb|EPS61936.1| hypothetical protein M569_12857, partial [Genlisea aurea]
Length=502

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/508 (75%), Positives = 431/508 (85%), Gaps = 9/508 (2%)
 Frame = -1

Query  1740  IMFC-WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             I FC W+ IHRL QR    P++WP+IGA++EQ+ NY RMHDWLV YLA S +VVV MPF 
Sbjct  2     IFFCSWILIHRLKQRNSKHPKTWPLIGAAIEQLLNYHRMHDWLVRYLAESSTVVVRMPFA  61

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             TYTY+AHP+NVEHVLKTNF NYPKG VYHSYMEVLLGDGIFN DGELWRKQRKTAS EFA
Sbjct  62    TYTYVAHPENVEHVLKTNFSNYPKGRVYHSYMEVLLGDGIFNVDGELWRKQRKTASFEFA  121

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLN-QQVDMQDLLMRMTLDSICKVGFGVEIGTL  1207
             SKNLRDFS+VVFR+YSLKL  IL ++S  + +QVDMQ+LLMRMTLDSICKVGFGVEI TL
Sbjct  122   SKNLRDFSSVVFREYSLKLHQILLRSSYEDRKQVDMQELLMRMTLDSICKVGFGVEIRTL  181

Query  1206  APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
               + P+NRFA+ FDAAN  VTLRFIDP W++K+FLN+GSEA+L +SIR IDDFTYSVI+ 
Sbjct  182   DSDSPDNRFAEGFDAANTAVTLRFIDPFWRVKRFLNMGSEAVLSRSIRIIDDFTYSVIKT  241

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             RK+E+EET+   K  KHDILSRFIEL KD ENNI+DKSLRDIVLNFVIAGRDTTATTLSW
Sbjct  242   RKSEMEETKNQGKMNKHDILSRFIELSKDSENNISDKSLRDIVLNFVIAGRDTTATTLSW  301

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
             AIYM +  E VAEKL+ EL   EE  A++  + L        ESL++RA +FA +LNYDT
Sbjct  302   AIYMTIEDESVAEKLYGELRRFEETYARDVGMEL-------SESLDERAQKFAEMLNYDT  354

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + KLYYLH+V+TETLRLYPAVPQDPKG+L DDVLPDGT VKAGGMVTYVP++MGRMEYNW
Sbjct  355   VGKLYYLHAVITETLRLYPAVPQDPKGVLNDDVLPDGTAVKAGGMVTYVPFAMGRMEYNW  414

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             GPDAASFKPERW+KDGVFQN SPFKFTAFQAGPRICLGKDSAYLQMKMA+AIL RF+KFK
Sbjct  415   GPDAASFKPERWIKDGVFQNPSPFKFTAFQAGPRICLGKDSAYLQMKMAMAILIRFYKFK  474

Query  306   LVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             LV G  V+YRMMT LSM +GLK+TVS R
Sbjct  475   LVPGQLVKYRMMTTLSMENGLKVTVSRR  502



>gb|KCW86574.1| hypothetical protein EUGRSUZ_B03209 [Eucalyptus grandis]
Length=472

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/471 (79%), Positives = 423/471 (90%), Gaps = 2/471 (0%)
 Frame = -1

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             MHDWLV YL+   +VVVPMPFTTYTYIA P+NVEHVLKTNF NYPKGEVYHSYMEVLLGD
Sbjct  1     MHDWLVEYLSKMRTVVVPMPFTTYTYIADPENVEHVLKTNFANYPKGEVYHSYMEVLLGD  60

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIFN DGE WRKQRKTAS EFASKNLRDFSTVVFR+YSLKL +IL+QAS  N++VDMQ+L
Sbjct  61    GIFNVDGESWRKQRKTASFEFASKNLRDFSTVVFREYSLKLSSILSQASFGNKEVDMQEL  120

Query  1269  LMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGS  1090
             LMRMTLDSICKVGFGVEIGTLAP+LP+N FA++FDAANIIVT RFIDPLW+IKKFLNVGS
Sbjct  121   LMRMTLDSICKVGFGVEIGTLAPDLPDNCFAQSFDAANIIVTFRFIDPLWRIKKFLNVGS  180

Query  1089  EAILDQSIRTIDDFTYSVIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNINDK  916
             EA+LD++I+ IDDFTY VIRKRKAE+E   K+  +  MKHDILSRFIELG D E+N+ DK
Sbjct  181   EALLDKAIKVIDDFTYCVIRKRKAEVEAACKSREDAKMKHDILSRFIELGNDLESNLTDK  240

Query  915   SLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQY  736
             SLRDIVLNFVIAGRDTTATTLSW+IYMIMTH+++A+K++SELE++E  +A+EE V L  Y
Sbjct  241   SLRDIVLNFVIAGRDTTATTLSWSIYMIMTHQNIAKKIYSELETLERDQAREEQVSLLPY  300

Query  735   SSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDG  556
             + DD +S NQR  QFA LL YD + KL+YLH+V+TETLRLYPAVPQDPKG+L+DD+LPDG
Sbjct  301   NVDDLKSFNQRVSQFAKLLTYDALGKLHYLHAVITETLRLYPAVPQDPKGVLKDDILPDG  360

Query  555   TRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICL  376
             T+VKAGGMVTYVPYSMGRMEYNWGPDAA FKPERWLK+G FQNASPFKFTAFQAGPRICL
Sbjct  361   TKVKAGGMVTYVPYSMGRMEYNWGPDAALFKPERWLKEGFFQNASPFKFTAFQAGPRICL  420

Query  375   GKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             GKDSAYLQMKMALAILCRF++FKLV  H VEYRMMT+LSM HGL+LT++ R
Sbjct  421   GKDSAYLQMKMALAILCRFYEFKLVPDHPVEYRMMTILSMKHGLRLTIARR  471



>ref|XP_008778343.1| PREDICTED: cytochrome P450 704B1 [Phoenix dactylifera]
Length=513

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/513 (72%), Positives = 434/513 (85%), Gaps = 5/513 (1%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             +++  W+ IHR SQR   GP++WP+IGA++EQ+ NY RMHDWL  YL+ S ++ V MPF 
Sbjct  1     MVVLSWILIHRWSQRNHKGPKTWPIIGAAIEQLRNYDRMHDWLAEYLSVSKTITVSMPFR  60

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             ++TYIA P NVEHVLKTNF NYPKGE+Y SYM+VLLGDGIFNADG++WRKQRKTASLEFA
Sbjct  61    SFTYIADPANVEHVLKTNFDNYPKGELYRSYMDVLLGDGIFNADGDMWRKQRKTASLEFA  120

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             SKNLRDFST VFR+Y+LKL  IL Q S+ NQ +DMQDL MRMTLDSICKVGFGVEIGTL+
Sbjct  121   SKNLRDFSTKVFREYALKLSNILCQLSINNQDMDMQDLFMRMTLDSICKVGFGVEIGTLS  180

Query  1203  PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKR  1024
             P+LP+N FA+AFDAANIIVTLRFIDPLW+IK+FL  GSEA+L++SI+ +DDFTY VIRKR
Sbjct  181   PHLPDNSFAQAFDAANIIVTLRFIDPLWRIKRFLRAGSEALLERSIKAVDDFTYDVIRKR  240

Query  1023  KAEIEETQ----KNEKSMKHDILSRFIELGKDPENNIND-KSLRDIVLNFVIAGRDTTAT  859
             KAEIE  +    +  K +KHDILSRFIELG+ P+++ +D KSLRD+VLNFVIAGRDTTAT
Sbjct  241   KAEIERARASGIREHKQIKHDILSRFIELGEVPDSSFSDEKSLRDVVLNFVIAGRDTTAT  300

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             TLSW IYM+MTH  VA+KL+ EL++ EE RAKEE V L  Y  +D +S + R  QFA LL
Sbjct  301   TLSWFIYMLMTHPAVADKLYFELKAYEEERAKEEKVKLISYVPNDVKSFSSRVNQFAELL  360

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
             NYD++ +L YLH+ +TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYSMGRM
Sbjct  361   NYDSLGRLVYLHACITETLRLYPAVPQDPKGILEDDVLPDGTQVKAGGMVTYVPYSMGRM  420

Query  498   EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
             EYNWGPDAASF+PERW K+G+ Q  SPFKFTAFQAGPRICLGKDSAYLQMKM LAILCRF
Sbjct  421   EYNWGPDAASFRPERWFKNGMLQTVSPFKFTAFQAGPRICLGKDSAYLQMKMTLAILCRF  480

Query  318   FKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             F F LV  H V+YRMMT+LSMAHGLK+ VS R 
Sbjct  481   FTFALVPNHPVKYRMMTILSMAHGLKIHVSRRA  513



>ref|XP_004985563.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Setaria italica]
Length=542

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/518 (74%), Positives = 438/518 (85%), Gaps = 9/518 (2%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +A+ L++  W+ +H+ S RK  GPRSWPVIGA+VEQ+ NY RMHDWLV YL+   SV V 
Sbjct  22    IAIFLVLLSWILVHKWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVEYLSKHRSVTVD  81

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKG+VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  82    MPFTSYTYIADPVNVEHVLKTNFTNYPKGDVYRSYMDVLLGDGIFNADGELWRKQRKTAS  141

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFS +VFR+YSLKL  IL QAS   + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  142   FEFASKNLRDFSAIVFREYSLKLSGILRQASKAGKVVDMQELYMRMTLDSICKVGFGVEI  201

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++K+F +VGSEA+L+QSI+ +D+FTYSV
Sbjct  202   GTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKRFFHVGSEALLEQSIKLVDEFTYSV  261

Query  1035  IRKRKAEIEETQ---KNEKSMKHDILSRFIELGKDPENN---INDKSLRDIVLNFVIAGR  874
             IR+RKAEI E +   K EK +KHDILSRFIELG+  E++    +DKSLRD+VLNFVIAGR
Sbjct  262   IRRRKAEIMEARSSGKEEKQIKHDILSRFIELGEAGEDSGGLGDDKSLRDVVLNFVIAGR  321

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYS--SDDPESLNQRA  700
             DTTATTLSW  YM M+H DVAEKL  EL + E  RA+EE V L      +DD ES   R 
Sbjct  322   DTTATTLSWFTYMAMSHPDVAEKLRRELCTFEAERAREEGVELVPCGPDADDDESFAARV  381

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              QFAGLL YD++ KL YLH+ VTETLRLYPAVPQDPKGILEDDVLPDGT+V+AGGMVTYV
Sbjct  382   TQFAGLLTYDSLGKLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYV  441

Query  519   PYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             PYSMGRMEYNWG DAA F+PERW+ +DG F+NASPFKFTAFQAGPRICLGKDSAYLQMKM
Sbjct  442   PYSMGRMEYNWGADAARFRPERWINEDGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKM  501

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             ALAILCRF++F+L+EGH VEYRMMT+LSMAHGLKL VS
Sbjct  502   ALAILCRFYRFQLLEGHPVEYRMMTILSMAHGLKLRVS  539



>dbj|BAC43393.1| unknown protein [Arabidopsis thaliana]
 gb|ABE65757.1| cytochrome P450 family protein [Arabidopsis thaliana]
Length=478

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/478 (78%), Positives = 421/478 (88%), Gaps = 8/478 (2%)
 Frame = -1

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             MHDWLV YL NS +VVVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGD
Sbjct  1     MHDWLVEYLYNSRTVVVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGD  60

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIFN+DGELWRKQRKTAS EFASKNLRDFSTVVF++YSLKLFTIL+QAS   QQVDMQ+L
Sbjct  61    GIFNSDGELWRKQRKTASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQEL  120

Query  1269  LMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGS  1090
             LMRMTLDSICKVGFGVEIGTLAP LPEN FAKAFD ANIIVTLRFIDPLWK+KKFLN+GS
Sbjct  121   LMRMTLDSICKVGFGVEIGTLAPELPENHFAKAFDTANIIVTLRFIDPLWKMKKFLNIGS  180

Query  1089  EAILDQSIRTIDDFTYSVIRKRKAEIEETQ--------KNEKSMKHDILSRFIELGKDPE  934
             EA+L +SI+ ++DFTYSVIR+RKAE+ E Q         N   +KHDILSRFIE+  DP+
Sbjct  181   EALLGKSIKVVNDFTYSVIRRRKAELLEAQISPTNNNNNNNNKVKHDILSRFIEISDDPD  240

Query  933   NNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEEN  754
             +   +KSLRDIVLNFVIAGRDTTATTL+WAIYMIM +E+VAEKL+SEL+ +E+  A+  N
Sbjct  241   SKETEKSLRDIVLNFVIAGRDTTATTLTWAIYMIMMNENVAEKLYSELQELEKESAEATN  300

Query  753   VLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILED  574
               LHQY ++D  S N++  +FAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LED
Sbjct  301   TSLHQYDTEDFNSFNEKVTEFAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDPKGVLED  360

Query  573   DVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQA  394
             D+LP+GT+VKAGGMVTYVPYSMGRMEYNWG DAA FKPERWLKDGVFQNASPFKFTAFQA
Sbjct  361   DMLPNGTKVKAGGMVTYVPYSMGRMEYNWGSDAALFKPERWLKDGVFQNASPFKFTAFQA  420

Query  393   GPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             GPRICLGKDSAYLQMKMA+AILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  421   GPRICLGKDSAYLQMKMAMAILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  478



>gb|ABK28457.1| unknown [Arabidopsis thaliana]
Length=479

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/478 (78%), Positives = 421/478 (88%), Gaps = 8/478 (2%)
 Frame = -1

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             MHDWLV YL NS +VVVPMPFTTYTYIA P NVE+VLKTNF NYPKGE YHSYMEVLLGD
Sbjct  1     MHDWLVEYLYNSRTVVVPMPFTTYTYIADPINVEYVLKTNFSNYPKGETYHSYMEVLLGD  60

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIFN+DGELWRKQRKTAS EFASKNLRDFSTVVF++YSLKLFTIL+QAS   QQVDMQ+L
Sbjct  61    GIFNSDGELWRKQRKTASFEFASKNLRDFSTVVFKEYSLKLFTILSQASFKEQQVDMQEL  120

Query  1269  LMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGS  1090
             LMRMTLDSICKVGFGVEIGTLAP LPEN FAKAFD ANIIVTLRFIDPLWK+KKFLN+GS
Sbjct  121   LMRMTLDSICKVGFGVEIGTLAPELPENHFAKAFDTANIIVTLRFIDPLWKMKKFLNIGS  180

Query  1089  EAILDQSIRTIDDFTYSVIRKRKAEIEETQ--------KNEKSMKHDILSRFIELGKDPE  934
             EA+L +SI+ ++DFTYSVIR+RKAE+ E Q         N   +KHDILSRFIE+  DP+
Sbjct  181   EALLGKSIKVVNDFTYSVIRRRKAELLEAQISPTNNNNNNNNKVKHDILSRFIEISDDPD  240

Query  933   NNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEEN  754
             +   +KSLRDIVLNFVIAGRDTTATTL+WAIYMIM +E+VAEKL+SEL+ +E+  A+  N
Sbjct  241   SKETEKSLRDIVLNFVIAGRDTTATTLTWAIYMIMMNENVAEKLYSELQELEKESAEATN  300

Query  753   VLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILED  574
               LHQY ++D  S N++  +FAGLLNYD++ KL+YLH+V+TETLRLYPAVPQDPKG+LED
Sbjct  301   TSLHQYDTEDFNSFNEKVTEFAGLLNYDSLGKLHYLHAVITETLRLYPAVPQDPKGVLED  360

Query  573   DVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQA  394
             D+LP+GT+VKAGGMVTYVPYSMGRMEYNWG DAA FKPERWLKDGVFQNASPFKFTAFQA
Sbjct  361   DMLPNGTKVKAGGMVTYVPYSMGRMEYNWGSDAALFKPERWLKDGVFQNASPFKFTAFQA  420

Query  393   GPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             GPRICLGKDSAYLQMKMA+AILCRF+KF LV  H V+YRMMT+LSMAHGLK+TVS R+
Sbjct  421   GPRICLGKDSAYLQMKMAMAILCRFYKFHLVPNHPVKYRMMTILSMAHGLKVTVSRRS  478



>ref|XP_004985564.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Setaria italica]
Length=541

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/517 (74%), Positives = 438/517 (85%), Gaps = 8/517 (2%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +A+ L++  W+ +H+ S RK  GPRSWPVIGA+VEQ+ NY RMHDWLV YL+   SV V 
Sbjct  22    IAIFLVLLSWILVHKWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVEYLSKHRSVTVD  81

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKG+VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  82    MPFTSYTYIADPVNVEHVLKTNFTNYPKGDVYRSYMDVLLGDGIFNADGELWRKQRKTAS  141

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFS +VFR+YSLKL  IL QAS   + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  142   FEFASKNLRDFSAIVFREYSLKLSGILRQASKAGKVVDMQELYMRMTLDSICKVGFGVEI  201

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++K+F +VGSEA+L+QSI+ +D+FTYSV
Sbjct  202   GTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKRFFHVGSEALLEQSIKLVDEFTYSV  261

Query  1035  IRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENN---INDKSLRDIVLNFVIAGRD  871
             IR+RKAEI E + +  E+ +KHDILSRFIELG+  E++    +DKSLRD+VLNFVIAGRD
Sbjct  262   IRRRKAEIMEARSSGKEEKIKHDILSRFIELGEAGEDSGGLGDDKSLRDVVLNFVIAGRD  321

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYS--SDDPESLNQRAM  697
             TTATTLSW  YM M+H DVAEKL  EL + E  RA+EE V L      +DD ES   R  
Sbjct  322   TTATTLSWFTYMAMSHPDVAEKLRRELCTFEAERAREEGVELVPCGPDADDDESFAARVT  381

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
             QFAGLL YD++ KL YLH+ VTETLRLYPAVPQDPKGILEDDVLPDGT+V+AGGMVTYVP
Sbjct  382   QFAGLLTYDSLGKLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYVP  441

Query  516   YSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
             YSMGRMEYNWG DAA F+PERW+ +DG F+NASPFKFTAFQAGPRICLGKDSAYLQMKMA
Sbjct  442   YSMGRMEYNWGADAARFRPERWINEDGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMA  501

Query  339   LAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             LAILCRF++F+L+EGH VEYRMMT+LSMAHGLKL VS
Sbjct  502   LAILCRFYRFQLLEGHPVEYRMMTILSMAHGLKLRVS  538



>dbj|BAK08270.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/522 (73%), Positives = 435/522 (83%), Gaps = 15/522 (3%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +A+ L+   W+ +HR S RK  GPRSWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  27    MAIFLVFLSWILVHRWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKYRTVTVD  86

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  87    MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  146

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFST+VFR+YSLKL +IL+ A    + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  147   FEFASKNLRDFSTIVFREYSLKLSSILSPACKAGKVVDMQELYMRMTLDSICKVGFGVEI  206

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P LPEN FA+AFDAANIIVTLRFIDPLW++KKFL+VGSEA+L+QSI+ +D+FTYSV
Sbjct  207   GTLSPELPENSFAQAFDAANIIVTLRFIDPLWRVKKFLHVGSEALLEQSIKLVDEFTYSV  266

Query  1035  IRKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENN-----INDKSLRDIVLNFVIAG  877
             IR+RKAEI + + + K   +KHDILSRFIELG+   ++      +DK LRD+VLNFVIAG
Sbjct  267   IRRRKAEIVQARASGKQEKIKHDILSRFIELGEAGGDDGGSLFGDDKGLRDVVLNFVIAG  326

Query  876   RDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLL-----HQYSSDDPESL  712
             RDTTATTLSW  YM MTH DVAEKL  EL + E  RA+EE V L      +  SD  E+ 
Sbjct  327   RDTTATTLSWFTYMAMTHPDVAEKLRRELAAFESERAREEGVTLVPCGDGEECSD--EAF  384

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
               R  QFAGLL+YD + KL YLH+ VTETLRLYPAVPQDPKGI EDDVLPDGT+V+AGGM
Sbjct  385   AARVAQFAGLLSYDGLGKLVYLHACVTETLRLYPAVPQDPKGIAEDDVLPDGTKVRAGGM  444

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYL  355
             VTYVPYSMGRMEYNWGPDAASF+PERW+  DG F+NASPFKFTAFQAGPRICLGKDSAYL
Sbjct  445   VTYVPYSMGRMEYNWGPDAASFRPERWIGDDGAFRNASPFKFTAFQAGPRICLGKDSAYL  504

Query  354   QMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             QMKMALAILCRFF+F+LVEGH V+YRMMT+LSMAHGLK+ VS
Sbjct  505   QMKMALAILCRFFRFELVEGHPVKYRMMTILSMAHGLKVRVS  546



>ref|XP_002465796.1| hypothetical protein SORBIDRAFT_01g045960 [Sorghum bicolor]
 gb|EER92794.1| hypothetical protein SORBIDRAFT_01g045960 [Sorghum bicolor]
Length=538

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/514 (73%), Positives = 433/514 (84%), Gaps = 5/514 (1%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +A+ L++  W  +HR S RK  GPRSWPVIGA++EQ+ NY RMHDWLVGYL+   +V V 
Sbjct  22    IAILLVVLSWALVHRWSLRKQKGPRSWPVIGATLEQLRNYHRMHDWLVGYLSRHKTVTVD  81

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKG+VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  82    MPFTSYTYIADPVNVEHVLKTNFTNYPKGDVYRSYMDVLLGDGIFNADGELWRKQRKTAS  141

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFS  VFR+YSLKL  IL+QAS   + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  142   FEFASKNLRDFSANVFREYSLKLSGILSQASKAGKVVDMQELYMRMTLDSICKVGFGVEI  201

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++K+F +VGSEA+L QSI+ +D+FTYSV
Sbjct  202   GTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRVKRFFHVGSEALLAQSIKLVDEFTYSV  261

Query  1035  IRKRKAEIEETQKNEKS--MKHDILSRFIELGK--DPENNINDKSLRDIVLNFVIAGRDT  868
             IR+RKAEI E + + K   MKHDILSRFIELG+  D     +DKSLRD+VLNFVIAGRDT
Sbjct  262   IRRRKAEIVEARASGKQEKMKHDILSRFIELGEAGDDGGFGDDKSLRDVVLNFVIAGRDT  321

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTLSW  +M M+H DVAEKL  EL + E  RA+EE V +     DD ++   R  QFA
Sbjct  322   TATTLSWFTHMAMSHPDVAEKLRRELCAFEAERAREEGVAVPCCGPDDDKAFAARVAQFA  381

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
             GLL YD++ KL YLH+ VTETLRLYPAVPQDPKGILEDDVLPDGT+V+AGGMVTYVPYSM
Sbjct  382   GLLTYDSLGKLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYVPYSM  441

Query  507   GRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             GRMEYNWGPDAASF+PERW+ ++G F+NASPFKFTAFQAGPRICLGKDSAYLQMKMALAI
Sbjct  442   GRMEYNWGPDAASFRPERWINEEGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  501

Query  330   LCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             L RF+ F+L+EGH V+YRMMT+LSMAHGLK+ VS
Sbjct  502   LFRFYSFQLLEGHPVQYRMMTILSMAHGLKVRVS  535



>ref|XP_002312255.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE89622.2| cytochrome P450 family protein [Populus trichocarpa]
Length=482

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/460 (79%), Positives = 410/460 (89%), Gaps = 4/460 (1%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             +VL L  ++  W+FIHR +QR+  GP++WP++GA++EQ  NY +MHDWLV YL+   +VV
Sbjct  21    MVLMLACMVLSWIFIHRWNQRQKRGPKTWPIVGAAIEQFMNYNQMHDWLVKYLSELRTVV  80

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VPMPFTTYTYIA P NVEHVLKTNF NYPKGE YHSYMEVLLGDGIFN DGELWRKQRKT
Sbjct  81    VPMPFTTYTYIADPANVEHVLKTNFANYPKGETYHSYMEVLLGDGIFNVDGELWRKQRKT  140

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EFAS+NLRDFSTVVFR+YSLKL +IL+QAS  NQ+V+MQ LLMRMTLDSICKVGFGV
Sbjct  141   ASFEFASRNLRDFSTVVFREYSLKLSSILSQASFHNQEVEMQGLLMRMTLDSICKVGFGV  200

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             EIGTL P+LP+NRFA+AFD ANIIVTLRFIDPLWK+KKFLNVGSEA+LD+SI+ +DDFTY
Sbjct  201   EIGTLTPSLPDNRFAQAFDTANIIVTLRFIDPLWKVKKFLNVGSEALLDKSIKIVDDFTY  260

Query  1041  SVIRKRKAEIEE---TQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             S+IRKRKAEIEE   T KN K MKHDILSRFIELG+DPE+N+ DKSLRD+VLNFVIAGRD
Sbjct  261   SMIRKRKAEIEEARGTGKNNK-MKHDILSRFIELGEDPESNLTDKSLRDVVLNFVIAGRD  319

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTATTLSWAIYM+MTH  VAEKL+SEL+  EE RAKEENV LHQ +++DPES +QR MQ+
Sbjct  320   TTATTLSWAIYMVMTHNHVAEKLYSELKFFEEDRAKEENVKLHQINTEDPESFSQRVMQY  379

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
             AG L YD++ +LYYLH+V+TETLRLYPAVPQDPKGILEDDVLPDGT+VKAGGMVTYVPYS
Sbjct  380   AGFLTYDSLGRLYYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYS  439

Query  510   MGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAG  391
             MGRMEYNWGPDAASFKPERWLKDG FQNASPFKFTAFQ  
Sbjct  440   MGRMEYNWGPDAASFKPERWLKDGFFQNASPFKFTAFQVA  479



>ref|NP_001130648.1| male sterile26 [Zea mays]
 gb|AAK52956.1|AF366297_1 cytochrome P450-like protein [Zea mays]
 gb|ACN29205.1| unknown [Zea mays]
 tpg|DAA43588.1| TPA: male sterile26 [Zea mays]
Length=543

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/517 (73%), Positives = 434/517 (84%), Gaps = 8/517 (2%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +AL L++  W+ + R S RK  GPRSWPVIGA+VEQ+ NY RMHDWLVGYL+   +V V 
Sbjct  24    IALLLVVLSWILVQRWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVGYLSRHRTVTVD  83

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKG VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  84    MPFTSYTYIADPVNVEHVLKTNFTNYPKGIVYRSYMDVLLGDGIFNADGELWRKQRKTAS  143

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFS +VFR+YSLKL  IL+QAS   + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  144   FEFASKNLRDFSAIVFREYSLKLSGILSQASKAGKVVDMQELYMRMTLDSICKVGFGVEI  203

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P+LPEN FA+AFDAANII+TLRFIDPLW+IK+F +VGSEA+L QSI+ +D+FTYSV
Sbjct  204   GTLSPDLPENSFAQAFDAANIIITLRFIDPLWRIKRFFHVGSEALLAQSIKLVDEFTYSV  263

Query  1035  IRKRKAEIEETQKNEKS--MKHDILSRFIELGK---DPENNINDKSLRDIVLNFVIAGRD  871
             IR+RKAEI E + + K   MKHDILSRFIELG+   D     +DKSLRD+VLNFVIAGRD
Sbjct  264   IRRRKAEIVEVRASGKQEKMKHDILSRFIELGEAGDDGGGFGDDKSLRDVVLNFVIAGRD  323

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENV--LLHQYSSDDPESLNQRAM  697
             TTATTLSW  +M M+H DVAEKL  EL + E  RA+EE V  +L   +  D ++   R  
Sbjct  324   TTATTLSWFTHMAMSHPDVAEKLRRELCAFEAERAREEGVTLVLCGGADADDKAFAARVA  383

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
             QFAGLL YD++ KL YLH+ VTETLRLYPAVPQDPKGILEDDVLPDGT+V+AGGMVTYVP
Sbjct  384   QFAGLLTYDSLGKLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYVP  443

Query  516   YSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
             YSMGRMEYNWGPDAASF+PERW+ +DG F+NASPFKFTAFQAGPRICLGKDSAYLQMKMA
Sbjct  444   YSMGRMEYNWGPDAASFRPERWINEDGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMA  503

Query  339   LAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             LAIL RF+ F+L+EGH V+YRMMT+LSMAHGLK+ VS
Sbjct  504   LAILFRFYSFRLLEGHPVQYRMMTILSMAHGLKVRVS  540



>ref|XP_003558727.1| PREDICTED: cytochrome P450 704B1 [Brachypodium distachyon]
Length=557

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/526 (71%), Positives = 431/526 (82%), Gaps = 17/526 (3%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +A+ +I+  W+ +HR S R   GP+SWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  26    VAIFVIVLSWILVHRWSLRNQKGPKSWPVIGATLEQLRNYYRMHDWLVEYLSKYRTVTVD  85

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  86    MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  145

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFST+VFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  146   FEFASKNLRDFSTIVFREYSLKLSSILSQACKTGKVVDMQELFMRMTLDSICKVGFGVEI  205

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++KK L VGSEA+L+QSI+ +D+FTYSV
Sbjct  206   GTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKKLLRVGSEALLEQSIKLVDEFTYSV  265

Query  1035  IRKRKAEIEETQKNEKS--MKHDILSRFIELGKDPENNIN---------DKSLRDIVLNF  889
             IR+RKAEI + + + K   +KHDILSRFIELG+   +N N         DK LRD+VLNF
Sbjct  266   IRRRKAEIVQARASGKQEKIKHDILSRFIELGEAGVDNDNGGGISLFGDDKGLRDVVLNF  325

Query  888   VIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQY--SSDDPE-  718
             VIAGRDTTATTLSW  YM MTH  VAEKL  EL + E  RA+EE + L  +   SD PE 
Sbjct  326   VIAGRDTTATTLSWFTYMAMTHPPVAEKLRRELAAFESDRAREEGISLIPFFSDSDGPEN  385

Query  717   --SLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVK  544
               S   R  QFA LL YD + KL YLH+ VTETLRLYPAVPQDPKG+ EDDVLPDGT+VK
Sbjct  386   QSSFAARVAQFAALLTYDGLGKLTYLHACVTETLRLYPAVPQDPKGVAEDDVLPDGTKVK  445

Query  543   AGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKD  367
             AGGMVTYVPYSMGRMEYNWGPDA  F+PERW+ +DG F+NASPFKFTAFQAGPRICLGKD
Sbjct  446   AGGMVTYVPYSMGRMEYNWGPDAGCFRPERWIGEDGGFRNASPFKFTAFQAGPRICLGKD  505

Query  366   SAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             SAYLQMKMALAIL RF++F+++EGH V+YRMMT+LSMAHGLK+ VS
Sbjct  506   SAYLQMKMALAILFRFYRFEILEGHPVKYRMMTILSMAHGLKVRVS  551



>gb|ACG35470.1| cytochrome P450 CYP704B12v2 [Zea mays]
Length=542

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/516 (73%), Positives = 431/516 (84%), Gaps = 7/516 (1%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +AL L++  W+ + R S RK  GPRSWPVIGA+VEQ+ NY RMHDWLVGYL+   +V V 
Sbjct  24    IALLLVVLSWILVQRWSLRKQKGPRSWPVIGATVEQLRNYHRMHDWLVGYLSRHRTVTVD  83

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKG VY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  84    MPFTSYTYIADPVNVEHVLKTNFTNYPKGIVYRSYMDVLLGDGIFNADGELWRKQRKTAS  143

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFS +VFR+YSLKL  IL+QAS   + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  144   FEFASKNLRDFSAIVFREYSLKLSGILSQASKAGKVVDMQELYMRMTLDSICKVGFGVEI  203

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P+LPEN FA+AFDAANIIVTLRFIDPLW IK+F +VGSEA+L QSI+ +D+FTYSV
Sbjct  204   GTLSPDLPENSFAQAFDAANIIVTLRFIDPLWPIKRFFHVGSEALLAQSIKLVDEFTYSV  263

Query  1035  IRKRKAEIEETQKNEKS--MKHDILSRFIELGK--DPENNINDKSLRDIVLNFVIAGRDT  868
             IR+RKAEI E + + K   MKHDILSRFIELG+  D     +DKSLRD+VLNFVIAGRDT
Sbjct  264   IRRRKAEIVEVRASGKQEKMKHDILSRFIELGEAGDDGGFGDDKSLRDVVLNFVIAGRDT  323

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENV--LLHQYSSDDPESLNQRAMQ  694
             TATTLSW  +M M+H +VAEKL  EL + E  RA+EE V  +L   +  D ++   R  Q
Sbjct  324   TATTLSWFTHMAMSHPEVAEKLRRELCAFEAERAREEGVTLVLCGGADADDKAFAARVAQ  383

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FAGLL YD++ KL YLH+ VTETLRLYPAVPQDPKGILEDDVLPDGT+V+AGGMVTYVPY
Sbjct  384   FAGLLTYDSLGKLVYLHACVTETLRLYPAVPQDPKGILEDDVLPDGTKVRAGGMVTYVPY  443

Query  513   SMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             SMGRMEYNWGPDAASF+PERW+ +DG F+NASPFKFTAFQAGPRICLGKDSAYLQMKMAL
Sbjct  444   SMGRMEYNWGPDAASFRPERWINEDGAFRNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  503

Query  336   AILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             AIL RF+ F+L+EGH V+YRMMT+LSMAHG  + VS
Sbjct  504   AILFRFYSFRLLEGHPVQYRMMTILSMAHGXXVRVS  539



>gb|AAL84318.1|AC073556_35 putative plant cytochrome P-450 protein [Oryza sativa Japonica 
Group]
 gb|ABF94184.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
Length=544

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/519 (71%), Positives = 428/519 (82%), Gaps = 11/519 (2%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  25    LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  84

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
              MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  85    DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  144

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGVE
Sbjct  145   SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQELFMRMTLDSICKVGFGVE  204

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++KKFL+VGSEA+L+QS++ +DDFTYS
Sbjct  205   IGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKKFLHVGSEALLEQSMKLVDDFTYS  264

Query  1038  VIRKRKAEIEETQKNEKS--MKHDILSRFI-----ELGKDPENNINDKSLRDIVLNFVIA  880
             VIR+RKAEI + + + K   +KHDILSRFI        +   +  +DKSLRD+VLNFVIA
Sbjct  265   VIRRRKAEILQARASGKQEKIKHDILSRFIELGEAGGDEGGGSFGDDKSLRDVVLNFVIA  324

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTATTLSW  YM MTH  VA+KL  EL + E+ RA+EE V L   + +   S   R 
Sbjct  325   GRDTTATTLSWFTYMAMTHPAVADKLRRELAAFEDERAREEGVALADAAGE--ASFAARV  382

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              QFA LL+YD + KL YLH+ VTETLRLYPAVPQDPKGI+EDDVLPDGT+V+AGGMVTYV
Sbjct  383   AQFASLLSYDAVGKLVYLHACVTETLRLYPAVPQDPKGIVEDDVLPDGTKVRAGGMVTYV  442

Query  519   PYSMGRMEYNWGPDAASFKPERWLK--DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
             PYSMGRMEYNWGPDAASF+PERWL    G F+NASPFKFTAFQAGPRICLGKDSAYLQMK
Sbjct  443   PYSMGRMEYNWGPDAASFRPERWLSGDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMK  502

Query  345   MALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             MALAIL RF+ F LVE H V+YRMMT+LSMAHGLK+ VS
Sbjct  503   MALAILFRFYTFDLVEDHPVKYRMMTILSMAHGLKVRVS  541



>gb|EAY88702.1| hypothetical protein OsI_10177 [Oryza sativa Indica Group]
Length=540

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/519 (71%), Positives = 427/519 (82%), Gaps = 11/519 (2%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  21    LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  80

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
              MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  81    DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  140

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGVE
Sbjct  141   SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQELFMRMTLDSICKVGFGVE  200

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++KKFL+VGSEA+L+QS++ +DDFTYS
Sbjct  201   IGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKKFLHVGSEALLEQSMKLVDDFTYS  260

Query  1038  VIRKRKAEIEETQKNEKS--MKHDILSRFI-----ELGKDPENNINDKSLRDIVLNFVIA  880
             VIR+RKAEI + + + K   +KHDILSRFI        +   +  +DKSLRD+VLNFVIA
Sbjct  261   VIRRRKAEILQARASGKQEKIKHDILSRFIELGEAGGDEGGGSFGDDKSLRDVVLNFVIA  320

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTATTLSW  YM MTH  VA+KL  EL + E  RA+EE V L   + +   S   R 
Sbjct  321   GRDTTATTLSWFTYMAMTHPAVADKLRRELAAFEAERAREEGVALADAAGE--ASFAARV  378

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              QFA LL+YD + KL YLH+ VTETLRLYPAVPQDPKGI+EDDVLPDGT+V+AGGMVTYV
Sbjct  379   AQFASLLSYDAVGKLVYLHACVTETLRLYPAVPQDPKGIVEDDVLPDGTKVRAGGMVTYV  438

Query  519   PYSMGRMEYNWGPDAASFKPERWLK--DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
             PYSMGRMEYNWGPDAASF+PERWL    G F+NASPFKFTAFQAGPRICLGKDSAYLQMK
Sbjct  439   PYSMGRMEYNWGPDAASFRPERWLSGDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMK  498

Query  345   MALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             MALAIL RF+ F LVE H V+YRMMT+LSMAHGLK+ VS
Sbjct  499   MALAILFRFYTFDLVEDHPVKYRMMTILSMAHGLKVRVS  537



>gb|EMT08626.1| Cytochrome P450 704C1 [Aegilops tauschii]
Length=632

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/517 (72%), Positives = 424/517 (82%), Gaps = 16/517 (3%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             +A+ L+   W+ +H  S RK  GPRSWPVIGA++EQ+ NY RMHDWLV YL+   +V V 
Sbjct  24    MAIFLVFLSWILVHWWSLRKQKGPRSWPVIGATLEQLRNYYRMHDWLVEYLSKHRTVTVD  83

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
             MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGELWRKQRKTAS
Sbjct  84    MPFTSYTYIADPVNVEHVLKTNFNNYPKGEVYRSYMDVLLGDGIFNADGELWRKQRKTAS  143

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EFASKNLRDFST+VFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGVEI
Sbjct  144   FEFASKNLRDFSTIVFREYSLKLSSILSQACKAGKVVDMQELYMRMTLDSICKVGFGVEI  203

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+P LPEN FA+AFDAANIIVTLRFIDPLW++KKFL+VGSEA+L+QSI+ +D+FTYSV
Sbjct  204   GTLSPELPENSFAQAFDAANIIVTLRFIDPLWRVKKFLHVGSEALLEQSIKLVDEFTYSV  263

Query  1035  IRKRKAEIEETQKNEKS--MKHDILSRFIEL-------GKDPENNINDKSLRDIVLNFVI  883
             IR+RKAEI + + + K   +KHDILSRFIEL               +DK LRD+VLNFVI
Sbjct  264   IRRRKAEIVQARASGKQEKIKHDILSRFIELGEAGGGGDDGGSLFGDDKGLRDVVLNFVI  323

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDD--PESLN  709
             AGRDTTATTLSWA    MTH DVAEKL  EL + E  RA+E+ V L      +   E+  
Sbjct  324   AGRDTTATTLSWA----MTHPDVAEKLRRELAAFEAERAREDGVALVPCGDGEGSDEAFA  379

Query  708   QRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMV  529
              R  QFAG L+YD + KL YLH+ VTETLRLYPAVPQDPKGI EDDVLPDGT+V+AGGMV
Sbjct  380   ARVAQFAGFLSYDGLGKLVYLHACVTETLRLYPAVPQDPKGIAEDDVLPDGTKVRAGGMV  439

Query  528   TYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             TYVPYSMGRMEYNWGPDAASF+PERW+  DG F+NASPFKFTAFQAGPRICLGKDSAYLQ
Sbjct  440   TYVPYSMGRMEYNWGPDAASFRPERWIGDDGAFRNASPFKFTAFQAGPRICLGKDSAYLQ  499

Query  351   MKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLK  241
             MKMALAILCRFF+F+LVEGH V+YRMMT+LSMAHGLK
Sbjct  500   MKMALAILCRFFRFELVEGHPVKYRMMTILSMAHGLK  536



>ref|XP_010917078.1| PREDICTED: cytochrome P450 704B1 [Elaeis guineensis]
Length=479

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/478 (73%), Positives = 403/478 (84%), Gaps = 9/478 (2%)
 Frame = -1

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             MHDWL  YL+ S ++ V MPFT++TYIA P NVEHVLKTNF NYPKGE+Y SYM+VLLGD
Sbjct  1     MHDWLAEYLSVSKTITVSMPFTSFTYIADPANVEHVLKTNFNNYPKGELYRSYMDVLLGD  60

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIFNADG++WRKQRKTAS EFASKNLRDFST VFR+Y+LKL  IL Q+S+ NQ +D+QDL
Sbjct  61    GIFNADGDMWRKQRKTASFEFASKNLRDFSTKVFREYALKLSNILCQSSINNQDMDVQDL  120

Query  1269  LMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGS  1090
              MRMTLDSICKVGFGVEIGTL+PNLP+N FA+AFDAANIIVTLRFIDP W+IK+FL  GS
Sbjct  121   FMRMTLDSICKVGFGVEIGTLSPNLPDNSFAQAFDAANIIVTLRFIDPFWRIKRFLRTGS  180

Query  1089  EAILDQSIRTIDDFTYSVIRKRKAEIEETQKN--------EKSMKHDILSRFIELGKDPE  934
             EA+L+QSI+ +D+FTY VIRKRKAEIE  + +           +KHDILSRFIELG++P+
Sbjct  181   EALLEQSIKVVDEFTYDVIRKRKAEIERARASGMREVMVFHFKIKHDILSRFIELGEEPD  240

Query  933   NNIND-KSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEE  757
             +  +D KSLRD+VLNFVIAGRDTTATTLSW IYM+MTH  VA+KL+ EL + EE RAKEE
Sbjct  241   SGFSDEKSLRDVVLNFVIAGRDTTATTLSWFIYMVMTHPAVADKLYFELRAYEEERAKEE  300

Query  756   NVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILE  577
              V +  Y ++D +S   R  QFA LLNYD++ +L YLH+ +TETLRLYPAVPQDPKG+L 
Sbjct  301   KVKVISYVTNDVKSFRSRVDQFAELLNYDSLGRLVYLHACITETLRLYPAVPQDPKGVLV  360

Query  576   DDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQ  397
             DDVLPDGT+VKAGGMVTYVPYSMGRMEYNWGPDAASF+PERW K+G+ Q+ SPFKFTAFQ
Sbjct  361   DDVLPDGTQVKAGGMVTYVPYSMGRMEYNWGPDAASFRPERWFKNGMLQSVSPFKFTAFQ  420

Query  396   AGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             AGPRICLGKDSAYLQMKM LAILCRFF F LV  H V+YRMMT+LSMAHGLK+ VS R
Sbjct  421   AGPRICLGKDSAYLQMKMTLAILCRFFTFTLVPNHPVKYRMMTILSMAHGLKIHVSRR  478



>ref|XP_009413465.1| PREDICTED: cytochrome P450 704B1 [Musa acuminata subsp. malaccensis]
Length=519

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/512 (69%), Positives = 410/512 (80%), Gaps = 10/512 (2%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             L L +  WVFIHR  QR    P++WPVIG+++EQ+ NY RMHDWL GYL+ S +V V +P
Sbjct  15    LALFLLSWVFIHRWKQRHQRCPKTWPVIGSTIEQLKNYDRMHDWLAGYLSESKTVTVSLP  74

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
             F +YTYIA P +VEHVLKTNF NYPKGE Y SYM+VLLGDGIFNADGELWR QRKTASLE
Sbjct  75    FKSYTYIADPASVEHVLKTNFANYPKGEAYRSYMDVLLGDGIFNADGELWRAQRKTASLE  134

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             FASKNLRD ST VFR+++LKL  IL Q  + ++ VDMQDL MRMTLDSI KVGFGVEIGT
Sbjct  135   FASKNLRDLSTRVFREHALKLSRILCQVPV-DRDVDMQDLFMRMTLDSIAKVGFGVEIGT  193

Query  1209  LAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIR  1030
             LA +LPEN FA+AFD ANIIVT RFIDP W+IK+ L V  EA L +SI+ +D+FTY +IR
Sbjct  194   LAADLPENAFAQAFDDANIIVTNRFIDPFWRIKRLLRVQGEARLQRSIKVLDEFTYDIIR  253

Query  1029  KRKAEIE--ETQKNEKSMKHDILSRFIELGK-DPENNINDKSLRDIVLNFVIAGRDTTAT  859
             +RKA+I+    ++N   MKHD+LSRFIELG+ D     +DKSLRD+VLNFVIAGRDTTA 
Sbjct  254   RRKAKIKLARAKRNGDEMKHDLLSRFIELGEGDGSIFSDDKSLRDVVLNFVIAGRDTTAA  313

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             TLSW IYM+MTH  VAEKL  E+ + EE RAKEE V L        E+ + R  QFAG L
Sbjct  314   TLSWFIYMVMTHPGVAEKLHDEVRAFEEERAKEEGVALL------VEAFDDRMTQFAGFL  367

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
             +YD+M +L YLH+ ++ETLRLYPAVPQDPKGIL+DDVLPDGT+VKAG MVTYVPY MGRM
Sbjct  368   SYDSMGRLAYLHACISETLRLYPAVPQDPKGILKDDVLPDGTKVKAGDMVTYVPYVMGRM  427

Query  498   EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
             EYNWGPDAA +KPERW KDG+ Q  SPFKFTAFQAGPRICLGKDSAYLQMKM LA+LCRF
Sbjct  428   EYNWGPDAALYKPERWFKDGILQTVSPFKFTAFQAGPRICLGKDSAYLQMKMTLAVLCRF  487

Query  318   FKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             F F LV  H+V+YRMMT+LSMAHGLK+ +S R
Sbjct  488   FTFTLVPNHTVQYRMMTILSMAHGLKVYISRR  519



>gb|EAZ25728.1| hypothetical protein OsJ_09563 [Oryza sativa Japonica Group]
Length=521

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/519 (68%), Positives = 411/519 (79%), Gaps = 30/519 (6%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  21    LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  80

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
              MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM+VLLGDGIFNADGE+WRKQRKTA
Sbjct  81    DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGEMWRKQRKTA  140

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFSTVVFR+YSLKL +IL+QA    + VDMQ+L MRMTLDSICKVGFGVE
Sbjct  141   SFEFASKNLRDFSTVVFREYSLKLSSILSQACKAGRVVDMQELFMRMTLDSICKVGFGVE  200

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++KKFL+VGSEA+L+QS++ +DDFTYS
Sbjct  201   IGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKKFLHVGSEALLEQSMKLVDDFTYS  260

Query  1038  VIRKRKAEIEETQKNEKS--MKHDILSRFI-----ELGKDPENNINDKSLRDIVLNFVIA  880
             VIR+RKAEI + + + K   +KHDILSRFI        +   +  +DKSLRD+VLNFVIA
Sbjct  261   VIRRRKAEILQARASGKQEKIKHDILSRFIELGEAGGDEGGGSFGDDKSLRDVVLNFVIA  320

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTATTLSW  YM MTH  VA+KL  EL + E+ RA+EE V L   + +   S   R 
Sbjct  321   GRDTTATTLSWFTYMAMTHPAVADKLRRELAAFEDERAREEGVALADAAGE--ASFAARV  378

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
              QFA LL+YD + KL                   DPKGI+EDDVLPDGT+V+AGGMVTYV
Sbjct  379   AQFASLLSYDAVGKL-------------------DPKGIVEDDVLPDGTKVRAGGMVTYV  419

Query  519   PYSMGRMEYNWGPDAASFKPERWLK--DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
             PYSMGRMEYNWGPDAASF+PERWL    G F+NASPFKFTAFQAGPRICLGKDSAYLQMK
Sbjct  420   PYSMGRMEYNWGPDAASFRPERWLSGDGGAFRNASPFKFTAFQAGPRICLGKDSAYLQMK  479

Query  345   MALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             MALAIL RF+ F LVE H V+YRMMT+LSMAHGLK+ VS
Sbjct  480   MALAILFRFYTFDLVEDHPVKYRMMTILSMAHGLKVRVS  518



>gb|ADG34845.1| cytochrome P450 protein [Vanda hybrid cultivar]
Length=538

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/523 (63%), Positives = 408/523 (78%), Gaps = 10/523 (2%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             L+    + +  W+F+HR +QR   GP++WP+IGA++E + NY RMHDW+  YL+   +V 
Sbjct  14    LIAFSAIFLISWIFLHRWAQRNRRGPKTWPLIGAAIELLNNYERMHDWITDYLSEWRTVT  73

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VP+PFT+YTY A P NVEH+LKTNF NYPKGE++ SYMEVLLGDGIFNADGELWRKQRKT
Sbjct  74    VPLPFTSYTYTADPANVEHILKTNFNNYPKGELFRSYMEVLLGDGIFNADGELWRKQRKT  133

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLN--QQVDMQDLLMRMTLDSICKVGF  1228
             AS EFASKNLR+ STVVFR+Y+LKL  IL QAS  +  Q VD+QDL MRMT+DSICK+GF
Sbjct  134   ASFEFASKNLRELSTVVFREYALKLSDILCQASCKDHHQAVDIQDLFMRMTMDSICKLGF  193

Query  1227  GVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDF  1048
             GVEIGTL+P LP+N FA+AFD AN  VT RF DPLW++K+FL VGSEA L+Q+IR ++DF
Sbjct  194   GVEIGTLSPQLPDNSFARAFDTANATVTRRFFDPLWRLKRFLCVGSEAALNQNIRIVNDF  253

Query  1047  TYSVIRKRKAEIEETQKN--EKSMKHDILSRFIELGK-DPENNIN-DKSLRDIVLNFVIA  880
             T +VIR RKAEI   ++N      K DILSRFIEL   D E++ + +K LRD+VLNFVIA
Sbjct  254   TSNVIRTRKAEIMRAKQNGHHDETKQDILSRFIELANTDKESDFSTEKGLRDVVLNFVIA  313

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             GRDTTA TLSW IY+++T   VA+KL+ E++  EE+RA+EEN+ L   + +D +S   R 
Sbjct  314   GRDTTAATLSWFIYILVTQPQVAQKLYIEMKEFEEIRAEEENINLDLCNLEDMDSFRNRL  373

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
               F+ LL+YD++A+L YLH+ +TETLRL+P VPQD KGIL+DDVLPDGT+++AG MV YV
Sbjct  374   SDFSRLLDYDSLARLQYLHACITETLRLFPPVPQDAKGILKDDVLPDGTKLRAGEMVLYV  433

Query  519   PYSMGRMEYNWGPDAASFKPERWL---KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
             PYSMGRMEY WG DA+ F+PERWL    + V  N SPFKFTAFQAGPR+CLGKDSAYLQM
Sbjct  434   PYSMGRMEYIWGIDASEFRPERWLNNDNNSVQNNVSPFKFTAFQAGPRMCLGKDSAYLQM  493

Query  348   KMALAILCRFFKFKLVEGH-SVEYRMMTVLSMAHGLKLTVSPR  223
             KM  A+LCRFF+F+L   H  V+YRMM VLSMAHGL + V  R
Sbjct  494   KMTAALLCRFFQFRLAPHHPPVKYRMMIVLSMAHGLHVLVCRR  536



>ref|XP_001764611.1| predicted protein [Physcomitrella patens]
 gb|EDQ70593.1| predicted protein [Physcomitrella patens]
Length=516

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/525 (57%), Positives = 379/525 (72%), Gaps = 15/525 (3%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             S P    S  T V+   L    W++I R  QR    P+ WPVIGA+VE + N+  +HDW+
Sbjct  6     SVPFSTESAVTFVIIATL---SWLWIFRWQQRHRLAPKEWPVIGAAVETIRNFDDLHDWV  62

Query  1614  VGYLANSYSVV-VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFN  1438
             + Y         V  P T YTY   P N+E++LKTNF N+PKG++YH  ME LLGDGIFN
Sbjct  63    LSYFQKGIKTFRVKFPGTMYTYTVDPKNIEYILKTNFANFPKGDLYHKNMETLLGDGIFN  122

Query  1437  ADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  1258
             ADGE+WR+QRKTAS EFAS+ LRD+STV+FR+ +LK+  I+  AS  +  VDMQDL MR+
Sbjct  123   ADGEVWRQQRKTASFEFASRVLRDYSTVIFRENALKVGDIVVGASQTHNAVDMQDLFMRL  182

Query  1257  TLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             TL+ ICKVGFGVEIGTL+P+LP   FA  FD AN  VT RF DP W++K+  N+G+EA+L
Sbjct  183   TLEGICKVGFGVEIGTLSPSLPAIPFASNFDNANEAVTYRFFDPFWRLKQLFNIGNEAVL  242

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIV  898
              +S++ +DDFTY+VIR R+ E++ T+   K  K D+LSRFI LG+DPE N  DK+LRDI+
Sbjct  243   SRSVKVVDDFTYNVIRTRRVELQSTEGENKVRKADLLSRFILLGEDPEQNFTDKTLRDII  302

Query  897   LNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPE  718
             LNF+IAGRDTTA TLSW  Y++  H  VA+K++ EL ++++    + NV       +  +
Sbjct  303   LNFIIAGRDTTAATLSWFFYLLGNHPRVADKIYDELHALDD----DANV-------NKSQ  351

Query  717   SLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAG  538
             SLNQ   ++A  L YD + KL YLH+ +TET+RLYPAVPQDPKGIL DDVLPDGT +K G
Sbjct  352   SLNQEMSEYATQLTYDVLLKLQYLHAAITETIRLYPAVPQDPKGILADDVLPDGTVLKKG  411

Query  537   GMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAY  358
             G++TYVPYS GRM+  WG DA  F+PERW+KDGVF   SPFKF+AFQAGPRICLGKDSAY
Sbjct  412   GLITYVPYSQGRMKDIWGEDAEDFRPERWIKDGVFTPLSPFKFSAFQAGPRICLGKDSAY  471

Query  357   LQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             LQMKMA A+LCRFFKF+L  GH V+YR M  LSM  G+K+ V+ R
Sbjct  472   LQMKMASALLCRFFKFELAPGHPVKYRTMATLSMQRGVKMYVTRR  516



>ref|XP_001764503.1| predicted protein [Physcomitrella patens]
 gb|EDQ70770.1| predicted protein [Physcomitrella patens]
Length=513

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/511 (54%), Positives = 371/511 (73%), Gaps = 15/511 (3%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV-VPM  1573
             +  + + W+F  R  QR    P+ WP+IG ++E + ++  MHDW++ Y         V  
Sbjct  16    IATLSYLWIF--RWRQRHRIEPKEWPIIGGALETIQHFDVMHDWILSYFNKGLKTFHVKY  73

Query  1572  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  1393
             P  TYTY   P+N+E++LKTNF N+PKGE+YH +ME LLGDGIFN+DGE WR+QRKTAS 
Sbjct  74    PGITYTYTIDPNNIEYILKTNFANFPKGELYHRHMETLLGDGIFNSDGEAWRQQRKTASF  133

Query  1392  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQ-DLLMRMTLDSICKVGFGVEI  1216
             EF S+ LRD+STVVFR+ +LK+  IL+     +Q +DMQ DL MR TL+ ICKVGFGVEI
Sbjct  134   EFTSRVLRDYSTVVFRENALKVGDILSSVCQKHQPIDMQQDLFMRFTLEGICKVGFGVEI  193

Query  1215  GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             GTL+ +LP   FA  FD AN  VT RF DP W +K+  N+G+EA+L +S++ +DDFTY V
Sbjct  194   GTLSESLPAVPFATNFDNANEAVTYRFFDPFWPLKQMFNIGNEAVLSRSVKVVDDFTYKV  253

Query  1035  IRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
             I+ R+AE++         K D+LSRFI LGKDPE N  DK+LRD++LNF+IAGRDTTA T
Sbjct  254   IKIRRAEMDLATSEGHDKKADLLSRFILLGKDPEQNFTDKTLRDVILNFIIAGRDTTAAT  313

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSW +Y++  +  VA+K++ EL ++E    K+ N+       +  ++LNQ+  +++ +L+
Sbjct  314   LSWFVYLLSIYPHVADKIYDELHALE----KDANI-------NASQTLNQKMREYSSILS  362

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
             YD + K+ YLH+ +TET+RLYPAVPQDPKGIL DDVLPDGT +K GG+V+YVPY+ GR +
Sbjct  363   YDVLTKVQYLHAAITETIRLYPAVPQDPKGILADDVLPDGTVLKKGGLVSYVPYAQGRAK  422

Query  495   YNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFF  316
               WG DA SF+PERW+KDGVF   SPF+F+AFQAGPRICLGKDSAYLQMKM  A+LCRFF
Sbjct  423   VIWGDDAESFRPERWIKDGVFIPLSPFRFSAFQAGPRICLGKDSAYLQMKMVTALLCRFF  482

Query  315   KFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             KF L+ GH V+YR M  L+M +G+K+ V+ R
Sbjct  483   KFDLMPGHQVKYRTMATLAMENGVKMFVTRR  513



>ref|XP_002963764.1| hypothetical protein SELMODRAFT_80659 [Selaginella moellendorffii]
 gb|EFJ35635.1| hypothetical protein SELMODRAFT_80659 [Selaginella moellendorffii]
Length=469

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/476 (61%), Positives = 355/476 (75%), Gaps = 14/476 (3%)
 Frame = -1

Query  1629  MHDWLVG------YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYM  1468
             MHD+L+        L NS +   PMP   Y Y   PD VEH+LK NF NYPKG+ +H  M
Sbjct  1     MHDFLLEKFLRNETLYNSKTFRAPMPTFDYYYTVDPDVVEHILKNNFANYPKGDKFHDIM  60

Query  1467  EVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQ  1288
             EVLLGDGIFN+DGE+W++QRKTAS EFASK LRDFSTVVFRDY++KL  I++  +   Q 
Sbjct  61    EVLLGDGIFNSDGEVWKRQRKTASFEFASKILRDFSTVVFRDYAVKLADIVSGCTSRGQS  120

Query  1287  VDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKK  1108
              DMQDL MRMTLDSICK+GFGVEIGTL+ +LPEN+FA AFD AN  VT RF+DP WK+  
Sbjct  121   FDMQDLFMRMTLDSICKLGFGVEIGTLSASLPENKFAIAFDNANAWVTNRFVDPFWKVGS  180

Query  1107  FLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENN  928
              L +G EA L ++ + +DDFTY+VI+ R+AE++    +EK  K DILSRF+ L  DP+N 
Sbjct  181   LLKLGREAQLAKNAKIVDDFTYNVIKTRRAELQGKCADEK--KADILSRFMLLSDDPKNQ  238

Query  927   INDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVL  748
             INDK+LRDIVLNFVIAGRDTTA TLSW +YM+ TH D  +K+++EL  +E     EE   
Sbjct  239   INDKTLRDIVLNFVIAGRDTTAVTLSWFVYMLATHPDCGDKIYAELCKLE----TEEMST  294

Query  747   LHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDV  568
                 +S+D  + +Q +  FA LL YD++AKL YLH+ +TETLRL+PAVP+D KG+L DD 
Sbjct  295   AAIKASEDTTTGSQIS-SFAKLLTYDSLAKLAYLHAAITETLRLFPAVPEDIKGVLADDT  353

Query  567   LPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAG  391
             LPDG +VKAG  + +VP+ MGRME  WG DA  +KPERWL KDGVFQ  SPFKFTAFQAG
Sbjct  354   LPDGKKVKAGDQINFVPWCMGRMESLWGEDAREYKPERWLSKDGVFQPVSPFKFTAFQAG  413

Query  390   PRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             PRICLGKDSAYLQMKM  A LCRFF+F+LV GH V+YRMM +LSMA+GL +T S R
Sbjct  414   PRICLGKDSAYLQMKMTAATLCRFFRFELVPGHQVKYRMMAILSMANGLCVTASER  469



>ref|XP_002974848.1| hypothetical protein SELMODRAFT_101765 [Selaginella moellendorffii]
 gb|EFJ24368.1| hypothetical protein SELMODRAFT_101765 [Selaginella moellendorffii]
Length=469

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/483 (60%), Positives = 353/483 (73%), Gaps = 28/483 (6%)
 Frame = -1

Query  1629  MHDWLVGY------LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYM  1468
             MHD+L+        L NS +   PMP   Y Y   PD VEH+LK NF NYPKG+ +H  M
Sbjct  1     MHDFLLEKFLRNEKLYNSKTFRAPMPTFDYYYTVDPDVVEHILKNNFANYPKGDKFHDIM  60

Query  1467  EVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQ  1288
             EVLLGDGIFN+DGE+W++QRKTAS EFASK LRDFSTVVFRDY++KL  I++  +   Q 
Sbjct  61    EVLLGDGIFNSDGEVWKRQRKTASFEFASKILRDFSTVVFRDYAVKLADIVSGCTSRGQS  120

Query  1287  VDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKK  1108
              DMQDL MRMTLDSICK+GFGVEIGTL+ +LPEN+FA AFD AN  VT RF+DP WK+  
Sbjct  121   FDMQDLFMRMTLDSICKLGFGVEIGTLSASLPENKFAIAFDNANAWVTNRFVDPFWKVGS  180

Query  1107  FLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENN  928
              L +G EA L ++ + +DDFTY+VI+ R+AE++    +EK  K DILSRF+ L  DP+N 
Sbjct  181   LLKLGREAQLAKNAKIVDDFTYNVIKTRRAELQGKCADEK--KADILSRFMLLSDDPKNQ  238

Query  927   INDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVE-------EMR  769
             INDK+LRDIVLNFVIAGRDTTA TLSW +YM+ TH D  +K+++EL  +E        ++
Sbjct  239   INDKTLRDIVLNFVIAGRDTTAVTLSWFVYMLATHPDCGDKIYAELCKLETDEMSTAAIK  298

Query  768   AKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPK  589
             A E+     Q SS            FA LL YD++AKL YLH+ +TETLRL+PAVP+D K
Sbjct  299   ASEDTTAGSQISS------------FAKLLTYDSLAKLAYLHAAITETLRLFPAVPEDIK  346

Query  588   GILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFK  412
             G+L DD LPDG +VKAG  + +VP+ MGRME  WG DA  +KPERWL KDGVFQ  SPFK
Sbjct  347   GVLADDTLPDGKKVKAGDQINFVPWCMGRMESLWGEDAREYKPERWLSKDGVFQPVSPFK  406

Query  411   FTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTV  232
             FTAFQAGPRICLGKDSAYLQMKM  A LCRFF+F+LV GH V+YRMM +LSMA+GL +T 
Sbjct  407   FTAFQAGPRICLGKDSAYLQMKMTAATLCRFFRFELVPGHQVKYRMMAILSMANGLCVTA  466

Query  231   SPR  223
             S R
Sbjct  467   SER  469



>ref|XP_006827309.1| hypothetical protein AMTR_s00010p00266280 [Amborella trichopoda]
 gb|ERM94546.1| hypothetical protein AMTR_s00010p00266280 [Amborella trichopoda]
Length=426

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/390 (68%), Positives = 325/390 (83%), Gaps = 1/390 (0%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             +L LAL  +   W+ +HR  QR   GP++WPV+G+++EQ+ NY RMHDWLV YL+   +V
Sbjct  15    SLGLALVCVFLSWILVHRWGQRNSKGPKTWPVVGSAIEQLMNYDRMHDWLVEYLSKERTV  74

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
             VV MPF +YTYIA P NVE+VLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE W++QRK
Sbjct  75    VVRMPFASYTYIADPVNVEYVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGETWKQQRK  134

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
             TAS EFASKNLRDFSTVVFRDY+LKL  IL+QAS    +VD+Q+LLMRMTLDSICKVGFG
Sbjct  135   TASFEFASKNLRDFSTVVFRDYALKLSNILSQASYCGHEVDIQELLMRMTLDSICKVGFG  194

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIGTL+ +LPEN FA+AFD ANIIVTLRFIDPLW+IK+FL+VGSEA+L QSI+ IDDFT
Sbjct  195   VEIGTLSIDLPENSFARAFDTANIIVTLRFIDPLWRIKRFLHVGSEALLKQSIQQIDDFT  254

Query  1044  YSVIRKRKAEIEETQ-KNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDT  868
             YSVI KRK EI+E       ++KHDILSRFI+L +DP +N+NDK+LRDIVLNFVIAGRDT
Sbjct  255   YSVISKRKFEIKEACISGNMNIKHDILSRFIKLSEDPNSNLNDKNLRDIVLNFVIAGRDT  314

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTLSW IY+++TH  V+++L+ EL++ EE RAKEE+V L QY   D +S N+R  QF+
Sbjct  315   TATTLSWFIYLMITHPHVSQRLYLELKAFEEERAKEEHVPLVQYDLQDIQSFNERVSQFS  374

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQ  598
              L+NYD++ +L YL++ +TETLRLYPAVPQ
Sbjct  375   SLMNYDSLGRLSYLYAAITETLRLYPAVPQ  404



>ref|XP_002978645.1| hypothetical protein SELMODRAFT_418431 [Selaginella moellendorffii]
 ref|XP_002984583.1| hypothetical protein SELMODRAFT_423745 [Selaginella moellendorffii]
 gb|EFJ14228.1| hypothetical protein SELMODRAFT_423745 [Selaginella moellendorffii]
 gb|EFJ20092.1| hypothetical protein SELMODRAFT_418431 [Selaginella moellendorffii]
Length=520

 Score =   533 bits (1373),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 259/520 (50%), Positives = 353/520 (68%), Gaps = 9/520 (2%)
 Frame = -1

Query  1776  SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  1597
             S   + ++++ L++  WVF+HRL QR   GP++WP++G  VEQ  N+ ++HDWL+GY   
Sbjct  7     SGSASWMISIALLLAWWVFLHRLRQRHLAGPKTWPLLGCIVEQARNFDKLHDWLLGYFNK  66

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
             + +  VPM     T+ A+P NVE++LKTNF N+PKG+      E L+G GIF  DGE W 
Sbjct  67    TLTFSVPMATINNTFTANPANVEYILKTNFNNFPKGDKLCGRFEDLMGQGIFTVDGERWI  126

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
              QRK A+ EFAS  LRD+S   FRD +L+L  +L  AS   +QVD+QDL MR+TLDSIC 
Sbjct  127   HQRKVATAEFASSKLRDYSIHTFRDKALRLVKVLDSASRSGKQVDLQDLFMRLTLDSICT  186

Query  1236  VGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTI  1057
             VGFGV +G L+P+LP   FA AFD A  ++  R++D  WKIK+  ++GSEA L Q ++ +
Sbjct  187   VGFGVGVGCLSPDLPFVPFAAAFDEAMRLIIRRYVDVFWKIKRAASIGSEARLAQCLKVV  246

Query  1056  DDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAG  877
             D F Y VI +R+   EE ++     + D+LSRF+ L  + E    DK LRD+V+NF++AG
Sbjct  247   DSFLYQVINRRR---EEMKRLSSEARADLLSRFMVL--EGEEAYTDKMLRDVVMNFMVAG  301

Query  876   RDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENV-LLHQYSSDDPESLNQRA  700
             RDTTA TLSW    +  H +VA+K+ +E+  V  + +K++ +  +   SS     L Q  
Sbjct  302   RDTTALTLSWFFSELCKHPEVADKIVAEVSQV--LGSKQQKIPKISDRSSSFDYGLEQEI  359

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
             +  A LL+Y T+ K+ YLH+ +TE LRLYPAVP D K ++EDD LPDGT+V+AG  V+YV
Sbjct  360   LDLAELLDYQTLNKMQYLHAALTEALRLYPAVPLDTKQVIEDDTLPDGTKVRAGQFVSYV  419

Query  519   PYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             PYSMGR+E+ WGPDA  FKPERWL   GV+Q  SP+KFT FQAGPR+CLGKDSAYLQMKM
Sbjct  420   PYSMGRLEHIWGPDATEFKPERWLNSSGVYQPQSPYKFTTFQAGPRMCLGKDSAYLQMKM  479

Query  342   ALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
                +L + F F LVEG S++YRMM VL +A G++  V+ R
Sbjct  480   TTVMLLKLFNFSLVEGQSLDYRMMAVLYIADGVQAKVTRR  519



>ref|XP_002981144.1| hypothetical protein SELMODRAFT_113735 [Selaginella moellendorffii]
 gb|EFJ17845.1| hypothetical protein SELMODRAFT_113735 [Selaginella moellendorffii]
Length=501

 Score =   522 bits (1345),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 252/506 (50%), Positives = 342/506 (68%), Gaps = 24/506 (5%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  1555
             W  IHR+ Q    G ++WP+IG ++E   NY R++DWL     +  + ++   MP   Y 
Sbjct  17    WCAIHRIRQIGTPGFKTWPLIGVTLEVAANYHRIYDWLSWNFRVKETMTMSATMPGRCYV  76

Query  1554  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  1375
             +   P NVEH+LKTNF NYPKGE +H   E LLG+GIFN+DGE WR QRKTAS EF+S+ 
Sbjct  77    FTVDPANVEHILKTNFANYPKGEEFHEIFEPLLGNGIFNSDGEPWRIQRKTASFEFSSRV  136

Query  1374  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNL  1195
             LRD S  VF+D++LKL  I         Q  +QDL MRMTLD+IC +GFG+ +G LAPNL
Sbjct  137   LRDVSCRVFKDHALKLARI---------QFYLQDLFMRMTLDTICFLGFGLHLGVLAPNL  187

Query  1194  PENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAE  1015
             P N FA AFDA N I++ RF DP WK K+FL +G E  L + ++ +DDFT+S+I +R+ +
Sbjct  188   PRNDFATAFDACNAIISYRFADPFWKFKRFLRIGQERSLQRHLQVVDDFTHSIICQRRLQ  247

Query  1014  IEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
             +++  K+ +  K D+LSRF+ L    + + +D  LRD++LNFVIAGRDTTA+TLS+  YM
Sbjct  248   LQDQPKDHQQSKQDLLSRFMLL----DESFSDDHLRDVILNFVIAGRDTTASTLSYFTYM  303

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             I +H D A K++ EL   EE++  +        +S  P S   +   F  LL Y+++AKL
Sbjct  304   IASHPDCATKIYQELHEFEELQLSD--------NSHRPSSFEDKIHGFTQLLTYESLAKL  355

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ + ETLRL+PAVP + KG++ DDVLP G  VK G  ++Y PY M  +E  WG DA
Sbjct  356   VYLHAALMETLRLFPAVPLNFKGVVADDVLPSGAMVKRGSTLSYAPYCMAHIESIWGSDA  415

Query  474   ASFKPERWLKDGVFQ-NASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE  298
             + F+PERW +DG +  + SPFKFTAFQAGPRICLGKDSA+LQMK+  A+LCRFF+F+LV 
Sbjct  416   SQFRPERWHRDGAWDFSISPFKFTAFQAGPRICLGKDSAFLQMKITAALLCRFFEFQLVP  475

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
                + YR+M  +S A+G+K+T S RT
Sbjct  476   RQILTYRVMATISFANGVKVTTSNRT  501



>ref|XP_002982626.1| hypothetical protein SELMODRAFT_116539 [Selaginella moellendorffii]
 gb|EFJ16379.1| hypothetical protein SELMODRAFT_116539 [Selaginella moellendorffii]
Length=501

 Score =   519 bits (1337),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 344/506 (68%), Gaps = 24/506 (5%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  1555
             W  IHR+ Q    G ++WP+IG ++E   NY R++DWL     +  + ++   MP  +Y 
Sbjct  17    WCAIHRIRQIGTPGFKTWPLIGVTLEVAANYHRIYDWLSWNFRVKETMTMSATMPGRSYV  76

Query  1554  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  1375
             +   P NVEH+LKTNF NYPKGE +H   E LLG+GIFN+DGE WR QRKTAS EF+S+ 
Sbjct  77    FTVDPANVEHILKTNFANYPKGEEFHEIFEPLLGNGIFNSDGEPWRIQRKTASFEFSSRV  136

Query  1374  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNL  1195
             LRD S  VF+D++LKL  I         ++ +QDL MRMTLD+IC +GFG+ +G LAPNL
Sbjct  137   LRDVSCRVFKDHALKLARI---------KIYLQDLFMRMTLDTICFLGFGLHLGVLAPNL  187

Query  1194  PENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAE  1015
             P N FA AFDA N I++ RF DP WK K+FL +G E  L + ++ +DDFT+S+I +R+ +
Sbjct  188   PRNDFATAFDACNAIISYRFADPFWKFKRFLRIGQERSLQRHLQVVDDFTHSIICQRRLQ  247

Query  1014  IEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
             +++  K+ +  + D+LSRF+ L    + + +D  LRD++LNFVIAGRDTTA+TLS+  YM
Sbjct  248   LQDQPKDHQQSRQDLLSRFMLL----DESFSDDHLRDVILNFVIAGRDTTASTLSYFTYM  303

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             I +H D A K++ EL   EE++  +        +S  P S   +   F  LL Y+++AKL
Sbjct  304   IASHPDCATKIYQELHEFEELQLAD--------NSHRPSSFEDKIHGFTQLLTYESLAKL  355

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ + ETLRL+PAVP + KG++ DDVLP G  VK G  ++Y PY M R++  WG DA
Sbjct  356   VYLHAALMETLRLFPAVPLNFKGVVADDVLPSGAMVKRGSTLSYAPYCMARIKSIWGSDA  415

Query  474   ASFKPERWLKDGVFQ-NASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE  298
             + F+PERW +DG +  + S FKFTAFQAGPRICLGKDSA+LQMK+  A+LCRFF+F+LV 
Sbjct  416   SQFRPERWRRDGAWDFSISSFKFTAFQAGPRICLGKDSAFLQMKITAALLCRFFEFQLVP  475

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
                + YR+M  +S A+G+K+T S RT
Sbjct  476   RQILTYRVMATISFANGVKVTTSNRT  501



>ref|XP_001768338.1| predicted protein [Physcomitrella patens]
 gb|EDQ66952.1| predicted protein [Physcomitrella patens]
Length=518

 Score =   512 bits (1318),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 336/497 (68%), Gaps = 16/497 (3%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY-LANSYSVVVPMPFTTYTY  1552
             WV +HR  +RKG  P  WP++G ++E + NY  ++DW+V Y L +  +    M     T+
Sbjct  27    WV-LHR--ERKG--PVQWPILGVTLEALKNYQTLNDWVVYYFLRDGLTFSCKMMHLDLTF  81

Query  1551  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  1372
              A P NV+H+LKTNF NY KG+ +H   E+ LGDGIFN DGE+WR QRKTAS EFAS+ L
Sbjct  82    TADPVNVKHILKTNFANYDKGKFFHENFEIFLGDGIFNVDGEIWRTQRKTASFEFASRKL  141

Query  1371  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP  1192
             RDFSTVVFRDYS+KL +IL +A+   Q +DMQDL MR TLDSI KV F  ++GTL P LP
Sbjct  142   RDFSTVVFRDYSVKLASILARAATAQQSMDMQDLFMRFTLDSIFKVTFDYDVGTLQPGLP  201

Query  1191  ENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
                FA+AF+  N I + R I+P+WK+ + L +GSE +L QS + +D+F Y VI  +KAE+
Sbjct  202   NIPFAQAFEITNEITSSRLINPIWKLNRALKIGSERVLLQSAKDVDEFIYGVIEAKKAEM  261

Query  1011  EETQKNEKSMKHDILSRFIELGKDPEN-NINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
               ++ +   +  D+ SRF+ L +D  +    DK+ RD +LNF+IAGRDTTA +LSW +Y 
Sbjct  262   ANSKTD--LLSSDLFSRFMRLEEDDSDIQFTDKNFRDTLLNFIIAGRDTTAVSLSWFVYR  319

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             +  + ++  +L  EL   + +R  ++         +  E L +R + FA LL +D + KL
Sbjct  320   MAQNPEMTARLQQELRDFDTVRNWKQQ-------PEGDEGLRRRVLGFAELLTFDNLVKL  372

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ + ETLRL+PAVP DPK  + DD+LPDGT++K G ++ Y PY+MGRM   WGPDA
Sbjct  373   QYLHACILETLRLHPAVPLDPKHAINDDILPDGTQIKKGSLIYYTPYAMGRMPALWGPDA  432

Query  474   ASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEG  295
               FKP+RW  DGV Q   PFKFTAFQAGPRICLGKDSA LQ++M LA+L RFF F++VEG
Sbjct  433   MEFKPQRWFVDGVVQTEQPFKFTAFQAGPRICLGKDSAMLQLRMVLALLYRFFTFQIVEG  492

Query  294   HSVEYRMMTVLSMAHGL  244
               + YR M  L +A+GL
Sbjct  493   TDIRYRQMATLLLANGL  509



>ref|XP_002988354.1| hypothetical protein SELMODRAFT_127881 [Selaginella moellendorffii]
 gb|EFJ10444.1| hypothetical protein SELMODRAFT_127881 [Selaginella moellendorffii]
Length=546

 Score =   508 bits (1309),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 258/526 (49%), Positives = 340/526 (65%), Gaps = 25/526 (5%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             T ++   LI+  W+F+HR  Q    GP+SWP++G   EQ+ N+ R+H WL+ Y   +++ 
Sbjct  34    TWIITWALILAWWIFLHRFRQGGLRGPKSWPLVGCLFEQIANFDRLHHWLLDYHHKTWTF  93

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
               P+     T+ AHP NVE++LKTNF NYPKGE+       ++G GIFN DGE+W  QRK
Sbjct  94    SAPVLGVNNTFTAHPANVEYILKTNFVNYPKGELLRQRFRDMMGYGIFNVDGEMWMHQRK  153

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
              A++EFAS  LRD+ST  FRD +LKL  IL   S   Q +D+QDL +R+TLDSICK+GFG
Sbjct  154   VATVEFASSKLRDYSTFAFRDLTLKLAGILADRSGTGQALDLQDLFLRLTLDSICKIGFG  213

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIG L P+LP   FA AFD  N ++  R+ID  WKIK+F N GSE  L + IR +DDF 
Sbjct  214   VEIGCLRPDLPLIPFAHAFDYGNTLIIRRYIDMFWKIKRFFNAGSERELKRCIRVMDDFL  273

Query  1044  YSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTT  865
             Y VI +R+ E+++++   +    DILSRF+ L  D E    DK LRD+V+NFVIAGRDTT
Sbjct  274   YRVIERRRQELKQSKDVGRP---DILSRFLSL--DEEEAYTDKMLRDVVINFVIAGRDTT  328

Query  864   ATTLSWAIYMIMTHEDVAEKLWSELESV----EEMRAKEENVLLHQYSSDDPESLNQRAM  697
             A TLSW    +    +V EK+ +E++ V    EE+  K+        S    E +  +  
Sbjct  329   ALTLSWLFSELAKRPEVVEKILAEVDRVFGADEELEGKD--------SMSKKEQVLAKVA  380

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
              F+  L+Y  + +L+YL + +TE LRLYPAVP + K ++ DDVLPDG  VK G  V+Y  
Sbjct  381   NFSRRLDYQGLNRLHYLQATLTEALRLYPAVPLETKTVVADDVLPDGFSVKGGQFVSYSS  440

Query  516   YSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQ-------AGPRICLGKDSA  361
             ++MGR+E  WGPD   FKPERWL+ D +FQ  SPFK TAFQ       AGPRICLGKDSA
Sbjct  441   WAMGRLEEIWGPDVLEFKPERWLRSDNIFQPQSPFKLTAFQARREFGKAGPRICLGKDSA  500

Query  360   YLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             YLQMK+   +L RFFKF+L++   V YRMM VL MA+GL   VS R
Sbjct  501   YLQMKITTILLLRFFKFELLDEKPVNYRMMVVLYMANGLLSRVSFR  546



>ref|XP_002979701.1| hypothetical protein SELMODRAFT_111270 [Selaginella moellendorffii]
 gb|EFJ19103.1| hypothetical protein SELMODRAFT_111270 [Selaginella moellendorffii]
Length=545

 Score =   507 bits (1305),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/526 (49%), Positives = 340/526 (65%), Gaps = 25/526 (5%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             T ++   LI+  W+F+HR  QR   GP+SWP++G   EQ+ N+ R+H WL+ Y   +++ 
Sbjct  33    TWIITWALILAWWIFLHRFRQRGLRGPKSWPLVGCLFEQIANFDRLHHWLLDYHHKTWTF  92

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
               P+     T+ AHP NVE++LKTNF NYPKGE+       ++G GIFN DGE+W  QRK
Sbjct  93    SAPVLGVNNTFTAHPANVEYILKTNFVNYPKGELLRQRFRDMMGYGIFNVDGEMWMHQRK  152

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
              A++EFAS  LRD+ST  FRD +LKL  IL   S   Q +D+QDL +R+TLDSICK+GFG
Sbjct  153   VATVEFASSKLRDYSTFAFRDLTLKLAGILADRSGTGQALDLQDLFLRLTLDSICKIGFG  212

Query  1224  VEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             VEIG L P+LP   FA AFD  N ++  R+ID  WKIK+  N GSE  L + IR +DDF 
Sbjct  213   VEIGCLRPDLPLIPFAHAFDYGNTLIIRRYIDMFWKIKRSFNAGSERELKRCIRVMDDFL  272

Query  1044  YSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTT  865
             Y VI +R+ E+++++   +    DILSRF+ L  D E    DK LRD+V+NFVIAGRDTT
Sbjct  273   YRVIERRRQELKQSKDVGRP---DILSRFLSL--DEEEAYTDKMLRDVVINFVIAGRDTT  327

Query  864   ATTLSWAIYMIMTHEDVAEKLWSELESV----EEMRAKEENVLLHQYSSDDPESLNQRAM  697
             A TLSW    +    +V EK+ +E++ V    EE+  K+        S    E +  +  
Sbjct  328   ALTLSWLFSELAKRPEVVEKILAEVDRVFGVDEELEGKD--------SMSKKEQVLAKVA  379

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
              F+  L+Y  + +L+YL + +TE LRLYPAVP + K ++ DDVLPDG  VK G  V+Y  
Sbjct  380   NFSRKLDYQGLNRLHYLQATLTEALRLYPAVPLETKTVVADDVLPDGFSVKGGQFVSYSS  439

Query  516   YSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQ-------AGPRICLGKDSA  361
             ++MGR+E  WGPD   FKP+RWL+ D +FQ  SPFK TAFQ       AGPRICLGKDSA
Sbjct  440   WAMGRLEEIWGPDVLEFKPDRWLRSDNIFQPQSPFKLTAFQARREFGKAGPRICLGKDSA  499

Query  360   YLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             YLQMK+   +L RFFKF+L++   V YRMM VL MA+GL   VS R
Sbjct  500   YLQMKITTILLLRFFKFELLDEKPVNYRMMVVLYMANGLLSRVSFR  545



>gb|ACN41008.1| unknown [Picea sitchensis]
Length=543

 Score =   504 bits (1297),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 260/515 (50%), Positives = 337/515 (65%), Gaps = 17/515 (3%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRK--GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             LG+ ++ WV+I R         GP+SWP++G+++E   N  R++DWL  Y  N  +    
Sbjct  39    LGISIWTWVWICRRRDNHIITAGPKSWPLLGSTLELTANLHRLYDWLTDYAMNFPTFEAK  98

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
                    +   P NVE++LKTNF NY KG   H     LLGDGIFN DGE+W+ QRK+AS
Sbjct  99    YIGFRLLFTVDPANVEYILKTNFSNYVKGPAAHEIQYDLLGDGIFNTDGEMWKLQRKSAS  158

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILT-QASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             LEF+SK LRD+S   FR Y+LKL  IL  Q +  N   +MQD+ MRMT DSIC+VGFGVE
Sbjct  159   LEFSSKMLRDYSADAFRKYALKLAMILQGQLAHNNNVANMQDMFMRMTFDSICEVGFGVE  218

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IG+LA +LP+  FA AFD +N +   R+ DP WK+KK  N+GSEA L Q +R +DDFTY 
Sbjct  219   IGSLASSLPDVPFASAFDRSNALCASRYFDPFWKLKKRFNLGSEAKLKQDVRVLDDFTYG  278

Query  1038  VIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             +I+KR+  +   Q   KS   D+LSRF  + K+      DK LRD +LNFVIAGRDTTA 
Sbjct  279   IIQKRRNLLNAHQDEVKS---DLLSRFFFMAKENPELYTDKKLRDAILNFVIAGRDTTAV  335

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             TLSW  +++  +    +K+  ELE VE       ++  H   SD       R  +++ LL
Sbjct  336   TLSWLFWLLAKNPSAEDKIVQELEEVERSHVG-LSITDHNDGSD-------RLEKYSQLL  387

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
              YDT++K++YL + +TE+LRLYPAVP + K  + DD+LPDG +VK G ++ YVPY+MGRM
Sbjct  388   TYDTLSKMHYLQAAITESLRLYPAVPLNGKTAVSDDILPDGNKVKRGNVINYVPYAMGRM  447

Query  498   EYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             +  WG DA  FKPERWL KDGVFQ  SPFKF AFQAGPRICLGKDSAYLQMK+A A L R
Sbjct  448   QRLWGDDALDFKPERWLNKDGVFQPQSPFKFVAFQAGPRICLGKDSAYLQMKIAAATLLR  507

Query  321   FFKFKLVEGHSVEYRMMTVLSMA--HGLKLTVSPR  223
             FFKF+LV G+ +EY +   L M+   GL + V PR
Sbjct  508   FFKFELVAGYRIEYMVALTLLMSSPQGLPMAVHPR  542



>ref|XP_002980994.1| hypothetical protein SELMODRAFT_113847 [Selaginella moellendorffii]
 gb|EFJ17695.1| hypothetical protein SELMODRAFT_113847 [Selaginella moellendorffii]
Length=512

 Score =   496 bits (1276),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 246/508 (48%), Positives = 342/508 (67%), Gaps = 17/508 (3%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  1555
             W  I  + Q    G ++WP+ G ++E   NY R++DWL     +  + ++   MP  ++ 
Sbjct  17    WCGIQCIRQIGTPGFKTWPLFGVTLEVAANYHRLYDWLSWNFQVKETMTMSATMPGRSFL  76

Query  1554  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  1375
             +   P NVEH+LKTNF NYPKGE +    + LLG+GIFN++GE WR QRKTAS EFAS+ 
Sbjct  77    FTVDPANVEHILKTNFANYPKGEDFQEIFQPLLGNGIFNSNGEAWRFQRKTASFEFASRV  136

Query  1374  LRDFSTVVFRDYSLKLFTILTQASLL--NQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP  1201
             LRD S  VF+D++LKL  I+     L  + +  +QDL MRMTLD+IC +GFG+ +G LAP
Sbjct  137   LRDVSCRVFKDHALKLARIVHALLFLLRSSRKFIQDLFMRMTLDTICYLGFGLHLGVLAP  196

Query  1200  NLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRK  1021
             NLP N FA AFDA N I++ R  DP WK+K+FL +G E  L + ++ +DDFT+S+I++R+
Sbjct  197   NLPRNDFATAFDACNAIISYRCADPFWKLKRFLRIGLERNLQRHLQVVDDFTHSIIQQRR  256

Query  1020  AEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAI  841
              ++++  K+ +  K D+LSRF+ L    + + +D  LRD++LNFVIAGRDTTA+TLS+  
Sbjct  257   LQLQDQYKHHQHSKQDLLSRFMLL----DESFSDDHLRDVILNFVIAGRDTTASTLSYFT  312

Query  840   YMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMA  661
             YMI +H D A K++ EL   EE++  +        +S  P S   +   F  LL Y+++A
Sbjct  313   YMIASHPDCATKIYQELHEFEELQLSD--------NSHRPSSFEDKIHGFTQLLTYESLA  364

Query  660   KLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGP  481
             KL YLH+ + ETLRL+PAVP + K    DDVLP G  VK G  V+YVPY M R+E  WG 
Sbjct  365   KLVYLHAALMETLRLFPAVPLNFKRAATDDVLPSGAVVKRGSTVSYVPYCMARVESIWGS  424

Query  480   DAASFKPERWLKDGVFQ-NASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKL  304
             DA+ F+PERW +DG +  + SPFKFTAFQAGPRICLGKDSA+LQMK+  A+LCRFF+F+L
Sbjct  425   DASQFRPERWRRDGAWDFSVSPFKFTAFQAGPRICLGKDSAFLQMKITAALLCRFFEFQL  484

Query  303   VEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             V G  + YR+M  +S+ +G+K+T S  T
Sbjct  485   VPGQILTYRVMATISLVNGVKVTTSNCT  512



>ref|XP_002974847.1| hypothetical protein SELMODRAFT_414990 [Selaginella moellendorffii]
 gb|EFJ24367.1| hypothetical protein SELMODRAFT_414990 [Selaginella moellendorffii]
Length=496

 Score =   491 bits (1264),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 250/501 (50%), Positives = 334/501 (67%), Gaps = 36/501 (7%)
 Frame = -1

Query  1719  IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  1546
             IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  22    IHRFS-RGGGRDGGLPLIGHTVEVLANYHRIFDLLLEKFQSQGTSTVPLWIPGQSYVFTV  80

Query  1545  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  1366
              P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRKTAS EFAS+ LR+
Sbjct  81    DPANVEYILKTRFQNFPKGERFREKFQPLLGAGIFNADGAAWKSQRKTASFEFASRVLRE  140

Query  1365  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN  1186
             +S  VFRD++L+L  I              DL +RMTLD+IC +GFGV +G L+  LP N
Sbjct  141   WSGSVFRDHALELARI--------------DLFLRMTLDTICNLGFGVHLGLLSSTLPHN  186

Query  1185  RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEE  1006
              FA AFD  N IV+ RF DP WK+K+ L +G E  L +++ T+D+FTY++IRKR+ ++ +
Sbjct  187   DFAAAFDRCNAIVSFRFADPFWKLKRLLRIGEEGDLPKNLATVDEFTYNIIRKRRIQLSK  246

Query  1005  TQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMT  826
               ++ ++ K D+LSRF+ L    + + +D  LRDIVLNFVIAGRDTTA TLS+ IYM+ +
Sbjct  247   ENEDLRARKKDLLSRFMLL----DESSSDAYLRDIVLNFVIAGRDTTAATLSYFIYMVAS  302

Query  825   HEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYL  646
             H D   +L SEL   +    +      H++  DDP S+      FA LL  + +AKL YL
Sbjct  303   HPDCQARLHSELLDFDHSSRQ------HEHHDDDPSSME----SFAKLLTLEALAKLPYL  352

Query  645   HSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASF  466
             H+ V ETLRLYP+VP + KG+  DDVLPDGTRV+ G +V+YVPY MGRME  WGPDAA F
Sbjct  353   HAAVNETLRLYPSVPLNFKGVASDDVLPDGTRVRRGEIVSYVPYCMGRMESLWGPDAADF  412

Query  465   KPERWL----KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE  298
             +PERW      D  F N+SPFKFTAFQAGPR+CLGKDSAYLQ+K+  A+LCRFF+F+LV 
Sbjct  413   RPERWRAVDGSDWDF-NSSPFKFTAFQAGPRVCLGKDSAYLQIKITAALLCRFFEFRLVP  471

Query  297   GHSVEYRMMTVLSMAHGLKLT  235
               ++ YR+M  +S+A G+K+ 
Sbjct  472   NQNLHYRVMATISLASGIKVV  492



>ref|XP_002982474.1| hypothetical protein SELMODRAFT_116579 [Selaginella moellendorffii]
 gb|EFJ16227.1| hypothetical protein SELMODRAFT_116579 [Selaginella moellendorffii]
Length=538

 Score =   491 bits (1263),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 246/532 (46%), Positives = 340/532 (64%), Gaps = 41/532 (8%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG--YLANSYSVVVPMPFTTYT  1555
             W  I  + Q    G ++WP+IG ++E   NY R++DWL     +  + ++   MP  ++ 
Sbjct  17    WCGIQCIRQIGTPGFKTWPLIGVTLEVAANYHRLYDWLSWNFQVKETMTMSATMPGRSFL  76

Query  1554  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  1375
             +   P NVEH+LKTNF NYPKGE +    + LLG+GIFN++GE WR QRKTAS EFAS+ 
Sbjct  77    FTVDPANVEHILKTNFANYPKGEDFQEIFQPLLGNGIFNSNGEAWRFQRKTASFEFASRV  136

Query  1374  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQ------------------DLLMRMTLD  1249
             LRD S  VF+D++LKL  I+  +      ++MQ                  DL MRMTLD
Sbjct  137   LRDVSCRVFKDHALKLARIVHGSQESEGSLEMQARIKSSSFLLRSSRKFIQDLFMRMTLD  196

Query  1248  SICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQS  1069
             +IC +GFG+ +G LAPNLP N FA AFDA N I++ R  DP WK+K+FL +G E  L + 
Sbjct  197   TICYLGFGLHLGVLAPNLPRNDFATAFDACNAIISYRCADPFWKLKRFLRIGLERNLRRH  256

Query  1068  IRTIDDFTYSVIRKRKAEIEETQKN--------EKSMKHDILSRFIELGKDPENNINDKS  913
             ++ +DDFT+S+I++R+ ++++                K D+LSRF+ L    + + +D  
Sbjct  257   LQVVDDFTHSIIQQRRLQLQDHHARIFIRFLRLSLQSKQDLLSRFMLL----DESFSDDH  312

Query  912   LRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYS  733
             LRD++LNFVIAGRDTTA+TLS+  YMI +H D A K++ EL   EE +  +        +
Sbjct  313   LRDVILNFVIAGRDTTASTLSYFTYMIASHPDCATKIYQELHEFEEFQLSD--------N  364

Query  732   SDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGT  553
             S  P S   +   F  LL Y+++AKL YLH+ + ETLRL+PAVP + K  + DDVLP G 
Sbjct  365   SHRPSSFEDKIHGFTQLLTYESLAKLVYLHAALMETLRLFPAVPLNFKLAVTDDVLPSGA  424

Query  552   RVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQ-NASPFKFTAFQAGPRICL  376
              VK G  V+YVPY M R+E  WG DA+ F+PERW +DG +  + SPFKFTAFQAGPRICL
Sbjct  425   VVKRGSTVSYVPYCMARVESIWGSDASQFRPERWRRDGAWDFSVSPFKFTAFQAGPRICL  484

Query  375   GKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             GKDSA+LQMK+  A+LCRFF+F+LV G  + YR+M  +S+ +G+K+T S  T
Sbjct  485   GKDSAFLQMKITAALLCRFFEFQLVPGQILTYRVMATISLVNGVKVTTSNCT  536



>ref|XP_006651077.1| PREDICTED: cytochrome P450 704C1-like [Oryza brachyantha]
Length=350

 Score =   483 bits (1243),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 231/324 (71%), Positives = 272/324 (84%), Gaps = 5/324 (2%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             ++A+ L++  W+ +H+ S R   GPRSWP+IGA+VEQ+ NY RMHDWLV YL+   +V V
Sbjct  25    LIAIFLVVLSWILVHKWSLRNQKGPRSWPIIGATVEQLKNYHRMHDWLVEYLSKDRTVTV  84

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
              MPFT+YTYIA P NVEHVLKTNF NYPKGEVY SYM VLLGDGIFNADGE+WRKQRKTA
Sbjct  85    DMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMNVLLGDGIFNADGEMWRKQRKTA  144

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EFASKNLRDFSTVVFR+YSLKL +IL QA    + VDMQ+L MRMTLDSICKVGFGVE
Sbjct  145   SFEFASKNLRDFSTVVFREYSLKLSSILNQACKAGRVVDMQELFMRMTLDSICKVGFGVE  204

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             IGTL+P+LPEN FA+AFDAANIIVTLRFIDPLW++KKFL+VGSEA+L+QS++ +DDFTYS
Sbjct  205   IGTLSPDLPENSFAQAFDAANIIVTLRFIDPLWRLKKFLHVGSEALLEQSMKLVDDFTYS  264

Query  1038  VIRKRKAEIEETQKN--EKSMKHDILSRFIELGKDPENNI---NDKSLRDIVLNFVIAGR  874
             VIR+RKAEI + + +  ++ +KHDILSRFIELG+  +      +DKSLRD+VLNFVIAGR
Sbjct  265   VIRRRKAEIVQARASGQQEKIKHDILSRFIELGEAGDEGSSFGDDKSLRDVVLNFVIAGR  324

Query  873   DTTATTLSWAIYMIMTHEDVAEKL  802
             DTTATTLSW  YM MTH  VAEKL
Sbjct  325   DTTATTLSWFTYMAMTHPAVAEKL  348



>ref|XP_002963763.1| hypothetical protein SELMODRAFT_405166 [Selaginella moellendorffii]
 gb|EFJ35634.1| hypothetical protein SELMODRAFT_405166 [Selaginella moellendorffii]
Length=496

 Score =   484 bits (1245),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 247/500 (49%), Positives = 333/500 (67%), Gaps = 34/500 (7%)
 Frame = -1

Query  1719  IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  1546
             IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  22    IHRFS-RGGGRDGGLPLIGHTVEVLANYHRIFDLLLQKFQSQGTSTVPLWIPGQSYVFTV  80

Query  1545  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  1366
              P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRKTAS EFAS+ LR+
Sbjct  81    DPANVEYILKTRFQNFPKGERFREKFQPLLGGGIFNADGAAWKSQRKTASFEFASRVLRE  140

Query  1365  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN  1186
             +S  VFRD++L+L  I              DL +RMTLD+IC +GFGV +G L+  LP N
Sbjct  141   WSGSVFRDHALELARI--------------DLFLRMTLDTICNLGFGVHLGLLSSTLPHN  186

Query  1185  RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEE  1006
              FA AFD  N IV+ RF DP WK+K+ L +G E  L +++ T+D+FTY++IRKR+ ++ +
Sbjct  187   DFAAAFDRCNAIVSFRFADPFWKLKRLLRIGEERDLPKNLATVDEFTYNIIRKRRIQLSK  246

Query  1005  TQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMT  826
               ++ ++ K D+LSRF+ L    + + +D  LRDIVLNFVIAGRDTTA TLS+ IYM+ +
Sbjct  247   ENEDLRARKKDLLSRFMLL----DESSSDAYLRDIVLNFVIAGRDTTAATLSYFIYMVAS  302

Query  825   HEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYL  646
             H D   +L SEL   +    +      H++  DDP  +      FA LL  + +AKL YL
Sbjct  303   HPDCQGRLHSELLDFDHSSRQ------HEHHDDDPSFME----SFAKLLTLEALAKLPYL  352

Query  645   HSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASF  466
             H+ V ETLRLYP+VP + KG+  DDVLPDGTRV+ G +V+YVPY MGRME  WGPDAA F
Sbjct  353   HAAVNETLRLYPSVPLNFKGVASDDVLPDGTRVRRGEIVSYVPYCMGRMESLWGPDAADF  412

Query  465   KPERWLK-DGVFQN--ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEG  295
             +PERW   DG   +  +SPFKFTAFQAGPR+CLGKDSAYLQ+K+  A+LCRFF+F+LV  
Sbjct  413   RPERWRAVDGSDWDFTSSPFKFTAFQAGPRVCLGKDSAYLQIKITAALLCRFFEFRLVPN  472

Query  294   HSVEYRMMTVLSMAHGLKLT  235
              ++ YR+M  +S+A G+++ 
Sbjct  473   QNLHYRVMATISLASGIEVV  492



>ref|XP_002974639.1| hypothetical protein SELMODRAFT_101746 [Selaginella moellendorffii]
 gb|EFJ24159.1| hypothetical protein SELMODRAFT_101746 [Selaginella moellendorffii]
Length=504

 Score =   474 bits (1220),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 249/501 (50%), Positives = 333/501 (66%), Gaps = 24/501 (5%)
 Frame = -1

Query  1719  IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  1546
             IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  18    IHRFS-RGGGRDGGLPLIGHTVEILANYHRIFDLLLEKFQSQGTSTVPLWIPGQSYVFTV  76

Query  1545  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  1366
              P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRK AS EFAS+ LR+
Sbjct  77    DPANVEYILKTRFQNFPKGERFREKFQPLLGGGIFNADGAAWKSQRKAASFEFASRVLRE  136

Query  1365  FSTVVFRDYSLKLFTILT-QASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             +S  VFRD++L+L  IL   A   +  +  +DL  RMTLD+IC +GFGV +G L+P LP 
Sbjct  137   WSGSVFRDHALELARILPGNAGKKDLSLLPRDLFQRMTLDTICSLGFGVRLGLLSPTLPH  196

Query  1188  NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIE  1009
             N FA A D  N IV+ RF DP WK+K+ L +G E  L +++ T+D+FTY++IRKR+  I+
Sbjct  197   NDFAAACDRCNAIVSFRFADPFWKLKRLLRIGEERDLPKNLATVDEFTYNIIRKRR--IQ  254

Query  1008  ETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIM  829
              +++NE  ++ D+LSRF+ L    + + +D  LRD+VLNFVIAGRDTTA TLS+ IYM+ 
Sbjct  255   LSKENE-DLRKDLLSRFMLL----DESSSDVYLRDMVLNFVIAGRDTTAATLSYFIYMVA  309

Query  828   THEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYY  649
             +H D   ++ SEL   E  R+  +    H    DDP S+      FA LL ++ +AKL Y
Sbjct  310   SHPDCQGRIHSELLDFE--RSSRQ----HPGHDDDPSSIES----FANLLKFEALAKLPY  359

Query  648   LHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAAS  469
             LH+ V ETLRLYP +P + KG+  DDVLPDGT V+ G +V+Y  Y MGRME  WGPDAA 
Sbjct  360   LHAAVNETLRLYPTLPLNFKGVASDDVLPDGTPVRRGEIVSYAAYCMGRMESLWGPDAAD  419

Query  468   FKPERW-LKDGVFQ--NASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE  298
             F+PERW   DG     N SPFKFTAFQAGPR+CLGKDSAYLQ+K+  A+LCRFF+F+LV 
Sbjct  420   FRPERWRTADGSNWDFNPSPFKFTAFQAGPRVCLGKDSAYLQIKITAALLCRFFEFRLVP  479

Query  297   GHSVEYRMMTVLSMAHGLKLT  235
               +  YR+M  +S+A G+K+ 
Sbjct  480   NQTFHYRVMATISLASGIKVV  500



>ref|XP_002963351.1| hypothetical protein SELMODRAFT_80855 [Selaginella moellendorffii]
 gb|EFJ35222.1| hypothetical protein SELMODRAFT_80855 [Selaginella moellendorffii]
Length=504

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 248/501 (50%), Positives = 332/501 (66%), Gaps = 24/501 (5%)
 Frame = -1

Query  1719  IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPM--PFTTYTYIA  1546
             IHR S R GG     P+IG +VE + NY R+ D L+    +  +  VP+  P  +Y +  
Sbjct  18    IHRFS-RGGGRDGGLPLIGHTVEILANYHRIFDLLLEKFQSQGTSTVPLWIPGQSYVFTV  76

Query  1545  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  1366
              P NVE++LKT F N+PKGE +    + LLG GIFNADG  W+ QRK AS EFAS+ LR+
Sbjct  77    DPANVEYILKTRFQNFPKGERFREKFQPLLGGGIFNADGAAWKSQRKAASFEFASRVLRE  136

Query  1365  FSTVVFRDYSLKLFTILT-QASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             +S  VFRD++L+L  IL   A   +  +  +DL  RMTLD+IC +GFGV +G L+P LP 
Sbjct  137   WSGSVFRDHALELARILPGNAGKKDLSLLPRDLFQRMTLDTICSLGFGVRLGLLSPTLPH  196

Query  1188  NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIE  1009
             N FA A D  N IV+ RF DP WK+K+ L +G E  L +++ T+D+FTY++IRKR+  I+
Sbjct  197   NDFAAACDRCNAIVSFRFADPFWKLKRLLRIGEERDLPKNLATVDEFTYNIIRKRR--IQ  254

Query  1008  ETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIM  829
              +++NE  ++ D+LSRF+ L    + + +D  LRD+VLNFV+AGRDTTA TLS+ IYM+ 
Sbjct  255   LSKENE-DLRKDLLSRFMLL----DESSSDVYLRDMVLNFVMAGRDTTAATLSYFIYMVA  309

Query  828   THEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYY  649
             +H D   ++ SEL   E  R+  +    H    DDP S+      FA LL  + +AKL Y
Sbjct  310   SHPDCQGRVHSELLDFE--RSSRQ----HPGHDDDPSSIES----FASLLTLEALAKLPY  359

Query  648   LHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAAS  469
             LH+ V ETLRLYP +P + KG+  DDVLPDGTRV+ G +V+Y  Y MGRME  WGPDAA 
Sbjct  360   LHAAVNETLRLYPTLPLNFKGVASDDVLPDGTRVRRGEIVSYAAYCMGRMESLWGPDAAD  419

Query  468   FKPERW-LKDGVFQ--NASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE  298
             F+PERW   DG     N SPFKF AFQAGPR+CLGKDSAYLQ+K+  A+LCRFF+F+LV 
Sbjct  420   FRPERWRTADGSNWDFNPSPFKFIAFQAGPRVCLGKDSAYLQIKITAALLCRFFEFRLVP  479

Query  297   GHSVEYRMMTVLSMAHGLKLT  235
               +  YR+M  +S+A G+K+ 
Sbjct  480   NQTFHYRVMATISLASGIKVV  500



>sp|Q50EK3.1|C04C1_PINTA RecName: Full=Cytochrome P450 704C1; AltName: Full=Cytochrome 
P450 CYPD [Pinus taeda]
 gb|AAX07434.1| cytochrome P450 CYPD [Pinus taeda]
Length=518

 Score =   467 bits (1202),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 252/529 (48%), Positives = 338/529 (64%), Gaps = 25/529 (5%)
 Frame = -1

Query  1785  LKVSSMETLVLALGLIMFCWVFIH-RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG  1609
             + + +M   V AL L    W+  + R  ++KG  P   PV+G  +    N+ R+HD+   
Sbjct  3     VNILTMFVTVSALALACSLWIASYLRNWRKKGVYP---PVVGTMLNHAINFERLHDYHTD  59

Query  1608  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  1429
                   +  V  P  +Y +   P NVEH+LKTNF NY KG   +  M+ LLGDGIFN DG
Sbjct  60    QAQRYKTFRVVYPTCSYVFTTDPVNVEHILKTNFANYDKGTFNYDIMKDLLGDGIFNVDG  119

Query  1428  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  1249
             + WR+QRK AS EFASK L+DFS+ VF + + KL  IL QA+ LN  V+MQDL MR +LD
Sbjct  120   DKWRQQRKLASSEFASKVLKDFSSGVFCNNAAKLANILAQAAKLNLSVEMQDLFMRSSLD  179

Query  1248  SICKVGFGVEIGTL----APNLPENRFAKAFDAANIIVTLR-FIDPLWKIKKFLNVGSEA  1084
             SICKV FG++I +L    A + PE  FAKAFD AN +V  R  +   WK+++F NVGSEA
Sbjct  180   SICKVVFGIDINSLSSSKAESGPEASFAKAFDVANAMVFHRHMVGSFWKVQRFFNVGSEA  239

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELG-KDPENNINDKSLR  907
             IL  +I+ +DDF Y VI  R+ E+   +K  ++++ DILSR+I +  K+ +  ++DK LR
Sbjct  240   ILRDNIKMVDDFLYKVIHFRRQEMFSAEK--ENVRPDILSRYIIISDKETDGKVSDKYLR  297

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             D++LNF++A RDTTA  LSW IYM+  H+ V EKL  E+ S         +V   QYS++
Sbjct  298   DVILNFMVAARDTTAIALSWFIYMLCKHQHVQEKLLEEIIS-------STSVHEDQYSTE  350

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                  N  A  FA  L  + + K++YLH+ ++ETLRLYPA+P D K ++ +D LPDG +V
Sbjct  351   ----CNDIA-SFAQSLTDEALGKMHYLHASLSETLRLYPALPVDGKYVVNEDTLPDGFKV  405

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKD  367
             K G  V ++PY+MGRM Y WG DA  FKPERW++DG+F   SPFKF AFQAGPR CLGKD
Sbjct  406   KKGDSVNFLPYAMGRMSYLWGDDAKEFKPERWIQDGIFHPKSPFKFPAFQAGPRTCLGKD  465

Query  366   SAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAH-GLKLTVSPR  223
              AYLQMK+  A+L RFFKF+ V+   V YR M  L M   GL + V+PR
Sbjct  466   FAYLQMKIVAAVLVRFFKFEAVKTKEVRYRTMLTLHMNEDGLNVQVTPR  514



>ref|XP_002976944.1| hypothetical protein SELMODRAFT_151517 [Selaginella moellendorffii]
 gb|EFJ22054.1| hypothetical protein SELMODRAFT_151517 [Selaginella moellendorffii]
Length=537

 Score =   461 bits (1186),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 232/511 (45%), Positives = 318/511 (62%), Gaps = 37/511 (7%)
 Frame = -1

Query  1704  QRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIA-HPDNVE  1528
             +R   GP+ WP++G+  + + N+  +HDW + Y ++    +     T Y  +   P NVE
Sbjct  43    KRDHKGPKRWPLVGSYFQVVKNFPVLHDWFLSYFSSECRTIAVDWGTFYNILTVDPANVE  102

Query  1527  HVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVF  1348
             H+LKTNF NYPKG V H+     +GDGIFN+DGE+W++ RK AS EF+SK + ++S  VF
Sbjct  103   HILKTNFANYPKGRVSHARNYDFMGDGIFNSDGEMWKRHRKLASYEFSSKKVNEYSGQVF  162

Query  1347  RDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAF  1168
             R  ++++  +L   +      D QD+ MRMTLDSIC+V FGVE+ TL+P+LP   FA +F
Sbjct  163   RKAAVRMMEVLENIASKKTSFDFQDISMRMTLDSICEVAFGVELNTLSPSLPAVPFAASF  222

Query  1167  DAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEK  988
             D  N ++  R I P+WKI + LN+GSE  L   I+ +D FT+ VI  R+ EIE  +K+ K
Sbjct  223   DRVNELIVRRLIGPVWKILRALNLGSERELKNQIQVLDSFTFQVIENRRQEIEACEKSGK  282

Query  987   SM------------------KHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
                                 + D+LSRF+       +  +D+ LRD +LNF+IAGRDTTA
Sbjct  283   EYVSFFLPNKTFSYRFVFQERQDLLSRFMT-STGASDAYHDRELRDAILNFIIAGRDTTA  341

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
              TLSW IY I  +  VA+++  EL+        E N L                  FA L
Sbjct  342   ITLSWFIYCICNNPRVAKEIRLELD---RTFGSESNTLTFS--------------AFAQL  384

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L+ + +  L+YLH+ ++ETLRLYP VP+D K    DDVLPDGT+VK G  V YV YSMGR
Sbjct  385   LSTENLRTLHYLHACISETLRLYPPVPRDGKYAANDDVLPDGTKVKRGDSVAYVQYSMGR  444

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             ME+ WGPDA  FKPERW+K+  +Q  SPF +TAFQAGPRICLGKD+AYLQ K+  A+L R
Sbjct  445   MEFLWGPDALEFKPERWIKNSEYQPQSPFVYTAFQAGPRICLGKDAAYLQAKITAAMLMR  504

Query  321   FFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             FF F+LV+ H V YR++ VL+M +G+K+ VS
Sbjct  505   FFNFELVKDHVVHYRLLMVLAMVNGIKVNVS  535



>ref|XP_002980688.1| hypothetical protein SELMODRAFT_112911 [Selaginella moellendorffii]
 gb|EFJ18339.1| hypothetical protein SELMODRAFT_112911 [Selaginella moellendorffii]
Length=537

 Score =   457 bits (1176),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/511 (45%), Positives = 316/511 (62%), Gaps = 37/511 (7%)
 Frame = -1

Query  1704  QRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIA-HPDNVE  1528
             +R   GP+ WP++G+  + + N+  +HDW + Y ++    +     T Y  +   P NVE
Sbjct  43    KRNHKGPKRWPLVGSYFQVVKNFPVLHDWFLSYFSSECRTIAVDWGTFYNILTIDPANVE  102

Query  1527  HVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVF  1348
             H+LKTNF NYPKG V  +     +GDGIFN+DGE+W++ RK AS EF+SK + ++S  VF
Sbjct  103   HILKTNFANYPKGRVSRARNYDFMGDGIFNSDGEMWKRHRKLASYEFSSKKVNEYSGQVF  162

Query  1347  RDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAF  1168
             +  ++++  +L   +      D QD+ MRMTLDSIC+V FGVE+ TL+P+LP   FA +F
Sbjct  163   KKAAVRMMEVLENIASTKTSFDFQDISMRMTLDSICEVAFGVELNTLSPSLPAVPFAASF  222

Query  1167  DAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEK  988
             D  N ++  R I P+WKI + LN+GSE  L   I+ +D FT+ VI  R+ EIE  +K+ K
Sbjct  223   DRVNELIVRRLIGPVWKILRALNLGSERELKNQIQVLDSFTFQVIENRRREIEACEKSGK  282

Query  987   SM------------------KHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
                                 + D+LSRF+       +   D+ LRD +LNF+IAGRDTTA
Sbjct  283   EYVSFFLPNTTFSYSFVFQERQDLLSRFMT-STGASDAYQDRELRDAILNFIIAGRDTTA  341

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
              TLSW IY I  +  VA+++  EL+        E N L                  FA L
Sbjct  342   ITLSWFIYCICNNPRVAKEIRLELD---RTFGSESNTLTFS--------------AFAQL  384

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L+ + +  L+YLH+ ++ETLRLYP VP+D K    DDVLPDGT+VK G  V YV YSMGR
Sbjct  385   LSTENLRTLHYLHACISETLRLYPPVPRDGKYAANDDVLPDGTKVKRGDSVAYVQYSMGR  444

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             ME+ WGPDA  FKPERW+K+  +Q  SPF +TAFQAGPRICLGKD+AYLQ K+  A+L R
Sbjct  445   MEFLWGPDALEFKPERWIKNSEYQPQSPFVYTAFQAGPRICLGKDAAYLQAKITAAMLMR  504

Query  321   FFKFKLVEGHSVEYRMMTVLSMAHGLKLTVS  229
             FF F+LV+ H V YR++ VL+M +G+K+ VS
Sbjct  505   FFNFELVKDHVVHYRLLMVLAMVNGIKVNVS  535



>ref|XP_007052012.1| Cytochrome P450 family protein [Theobroma cacao]
 gb|EOX96169.1| Cytochrome P450 family protein [Theobroma cacao]
Length=508

 Score =   455 bits (1170),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 244/533 (46%), Positives = 336/533 (63%), Gaps = 36/533 (7%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMF-CWVFIHRLSQR-KGGGPRSWPVIGASVEQMTNYGRMHD  1621
             SNP   +++  L L L L +F    F  +L ++ K    +  PV G    Q+ N+ R+H 
Sbjct  4     SNP---ATLVALFLNLILTLFTVKFFAAKLREKQKKNKTKYHPVGGTVFSQLLNFKRLHH  60

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF +  Y + PDNVE++LKTN  NY KG+  +S ++ LLGDGIF
Sbjct  61    YMTDLAGKYRTYRLLSPFRSEVYTSEPDNVEYILKTNIQNYGKGDYNYSLLKGLLGDGIF  120

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG+ WR+QRK +S EF++K LRDFSTVVFR  + KL  I++ A+  N+ +D+QDL M+
Sbjct  121   AVDGDKWRQQRKVSSYEFSTKVLRDFSTVVFRKNAAKLANIVSDAAKSNKIMDIQDLFMK  180

Query  1260  MTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDSI KVGFGVE+ ++   NL    F  AFD ++  +  R++D  WKIK+FLN+GSEA
Sbjct  181   STLDSIFKVGFGVELDSVCGSNLEGKEFTAAFDDSSAAILFRYVDIFWKIKRFLNIGSEA  240

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM-KHDILSRFIELGKDPENNINDKSLR  907
              L +S + +D+F Y +I  +  ++  +  N+ SM K DILSRF++L     N+ +   +R
Sbjct  241   KLKKSTKVVDNFVYKLIHNKIEQMRNS--NDSSMKKEDILSRFLQL-----NDTDPTYMR  293

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSS  730
             DI+LNF+IAG+DTTATTLSW IYM+  H DV EK+  E+ E+ + M  K+          
Sbjct  294   DIILNFIIAGKDTTATTLSWFIYMLCKHPDVQEKVAQEVKEATDTMEVKD----------  343

Query  729   DDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTR  550
                        +FA +L+ + + K++YLH+ +TETLRLYPAVP DPK    DD LPDG  
Sbjct  344   ---------FAEFAAILSEEALGKMHYLHAALTETLRLYPAVPVDPKICFSDDTLPDGFS  394

Query  549   VKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLG  373
             V+ G MV Y PY+MGRM++ WG DA  F+PERWL +DG+FQ  SPFKFTAFQAGPRICLG
Sbjct  395   VRKGDMVCYQPYAMGRMKFIWGDDAEEFRPERWLDEDGMFQPESPFKFTAFQAGPRICLG  454

Query  372   KDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRTH  217
             K+ AY QMK+  A+L  +F FKL  E  SV YR M  L +  GL +   PR  
Sbjct  455   KEFAYRQMKIFSAVLVHYFVFKLSDENKSVTYRTMITLHVDGGLHVRAFPRCQ  507



>ref|XP_007052009.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 ref|XP_007052010.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 gb|EOX96166.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
 gb|EOX96167.1| Cytochrome P450 family protein isoform 1 [Theobroma cacao]
Length=508

 Score =   448 bits (1152),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 241/532 (45%), Positives = 335/532 (63%), Gaps = 34/532 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMF-CWVFIHRLSQR-KGGGPRSWPVIGASVEQMTNYGRMHD  1621
             SNP   +++  L L L L +F    F  +L ++ K    +  PV G    Q+ N+ R+H 
Sbjct  4     SNP---ATLVALFLNLILTLFTVKFFAAKLREKQKKNKTKYHPVGGTVFNQLLNFKRLHH  60

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF +  Y + PDNVE++ KTNF NY KGE  +S ++ LLGDGIF
Sbjct  61    YMTDLAGKYRTYRLLSPFRSEVYTSEPDNVEYIPKTNFQNYGKGEYNYSLLKGLLGDGIF  120

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG+ WR+QRK +S EF++K LRDFSTVVFR  + KL  I++ A+  N+ +D+QDL M+
Sbjct  121   AVDGDKWRQQRKVSSYEFSTKVLRDFSTVVFRKNAAKLANIVSDAAKSNKIMDIQDLFMK  180

Query  1260  MTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDSI KVGFGVE+ ++   NL    F  AFD ++  +  R++D  WKIK+FLN+GSEA
Sbjct  181   STLDSIFKVGFGVELDSVCGSNLEGKEFTAAFDDSSAAILFRYVDIFWKIKRFLNIGSEA  240

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM-KHDILSRFIELGKDPENNINDKSLR  907
              L +S +  D+F Y +I  +  ++  +  N+ SM K DILSRF++L     N+ +   +R
Sbjct  241   KLKKSTKVADNFVYKLIHNKIEQMRNS--NDSSMKKEDILSRFLQL-----NDTDPTYVR  293

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+LNF+IAG+DTTATTLSW IYM+  H DV EK+  E++   + +       +  +S  
Sbjct  294   DIILNFIIAGKDTTATTLSWFIYMLCKHPDVQEKVAQEVKKATDTKE------VKDFS--  345

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                       +FA +L+ + + K++YLH+ +TETLRLYP+VP D K  L DD LPDG  V
Sbjct  346   ----------EFAAILSEEALGKMHYLHAALTETLRLYPSVPVDAKICLSDDTLPDGFSV  395

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGK  370
             + G MV Y PY+MGRM++ WG DA  F+PERW+ +DG+FQ  SPFKFTAFQAGPRICLGK
Sbjct  396   RKGDMVCYQPYAMGRMKFIWGDDAEEFRPERWVGEDGMFQPESPFKFTAFQAGPRICLGK  455

Query  369   DSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRTH  217
             + AY QMK+  A+L  +F FKL  E  SV YR M  L +  GL +   PR  
Sbjct  456   EFAYRQMKIFSAVLVHYFVFKLSDENKSVTYRTMITLHVDGGLHVRAFPRCQ  507



>ref|XP_007052008.1| Cytochrome P450 family protein [Theobroma cacao]
 gb|EOX96165.1| Cytochrome P450 family protein [Theobroma cacao]
Length=514

 Score =   442 bits (1138),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 244/536 (46%), Positives = 334/536 (62%), Gaps = 38/536 (7%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIH---RLSQRKGGGPRSWPVIGASVEQMTNYGRMH  1624
             SNP+ + +   LVL+L L +F   F+    R  QRK    +  PV G    Q+ N+ R+H
Sbjct  6     SNPVPLVA---LVLSLILALFTVKFLTAKLRERQRKNKA-KYHPVGGTVFNQLLNFRRLH  61

Query  1623  DWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGI  1444
              ++        +  +  PF    Y + PDNVE++LKTNF NY KGE  +S ++ LLGDGI
Sbjct  62    HYMTDLAGKYRTYRLLSPFRNEIYTSEPDNVEYILKTNFHNYGKGEYNYSLLKGLLGDGI  121

Query  1443  FNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLM  1264
             F  DG+ WR+QRK +S EF++K LRDFS+VVFR+ + KL TI+++A+  N+ +D+QDL M
Sbjct  122   FTVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRENAAKLATIVSEAANSNEIMDIQDLFM  181

Query  1263  RMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSE  1087
             + TLDSI KV FGVE+ ++   NL   +F  AFD ++  +  R++D  WKIK+FLN+GSE
Sbjct  182   KSTLDSIFKVAFGVELDSMCGSNLEGKQFTAAFDDSSAAILFRYVDIFWKIKRFLNIGSE  241

Query  1086  AILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM----KHDILSRFIELGKDPENNIND  919
             A L +SI  +D+F Y +I   K E     K+E S+    K DILSRF+++     ++ + 
Sbjct  242   ATLKKSIEVVDNFVYKLIHN-KIEQMRNSKDESSIMQMKKEDILSRFLQV-----SDTDP  295

Query  918   KSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQ  739
               LRDI+LNF+IAG+DTTA TLSW IYM+  H DV EK+  E++                
Sbjct  296   TYLRDIILNFIIAGKDTTAATLSWFIYMLCKHPDVQEKVAQEVK----------------  339

Query  738   YSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPD  559
               + D + +   A +FA +L+ + + K++YLH+ +TETLRLYPAVP D K    DD LPD
Sbjct  340   -EATDTKDVKDYA-EFAAILSEEALGKMHYLHAAITETLRLYPAVPVDAKVCFSDDTLPD  397

Query  558   GTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRI  382
             G  V+ G MV Y PY+MGRM++ WG DA  FKPER L ++G+FQ  SPFKFTAFQAGPRI
Sbjct  398   GFSVRKGDMVCYQPYAMGRMQFIWGDDAEEFKPERCLDEEGMFQPESPFKFTAFQAGPRI  457

Query  381   CLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRTH  217
             CLGK+ AY QMK+  A+L   F FKL  E   V YR M  L +  GL +    R  
Sbjct  458   CLGKEFAYRQMKIFSAVLVYCFVFKLSDENKCVTYRTMINLHVDGGLHVRAFHRCQ  513



>ref|XP_006445219.1| hypothetical protein CICLE_v10019805mg [Citrus clementina]
 ref|XP_006490952.1| PREDICTED: cytochrome P450 704C1-like [Citrus sinensis]
 gb|ESR58459.1| hypothetical protein CICLE_v10019805mg [Citrus clementina]
Length=504

 Score =   441 bits (1133),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 241/522 (46%), Positives = 329/522 (63%), Gaps = 31/522 (6%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  1597
             S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9     SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
               +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68    HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
             +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128   EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  1236  VGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRT  1060
             V FGVE+ ++  +  E  RF+ AFD A+ +   R++D  WKIKKFLN+GSEA L Q I  
Sbjct  188   VAFGVELDSVCGSNEEGTRFSSAFDDASAMTLWRYVDIFWKIKKFLNIGSEARLKQRIEV  247

Query  1059  IDDFTYSVIRKRKAEIEETQKNEKSM-KHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
             ID F Y +IRK+  ++ + Q+   SM K DILSRF+++  DP      K LRDI+LNFVI
Sbjct  248   IDTFVYKIIRKKTDQMHDFQEEYTSMKKEDILSRFLQV-TDP------KYLRDIILNFVI  300

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AG+DTTA TLSW IYM+  H  V EK+  E++  E   AK+ +  L              
Sbjct  301   AGKDTTAATLSWFIYMLCKHPAVQEKIVQEVK--EATGAKDISDFL--------------  344

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               + AG ++ + + K++YLH+ +TETLRLYPAVP D K    DD LPDG  V+ G MV Y
Sbjct  345   --KVAGCISEEALEKMHYLHAAITETLRLYPAVPVDAKMCFSDDTLPDGFSVRKGDMVCY  402

Query  522   VPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
               Y+MGRM++ WG DA  FKPERWL ++G+FQ  SPFKFTAFQAGPRICLGK+ AY QMK
Sbjct  403   QAYAMGRMKFIWGDDAEEFKPERWLDENGIFQKESPFKFTAFQAGPRICLGKEFAYRQMK  462

Query  345   MALAILCRFFKFKLVE-GHSVEYRMMTVLSMAHGLKLTVSPR  223
             +  A+L   FKF+L     +V YR M  L +  GL + V  R
Sbjct  463   IYSAVLLSCFKFRLRNVSETVNYRTMINLHIDGGLHVRVFHR  504



>gb|KHF99845.1| Cytochrome P450 protein [Gossypium arboreum]
Length=524

 Score =   439 bits (1130),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 237/531 (45%), Positives = 331/531 (62%), Gaps = 32/531 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             S P  +  +  L   L + +  ++F+H    R     R  P+ G+ + Q+ ++  + D+ 
Sbjct  20    STPFVLLLLGALTSVLVIFVALFLFLHVPELRSKA--RRPPIAGSMLHQLLHFNTLSDYQ  77

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  + MP  +  Y   P NVE++LKTNFPNY +G  +   M  L GDGIF  
Sbjct  78    TSLAKKHRTYRLIMPLHSEIYTTDPANVEYILKTNFPNYGRG-AHIEIMRDLFGDGIFAV  136

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             DGE WR QRK AS EF+++ LR++S+ VFRD + KL   ++ A++ N+ +D+QDL M+  
Sbjct  137   DGEKWRHQRKLASYEFSTRVLREYSSAVFRDNATKLVAKVSTAAVANRAMDLQDLFMKSA  196

Query  1254  LDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KVGFGVE+  L+  +   NRF KAFD +N IV  R++D  WK+K+F N+G EA L
Sbjct  197   LDSIFKVGFGVELNALSGSDEFANRFTKAFDDSNFIVFRRYVDMFWKVKRFFNIGLEAAL  256

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM--KHDILSRFI-ELGKDPENNINDKSLR  907
              ++++ IDDF + +IR ++ ++E    NEK +  K DILSRF+ E  +DPEN +ND+ LR
Sbjct  257   KRNVKIIDDFIFDLIRCKREQME----NEKLVREKEDILSRFLMESKRDPEN-MNDRYLR  311

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+LNF+IAG+DT+A TL+W  YM+  H  V EK+  E+    +  AK+           
Sbjct  312   DIILNFMIAGKDTSAGTLTWFFYMLHKHPLVQEKVVHEIRDATQ--AKD-----------  358

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                  N  A + + L+  D + +++YLH+ +TETLRLYPAVP D K  +EDDVLPDG  V
Sbjct  359   -----NICAEELSRLMTDDVLDRMHYLHAAITETLRLYPAVPTDGKMSVEDDVLPDGVEV  413

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGK  370
             K G  + Y+ Y+MGRM Y WG DA  ++PERWL +DG+F+  SPFKFTAFQAGPRICLGK
Sbjct  414   KKGEGINYMAYAMGRMTYIWGEDAVEYRPERWLDEDGIFRPESPFKFTAFQAGPRICLGK  473

Query  369   DSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             + AY QMK+  A+L   FKF+LV E     YR M  L MA GL +   PRT
Sbjct  474   EFAYRQMKIMAAVLLYLFKFRLVDETKDATYRTMFTLHMADGLHVYAFPRT  524



>gb|KCW44361.1| hypothetical protein EUGRSUZ_L02168 [Eucalyptus grandis]
Length=512

 Score =   439 bits (1128),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 227/502 (45%), Positives = 317/502 (63%), Gaps = 26/502 (5%)
 Frame = -1

Query  1716  HRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPD  1537
             HR         +  PV G ++ Q+ N+GR+H ++        +  +  PF +  Y + P 
Sbjct  34    HRSRMAAAAAKKYHPVAGTALNQLLNFGRLHHYMTDLAGKHGTYRLLGPFWSEVYTSDPA  93

Query  1536  NVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFST  1357
             NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+
Sbjct  94    NVEYMLKTNFKNYGKGRYNYSLLKDLLGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSS  153

Query  1356  VVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RF  1180
             VVF+  + KL  IL++A+  NQ VDMQDL M+ TLDSI KV FGVE+ ++     E   F
Sbjct  154   VVFQRNAAKLANILSEAASTNQIVDMQDLFMKSTLDSIFKVAFGVELDSMCGTNEEGAEF  213

Query  1179  AKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQ  1000
             ++AFD A+ I   R++D  WKIKKFLN+GSEA L ++IR ID+F Y +I+++  ++  + 
Sbjct  214   SRAFDDASAITLRRYVDISWKIKKFLNIGSEAALKKNIRIIDNFVYKLIKRKIEQMHNST  273

Query  999   KNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHE  820
              +    K DILSRF+++        +   LRDI+LNF+IAG+DTTA TLSW IYM+  H 
Sbjct  274   DDPSMKKEDILSRFLQV-----TETDQTYLRDIILNFIIAGKDTTAATLSWFIYMLCKHP  328

Query  819   DVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHS  640
              + EK+  E++ +  ++       +  ++S            FA  +  + + K++YLH+
Sbjct  329   TIQEKVAREVKQMSNVKE------ISDFAS------------FAASMGEEALEKMHYLHA  370

Query  639   VVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKP  460
              +TETLRLYPAVP D K    DDV PDG  V+ G  V++ PY+MGRM++ WG DA  F+P
Sbjct  371   TITETLRLYPAVPVDIKICSSDDVFPDGFSVRKGDTVSFQPYAMGRMKFIWGDDAEDFRP  430

Query  459   ERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSV  286
             ERWL  +GVFQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L   F FKL  E   V
Sbjct  431   ERWLDSNGVFQPESPFKFTAFQAGPRICLGKEFAYWQMKIFSAVLLSCFTFKLADEEKPV  490

Query  285   EYRMMTVLSMAHGLKLTVSPRT  220
             +YR M  L +  GL ++V+ R 
Sbjct  491   DYRTMITLHIDGGLHVSVTRRC  512



>gb|KDO85879.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=504

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/522 (46%), Positives = 328/522 (63%), Gaps = 31/522 (6%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  1597
             S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9     SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
               +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68    HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
             +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128   EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  1236  VGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRT  1060
             V FGVE+ ++  +  E  RF+ AFD A+ +   R++D  WKIKK LN+GSEA L Q I  
Sbjct  188   VAFGVELDSVCGSNEEGTRFSSAFDDASAMTLWRYVDIFWKIKKLLNIGSEARLKQRIEV  247

Query  1059  IDDFTYSVIRKRKAEIEETQKNEKSM-KHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
             ID F Y +IRK+  ++ + Q+   SM K DILSRF+++  DP      K LRDI+LNFVI
Sbjct  248   IDTFVYKIIRKKTDQMHDFQEEYTSMKKEDILSRFLQV-TDP------KYLRDIILNFVI  300

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AG+DTTA TLSW IYM+  H  V EK+  E++  E   AK+ +  L              
Sbjct  301   AGKDTTAATLSWFIYMLCKHPAVQEKIVQEVK--EATGAKDISDFL--------------  344

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               + AG ++ + + K++YLH+ +TETLRLYPAVP D K    DD LPDG  V+ G MV Y
Sbjct  345   --KVAGCISEEALEKMHYLHAAITETLRLYPAVPVDAKMCFSDDTLPDGFSVRKGDMVCY  402

Query  522   VPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
               Y+MGRM++ WG DA  FKPERWL ++G+FQ  SPFKFTAFQAGPRICLGK+ AY QMK
Sbjct  403   QAYAMGRMKFIWGDDAEEFKPERWLDENGIFQKESPFKFTAFQAGPRICLGKEFAYRQMK  462

Query  345   MALAILCRFFKFKLVE-GHSVEYRMMTVLSMAHGLKLTVSPR  223
             +  A+L   FKF+L     +V YR M  L +  GL + V  R
Sbjct  463   IYSAVLLSCFKFRLRNVSETVNYRTMINLHIDGGLHVRVFHR  504



>ref|XP_011093193.1| PREDICTED: cytochrome P450 704C1-like [Sesamum indicum]
Length=504

 Score =   438 bits (1127),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 229/523 (44%), Positives = 331/523 (63%), Gaps = 37/523 (7%)
 Frame = -1

Query  1749  LGLIMFCWVF-------IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             + +I+ C +F       + R  Q+K G     P+ G    Q+ N+ R+HD++        
Sbjct  1     MAIIILCVIFSIISIQLLARKLQQKQGKKTYHPIGGTVFHQLVNFNRLHDYMTDLAGKHK  60

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR+Q
Sbjct  61    TYRLIGPFRSEVYTSDPANVEYMLKTNFENYGKGWYNYSILKDLLGDGIFTVDGEKWREQ  120

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RK +S EF+++ LRDFS+V+FRD  +KL  I+++A++ N+ +D+QDL M+ TLDSI +V 
Sbjct  121   RKVSSYEFSTRVLRDFSSVIFRDNVVKLTRIVSEAAISNEPMDIQDLFMKATLDSIFRVA  180

Query  1230  FGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             FGV++ T+  +  E  +F+ AFD A+ +   R++D LWKIK+   +GSEA L +++R ID
Sbjct  181   FGVDLDTMCGSNEEGAKFSNAFDDASALTLWRYVDILWKIKRTFGIGSEAKLKKTLRVID  240

Query  1053  DFTYSVIRKRKAEIEETQKNE--KSMKHDILSRFIELGK-DPENNINDKSLRDIVLNFVI  883
             +F Y +I  +  ++ E+  +   +  K DILSRF++  + DP      K LRDI+LNF+I
Sbjct  241   EFVYKLISSKSEKMHESPDDSTLQLKKEDILSRFLQFQETDP------KYLRDIILNFII  294

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AG+DTTATT+SW IYM+  H  V +K+  E++ V                +D  E ++  
Sbjct  295   AGKDTTATTISWFIYMLCKHPLVQDKVAKEIKDV----------------TDSKEVVS--  336

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               +FA  ++ + + K++YLH+ +TETLRLYPAVP D K  L DD +PDG  V  G MV Y
Sbjct  337   ISEFAASVSEENLEKMHYLHAALTETLRLYPAVPVDAKVCLSDDTMPDGYSVNKGDMVAY  396

Query  522   VPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
              PY+MGRM + WG DA  F+PERW+ ++G FQ  SP+KFTAFQAGPRICLGK+ AY QMK
Sbjct  397   QPYAMGRMRFIWGDDAEDFRPERWIDENGCFQQESPYKFTAFQAGPRICLGKEFAYRQMK  456

Query  345   MALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             +  A+L RFF FKL  EG +V+YR M  L +  GL +    R+
Sbjct  457   IFSAVLLRFFVFKLSHEGQTVKYRTMINLHIDGGLSVRAFHRS  499



>ref|XP_010041418.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=475

 Score =   437 bits (1124),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 225/488 (46%), Positives = 314/488 (64%), Gaps = 26/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G ++ Q+ N+GR+H ++        +  +  PF +  Y + P NVE++LKTNF NY 
Sbjct  11    PVAGTALNQLLNFGRLHHYMTDLAGKHGTYRLLGPFWSEVYTSDPANVEYMLKTNFKNYG  70

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+VVF+  + KL  IL
Sbjct  71    KGRYNYSLLKDLLGDGIFAVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFQRNAAKLANIL  130

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLR  1138
             ++A+  NQ VDMQDL M+ TLDSI KV FGVE+ ++     E   F++AFD A+ I   R
Sbjct  131   SEAASTNQIVDMQDLFMKSTLDSIFKVAFGVELDSMCGTNEEGAEFSRAFDDASAITLRR  190

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WKIKKFLN+GSEA L ++IR ID+F Y +I+++  ++  +  +    K DILSRF
Sbjct  191   YVDISWKIKKFLNIGSEAALKKNIRIIDNFVYKLIKRKIEQMHNSTDDPSMKKEDILSRF  250

Query  957   IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVE  778
             +++        +   LRDI+LNF+IAG+DTTA TLSW IYM+  H  + EK+  E++ + 
Sbjct  251   LQV-----TETDQTYLRDIILNFIIAGKDTTAATLSWFIYMLCKHPTIQEKVAREVKQMS  305

Query  777   EMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQ  598
              ++       +  ++S            FA  +  + + K++YLH+ +TETLRLYPAVP 
Sbjct  306   NVKE------ISDFAS------------FAASMGEEALEKMHYLHATITETLRLYPAVPV  347

Query  597   DPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNAS  421
             D K    DDV PDG  V+ G  V++ PY+MGRM++ WG DA  F+PERWL  +GVFQ  S
Sbjct  348   DIKICSSDDVFPDGFSVRKGDTVSFQPYAMGRMKFIWGDDAEDFRPERWLDSNGVFQPES  407

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY QMK+  A+L   F FKL  E   V+YR M  L +  GL
Sbjct  408   PFKFTAFQAGPRICLGKEFAYWQMKIFSAVLLSCFTFKLADEEKPVDYRTMITLHIDGGL  467

Query  243   KLTVSPRT  220
              ++V+ R 
Sbjct  468   HVSVTRRC  475



>ref|XP_010053880.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=513

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 229/488 (47%), Positives = 312/488 (64%), Gaps = 26/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G  + Q+ N+GR+H ++    A   +  +  PF +  Y + P NVE++LKTNF NY 
Sbjct  49    PVAGTVLNQLLNFGRLHHYMTDLAAKHRTYRLLRPFRSEVYTSDPANVEYMLKTNFENYG  108

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   +S ++ LLGDGIF  DG+ WR+QRK +S EF++K LRDFS+VVFR  + KL  IL
Sbjct  109   KGWYSYSLLKDLLGDGIFTVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRRTAAKLANIL  168

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLR  1138
             ++A+  NQ VDMQDL M+ TLDSI KV FGVE+ ++     E   F++AFD A+ I   R
Sbjct  169   SEAASTNQIVDMQDLFMKSTLDSIFKVAFGVELDSMCGTNEEGAEFSRAFDDASAITLWR  228

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WKIKKFLN+GSEA L ++IR I++F Y +I ++  ++  +  +    K DILSRF
Sbjct  229   YVDISWKIKKFLNIGSEAALMKNIRIINNFVYKLITRKIEQMHNSTDDPSMKKEDILSRF  288

Query  957   IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVE  778
             +++        +   LRDI+LN +IAG+DTTA TLSW IYM+  H  + EK+  E   V+
Sbjct  289   LQV-----TETDQTYLRDIILNLIIAGKDTTAATLSWFIYMLCKHPTIQEKVAQE---VK  340

Query  777   EMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQ  598
             +M   EE   +  +++            FA  +  + + K++YLH+ +TETLRLYPAVP 
Sbjct  341   QMSNVEE---ISDFAN------------FAASMGEEALEKMHYLHATITETLRLYPAVPF  385

Query  597   DPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNAS  421
             D K    DDV PDG  V+ G MV++ PY+MGRM++ WG DA  F PERWL  +GVFQ  S
Sbjct  386   DAKICFSDDVFPDGFNVRKGDMVSFQPYAMGRMKFIWGDDAEDFHPERWLDSNGVFQPES  445

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY QMK+  A+L   F FKL  E   V YR M  L +  GL
Sbjct  446   PFKFTAFQAGPRICLGKEFAYWQMKIFSAVLLSCFTFKLADEEKPVHYRTMITLHIDGGL  505

Query  243   KLTVSPRT  220
              ++V+ R 
Sbjct  506   HVSVTRRC  513



>gb|EAY95236.1| hypothetical protein OsI_17053 [Oryza sativa Indica Group]
Length=506

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 239/486 (49%), Positives = 309/486 (64%), Gaps = 26/486 (5%)
 Frame = -1

Query  1695  GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  1516
             G   R  PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVEH+LK
Sbjct  30    GKKRRYPPVAGTMFHQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILK  89

Query  1515  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  1336
             TNF NY KG + H  +E LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VFRD +
Sbjct  90    TNFANYGKGPMTHDVLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTA  149

Query  1335  LKLFTILTQ--ASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFD  1165
              +L  IL +  A+   ++VDMQDLLMR TLDS  +VGFGV +G L+ +  E   FA+AFD
Sbjct  150   AELAGILERGPAAKGRERVDMQDLLMRATLDSFFRVGFGVNLGVLSGSSKEGLVFARAFD  209

Query  1164  AANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKS  985
              A+  V  RF D LWK+K+FLN+ SEA + QSIRTI+DF YS+I  RK E    +++E +
Sbjct  210   DASEQVLFRFFDLLWKVKRFLNISSEATMKQSIRTINDFVYSII-DRKIEQMSREQHEFA  268

Query  984   MKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAE  808
              K DILSRF +E  KDP    ++K +RDI+LNFVIAGRDTTA TLSW +Y +  ++ V +
Sbjct  269   KKEDILSRFLLEREKDP-GCFDNKYIRDIILNFVIAGRDTTAGTLSWFLYAVCKNQRVQD  327

Query  807   KLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTE  628
             K+  E   V +    + +V +  +SS                L  D + K+ YLH+ +TE
Sbjct  328   KIARE---VRDATTGDRDVGVQDFSS---------------FLTEDAINKMQYLHAALTE  369

Query  627   TLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL  448
             TLRLYP VP D K    DD LPDG  VK G MV Y PY MGRM++ WG DA  FKPERWL
Sbjct  370   TLRLYPGVPLDVKYCFSDDTLPDGHAVKKGDMVNYQPYPMGRMKFLWGDDAEEFKPERWL  429

Query  447   KD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE-GHSVEYRM  274
              D G+F   SPFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF+F++ +   +V YR 
Sbjct  430   DDSGMFVAESPFKFTAFQAGPRICLGKEFAYRQMKIVSAVLLYFFRFEMWDVDATVGYRP  489

Query  273   MTVLSM  256
             M  L M
Sbjct  490   MLTLKM  495



>ref|XP_010054890.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW78248.1| hypothetical protein EUGRSUZ_D02437 [Eucalyptus grandis]
Length=515

 Score =   435 bits (1119),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 237/526 (45%), Positives = 323/526 (61%), Gaps = 35/526 (7%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSW------PVIGASVEQMTNYGRMHDWLV  1612
             +   LVLAL    F ++F     Q +     +       PV G  + Q+ N+GR+H ++ 
Sbjct  13    TASALVLALA---FAYLFAKTWKQHRSKPAAAATAKKYHPVAGTVLNQLLNFGRLHHYMT  69

Query  1611  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  1432
                A   +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  D
Sbjct  70    DLAAKHRTYRLLRPFRSEVYTSDPANVEYMLKTNFENYGKGWYNNSLLKDLLGDGIFAVD  129

Query  1431  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  1252
             G  WR+QRK +S EF+ K LRDFS+VVFR  + KL   L++A+  NQ VDMQDL M+ TL
Sbjct  130   GNKWRQQRKVSSYEFSRKVLRDFSSVVFRRTAAKLANTLSEAASTNQIVDMQDLFMKSTL  189

Query  1251  DSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILD  1075
             DSI KV FGVE+ ++     E   F++AFD A+ I   R++D  WKIKKFLN+GSEA L 
Sbjct  190   DSIFKVAFGVELDSMCGTNEEGAEFSRAFDDASAITLRRYVDISWKIKKFLNIGSEAALK  249

Query  1074  QSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVL  895
             ++IR +D+F Y +IR++  ++  +  +    K DILSRF+++        +   LRDI+L
Sbjct  250   KNIRIMDNFVYKLIRRKIEQMHNSTDDPSMKKEDILSRFLQV-----TETDQTYLRDIIL  304

Query  894   NFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPES  715
             NF+IAG+DTTA TLSW IYM+  H  + EK+  E   V++M   EE   +  +++     
Sbjct  305   NFIIAGKDTTAATLSWFIYMLCKHPTIQEKVAQE---VKQMSNVEE---ISDFAN-----  353

Query  714   LNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGG  535
                    FA  +  + + K++YLH+ +TETLRLYPAVP D K    DDV PDG  V+ G 
Sbjct  354   -------FAASMGEEALEKMHYLHATITETLRLYPAVPVDAKICFSDDVFPDGFNVRKGD  406

Query  534   MVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAY  358
             MV++ PY+MGRM++ WG DA  F PERWL  +GVFQ  SPFKFTAFQAGPRICLGK+ AY
Sbjct  407   MVSFQPYAMGRMKFIWGDDAEDFHPERWLDSNGVFQPESPFKFTAFQAGPRICLGKEFAY  466

Query  357   LQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
              QMK+   +L   F FKL  E   V YR M  L +  GL ++V+ R
Sbjct  467   RQMKIFSVVLLSCFTFKLADEKKPVNYRTMINLHIDGGLPVSVTRR  512



>ref|XP_010934568.1| PREDICTED: cytochrome P450 704C1-like [Elaeis guineensis]
Length=529

 Score =   436 bits (1120),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 235/513 (46%), Positives = 323/513 (63%), Gaps = 29/513 (6%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSV  1585
             TL+  +   +    FI   ++R     R  PV G+   Q+  +  +HD+     A   + 
Sbjct  26    TLIATVIACLCLHTFIKAATKR-----RHPPVTGSIFHQLYYFSTVHDYHTDLAARFKTF  80

Query  1584  VVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRK  1405
              +  P  +  Y   P  VE++L+TN+ NY KG   +  ++ L GDGIF  DGE WR QRK
Sbjct  81    RLFAPTHSLIYTVEPAVVEYILRTNYTNYGKGSYNYENLKDLFGDGIFAVDGEKWRHQRK  140

Query  1404  TASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFG  1225
              AS EF +KNLRDFS+ VFR  + +L  ++++A+  NQ +D+QDL MR TLDSI K+GFG
Sbjct  141   LASYEFTTKNLRDFSSDVFRSNAARLSLMISKAANSNQAMDIQDLFMRSTLDSIFKIGFG  200

Query  1224  VEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDF  1048
              E+ TL+    E N FAKAFD ++ ++  R+ID  WKIK+FL +GSEA L ++IR ID F
Sbjct  201   DELDTLSGLSEEGNSFAKAFDDSSDLILWRYIDIFWKIKRFLGIGSEAELKKNIRVIDGF  260

Query  1047  TYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRD  871
              Y +IR++   + E Q+N+   K+DILSRF +E  KDP+ N+NDK LRDI+LNF+IAGRD
Sbjct  261   AYKLIRRKTQSMSE-QQNDTIKKNDILSRFLVEKKKDPK-NLNDKYLRDIILNFIIAGRD  318

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTA TLSW  YM+  H  + EKL  E++   +              ++D  S+    ++F
Sbjct  319   TTAVTLSWFFYMLCKHPSLQEKLAREIKEATK--------------TNDSISI----VEF  360

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
                L  + + K+ YLH+ +TETLR+YPAVP+DPK    DD LP G  +K G MV ++PYS
Sbjct  361   TSRLTEEALNKMQYLHAALTETLRIYPAVPEDPKVCFSDDTLPGGFDIKKGDMVCFLPYS  420

Query  510   MGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             MGRM++ WG DA  F+PERWL ++GVFQ  +PFKFTAFQAGPRICLGK+ AY QMK+  A
Sbjct  421   MGRMKFLWGVDAEVFRPERWLDENGVFQPENPFKFTAFQAGPRICLGKEFAYRQMKIFAA  480

Query  333   ILCRFFKFKLVE-GHSVEYRMMTVLSMAHGLKL  238
             +L  FFKFKL +   +  Y+    L +  GL L
Sbjct  481   VLIHFFKFKLSDKSKNAHYKSTITLRINQGLHL  513



>ref|XP_010272641.1| PREDICTED: cytochrome P450 704C1-like [Nelumbo nucifera]
Length=519

 Score =   435 bits (1119),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 234/520 (45%), Positives = 314/520 (60%), Gaps = 20/520 (4%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  1594
             ++ +  L L  I FC + +     +    PR  PV G   +Q+  + R++D+        
Sbjct  9     TVASAALFLLFISFCALLLKIFMGKSVMDPRYAPVKGTIFDQLLYFNRLYDYQTQVARTH  68

Query  1593  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  1414
              +  +  P  +  Y   P N+E+VLKTNF  Y KG+     +  L+G GIF  DG+ WR+
Sbjct  69    QTFRLLAPSHSEIYTTDPRNIEYVLKTNFDKYSKGQYNQDIVTDLVGHGIFAVDGDRWRQ  128

Query  1413  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  1234
             QRK AS EF+++ LRDFS+ VFR  + KL  I+ + S+ NQ  D+QDLLMR TLDSI KV
Sbjct  129   QRKLASFEFSTRVLRDFSSAVFRRNAAKLSRIILEFSITNQTFDIQDLLMRCTLDSIFKV  188

Query  1233  GFGVEIGTLAP-NLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTI  1057
             GFG+++  L   +     F KAFD +N +V  R+ DPLWK+K+FLN+GSEA L ++I+ I
Sbjct  189   GFGMDLDCLGGLSKQGGSFIKAFDESNELVCWRYADPLWKVKRFLNMGSEAKLKKTIKII  248

Query  1056  DDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIA  880
             DD  Y +I+ ++ ++     +  + K DILSRFI E  KDP+  +ND+ LRDI+LNF+ A
Sbjct  249   DDLIYELIQSKRKQLSVKGDSITNEKEDILSRFIVESEKDPKT-MNDQYLRDIILNFMFA  307

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             G+DTTA TLSW +YM+  H  + EK+  E+         E N+     S+          
Sbjct  308   GKDTTANTLSWFLYMLCKHPFIQEKIAQEVTEAFNCETNETNIDEFVISN----------  357

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
                   L    M K++YLH+ +TETLRLYPAVP D K   EDDVLPDG RVK G  V Y+
Sbjct  358   ------LTDAAMEKMHYLHAALTETLRLYPAVPVDGKCSEEDDVLPDGFRVKKGDSVYYI  411

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
              Y+MGRM   WG DA  F+PERWLK+GVFQ  SPFKF AF AGPRICLGKD AY QMK+ 
Sbjct  412   AYAMGRMANLWGEDAEDFRPERWLKNGVFQPESPFKFVAFHAGPRICLGKDFAYRQMKIV  471

Query  339   LAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
               +L RFF+F+L  E  +V YR M  L +  GL+L    R
Sbjct  472   AMVLIRFFRFRLADENKAVTYRTMFTLHIHGGLQLGAISR  511



>gb|KDO85880.1| hypothetical protein CISIN_1g010681mg [Citrus sinensis]
Length=503

 Score =   434 bits (1117),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 240/522 (46%), Positives = 328/522 (63%), Gaps = 32/522 (6%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLAN  1597
             S + L +AL  I+   +    L+Q+ G   + +  IG +V  Q+ N+ R+H ++    A 
Sbjct  9     SFKALAIALA-ILVVQIVTKTLTQKSGNKQKKYHPIGGTVFNQLLNFNRLHHYMTDLAAK  67

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
               +  +  PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DGE WR
Sbjct  68    HGTYRLLGPFRSEVYSSDPANVEYMLKTNFDNYGKGSYNYSILKDLLGDGIFTVDGEKWR  127

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
             +QRK +S EF++K LRDFS+  FR  + KL  +L++A+  ++ +D+QDL M+ TLDSI K
Sbjct  128   EQRKISSHEFSTKVLRDFSSAAFRKNAAKLAQLLSEAANSDKILDIQDLFMKSTLDSIFK  187

Query  1236  VGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRT  1060
             V FGVE+ ++  +  E  RF+ AFD A+ +   R++D  WKIKK LN+GSEA L Q I  
Sbjct  188   VAFGVELDSVCGSNEEGTRFSSAFDDASAMTLWRYVDIFWKIKKLLNIGSEARLKQRIEV  247

Query  1059  IDDFTYSVIRKRKAEIEETQKNEKSM-KHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
             ID F Y +IRK+  ++ + Q+   SM K DILSRF+++  DP      K LRDI+LNFVI
Sbjct  248   IDTFVYKIIRKKTDQMHDFQEEYTSMKKEDILSRFLQV-TDP------KYLRDIILNFVI  300

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AG+DTTA TLSW IYM+  H  V EK+  E++  E   AK+ +  L              
Sbjct  301   AGKDTTAATLSWFIYMLCKHPAVQEKIVQEVK--EATGAKDISDFL--------------  344

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
               + AG ++ + + K++YLH+ +TETLRLYPAVP D K    DD LPDG  V+ G MV Y
Sbjct  345   --KVAGCISEEALEKMHYLHAAITETLRLYPAVP-DAKMCFSDDTLPDGFSVRKGDMVCY  401

Query  522   VPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
               Y+MGRM++ WG DA  FKPERWL ++G+FQ  SPFKFTAFQAGPRICLGK+ AY QMK
Sbjct  402   QAYAMGRMKFIWGDDAEEFKPERWLDENGIFQKESPFKFTAFQAGPRICLGKEFAYRQMK  461

Query  345   MALAILCRFFKFKLVE-GHSVEYRMMTVLSMAHGLKLTVSPR  223
             +  A+L   FKF+L     +V YR M  L +  GL + V  R
Sbjct  462   IYSAVLLSCFKFRLRNVSETVNYRTMINLHIDGGLHVRVFHR  503



>ref|XP_002320074.1| hypothetical protein POPTR_0014s06820g [Populus trichocarpa]
 gb|EEE98389.1| hypothetical protein POPTR_0014s06820g [Populus trichocarpa]
Length=508

 Score =   434 bits (1117),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 236/524 (45%), Positives = 319/524 (61%), Gaps = 32/524 (6%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  1621
             V SNPLK S+     L L L +F      R   +K    +  PV G    Q+ ++ R+H 
Sbjct  6     VLSNPLKFSA-----LVLILSIFIVQLFLRKLNKKQKKYKYHPVAGTVFTQLLHFNRVHH  60

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF +  Y   P NVE++LKTNF NY KG+  +  +  LLGDGIF
Sbjct  61    YMTNLAGKYKTYRLRAPFRSEIYTVDPVNVEYILKTNFENYGKGDHNYDNLSGLLGDGIF  120

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG  WR+QRK +S EF++K LRDFS+V+FR    KL  I+++A+  NQ +D+QDL M+
Sbjct  121   TVDGHKWRQQRKVSSYEFSTKVLRDFSSVIFRKNVAKLANIVSEAAKSNQSMDIQDLFMK  180

Query  1260  MTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDSI KVGFGVE+ ++  +  E  +F  AFD A+ +   R++D  WKIK+FLN+GSEA
Sbjct  181   STLDSIFKVGFGVELDSMCGSNEEGVKFTSAFDDASALTLWRYVDVFWKIKRFLNIGSEA  240

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKS-LR  907
              L ++++ ++DF Y +I K+   +  +++     K DILSRF+++ +      ND + LR
Sbjct  241   ALKKNVKVVNDFVYKLINKKIELMRNSKEVSSLKKDDILSRFLQVTE------NDPTYLR  294

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+LNFVIAG+DTTAT LSW IYM+  H  V  K+  E+   E  + KE           
Sbjct  295   DIILNFVIAGKDTTATALSWFIYMLCKHPAVQNKIAQEVR--EATKVKE-----------  341

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                  N    +FA  +N + + K+ YLH+ ++ETLRLYP+VP D K    DD LPDG  V
Sbjct  342   -----NTDFAEFAASINEEALEKMNYLHAAISETLRLYPSVPVDGKICFSDDTLPDGFNV  396

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKD  367
               G MV Y PY+MGRM++ WG DA  +KPERWLKDGVFQ  SPFKFTAFQAGPRICLGK+
Sbjct  397   SKGDMVAYQPYAMGRMKFIWGDDAEEYKPERWLKDGVFQQESPFKFTAFQAGPRICLGKE  456

Query  366   SAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKL  238
              AY QMK+  A+L   F FKL  E   V YR M  L +  GL +
Sbjct  457   FAYRQMKIFAAVLVASFTFKLADEKKPVNYRTMINLHVDGGLHV  500



>ref|XP_010056271.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72919.1| hypothetical protein EUGRSUZ_E01360 [Eucalyptus grandis]
Length=513

 Score =   434 bits (1116),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 232/509 (46%), Positives = 318/509 (62%), Gaps = 23/509 (5%)
 Frame = -1

Query  1740  IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  1561
             I F  + +   + +     +  PV G    Q+  + R++D+L G    S +  +  P  +
Sbjct  22    IAFALLLLKTFTGKSLRSSKYPPVRGTVFVQLVYFNRLYDYLTGVARRSPTFRLLAPHQS  81

Query  1560  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  1381
               Y   P NVEH+LKTNF  Y KG+     M+ L G+GIF  DGE W+KQRK AS EFA+
Sbjct  82    EMYTTDPRNVEHILKTNFDKYMKGKYDIDIMKDLFGEGIFVVDGEKWKKQRKVASFEFAT  141

Query  1380  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP  1201
             K LRDFS  VFR  + KL  ++ + S  ++  DMQD+LMR TLDSI KVGFGV++  L  
Sbjct  142   KVLRDFSCCVFRKNAAKLIKVVEELSAASEGFDMQDILMRCTLDSIFKVGFGVDLNCLEG  201

Query  1200  NLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKR  1024
             +  E R F KAFD AN +   R+IDP W++K+ L++GSEA L  +I+ ID+F + +I+ +
Sbjct  202   SSKEGRAFMKAFDEANELTYWRYIDPSWELKRLLSIGSEARLRNNIKLIDNFVHQLIKIK  261

Query  1023  KAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             + ++    + E++ K DILSRF+ E  KDP+N +N+K LRDI+LNF+IAG+DT+A+TLSW
Sbjct  262   RNQL--AVQREQNDKEDILSRFLLECEKDPKN-MNEKYLRDIILNFMIAGKDTSASTLSW  318

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
              +YM+  +  V +K+  E++ V   +A E N          P+   +R       +    
Sbjct  319   FLYMLCKNPLVQQKIVDEIKEVTGDQASEAN----------PDEFVER-------ITDPV  361

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + +++YLH+ +TETLRLYPAVP D +    DDVLPDG  VK G  + Y+ YSMGRM   W
Sbjct  362   LGRMHYLHATLTETLRLYPAVPLDGRCAETDDVLPDGFHVKKGDNINYLAYSMGRMHNIW  421

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G DA  FKPERWLKDG+FQN SPFKF AF AGPRICLGKD AY QMK+    L RFF+F+
Sbjct  422   GEDAEDFKPERWLKDGIFQNESPFKFVAFHAGPRICLGKDFAYRQMKIVSIALLRFFRFR  481

Query  306   LV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             L  E   V Y++M  L + +GL L   PR
Sbjct  482   LADETRPVTYKVMFTLHIDNGLPLHAVPR  510



>ref|NP_001053615.1| Os04g0573900 [Oryza sativa Japonica Group]
 emb|CAD41666.3| OSJNBa0019K04.13 [Oryza sativa Japonica Group]
 dbj|BAF15529.1| Os04g0573900 [Oryza sativa Japonica Group]
Length=506

 Score =   433 bits (1114),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 238/486 (49%), Positives = 309/486 (64%), Gaps = 26/486 (5%)
 Frame = -1

Query  1695  GGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLK  1516
             G   R  PV G    Q+ N+GR+ ++         +  +  P   Y Y   P NVEH+LK
Sbjct  30    GKKRRYPPVAGTMFHQLLNFGRLLEYHTELSRKYRTFRMLTPTCNYVYTVEPANVEHILK  89

Query  1515  TNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYS  1336
             TNF NY KG + H  +E LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VFRD +
Sbjct  90    TNFANYGKGPMTHDVLEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFRDTA  149

Query  1335  LKLFTILTQ--ASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFD  1165
              +L  IL +  A+   ++VDMQDLLMR TLDS  +VGFGV +G L+ +  E   FA+AFD
Sbjct  150   AELAGILERGPAAKGRERVDMQDLLMRATLDSFFRVGFGVNLGVLSGSSKEGLVFARAFD  209

Query  1164  AANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKS  985
              A+  V  RF D LWK+K+FLN+ SEA + QSIRTI+DF YS+I  RK E    +++E +
Sbjct  210   DASEQVLFRFFDLLWKVKRFLNISSEATMKQSIRTINDFVYSII-DRKIEQMSREQHEFA  268

Query  984   MKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAE  808
              K DILSRF +E  KDP    ++K +RDI+LNFVIAGRDTTA TLSW +Y +  ++ V +
Sbjct  269   KKEDILSRFLLEREKDP-GCFDNKYIRDIILNFVIAGRDTTAGTLSWFLYAVCKNQRVQD  327

Query  807   KLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTE  628
             K+  E   V +    + +V +  +SS                L  D + K+ YLH+ +TE
Sbjct  328   KIARE---VRDATTGDRDVGVQDFSS---------------FLTEDAINKMQYLHAALTE  369

Query  627   TLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL  448
             TLRLYP VP D K    DD LPDG  VK G MV Y PY MGRM++ WG +A  FKPERWL
Sbjct  370   TLRLYPGVPLDVKYCFSDDTLPDGHAVKKGDMVNYQPYPMGRMKFLWGDNAEEFKPERWL  429

Query  447   KD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH-SVEYRM  274
              D G+F   SPFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF+F++ +   +V YR 
Sbjct  430   DDSGMFVAESPFKFTAFQAGPRICLGKEFAYRQMKIVSAVLLYFFRFEMWDDDATVGYRP  489

Query  273   MTVLSM  256
             M  L M
Sbjct  490   MLTLKM  495



>gb|ABK94777.1| unknown [Populus trichocarpa]
Length=508

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 236/524 (45%), Positives = 318/524 (61%), Gaps = 32/524 (6%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  1621
             V SNPLK S+     L L L +F      R   +K    +  PV G    Q+ ++ R+H 
Sbjct  6     VLSNPLKFSA-----LVLILSIFIVQLFLRKLNKKQKKYKYHPVAGTVFTQLLHFNRVHH  60

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF +  Y   P NVE++LKTNF NY KG+  +  +  LLGDGIF
Sbjct  61    YMTNLAGKYKTYRLRAPFRSEIYTVDPVNVEYILKTNFENYGKGDHNYDNLSGLLGDGIF  120

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG  WR+QRK +S EF++K LRDFS+V+FR    KL  I+++A+  NQ +D+QDL M+
Sbjct  121   TVDGHKWRQQRKVSSYEFSTKVLRDFSSVIFRKNVAKLANIVSEAAKSNQSMDIQDLFMK  180

Query  1260  MTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDSI KVGFGVE+ ++   N    +F  AFD A+ +   R++D  WKIK+FLN+GSEA
Sbjct  181   STLDSIFKVGFGVELDSMCGSNEGGVKFTSAFDDASALTLWRYVDVFWKIKRFLNIGSEA  240

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKS-LR  907
              L ++++ ++DF Y +I K+   +  +++     K DILSRF+++ +      ND + LR
Sbjct  241   ALKKNVKVVNDFVYKLINKKIELMRNSKEVSSLKKDDILSRFLQVTE------NDPTYLR  294

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+LNFVIAG+DTTAT LSW IYM+  H  V  K+  E+   E  + KE           
Sbjct  295   DIILNFVIAGKDTTATALSWFIYMLCKHPAVQNKIAQEVR--EATKVKE-----------  341

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                  N    +FA  +N + + K+ YLH+ ++ETLRLYP+VP D K    DD LPDG  V
Sbjct  342   -----NTDFAEFAASINEEALEKMNYLHAAISETLRLYPSVPVDGKICFSDDTLPDGFNV  396

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKD  367
               G MV Y PY+MGRM++ WG DA  +KPERWLKDGVFQ  SPFKFTAFQAGPRICLGK+
Sbjct  397   SKGDMVAYQPYAMGRMKFIWGDDAEEYKPERWLKDGVFQQESPFKFTAFQAGPRICLGKE  456

Query  366   SAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKL  238
              AY QMK+  A+L   F FKL  E   V YR M  L +  GL +
Sbjct  457   FAYRQMKIFAAVLVASFTFKLADEKKPVNYRTMINLHVDGGLHV  500



>ref|XP_010056273.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72920.1| hypothetical protein EUGRSUZ_E01361 [Eucalyptus grandis]
Length=513

 Score =   432 bits (1112),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 231/509 (45%), Positives = 315/509 (62%), Gaps = 23/509 (5%)
 Frame = -1

Query  1740  IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  1561
             I F  + +   + +     +  PV G    Q+  + R++D+L G    S +  +  P  +
Sbjct  22    IAFALLLLKTFTGKSLRSSKYPPVRGTVFVQLVYFNRLYDYLTGVARRSPTFRLLAPHQS  81

Query  1560  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  1381
               Y   P NVEH+LKTNF  Y KG+     M+ L G GIF  DGE W+KQRK AS EFA+
Sbjct  82    EMYTTDPRNVEHILKTNFDKYTKGKYDIDIMKDLFGQGIFVVDGEKWKKQRKVASFEFAT  141

Query  1380  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP  1201
             K LRDFS  VFR  + KL  ++ + S  ++  DMQD+LMR TLDSI KVGFGV++  L  
Sbjct  142   KVLRDFSCCVFRKNAAKLIKVVEELSAASEGFDMQDILMRCTLDSIFKVGFGVDLNCLEG  201

Query  1200  NLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKR  1024
             +  E R F KAFD AN +   R+IDP W++K+ L++GSEA L  +I+ ID+F + +I+ +
Sbjct  202   SSKEGRAFMKAFDEANELTYWRYIDPSWELKRLLSIGSEARLRNNIKLIDNFVHQLIKIK  261

Query  1023  KAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             + ++    + E+  K DILSRF+ E  KDP+N +N+K LRDI+LNF+IAG+DT+A+TLSW
Sbjct  262   RNQL--AAQREQDDKEDILSRFLLECEKDPKN-MNEKYLRDIILNFMIAGKDTSASTLSW  318

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
              +YM+  +  V +K+  E++ V   +A E N          P+   +R       +    
Sbjct  319   FLYMLCKNPLVQQKIVDEIKEVTGDQASEAN----------PDEFVER-------ITDPV  361

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + +++YLH+ +TETLRLYPAVP D +    DDVLPDG  VK G  + Y+ YSMGRM   W
Sbjct  362   LGRMHYLHATLTETLRLYPAVPLDGRCAETDDVLPDGFHVKKGDNINYLAYSMGRMHNIW  421

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G DA  FKPERWLKDG+FQN  PFKF AF AGPRICLGKD AY QMK+    L RFF+F+
Sbjct  422   GEDAEDFKPERWLKDGIFQNEPPFKFVAFHAGPRICLGKDFAYRQMKIVSIALLRFFRFR  481

Query  306   LV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             L  E   V Y++M  L + +GL L   PR
Sbjct  482   LADETRPVTYKVMFTLHIDNGLPLHAVPR  510



>ref|XP_002270428.2| PREDICTED: cytochrome P450 704C1-like isoform X6 [Vitis vinifera]
 ref|XP_010662359.1| PREDICTED: cytochrome P450 704C1-like isoform X6 [Vitis vinifera]
Length=474

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  8     PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  67

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  68    KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  127

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  128   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  187

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  188   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  245

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  246   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKV--VLEVR  302

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  303   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  346

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  347   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  406

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  407   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  466

Query  243   KLTVSPR  223
              L   PR
Sbjct  467   HLYAFPR  473



>ref|XP_010662358.1| PREDICTED: cytochrome P450 704C1-like isoform X5 [Vitis vinifera]
Length=496

 Score =   431 bits (1109),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  30    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  89

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  90    KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  149

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  150   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  209

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  210   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  267

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  268   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKV--VLEVR  324

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  325   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  368

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  369   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  428

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  429   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  488

Query  243   KLTVSPR  223
              L   PR
Sbjct  489   HLYAFPR  495



>ref|XP_007134454.1| hypothetical protein PHAVU_010G048700g [Phaseolus vulgaris]
 gb|ESW06448.1| hypothetical protein PHAVU_010G048700g [Phaseolus vulgaris]
Length=509

 Score =   432 bits (1110),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 227/510 (45%), Positives = 309/510 (61%), Gaps = 21/510 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
              ++FC++ +  +  +  G P   PV G    Q+  +  +HD+         +  +  P  
Sbjct  19    FLVFCFLTLTMILGKSIGDPDYAPVKGTVFNQLFYFNTLHDYHAEVAKTHPTFRLLAPDQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y   P N+EH+LKTNF  Y KG+     M  L G+GIF  D E WR+QRK AS EF+
Sbjct  79    SELYTVDPRNIEHILKTNFDKYSKGKYNQDIMTDLFGEGIFVVDDEKWRQQRKLASYEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  + KL  I+++ S  +Q  DMQD+LMR TLDSI KVGFG E+  L 
Sbjct  139   TRVLRDFSCSVFRRNAAKLVRIISEFSHQDQVFDMQDMLMRCTLDSIFKVGFGAELNCLE  198

Query  1203  PNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E + F KAFD +N ++  R++DPLWK+K+F N+G EA L ++I+ IDDF + VI  
Sbjct  199   GSSKEGSEFMKAFDESNALIYWRYVDPLWKLKRFFNIGCEATLKRNIKIIDDFVHGVINT  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             RKA++E  Q  E ++K DILSRF+   K  +  + D+ LRDI+LNF+IAG+DT+A TLSW
Sbjct  259   RKAQLEIHQ--ESNVKEDILSRFLIESKKDKETMTDQYLRDIILNFMIAGKDTSANTLSW  316

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               YM+  +  V EK+  E+  V      EE++                   F   +  DT
Sbjct  317   FFYMLCKNPLVEEKIVQEVRDVTCSHESEESI-----------------DTFVANITDDT  359

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + K++YLH+ +TETLRLYPAVP D +     DVLPDG ++K G  V Y+ Y MGRM   W
Sbjct  360   LEKMHYLHAALTETLRLYPAVPADGRTAEAPDVLPDGHKLKRGDGVFYLAYGMGRMCSIW  419

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G DA  F+PERWL +GVFQ+ SPFKF AF AGPRICLGKD AY QMK+    L  FFKFK
Sbjct  420   GEDAEEFRPERWLNNGVFQSQSPFKFIAFHAGPRICLGKDFAYRQMKIVAMTLLHFFKFK  479

Query  306   LV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             L  +  +V Y++M  L +  GL L+  PR+
Sbjct  480   LANKTQNVTYKVMFTLHIDKGLPLSAIPRS  509



>ref|XP_010662357.1| PREDICTED: cytochrome P450 704C1-like isoform X4 [Vitis vinifera]
Length=497

 Score =   431 bits (1108),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  31    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  90

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  91    KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  150

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  151   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  210

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  211   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  268

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  269   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKV--VLEVR  325

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  326   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  369

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  370   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  429

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  430   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  489

Query  243   KLTVSPR  223
              L   PR
Sbjct  490   HLYAFPR  496



>ref|XP_006857967.1| hypothetical protein AMTR_s00069p00176780 [Amborella trichopoda]
 gb|ERN19434.1| hypothetical protein AMTR_s00069p00176780 [Amborella trichopoda]
Length=510

 Score =   431 bits (1109),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 226/520 (43%), Positives = 325/520 (63%), Gaps = 20/520 (4%)
 Frame = -1

Query  1791  NPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLV  1612
              P++ S +  L+ ++ + +F  V + R   R G  P   PV+G  V Q+ N+  +H + +
Sbjct  2     TPVEASIL--LIASVIITVFICVILERRVWRYGAYP---PVVGTVVHQLINFSTLHHFHL  56

Query  1611  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  1432
             G+     +  +  P     Y  +P N++H+LKTNF NY KG+  H  ++ L GDGIF  D
Sbjct  57    GHAQKHTTYRLLSPARGELYTVNPANLQHILKTNFANYGKGKYQHEVLKDLFGDGIFAVD  116

Query  1431  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  1252
             GE W+ QRK AS EF++K LR+FS  VF   ++KL   +++A+  +  +D+QDLLM+ T+
Sbjct  117   GERWKTQRKLASYEFSTKVLREFSCKVFCKNAVKLAGKISEAAKSHLIMDIQDLLMKATM  176

Query  1251  DSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQ  1072
             DS+ KVGFG+E+ TL     EN+FAKAF   +  +  RF +PLWK+++FL++G EA+L +
Sbjct  177   DSLFKVGFGLELNTLLGCEEENKFAKAFGELSAQLLRRFTNPLWKLERFLSLGPEAMLRK  236

Query  1071  SIRTIDDFTYSVIRKRKAEI-EETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVL  895
             +I+ IDDF Y +I++++ ++ +E    EK  K DILSRF+   +     ++DK LRDI+L
Sbjct  237   NIKFIDDFVYKIIQQKREQVSKEHDSLEKHRKEDILSRFLVESEKYHEKMSDKYLRDIIL  296

Query  894   NFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPES  715
             NF+IAGRDTTA TLSW  Y++  H  + EK+  E+   E +  K E          + E 
Sbjct  297   NFLIAGRDTTAGTLSWFFYLLCKHPHIQEKIAQEVR--ESVCTKNEG---------NVEG  345

Query  714   LNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGG  535
             +      FA  L    + +L +LH+ + ETLRLYPAVP + K    DDVLPDG++V+ G 
Sbjct  346   VTMSG--FADALTEGALGRLQFLHAALAETLRLYPAVPVNAKVAFGDDVLPDGSKVRKGD  403

Query  534   MVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYL  355
             MV Y+ Y+MGRM   WG DA  F+PERW+++GVFQ  +PF+F AFQ GPRICLGKD AYL
Sbjct  404   MVNYLSYAMGRMTSIWGDDAYHFRPERWIQNGVFQPKTPFEFPAFQGGPRICLGKDFAYL  463

Query  354   QMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKL  238
             QMK+  A+L RFFKFKL  E     Y  M  L + HGL +
Sbjct  464   QMKVMAAVLIRFFKFKLRDEEQEAHYHTMLTLHIDHGLHV  503



>ref|XP_009389623.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. 
malaccensis]
Length=521

 Score =   432 bits (1110),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 240/507 (47%), Positives = 312/507 (62%), Gaps = 30/507 (6%)
 Frame = -1

Query  1731  CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  1552
             C   +HR   RK   P   PV G    Q+ N  ++ D+         +  +  PF  Y Y
Sbjct  34    CSSSVHR---RKPNYP---PVAGTVFHQLLNLRQLADFQTDLSRKYRTFRILTPFCNYVY  87

Query  1551  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  1372
                P NVEH+LKTNF NY KG   +  M    GDGIF  D E WR QRK AS EF++K L
Sbjct  88    TVDPANVEHILKTNFANYGKGSFTYDLMCDFFGDGIFAVDDEKWRHQRKLASFEFSTKVL  147

Query  1371  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP  1192
             RD S+VVFR  + +L  I++ A+  N+ +++QDLLM+ TLDSICKVGFGVE+ TL  +  
Sbjct  148   RDSSSVVFRSTAARLAKIISNAARSNEMIEIQDLLMKSTLDSICKVGFGVELDTLTGSTE  207

Query  1191  ENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAE  1015
             E R FAKAFD A+  + LRF+D  WK+K+FLN+GSEA + +++++IDDF Y +I  +  +
Sbjct  208   EGRTFAKAFDDASAQIMLRFLDVFWKVKRFLNIGSEAKMKKNLKSIDDFVYKLIDTKIEQ  267

Query  1014  IEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIY  838
             + + Q      K DILSRF IE  K+P ++++ K LRDI+LNFVIAGRDTTA TLSW  Y
Sbjct  268   LSQRQTGFME-KEDILSRFLIEREKNP-DDMSYKYLRDIILNFVIAGRDTTAGTLSWFFY  325

Query  837   MIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAK  658
             M+  H  V EK+  E+    +++ +   V + ++ +   E          G LN     +
Sbjct  326   MLCKHPSVQEKVAQEVREATKIKGE---VTIDEFVASLTE----------GALN-----E  367

Query  657   LYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPD  478
             + YLH+ +TETLRLYPAVP D K    DD LPDG  VK G +V Y PY MGRM++ WG D
Sbjct  368   MQYLHASLTETLRLYPAVPLDVKHCFSDDTLPDGFDVKKGDLVNYQPYPMGRMQFLWGED  427

Query  477   AASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKL-  304
             A  F+PERWL  DGVF   SPFKF AFQAGPRICLGK+ AY QMK+  A L  FFKFK+ 
Sbjct  428   AEDFRPERWLNSDGVFVPESPFKFPAFQAGPRICLGKEFAYRQMKILAATLLCFFKFKMW  487

Query  303   VEGHSVEYRMMTVLSMAHGLKLTVSPR  223
              E ++V YR M  L +  GL L    R
Sbjct  488   EEMNTVRYRTMITLQIYGGLHLAARHR  514



>ref|XP_010662355.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Vitis vinifera]
Length=513

 Score =   431 bits (1109),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  47    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  106

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  107   KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  166

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  167   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  226

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  227   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  284

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  285   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKVV--LEVR  341

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  342   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  385

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  386   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  445

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  446   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  505

Query  243   KLTVSPR  223
              L   PR
Sbjct  506   HLYAFPR  512



>ref|XP_010662356.1| PREDICTED: cytochrome P450 704C1-like isoform X3 [Vitis vinifera]
Length=502

 Score =   431 bits (1108),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  36    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  95

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  96    KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  155

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  156   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  215

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  216   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  273

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  274   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKVV--LEVR  330

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  331   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  374

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  375   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  434

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  435   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  494

Query  243   KLTVSPR  223
              L   PR
Sbjct  495   HLYAFPR  501



>ref|XP_006576393.1| PREDICTED: cytochrome P450 704C1-like [Glycine max]
Length=511

 Score =   431 bits (1108),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 222/510 (44%), Positives = 312/510 (61%), Gaps = 19/510 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
              ++FC++ +  +  +  G P   PV G    Q+  +  +HD+       + +  +  P  
Sbjct  19    FLVFCFIMLTIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYHAQVAKTNPTFRLLAPDQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y A P N+EH+LKTNF  Y KG+     +  L G+GIF  DG+ WR+QRK AS EF+
Sbjct  79    SELYTADPRNIEHILKTNFDKYSKGKYNQDIVTDLFGEGIFAVDGDKWRQQRKLASFEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  + KL  ++++ S   Q  DMQD+LMR TLDSI KVGFG E+  L 
Sbjct  139   TRVLRDFSCSVFRRNAAKLVRVISEFSHQGQVFDMQDILMRCTLDSIFKVGFGTELNCLD  198

Query  1203  PNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E + F KAFD +N ++  R++DP WK+K+FLN+G EA L ++++ IDDF + VI+ 
Sbjct  199   GSSKEGSEFMKAFDESNALIYWRYVDPFWKLKRFLNIGCEATLKRNVKIIDDFVHGVIKT  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             RKA++   Q  E ++K DILSRF+   K  +  + D+ LRDI+LNF+IAG+DT+A TLSW
Sbjct  259   RKAQLALQQ--EYNVKEDILSRFLIESKKDQKTMTDQYLRDIILNFMIAGKDTSANTLSW  316

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               YM+  +  + EK+  E+  V    + E        S  + E       +F   +  DT
Sbjct  317   FFYMLCKNPLIEEKIVQEVRDVSCSCSHE--------SEPNIE-------EFVAKITDDT  361

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + +++YLH+ +TETLRLYPAVP D +     D+LPDG ++K G  V Y+ Y MGRM   W
Sbjct  362   LDRMHYLHAALTETLRLYPAVPADGRTAEAHDILPDGHKLKKGDGVYYLAYGMGRMCSIW  421

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G DA  F+PERWL +G+FQ  SPFKF AF AGPRICLGKD AY QMK+    L RFF+FK
Sbjct  422   GEDAEEFRPERWLNNGIFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVAMALVRFFRFK  481

Query  306   LVEG-HSVEYRMMTVLSMAHGLKLTVSPRT  220
             L  G  +V Y++M  L +  GL L   PR+
Sbjct  482   LANGTQNVTYKVMFTLHIDKGLLLCAIPRS  511



>gb|AAZ39646.1| cytochrome P450 monooxygenase [Petunia x hybrida]
Length=499

 Score =   430 bits (1106),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 236/525 (45%), Positives = 331/525 (63%), Gaps = 35/525 (7%)
 Frame = -1

Query  1770  METLVLALGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLA  1600
             M T +L+L   +FC   IH ++++   + G  R  P+ G    Q+ N+ R+HD++     
Sbjct  1     MTTTILSL---LFCGFIIHLVTRKLLGRYGKKRYHPIGGTMFNQLLNFHRLHDYMTDLAG  57

Query  1599  NSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELW  1420
                +  +  PF    Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ W
Sbjct  58    KHKTYRLISPFRNEIYSSDPANVEYILKTNFDNYGKGWYSYSILKELLGDGIFTVDGDKW  117

Query  1419  RKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSIC  1240
             R+QRK +S EF+++ LRDFS+VVFR    KL  IL++A+  N+ VD+QDL M+ TLDSI 
Sbjct  118   REQRKLSSHEFSTRVLRDFSSVVFRKNVAKLAHILSEAANSNKIVDIQDLFMKATLDSIF  177

Query  1239  KVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIR  1063
             +V FGVE+ ++  +  E + F+ AFD A+ +   R++D  WKIKK LN+GSEA L  +IR
Sbjct  178   RVAFGVELDSMCGSNEEGKNFSNAFDNASALTLWRYVDMFWKIKKALNIGSEAKLRDNIR  237

Query  1062  TIDDFTYSVIRKRKAEIE--ETQKNEKSMKHDILSRFIEL-GKDPENNINDKSLRDIVLN  892
             T+D F Y +I ++  ++   E   + +  K DILSRF+++ G DP      K LRDI+LN
Sbjct  238   TVDAFVYKLIHRKTEQMSKPEADLSLQWKKEDILSRFLQVTGTDP------KYLRDIILN  291

Query  891   FVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESL  712
             F+IAG+DTTATTLSW IY++  +  V EK+  E+         +E  +  + ++D  E  
Sbjct  292   FIIAGKDTTATTLSWFIYVLCKYPHVQEKIAQEI---------KEAAIEIEDATDITE--  340

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
                   FA  ++ D + K+ YLH+ +TETLRLYPAVP D K  L DD LPDG  V  G M
Sbjct  341   ------FAANVSEDALEKMQYLHAALTETLRLYPAVPVDAKICLSDDTLPDGFSVNKGDM  394

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYL  355
             V+Y PY+MGRM++ WG DA  +KPERWL  DG F+  +PFKFTAFQAGPRICLGK+ AY 
Sbjct  395   VSYQPYAMGRMKFIWGDDAEEYKPERWLDGDGFFRQENPFKFTAFQAGPRICLGKEFAYR  454

Query  354   QMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             QMK+  A+L R+F F+L +   +V YR M  L +  GL + +  R
Sbjct  455   QMKIFSAVLLRYFGFRLSDDKKNVNYRTMINLHIDGGLHIRIFHR  499



>emb|CBI24485.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   430 bits (1106),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  8     PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  67

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  68    KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  127

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  128   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  187

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  188   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  245

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  246   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKV--VLEVR  302

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  303   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  346

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  347   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  406

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  407   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  466

Query  243   KLTVSPR  223
              L   PR
Sbjct  467   HLYAFPR  473



>ref|XP_010662354.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Vitis vinifera]
Length=527

 Score =   431 bits (1108),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 230/487 (47%), Positives = 314/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ ++ ++ D+         +  + +P  +  Y A P NVE++LKTNF NY 
Sbjct  61    PVAGPVFSQLIHFSKLFDYQASLAQKYITYRMILPSHSEIYTADPVNVEYILKTNFINYG  120

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE +   M+ L GDGIF  DGE WR QRK AS EF++K LRDFST VF+D + KL   +
Sbjct  121   KGEYHCDIMKDLFGDGIFAVDGEKWRHQRKLASYEFSTKVLRDFSTSVFQDNAAKLVLKV  180

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
             +  +   Q +D+QD+LM+ TLDSI KVGFGV++ +L+  ++  N+F KAFD +N+IV  R
Sbjct  181   SMVAAAKQMMDLQDMLMKSTLDSIFKVGFGVDLNSLSGSDVFGNQFIKAFDDSNVIVYWR  240

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D LW+IK+FLN+G EA L  +I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  241   YVDLLWRIKRFLNLGLEAALKHNIKVIDSFIFELIRCKREQMKNKELDRG--KEDILSRF  298

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+  +ND+ LRDI+L+FVIAG+DT+A TL+W  Y++  H  V EK+   LE  
Sbjct  299   LLESKKDPKK-MNDRYLRDIILSFVIAGKDTSADTLTWFFYLLCKHPLVQEKVV--LEVR  355

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E  +A+                +N  A +FA  +   ++ K+ YLH+ +TETLRLYPAVP
Sbjct  356   EATKAQ----------------INIPADEFAKKITEKSLDKMQYLHAALTETLRLYPAVP  399

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  + Y+ Y+MGRM   WG DA  F+PERWL++GVFQ  S
Sbjct  400   MDGKHSEEDDILPDGFKVKKGDGMCYMAYAMGRMRCIWGEDAGEFRPERWLENGVFQPES  459

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY Q+K+  A+L  FFKFKLV E     YR M  L M  GL
Sbjct  460   PFKFTAFQAGPRICLGKEFAYRQLKILAAVLVYFFKFKLVDERKEARYRTMFTLHMDQGL  519

Query  243   KLTVSPR  223
              L   PR
Sbjct  520   HLYAFPR  526



>ref|XP_003521549.1| PREDICTED: cytochrome P450 704C1-like isoform 1 [Glycine max]
Length=511

 Score =   430 bits (1106),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 223/510 (44%), Positives = 311/510 (61%), Gaps = 19/510 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
              ++FC++ +  +  +  G P   PV G    Q+  +  +HD+       + +  +  P  
Sbjct  19    FLVFCFIMLTIIIGKSIGDPDYAPVKGTVFNQLLYFNTLHDYQAQLAKTNPTFRLLAPDQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y A P NVEH+LKTNF  Y KG+     M  L G+GIF  DG+ WR+QRK AS EF+
Sbjct  79    SELYTADPRNVEHILKTNFDKYSKGKYNQDIMTDLFGEGIFAVDGDKWRQQRKLASFEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  + KL  ++++ S   Q  DMQD+LMR TLDSI KVGFG E+  L 
Sbjct  139   TRVLRDFSCSVFRRNAAKLVRVISEFSHQGQVFDMQDILMRCTLDSIFKVGFGTELNCLD  198

Query  1203  PNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E + F KAFD +N ++  R++DP WK+K+FLN+G EA L ++++ IDDF + VI+ 
Sbjct  199   GSSKEGSEFMKAFDESNALIYWRYVDPFWKLKRFLNIGCEATLKRNVKIIDDFVHGVIKT  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             RKA++   Q  E ++K DILSRF+   K  +  + D+ LRDI+LNF+IAG+DT+A TLSW
Sbjct  259   RKAQLALQQ--EYNVKEDILSRFLIESKKDQKTMTDQYLRDIILNFMIAGKDTSANTLSW  316

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               YM+  +  + EK+  E+  V    + E        S  + E       +F   +  DT
Sbjct  317   FFYMLCKNPLIEEKIVQEVRDVTCSCSHE--------SEPNIE-------EFVAKITDDT  361

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + +++YLH+ +TETLRLYPAVP D +     D+LPDG ++K G  V Y+ Y MGRM   W
Sbjct  362   LDRMHYLHAALTETLRLYPAVPADGRSAEAHDILPDGHKLKKGDGVYYLAYGMGRMCSIW  421

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G DA  F+PERWL +G+FQ  SPFKF AF AGPRICLGKD AY QMK+    L RFF+FK
Sbjct  422   GEDAEEFRPERWLNNGIFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVAMALVRFFRFK  481

Query  306   LV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             L     +V Y++M  L +  GL L   PR+
Sbjct  482   LSNRTQNVTYKVMFTLHIDKGLLLCAIPRS  511



>gb|KHN04083.1| Cytochrome P450 704C1 [Glycine soja]
Length=486

 Score =   428 bits (1100),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 220/493 (45%), Positives = 301/493 (61%), Gaps = 19/493 (4%)
 Frame = -1

Query  1692  GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKT  1513
             G P   PV G    Q+  +  +HD+       + +  +  P  +  Y A P NVEH+LKT
Sbjct  11    GDPDYAPVKGTVFNQLLYFNTLHDYQAQLAKTNPTFRLLAPDQSELYTADPRNVEHILKT  70

Query  1512  NFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSL  1333
             NF  Y KG+     M  L G+GIF  DG+ WR+QRK AS EF+++ LRDFS  VFR  + 
Sbjct  71    NFDKYSKGKYNQDIMTDLFGEGIFAVDGDKWRQQRKLASFEFSTRVLRDFSCSVFRRNAA  130

Query  1332  KLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAAN  1156
             KL  ++++ S   Q  DMQD+LMR TLDSI KVGFG E+  L  +  E + F KAFD +N
Sbjct  131   KLVRVISEFSHQGQVFDMQDILMRCTLDSIFKVGFGTELNCLDGSSKEGSEFMKAFDESN  190

Query  1155  IIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH  976
              ++  R++DP WK+K+FLN+G EA L ++++ IDDF + VI+ RKA++   Q  E ++K 
Sbjct  191   ALIYWRYVDPFWKLKRFLNIGCEATLKRNVKIIDDFVHGVIKTRKAQLALQQ--EYNVKE  248

Query  975   DILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWS  796
             DILSRF+   K  +  + D+ LRDI+LNF+IAG+DT+A TLSW  YM+  +  + EK+  
Sbjct  249   DILSRFLIESKKDQKTMTDQYLRDIILNFMIAGKDTSANTLSWFFYMLCKNPLIEEKIVQ  308

Query  795   ELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRL  616
             E+  V    + E    + +               F   +  DT+ +++YLH+ +TETLRL
Sbjct  309   EVRDVTCSCSHESEPNIEE---------------FVAKITDDTLDRMHYLHAALTETLRL  353

Query  615   YPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGV  436
             YPAVP D +     D+LPDG ++K G  V Y+ Y MGRM   WG DA  F+PERWL +G+
Sbjct  354   YPAVPADGRSAEAHDILPDGHKLKKGDGVYYLAYGMGRMCSIWGEDAEEFRPERWLNNGI  413

Query  435   FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLS  259
             FQ  SPFKF AF AGPRICLGKD AY QMK+    L RFF+FKL  G  +V Y++M  L 
Sbjct  414   FQPESPFKFVAFHAGPRICLGKDFAYRQMKIVAMALVRFFRFKLANGTQNVTYKVMFTLH  473

Query  258   MAHGLKLTVSPRT  220
             +  GL L   PR+
Sbjct  474   IDKGLLLCAIPRS  486



>ref|XP_008809790.1| PREDICTED: cytochrome P450 704C1 isoform X2 [Phoenix dactylifera]
Length=512

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 232/505 (46%), Positives = 314/505 (62%), Gaps = 31/505 (6%)
 Frame = -1

Query  1740  IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  1561
             ++  W  + + +++K   P   PV G       N+GR+HD+         +  +  PF +
Sbjct  30    VLIVWRSLGKATRKKKRYP---PVAGTIFHHFLNFGRLHDYSTSLARKHKTYRLLSPFCS  86

Query  1560  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  1381
               Y A P NVE +LKTNF NY KG+  ++ M+ LLGDGIF  DGE W  QRK AS+EF+ 
Sbjct  87    EVYTADPANVEFILKTNFSNYGKGQYNYNNMKDLLGDGIFAVDGEKWYHQRKVASVEFSK  146

Query  1380  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP  1201
               LRD+S  VF   + KL +++++A   ++ VD+QDL M+ T+DSI +V FGVEI +L  
Sbjct  147   SVLRDYSNAVFISNATKLASVISEAVRSSKIVDIQDLFMKSTMDSIFQVAFGVEIDSLCG  206

Query  1200  NLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKR  1024
             +  E ++FA+AFD ++ + T R++D  WKIKK LN+GSEA+L++ I+ +DDF Y VI  +
Sbjct  207   SNEEGSKFAEAFDDSSALTTWRYVDISWKIKKLLNIGSEAVLNKRIQVVDDFVYKVIDNK  266

Query  1023  KAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
                    ++++ S K D LSRF +E  +DPE  I  K LRDI+LNF++AG+DTTA TLSW
Sbjct  267   ------IKQHDLSKKEDFLSRFLVESQQDPE-KITHKYLRDIILNFMVAGKDTTAVTLSW  319

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               YM+  H  V EK+  EL            +L  +   +D         +FA  L  +T
Sbjct  320   LFYMLCKHPSVEEKIVEEL------------ILATKEIGNDAS-----IGEFAASLTEET  362

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + K+ YLH+ ++ETLRLYPAVP +PK    DD LPDG  VK G MV Y+PY MGRM++ W
Sbjct  363   IDKMQYLHATLSETLRLYPAVPLNPKICFADDTLPDGHDVKKGDMVVYMPYVMGRMKFIW  422

Query  486   GPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKF  310
             G DA  F+PERWL  DGVF   SPFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF+F
Sbjct  423   GDDAEDFRPERWLNSDGVFSPESPFKFTAFQAGPRICLGKELAYRQMKIFAALLLSFFRF  482

Query  309   KLV-EGHSVEYRMMTVLSMAHGLKL  238
             KL  E   V YR M  L +  GL L
Sbjct  483   KLSNERQPVNYRTMLTLQIDKGLHL  507



>ref|XP_009776441.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Nicotiana sylvestris]
Length=517

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 238/530 (45%), Positives = 327/530 (62%), Gaps = 39/530 (7%)
 Frame = -1

Query  1776  SSMETLVLALGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVG  1609
             SSM  +   +  ++FC   +H L+++   K G  R +  IG ++  Q+ N+ R+H ++  
Sbjct  15    SSMIYIPATILSLIFCGFIVHILTRKILGKHGKKRLYHPIGGTIFNQLLNFHRLHHYMTD  74

Query  1608  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  1429
                   +  +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG
Sbjct  75    LAGKYRTYRLISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDG  134

Query  1428  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  1249
             + WR+QRK +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLD
Sbjct  135   DKWREQRKLSSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLD  194

Query  1248  SICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQ  1072
             SI +V FGVE+ ++  +  E R F  AFD A+ +   R++D  WKIKK LN+GSEA L  
Sbjct  195   SIFRVAFGVELDSMCGSNDEGREFGDAFDNASEMTLWRYVDIFWKIKKALNIGSEAKLKD  254

Query  1071  SIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIEL-GKDPENNINDKSLRDIVL  895
             +IRTID F Y +I ++  ++ + + N    K DILSRF+++ G DP      K LRDI+L
Sbjct  255   NIRTIDAFVYKLIHRKTEQMSKPEANLSWKKEDILSRFLQITGIDP------KFLRDIIL  308

Query  894   NFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDDPE  718
             +F+IAG+DTTATTLSW IYM+  +  V EK+  E+ E+V E                   
Sbjct  309   SFIIAGKDTTATTLSWFIYMLCKYPQVQEKVAQEIKEAVTE-------------------  349

Query  717   SLNQRAM---QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                Q AM    FA  ++ D + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V
Sbjct  350   --KQDAMDITDFAANVSEDALEKMQYLHAALTETLRLYPAVPVDAKLSFSDDTLPDGFSV  407

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGK  370
               G MV+Y PY+MGRM + WG DA  +KPERWL  +G F+  SPFKFTAFQAGPRICLGK
Sbjct  408   NKGDMVSYQPYAMGRMRFIWGDDAEEYKPERWLDGNGFFRQESPFKFTAFQAGPRICLGK  467

Query  369   DSAYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             + AY QMK+  A+L R+F FKL +   +V YR M  L +  GL +    R
Sbjct  468   EFAYRQMKIFSAVLLRYFAFKLSDDKKTVNYRTMINLHIDGGLHVRFFHR  517



>gb|KDP27731.1| hypothetical protein JCGZ_19708 [Jatropha curcas]
Length=579

 Score =   431 bits (1107),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/487 (46%), Positives = 311/487 (64%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G    Q+ N+ R+H ++    +   +  +  PF    Y + P NVE++LKTNFPNY 
Sbjct  111   PIGGTVFNQLFNFNRLHHYMTDLASKYKTYRLLAPFRDEVYTSDPLNVEYILKTNFPNYG  170

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE  ++ +  LLGDGIF  DGE WR+QRK +S EF++K LR+FS+VVFR+ + KL  I+
Sbjct  171   KGEYNYNNLRDLLGDGIFTVDGEKWRQQRKVSSYEFSTKVLREFSSVVFRNNAAKLAGIV  230

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLR  1138
             T+A+  NQ +D+QDL M+ TLDSI KV FGVE+ ++  +  E   F+ AFD A+ I   R
Sbjct  231   TEAAKSNQSMDIQDLFMKSTLDSIFKVAFGVELDSMCGSNEEGIMFSTAFDNASSITLWR  290

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WKI++FLN+GSEA L ++I+ IDDF Y +I ++  ++  +  +  + K DILSRF
Sbjct  291   YVDIFWKIRRFLNIGSEAALKKNIKVIDDFVYKLINRKIEKMHSSTDDLSTKKDDILSRF  350

Query  957   IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVE  778
             ++L    ++  +   LRDI+LNFVIAG+DTTA TLSW IY++  +  V EK+  E+  + 
Sbjct  351   LQLN---DSETDTTYLRDIILNFVIAGKDTTAATLSWFIYVLCQNPAVQEKVAEEVREIS  407

Query  777   EMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQ  598
             +++                E  N     FA  ++ + + K+ YLH+ +TETLRLYPAVP 
Sbjct  408   KVK----------------EVTNFAG--FAASIDEEALEKMNYLHAALTETLRLYPAVPV  449

Query  597   DPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNAS  421
             D K  L DD LPDG  V+ G MV Y PY+MGRM++ WG DA  +KPERWL +DGVFQ  S
Sbjct  450   DAKICLSDDTLPDGFSVRKGNMVAYQPYAMGRMKFIWGDDAEEYKPERWLNEDGVFQQES  509

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPR CLGK+ AY QMK+  A+L   F FKL  E  +V YR M  L +  GL
Sbjct  510   PFKFTAFQAGPRTCLGKEFAYRQMKIFSAVLLSCFIFKLTDEKKAVNYRTMINLHIDGGL  569

Query  243   KLTVSPR  223
              +    R
Sbjct  570   HVRAFQR  576



>emb|CDP17799.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 221/490 (45%), Positives = 309/490 (63%), Gaps = 26/490 (5%)
 Frame = -1

Query  1683  RSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFP  1504
             R  P+ G  + Q+ N+ R+H ++        +  +  PF    Y + P NVE++LKTNF 
Sbjct  42    RHHPIGGTMLNQLINFNRLHHYMTELATKYKTYRLISPFRNEVYTSDPANVEYILKTNFE  101

Query  1503  NYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLF  1324
             NY KG   ++ ++ LLGDGIF  DG+ WR+QRK +S EF+++ LRDFS+V+FR    KL 
Sbjct  102   NYGKGLYNYTILKDLLGDGIFTVDGDKWREQRKISSFEFSTRVLRDFSSVIFRRNVAKLA  161

Query  1323  TILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIV  1147
              I+ +A+  NQ  D+QDL M+ TLDSI +V FGVE+ ++  +  E  +F+ AFD A+ + 
Sbjct  162   NIIREATNSNQTFDIQDLFMKATLDSIFRVAFGVELDSMCGSNEEGKKFSNAFDDASAMS  221

Query  1146  TLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDIL  967
               R++D  WKIKK LN+G+EA L + IR +DDF Y +IR +  ++ E+  +    K DIL
Sbjct  222   LRRYVDIFWKIKKALNIGTEAKLKEKIRVVDDFVYKLIRSKTEQMHESSDDCSWKKEDIL  281

Query  966   SRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELE  787
             SRF+++ +      + K LRDI+LNF+IAG+DTTA TLSW IYM+  H D+ EK+  E++
Sbjct  282   SRFLQVSE-----TDSKYLRDIILNFIIAGKDTTAATLSWFIYMLCRHPDIQEKVAQEIK  336

Query  786   SVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPA  607
                  R   +   + +Y+S+               L+ + + K++YLH  +TETLRLYPA
Sbjct  337   EETNGRKTTD---IAEYTSE---------------LSEEALEKMHYLHGALTETLRLYPA  378

Query  606   VPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQ  430
             VP D K    DD+LPDG  VK G MV + PY+MGRM++ WG DA  F+PERWL  +G F+
Sbjct  379   VPVDAKICSSDDILPDGFSVKKGDMVAFQPYAMGRMKFIWGDDAQEFRPERWLDVNGCFR  438

Query  429   NASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMA  253
               SPFKFTAFQAGPRICLGK+ AY QMK+  A+L RFF FKL  E  +V YR M  L + 
Sbjct  439   PESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLLRFFVFKLGDERKAVNYRTMINLHID  498

Query  252   HGLKLTVSPR  223
              GL +    R
Sbjct  499   GGLHVRAFHR  508



>ref|XP_011034662.1| PREDICTED: cytochrome P450 704C1-like [Populus euphratica]
Length=508

 Score =   427 bits (1099),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 233/524 (44%), Positives = 326/524 (62%), Gaps = 32/524 (6%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  1621
             V SNPLK S++  L+L++ ++    +FI R   +K    +  PV G    Q+ ++ R+H 
Sbjct  6     VLSNPLKFSAL-VLILSIFIVQ---LFI-RKLNKKQKKYKYHPVAGTVFTQLLHFNRVHH  60

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF +  Y   P NVE++LKTNF NY KG+  +  +  LLGDGIF
Sbjct  61    YMTNLAGKYKTYRLRAPFRSEIYTVDPVNVEYILKTNFENYGKGDHNYDNLSGLLGDGIF  120

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG+ WR+QRK +S EF++K LRDFS+VVFR    KL  I+++A+  NQ +D+QDL M+
Sbjct  121   TVDGDKWRQQRKVSSYEFSTKVLRDFSSVVFRKNVAKLANIVSEAAKANQSMDIQDLFMK  180

Query  1260  MTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDSI KV FGVE+ ++  +  E  +F  AFD A+ +   R++D  WKIK+FLN+GSEA
Sbjct  181   STLDSIFKVAFGVELDSMCGSNEEGLKFTSAFDDASALTLWRYVDVFWKIKRFLNIGSEA  240

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKS-LR  907
              L ++++ ++DF Y +I K+   +  +++     K DILSRF+++ +      ND + +R
Sbjct  241   ALKKNVKVVNDFVYKLINKKIELMRNSEEVSSLKKDDILSRFLQVTE------NDPTYIR  294

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+LNFVIAG+DTTAT LSW IYM+  H  V +K+  E+   E  + KE         +D
Sbjct  295   DIILNFVIAGKDTTATALSWFIYMLCKHPAVQDKIAQEVR--EATKVKE--------ITD  344

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
               E        F+  +N + + K+ YLH+ ++ETLRLYP+VP D K    DD+LPDG  V
Sbjct  345   FAE--------FSASVNEEALEKMNYLHAAISETLRLYPSVPVDGKICFSDDILPDGFNV  396

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKD  367
               G MV Y PY+MGRM++ WG DA  +KPERWLKDGVFQ  SPFKFTAFQAGPRIC G +
Sbjct  397   SKGDMVAYQPYAMGRMKFIWGDDAEEYKPERWLKDGVFQQESPFKFTAFQAGPRICHGNE  456

Query  366   SAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKL  238
              AY QMK+  A+L   F FKL  E   V YR M  L +  GL +
Sbjct  457   FAYRQMKIFAAVLVAIFTFKLADEKKPVNYRTMINLHVDGGLHV  500



>ref|XP_008809789.1| PREDICTED: cytochrome P450 704C1 isoform X1 [Phoenix dactylifera]
Length=515

 Score =   427 bits (1099),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 233/505 (46%), Positives = 313/505 (62%), Gaps = 28/505 (6%)
 Frame = -1

Query  1740  IMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT  1561
             ++  W  + + +++K   P   PV G       N+GR+HD+         +  +  PF +
Sbjct  30    VLIVWRSLGKATRKKKRYP---PVAGTIFHHFLNFGRLHDYSTSLARKHKTYRLLSPFCS  86

Query  1560  YTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFAS  1381
               Y A P NVE +LKTNF NY KG+  ++ M+ LLGDGIF  DGE W  QRK AS+EF+ 
Sbjct  87    EVYTADPANVEFILKTNFSNYGKGQYNYNNMKDLLGDGIFAVDGEKWYHQRKVASVEFSK  146

Query  1380  KNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP  1201
               LRD+S  VF   + KL +++++A   ++ VD+QDL M+ T+DSI +V FGVEI +L  
Sbjct  147   SVLRDYSNAVFISNATKLASVISEAVRSSKIVDIQDLFMKSTMDSIFQVAFGVEIDSLCG  206

Query  1200  NLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKR  1024
             +  E ++FA+AFD ++ + T R++D  WKIKK LN+GSEA+L++ I+ +DDF Y VI  +
Sbjct  207   SNEEGSKFAEAFDDSSALTTWRYVDISWKIKKLLNIGSEAVLNKRIQVVDDFVYKVIDNK  266

Query  1023  KAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
                I++      S K D LSRF +E  +DPE  I  K LRDI+LNF++AG+DTTA TLSW
Sbjct  267   ---IKQHDLVRLSKKEDFLSRFLVESQQDPE-KITHKYLRDIILNFMVAGKDTTAVTLSW  322

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               YM+  H  V EK+  EL            +L  +   +D         +FA  L  +T
Sbjct  323   LFYMLCKHPSVEEKIVEEL------------ILATKEIGNDAS-----IGEFAASLTEET  365

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + K+ YLH+ ++ETLRLYPAVP +PK    DD LPDG  VK G MV Y+PY MGRM++ W
Sbjct  366   IDKMQYLHATLSETLRLYPAVPLNPKICFADDTLPDGHDVKKGDMVVYMPYVMGRMKFIW  425

Query  486   GPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKF  310
             G DA  F+PERWL  DGVF   SPFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF+F
Sbjct  426   GDDAEDFRPERWLNSDGVFSPESPFKFTAFQAGPRICLGKELAYRQMKIFAALLLSFFRF  485

Query  309   KLV-EGHSVEYRMMTVLSMAHGLKL  238
             KL  E   V YR M  L +  GL L
Sbjct  486   KLSNERQPVNYRTMLTLQIDKGLHL  510



>ref|XP_011034689.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Populus euphratica]
 ref|XP_011034695.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Populus euphratica]
Length=509

 Score =   427 bits (1097),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 231/527 (44%), Positives = 323/527 (61%), Gaps = 32/527 (6%)
 Frame = -1

Query  1779  VSSMETLVLALGLIMFCWVFIHRLSQRKGGGP----RSWPVIGASVEQMTNYGRMHDWLV  1612
             + S+   +    L++   +FI +LS RK        R  P+ G    Q+ N+ R+H ++ 
Sbjct  4     IDSLSNSLTLSALVLILSIFIVQLSIRKLNKKQEKRRYHPLGGTVFNQLLNFNRLHHYMT  63

Query  1611  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  1432
                    +  +  PF +  Y A P NVE++LKTNF NY KG   +  +  LLGDGIF  D
Sbjct  64    DLAGKHKTYRLIAPFRSEVYTADPVNVEYILKTNFENYGKGGHNYDNLSGLLGDGIFTVD  123

Query  1431  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  1252
             G+ WR+QRK +S EF++K LRDFS+VVFR    KL  I+++A+  NQ +D+QDL M+ TL
Sbjct  124   GDKWRQQRKVSSYEFSTKVLRDFSSVVFRKNVAKLANIVSEAAKANQSMDIQDLFMKSTL  183

Query  1251  DSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILD  1075
             DSI KV FGVE+ ++  +  E  +F +AFD A+ +   R++D  WKIK+FLN+GSEA L 
Sbjct  184   DSIFKVAFGVELDSMCGSNEEGIKFTRAFDDASALTLWRYVDVFWKIKRFLNIGSEAALK  243

Query  1074  QSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGK-DPENNINDKSLRDIV  898
             ++++ ++DF Y +I K+   +  +++     K DILSRF+++ + DP        LRDI+
Sbjct  244   KNVKVVNDFVYKLINKKIELMRNSEEVSSLKKDDILSRFLQVTESDPT------YLRDII  297

Query  897   LNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPE  718
             LNFVIAG+DTTA  LSW IYM+  +  V +K+  E+   E  + KE    +  ++     
Sbjct  298   LNFVIAGKDTTAAALSWFIYMLCKYPAVQKKVAQEVR--EATKVKE----ITNFA-----  346

Query  717   SLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAG  538
                    +FA  +N + + K+ YLH+ +TETLRLYP+VP D K    DD LPDG  V+ G
Sbjct  347   -------EFAASINDEALEKMNYLHAAITETLRLYPSVPVDAKVCFSDDTLPDGFNVRKG  399

Query  537   GMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSA  361
              MV Y+PY+MGRM++ WG DA  +KPERWL +DGVFQ  SPFKFTAFQAGPRICLGK+ A
Sbjct  400   DMVAYLPYAMGRMKFIWGDDAEEYKPERWLNEDGVFQQESPFKFTAFQAGPRICLGKEFA  459

Query  360   YLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             Y QMK+  A+L   F FKL  E   V YR M  L +  GL +    R
Sbjct  460   YRQMKIFAAVLSGSFIFKLADERKPVNYRTMINLHVDGGLPVCALHR  506



>ref|XP_010934572.1| PREDICTED: cytochrome P450 704C1-like [Elaeis guineensis]
Length=522

 Score =   427 bits (1098),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 316/518 (61%), Gaps = 27/518 (5%)
 Frame = -1

Query  1761  LVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVV  1582
             L +   +I F   +I    QR    P   P+ G    Q+  + ++ D+         +  
Sbjct  29    LYVVASIISFSIFYIKESIQR-ADRP---PITGTVFHQLIYFDKLFDFQANIARKYQTFR  84

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             +  P  +  + A+P N+EH+LK+NF  Y KG+  +  M+ L GDGIF  DGE WR QRK 
Sbjct  85    LIKPSHSEIFTANPANIEHILKSNFSKYSKGQYNYRIMKDLFGDGIFAVDGEKWRHQRKL  144

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS EF++K LRDFS+VVF+  + KL   ++ A      +DMQDLLMR TLDSI KVGFGV
Sbjct  145   ASYEFSTKVLRDFSSVVFQQNAAKLVRKISDAVNTATMIDMQDLLMRSTLDSIFKVGFGV  204

Query  1221  EIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             E+ TL+  N    RF+KAFD +N IV  R+ D  W IK+ LN+G EA L ++++ IDDF 
Sbjct  205   ELDTLSGSNEFGVRFSKAFDDSNSIVFWRYADIFWDIKRLLNIGLEAQLKRNLKVIDDFV  264

Query  1044  YSVIRKRKAEIEETQKNEKSMKHDILSRFIELG-KDPENNINDKSLRDIVLNFVIAGRDT  868
             Y +I +++ +++  Q+++   K DILSRFI    KDPEN + D+ LRDI+LNF+IAG+DT
Sbjct  265   YQLIHRKREQMKSRQEDKS--KEDILSRFILASEKDPEN-MTDRYLRDIILNFLIAGKDT  321

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             +A TLSW  +M+  H  V EK+  E+  V +      ++                 M+F+
Sbjct  322   SANTLSWFFFMLCKHPLVQEKIAIEIREVTKFEGGRTDI-----------------MEFS  364

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
               L+ + + +++YLH+ +TETLRLYPAVP D K   EDDVLPDG +VK G  V Y+ Y+M
Sbjct  365   ASLSEEVIDRMHYLHAALTETLRLYPAVPVDGKTSDEDDVLPDGFKVKKGDGVNYLTYAM  424

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRM Y WG DA  F+PERWL+ GVF+  SPFKF AF AGPRICLGK+ AY QMK+  A L
Sbjct  425   GRMTYLWGEDAEEFRPERWLEKGVFRPESPFKFVAFNAGPRICLGKEFAYRQMKILAAAL  484

Query  327   CRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRTH  217
               FFKFKL  E  +  YR M  L M  GL L    R++
Sbjct  485   LHFFKFKLEDESKTAAYRTMFTLHMDKGLPLLAYHRSN  522



>ref|XP_010056272.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72921.1| hypothetical protein EUGRSUZ_E01363 [Eucalyptus grandis]
Length=513

 Score =   426 bits (1095),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 229/487 (47%), Positives = 300/487 (62%), Gaps = 23/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+  + R++D+  G    + +  +  P  +  Y A P NVEH+LKTNF  Y 
Sbjct  44    PVHGTVFGQLFYFNRLYDYQTGVAKRTTTFRILAPDQSEIYTADPRNVEHILKTNFEKYT  103

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE     ++ L G+GIF  DGE W+KQRK AS EFA++ LRDFS  VFR  S KL  ++
Sbjct  104   KGEYNKDIVKDLFGEGIFAVDGEKWKKQRKVASFEFATRVLRDFSCCVFRQNSAKLVKVV  163

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLR  1138
              + S  ++  DMQDLLMR TLDSI KVGFGVE+  L  +  E R F KAFD A+ ++  R
Sbjct  164   EELSAASEGFDMQDLLMRCTLDSIFKVGFGVELNCLEGSSKEGRAFMKAFDEASALIYWR  223

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             + DP WK+K+ L +GSEA L ++I+ ID+F + +IR ++ ++   Q  E + K DILSRF
Sbjct  224   YADPSWKLKRLLKIGSEARLRKNIKLIDNFVHQLIRTKRNQLPAQQ--ECNDKEDILSRF  281

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDPE  +NDK LRDI+LNF+IAG+DT+A+TLSW +YM+  H  V  K+  E++  
Sbjct  282   LLESEKDPET-MNDKYLRDIILNFMIAGKDTSASTLSWFLYMLCKHPLVQHKIVDEIKDA  340

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
                +A E N         DP                  + +++YLH+ +TETLRLYPAVP
Sbjct  341   IGDQASEANPYCFVERITDP-----------------VLDRMHYLHATLTETLRLYPAVP  383

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D +    DDVLPDG  VK    V Y+ YSM RM   WG DA  FKPERWLKDG+FQ  S
Sbjct  384   LDGRCAETDDVLPDGFHVKKADGVYYLAYSMARMHNLWGEDAEDFKPERWLKDGIFQIES  443

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFK+ AF AGPRICLGKD AY QMK+    L  FF+F+L  E   V Y++M  L + +GL
Sbjct  444   PFKYVAFHAGPRICLGKDFAYRQMKIVSIALLHFFRFRLADETRPVTYKVMFTLHINNGL  503

Query  243   KLTVSPR  223
              L   PR
Sbjct  504   HLRAVPR  510



>gb|KHG09033.1| Cytochrome P450 protein [Gossypium arboreum]
Length=506

 Score =   426 bits (1094),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/506 (43%), Positives = 319/506 (63%), Gaps = 30/506 (6%)
 Frame = -1

Query  1722  FIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAH  1543
             F  +L Q++    +  PV G  +  + N+ R+H ++    A   +  +  P+ +  + + 
Sbjct  24    FTAKLKQKQTKN-KYHPVAGTIINLLLNFNRLHHYMAHLAAKYRTYRLLSPYRSEIHTSE  82

Query  1542  PDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDF  1363
             P NVE++LKTNF NY KGE  HS +    G+GIF  DG+ WR+QRK +S EF++K LRDF
Sbjct  83    PANVEYILKTNFDNYGKGEYNHSLLRDFFGEGIFTVDGDKWRQQRKASSYEFSTKVLRDF  142

Query  1362  STVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPEN  1186
             S+VVFR    +L  I+++A+  N+ +DMQDL M+ TLDSI KV FGVE+ ++   N+   
Sbjct  143   SSVVFRKNVARLANIVSEAANSNETMDMQDLFMKSTLDSIFKVAFGVELDSMCGSNVEGK  202

Query  1185  RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEE  1006
              FA AFD A+++V  R++D  WKIK++LN+GSEA L ++I+ +D+F + +I  +  ++ +
Sbjct  203   EFATAFDNASVLVVYRYVDLFWKIKRYLNIGSEAALKRNIKVVDNFVFKLIHNKIEQLRD  262

Query  1005  TQKNEKSM-KHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIM  829
             ++ +   + K DIL+R+++L     N+ + K LRD ++NF  AG+DTTA+TLSW IYM+ 
Sbjct  263   SKDDSAVIKKEDILTRYLQL-----NDTDPKYLRDTIINFTGAGKDTTASTLSWFIYMLC  317

Query  828   THEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLY  652
              H DV EK+  E+ E+ + M  K+ +                   +FA  L  + + K++
Sbjct  318   KHPDVQEKVAVEVKEATKSMEVKDVD-------------------EFAASLREEALEKMH  358

Query  651   YLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAA  472
             YLH+ +TET+RLYPAVP D K    DD LPDG  V+   ++ Y PY+MGRM++ WG DA 
Sbjct  359   YLHAAITETIRLYPAVPMDGKICFSDDTLPDGFSVRKDDLIVYQPYAMGRMKFIWGDDAE  418

Query  471   SFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-E  298
              F+PERWL K+G+F++ SPFKFTAFQAGPR+CLGKD AY QMK+  A+L R F FKL  E
Sbjct  419   EFRPERWLDKNGMFRSESPFKFTAFQAGPRVCLGKDFAYRQMKIFSAVLLRCFVFKLSDE  478

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
                V YR M  L +  GL +    R 
Sbjct  479   NREVTYRTMINLHIDGGLHVRAFHRC  504



>ref|XP_010692303.1| PREDICTED: cytochrome P450 704C1-like [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   426 bits (1094),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/491 (45%), Positives = 308/491 (63%), Gaps = 29/491 (6%)
 Frame = -1

Query  1692  GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKT  1513
             G  +  P+ G    Q+ N+ R+H ++    A   +  +  PF +  Y + P NVE++LKT
Sbjct  39    GNKKYHPIAGTMFHQLINFKRLHHYMTNLAAKYKTYRLLTPFRSEIYTSDPANVEYILKT  98

Query  1512  NFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSL  1333
             NF NY KGE  +  +  LLGDGIF  DGE WR QRK +S EF+++ LRDFS+ +FR   +
Sbjct  99    NFDNYGKGEYNYGNLSDLLGDGIFAVDGEKWRHQRKVSSYEFSTRVLRDFSSKIFRKNVV  158

Query  1332  KLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAAN  1156
             KL  I+  A+  NQ +D+QDL M+ TLDSI KV FGVE+ ++  +  E  RF++AFD A+
Sbjct  159   KLAKIIADAANSNQIMDIQDLFMKSTLDSIFKVAFGVELDSMCGSNEEGRRFSQAFDDAS  218

Query  1155  IIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM--  982
              +   R++D  W+IKK+LN+G+EA L ++I+ +DDF Y +I  +   ++ +  N   M  
Sbjct  219   ALSLYRYVDIFWRIKKYLNIGAEAKLKKNIKIVDDFVYRLITNKVELMKSSGSNYSEMQM  278

Query  981   -KHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEK  805
              K DILSRF+E     + N + K LRDI+LNFVIAG+DTTA TLSW IYM+  H+ V EK
Sbjct  279   KKDDILSRFLE-----QCNTDFKYLRDIILNFVIAGKDTTAATLSWFIYMLCKHQKVQEK  333

Query  804   LWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTET  625
             +  E+  V  M        +  +S            +F   ++ +++ ++ YLH+ +TET
Sbjct  334   IAEEVRKVTNMEK------VGSFS------------EFEASVSEESLERMQYLHAALTET  375

Query  624   LRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-  448
             LRLYPAVP D K    DD LPDG  VK G MV+Y PY+MGRM + WG DA  ++PERWL 
Sbjct  376   LRLYPAVPVDAKICFSDDTLPDGYSVKKGDMVSYQPYAMGRMRFIWGDDAEEYRPERWLN  435

Query  447   KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMM  271
             +DG+FQ  +PFKFTAFQAGPRICLGK+ AY QMK+  A+L   F FKL  E  +V YR M
Sbjct  436   EDGIFQPENPFKFTAFQAGPRICLGKEFAYRQMKIFSAVLLSSFIFKLSDEKSTVNYRTM  495

Query  270   TVLSMAHGLKL  238
               L +  GL +
Sbjct  496   INLHIDGGLHI  506



>ref|XP_006339516.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=507

 Score =   425 bits (1093),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 230/527 (44%), Positives = 328/527 (62%), Gaps = 29/527 (6%)
 Frame = -1

Query  1785  LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  1606
             L  SS+ ++   +  ++FC    H L+++     R  P+ G    Q+ N+ R+H ++   
Sbjct  4     LHNSSIMSIAATILSLVFCGFIFHLLTRKVDAKKRYHPIGGTIFNQLINFHRLHHYMTDL  63

Query  1605  LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  1426
              +   +  +  PF +  Y + P NVE++LKTNF NY +G  ++S ++ LLGDGIF  DG+
Sbjct  64    ASKYKTYRLISPFRSEIYTSDPVNVEYILKTNFDNYGRGRYHYSNLKDLLGDGIFTVDGD  123

Query  1425  LWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDS  1246
              WR+QRK +S EF+++ LRDFS+VVFR    KL  IL++A+   + VD+QDL M+ TLDS
Sbjct  124   KWREQRKLSSHEFSTRVLRDFSSVVFRKNVAKLAHILSEAASSEKTVDIQDLFMKATLDS  183

Query  1245  ICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQS  1069
             I KV FGVE+ ++  +  E  +F  AFD A+ +   R++D  WKIK+ LN+GSEA L  +
Sbjct  184   IFKVAFGVELDSMCGSNEEGKKFGDAFDNASEMTLWRYVDIFWKIKRTLNIGSEAKLRNN  243

Query  1068  IRTIDDFTYSVIRKRKAEIE--ETQKNEKSMKHDILSRFIEL-GKDPENNINDKSLRDIV  898
             IRTID+F Y +I ++  ++   E   + +  K DILSRF+++ G DP      K LRDI+
Sbjct  244   IRTIDEFVYKLIHRKTEQMNRPEADLSLQWKKEDILSRFLQITGTDP------KFLRDII  297

Query  897   LNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPE  718
             L+F+IAG+DTTATTLSW IY++  +  V EK+  E   ++E  A++E+            
Sbjct  298   LSFIIAGKDTTATTLSWFIYVLCKYPHVQEKVAQE---IKEATAEKEDA-----------  343

Query  717   SLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAG  538
                     FA  ++ D + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V  G
Sbjct  344   ---TDVTDFAANVSEDALEKMQYLHAALTETLRLYPAVPVDGKICFSDDTLPDGFSVNKG  400

Query  537   GMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSA  361
              MV+Y PY+MGRM++ WG DA  +KPERWL  DG F+  SPFKFTAFQAGPRICLGK+ A
Sbjct  401   DMVSYQPYAMGRMKFIWGDDAEEYKPERWLDGDGFFRPESPFKFTAFQAGPRICLGKEFA  460

Query  360   YLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             + QMK+  ++L  +F FKL +   +V YR M  L +  GL + V  R
Sbjct  461   FRQMKIFSSVLLSYFVFKLSDDKQTVNYRTMINLHINGGLHVRVFHR  507



>ref|XP_010933916.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Elaeis guineensis]
Length=528

 Score =   426 bits (1095),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 229/509 (45%), Positives = 316/509 (62%), Gaps = 26/509 (5%)
 Frame = -1

Query  1752  ALGLI-MFCWVFIHRLSQRKGGGPRSWP-VIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             ALGL+ ++C   + R+  R G   + +P V G    Q  N+ R+HD+         +  +
Sbjct  37    ALGLLALYC---VLRIFHRGGNHKKRYPPVAGTIFHQFLNFRRLHDYHTELSRKYKTFKL  93

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               PF    Y + P  VE++LKTNFPNY KG   +   + L GDGIF  DG+ WR QRK A
Sbjct  94    LAPFRQQIYTSDPTVVEYILKTNFPNYGKGSFSYQTGQDLFGDGIFVVDGDKWRHQRKLA  153

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EF++K LRD S  +F+  + KL  I++++ + N+++D+QDL M+ T+DSI KVGFG++
Sbjct  154   SYEFSTKVLRDSSGAIFKSNAGKLAHIISKSVIANKKLDIQDLFMKSTMDSIFKVGFGMD  213

Query  1218  IGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
             +  L  +   + F  AFD ++ ++  R ++  WKI K LNVGSEAIL + I+ ++DFTY 
Sbjct  214   LDCLQDSYDGSIFTNAFDDSSELIMRRVVNVFWKIMKLLNVGSEAILKERIKVVNDFTYK  273

Query  1038  VIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             +I KR  E     +N+   K DILSRF+E  K    N+  + LRDIVLNF+IAG+DTTA 
Sbjct  274   LIDKR-VEQSSNGRNDLVKKEDILSRFLEESKKDPQNMTHQYLRDIVLNFLIAGKDTTAG  332

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             TLSW  YM+  +  + EK+  E++ V E  AKE+         DD          FA  +
Sbjct  333   TLSWFFYMLCKNPSIQEKISQEVKEVTE--AKEDATF------DD----------FAKSI  374

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
               +++ K++YLH+ ++ETLRLYPAVP D K    DD+LP+G  V+ G +V Y PY+MGRM
Sbjct  375   TDESLNKMHYLHAALSETLRLYPAVPLDNKVCFSDDILPNGFNVRKGDIVFYQPYAMGRM  434

Query  498   EYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             EY WG DA  F+PERWL D G+FQ  SP+KFTAFQAGPRICLGK+ AY QMK+  A+L R
Sbjct  435   EYLWGKDAECFRPERWLDDNGIFQAESPYKFTAFQAGPRICLGKEFAYRQMKIFAAVLLR  494

Query  321   FFKFKLVEGHSV-EYRMMTVLSMAHGLKL  238
             FF FKL +  +V  YR    L +  GL L
Sbjct  495   FFVFKLSDEKTVANYRTTITLHIDQGLHL  523



>ref|XP_010277455.1| PREDICTED: cytochrome P450 704C1-like [Nelumbo nucifera]
Length=520

 Score =   425 bits (1093),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 239/531 (45%), Positives = 325/531 (61%), Gaps = 34/531 (6%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVF---IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL  1603
             S+   V AL +++   VF     + S ++G   R  P+ G    Q+ N+ R+H ++    
Sbjct  10    SVSLTVTALAVVLAILVFKAISTKTSSQRGTKKRYHPIAGTIFNQLLNFHRLHHYMTDLA  69

Query  1602  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  1423
                 +  +  PF    Y A P NVE++LKTNF N+ KG   +  +  LLGDGIF  DGE 
Sbjct  70    IKYGTYRLLSPFRNEVYTADPVNVEYMLKTNFANFGKGLHNYEILSDLLGDGIFTVDGEK  129

Query  1422  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  1243
             WR QRK +S EF++K LRD+S+VVFR  +++L  +L+ ++  NQ  D+QDL M+ TLDSI
Sbjct  130   WRHQRKVSSYEFSAKVLRDYSSVVFRRNAVRLAKMLSDSAASNQIFDIQDLFMKSTLDSI  189

Query  1242  CKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIR  1063
              KVGFGVE+ ++  +    +FA+AFD ++ +   R++D  WKIKKFLN+G EA L ++I+
Sbjct  190   FKVGFGVELDSMGGSSEGTKFAQAFDDSSALTLWRYVDIFWKIKKFLNIGKEATLKKNIK  249

Query  1062  TIDDFTYSVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDIVLNFV  886
              ID+F Y +IR  K E ++   N+ S+K  DILSRF+EL     N  + + LRDI+LNF+
Sbjct  250   VIDNFMYKLIRS-KIEQKQNSDNDTSLKKDDILSRFLEL-----NETDPQYLRDIILNFL  303

Query  885   IAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQ  706
             +AGRDTTATTLSW +YM+  H  V EK+  E+  +E  RAK+        SS D      
Sbjct  304   VAGRDTTATTLSWFLYMLCKHPRVQEKVAQEV--MEATRAKDA-------SSYD------  348

Query  705   RAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVT  526
                + A  LN + + K+ YLH+ ++ETLRLYPAV  D K    DD LPDG  V  G MV 
Sbjct  349   ---EIAAHLNDEALDKMQYLHAALSETLRLYPAVAVDAKICFSDDTLPDGYSVNKGDMVV  405

Query  525   YVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
             Y PY+MGRM++ WG DA  F+PERWL +DG+F+  S  KFTAFQAGPRICLGK+ AY QM
Sbjct  406   YQPYAMGRMKFIWGEDAEVFRPERWLNEDGLFRPESSSKFTAFQAGPRICLGKEFAYRQM  465

Query  348   KMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR----THNP  211
             K+  A+L   F FKL  E   V YR M  L +  GL L    R    + NP
Sbjct  466   KIFSALLLSCFVFKLSDENQVVHYRTMLNLHIDGGLYLRAFHRLRLGSENP  516



>ref|XP_009389611.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. 
malaccensis]
Length=521

 Score =   425 bits (1093),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 236/509 (46%), Positives = 309/509 (61%), Gaps = 34/509 (7%)
 Frame = -1

Query  1731  CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  1552
             C   +HR   RK   P   P+ G    Q+ N  R+ D+         +  +  PF  Y +
Sbjct  34    CSSSVHR---RKPNYP---PIAGTVFHQLLNLSRLADFQTDLSRKYRTFRILTPFCNYVF  87

Query  1551  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  1372
                P NVEH+LK NF NY KG   +  M    GDGIF  DGE WR QRK AS EF++K L
Sbjct  88    TVDPANVEHILKINFANYGKGSFTYDIMCDFFGDGIFAVDGEKWRHQRKLASFEFSTKVL  147

Query  1371  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP  1192
             ++ S+VVFR  + +L  I++ A+  N+ +++QDLLM+ TLDSIC+VGFGVE+ TL  +  
Sbjct  148   KNNSSVVFRSTAARLAKIISNAARSNEMIEIQDLLMKSTLDSICEVGFGVELDTLTGSTE  207

Query  1191  ENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAE  1015
             E R FAKAFD A+  + LRF D  WK+K+FLN+GSEA + +S+++IDDF Y +I     +
Sbjct  208   EGRTFAKAFDDASAQIVLRFFDVFWKVKRFLNIGSEAKMKKSLKSIDDFVYKLI---DTK  264

Query  1014  IEETQKNEKSM--KHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWA  844
             IE+  + E     K DILSRF IE  K+P ++++ K LRDI+LNFVIAGRDTTA TLSW 
Sbjct  265   IEQLSQRETGFMEKEDILSRFLIEREKNP-DDMSYKYLRDIILNFVIAGRDTTAGTLSWF  323

Query  843   IYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTM  664
              YM+  H +V EK+  E+    +++         + + D          +F   L  + +
Sbjct  324   FYMLCKHPNVQEKVAQEVREATKIKG--------EVTVD----------EFVASLTEEAL  365

Query  663   AKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWG  484
              ++ YLH+ +TETLRLYPAVP D K    +D LPDG  VK G +V Y PY MGRM++ WG
Sbjct  366   NEMQYLHASLTETLRLYPAVPLDVKHCFSEDTLPDGFDVKKGDLVIYQPYPMGRMQFLWG  425

Query  483   PDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
              DA  F+PERWL  DGVF   SPFKF AFQAGPRICLGK+ AY QMK+  A L  FFKFK
Sbjct  426   EDAEDFRPERWLNGDGVFVPESPFKFPAFQAGPRICLGKEFAYRQMKIFAATLLCFFKFK  485

Query  306   LVEGHS-VEYRMMTVLSMAHGLKLTVSPR  223
             + E  S V  R M  L +  GL L    R
Sbjct  486   MWEEMSTVRSRTMLTLQIYGGLHLAALHR  514



>ref|XP_009593544.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Nicotiana tomentosiformis]
Length=520

 Score =   425 bits (1092),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 234/517 (45%), Positives = 326/517 (63%), Gaps = 32/517 (6%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLANSYSVV  1582
             L LI F ++ +H L+++   K G  R +  IG ++  Q+ N+ R+H ++        +  
Sbjct  25    LSLICFGFI-VHILTRKVLGKHGKKRLYHPIGGTIFNQLINFHRLHHYMTDLAGKYRTYR  83

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG+ WR+QRK 
Sbjct  84    LISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDGDEWREQRKL  143

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLDSI +V FGV
Sbjct  144   SSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLDSIFRVAFGV  203

Query  1221  EIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             E+ ++  +  E  +F+ AFD A+ +   R++D  WKIK+ LN+GSEA L  +IRTID F 
Sbjct  204   ELDSMCGSNEEGKKFSDAFDNASEMTLWRYVDIFWKIKRALNIGSEAKLGDNIRTIDVFA  263

Query  1044  YSVIRKRKAEIEETQKNEKSMKHDILSRFIEL-GKDPENNINDKSLRDIVLNFVIAGRDT  868
             Y +I ++  ++ + + N    K DILSRF+++ G DP      K LRDI+L+F+IAG+DT
Sbjct  264   YKLIHRKTEQMSKPEANLSWKKEDILSRFLQITGTDP------KFLRDIILSFIIAGKDT  317

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             TATTLSW IYM+     V EK+  E   ++E   +E++ L                  FA
Sbjct  318   TATTLSWFIYMLCKFPYVQEKVAQE---IKEAVTEEQDAL--------------DITDFA  360

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
               ++ DT+ K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V  G MV+Y PY+M
Sbjct  361   ANVSEDTIEKMQYLHAALTETLRLYPAVPVDAKISFSDDTLPDGFSVNKGDMVSYQPYAM  420

Query  507   GRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             GRM + WG DA  +KPERWL  +G F+  SPFKFTAFQAGPRICLGK+ AY QMK+  A+
Sbjct  421   GRMRFIWGEDAEEYKPERWLDGNGFFRQESPFKFTAFQAGPRICLGKEFAYRQMKIFSAV  480

Query  330   LCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             L R+F FKL E   +V YR +  L +  GL + V  R
Sbjct  481   LLRYFAFKLSEDKKTVNYRTVINLHIDGGLHVRVFHR  517



>ref|XP_007038505.1| Cytochrome P450 704C1 [Theobroma cacao]
 gb|EOY23006.1| Cytochrome P450 704C1 [Theobroma cacao]
Length=768

 Score =   432 bits (1112),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 228/490 (47%), Positives = 314/490 (64%), Gaps = 29/490 (6%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G  + Q+ ++  + D+         +  + MP  +  Y A P N+EH+LKTNFPNY 
Sbjct  303   PVAGLMLHQLVHFNGLFDYQTSLAKKHSTYRLIMPLRSEIYTADPVNIEHILKTNFPNYG  362

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             +G      +  L GDGIF  DGE WR QRK AS EF++K LR++ST VF+D + KL + +
Sbjct  363   RG-ARAVILRDLFGDGIFAVDGEKWRHQRKLASHEFSTKVLREYSTAVFQDNAAKLVSKV  421

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP-ENRFAKAFDAANIIVTLR  1138
             +        +D+QD+ M+ TLDSI KVGFGVE+  L+ +    N+F KAFD +N+IV  R
Sbjct  422   SIMGAARHAMDLQDMFMKSTLDSIFKVGFGVELNALSGSDEFGNQFTKAFDDSNVIVYWR  481

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMK--HDILS  964
             F+DP WK+K+ LN+G EA L ++++ IDDF + ++R ++    E  KNEK ++   DILS
Sbjct  482   FVDPFWKVKRLLNIGLEAALKRNVKIIDDFIFELVRCKR----EQMKNEKLVRDREDILS  537

Query  963   RFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELE  787
             RF+ E  KDPEN + D+ LRDI+LNF+IAG+DT+A TL+W  YM+  H  V +K+  E+ 
Sbjct  538   RFLMESEKDPEN-MTDQYLRDIILNFMIAGKDTSANTLTWFFYMLCKHPLVQKKVVQEV-  595

Query  786   SVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPA  607
              +E  +A+++                  A +F+ L+    + ++ YLH+ +TETLRLYPA
Sbjct  596   -IESTQAEDKIC----------------ADEFSRLMTEQALDRMQYLHAALTETLRLYPA  638

Query  606   VPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQN  427
             VP D K   EDDVLPDG +VK G  VTY+ Y+MGRM Y WG DA  ++PERWL++G+FQ 
Sbjct  639   VPADGKRAAEDDVLPDGFKVKKGDGVTYMAYAMGRMTYIWGEDADEYRPERWLENGIFQP  698

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAH  250
              SPFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF+F+LV E     YR M  L MA 
Sbjct  699   ESPFKFTAFQAGPRICLGKEFAYRQMKILAAVLLYFFQFRLVDETKEATYRTMFTLHMAE  758

Query  249   GLKLTVSPRT  220
             GL +   PR 
Sbjct  759   GLNVYAFPRA  768



>ref|XP_010056270.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
 gb|KCW72917.1| hypothetical protein EUGRSUZ_E01358 [Eucalyptus grandis]
Length=513

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 223/487 (46%), Positives = 307/487 (63%), Gaps = 23/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ N+ R++D+L      S +  +  P  +  Y   P N+EH++KTNF NY 
Sbjct  44    PVRGTVFAQLFNFNRLYDYLTEVARISPTFRLLAPDRSQIYTTDPRNIEHMVKTNFDNYT  103

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             +G+     ++ L G+GIF  DGE W+KQRK AS EFA++ LRDFS  VFR  + KL  ++
Sbjct  104   RGKFDIDILKDLFGEGIFVVDGEKWKKQRKVASFEFATRVLRDFSCCVFRKNAAKLVKVV  163

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLR  1138
              + S  ++  DMQD+LMR TLDSI KVGFG E+  L  +  E R F KAFD AN +   R
Sbjct  164   EELSAASEGFDMQDILMRCTLDSIFKVGFGAELNCLEGSSKEGRAFMKAFDEANALTYWR  223

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             +IDP W++K+ LN+GSEA L   I+ +D+F + +I+ ++ ++    + E + K DILSRF
Sbjct  224   YIDPSWELKRLLNIGSEACLRNDIKLMDNFVHQLIKIKRNQL--AVRRELNDKEDILSRF  281

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDP+N +N+K LRDI+LNF+IAG+DT+A TLSW +YM+  +  V +K+  E++ V
Sbjct  282   LLECEKDPKN-MNEKYLRDIILNFMIAGKDTSANTLSWFLYMLCKNPLVQQKIVDEIKEV  340

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
                       +  Q S  +P+   +R       +    + +++YLH+ +TETLRLYPA+P
Sbjct  341   ----------IGDQPSEANPDEFVER-------ITDPVLGRMHYLHATLTETLRLYPALP  383

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D +    DDVLPDG  VK G  V Y+ YSM RM   WG DA  FKPERWLKDG+FQN S
Sbjct  384   LDGRCAETDDVLPDGFHVKKGDNVNYLAYSMARMHNIWGEDAEDFKPERWLKDGIFQNES  443

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKF AF AGPRICLGKD AY QMK+    L RFF+F+L  E   + Y++M  L + +GL
Sbjct  444   PFKFVAFHAGPRICLGKDFAYRQMKIVSIALLRFFRFRLADEARPITYKVMFTLHIDNGL  503

Query  243   KLTVSPR  223
              L   PR
Sbjct  504   PLHAVPR  510



>emb|CBI38796.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 323/528 (61%), Gaps = 32/528 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
              NP+   S+   + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++
Sbjct  8     CNPM---SLVFAISALTLVFLVKILVGKSTEKK---RRYHPIGGTIFNQLFNFNRLHHYM  61

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  
Sbjct  62    TDLAGKHRTYRLLSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTV  121

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             D E WR+QRK +S EF++K LRDFS+VVFR    KL  ++++A+  N+ +D+Q L M+ T
Sbjct  122   DDEKWRQQRKVSSYEFSTKVLRDFSSVVFRKNGAKLAKVVSEAARSNRTMDIQGLFMKAT  181

Query  1254  LDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FGV++ ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L
Sbjct  182   LDSISKVAFGVKLDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATL  241

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDI  901
              +SI+ +DDF Y +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI
Sbjct  242   KRSIKVVDDFVYKLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDI  297

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDP  721
             +LNF+IAG+DTTAT LSW IYM+  H  + EK+  E+   E +  KE       Y+    
Sbjct  298   ILNFIIAGKDTTATALSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA----  347

Query  720   ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKA  541
                     +FA  +  + + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V+ 
Sbjct  348   --------EFAASVTEEALEKMQYLHAAITETLRLYPAVPFDAKICFSDDTLPDGFSVRK  399

Query  540   GGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDS  364
             G MV+Y PY+MGRM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ 
Sbjct  400   GDMVSYQPYAMGRMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEF  459

Query  363   AYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             AY QMK+  AIL   F FKL +   +V YR M  L +  GL +    R
Sbjct  460   AYRQMKILSAILSGCFVFKLSDDKKAVNYRTMITLLIDGGLHVRAFHR  507



>ref|XP_009776440.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Nicotiana sylvestris]
Length=519

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 238/532 (45%), Positives = 328/532 (62%), Gaps = 41/532 (8%)
 Frame = -1

Query  1776  SSMETLVLALGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVG  1609
             SSM  +   +  ++FC   +H L+++   K G  R +  IG ++  Q+ N+ R+H ++  
Sbjct  15    SSMIYIPATILSLIFCGFIVHILTRKILGKHGKKRLYHPIGGTIFNQLLNFHRLHHYMTD  74

Query  1608  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  1429
                   +  +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG
Sbjct  75    LAGKYRTYRLISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDG  134

Query  1428  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  1249
             + WR+QRK +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLD
Sbjct  135   DKWREQRKLSSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLD  194

Query  1248  SICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQ  1072
             SI +V FGVE+ ++  +  E R F  AFD A+ +   R++D  WKIKK LN+GSEA L  
Sbjct  195   SIFRVAFGVELDSMCGSNDEGREFGDAFDNASEMTLWRYVDIFWKIKKALNIGSEAKLKD  254

Query  1071  SIRTIDDFTYSVIRKRKAEIEETQKN--EKSMKHDILSRFIEL-GKDPENNINDKSLRDI  901
             +IRTID F Y +I ++  ++ + + N   +  K DILSRF+++ G DP      K LRDI
Sbjct  255   NIRTIDAFVYKLIHRKTEQMSKPEANLSLQWKKEDILSRFLQITGIDP------KFLRDI  308

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDD  724
             +L+F+IAG+DTTATTLSW IYM+  +  V EK+  E+ E+V E                 
Sbjct  309   ILSFIIAGKDTTATTLSWFIYMLCKYPQVQEKVAQEIKEAVTE-----------------  351

Query  723   PESLNQRAM---QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGT  553
                  Q AM    FA  ++ D + K+ YLH+ +TETLRLYPAVP D K    DD LPDG 
Sbjct  352   ----KQDAMDITDFAANVSEDALEKMQYLHAALTETLRLYPAVPVDAKLSFSDDTLPDGF  407

Query  552   RVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICL  376
              V  G MV+Y PY+MGRM + WG DA  +KPERWL  +G F+  SPFKFTAFQAGPRICL
Sbjct  408   SVNKGDMVSYQPYAMGRMRFIWGDDAEEYKPERWLDGNGFFRQESPFKFTAFQAGPRICL  467

Query  375   GKDSAYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             GK+ AY QMK+  A+L R+F FKL +   +V YR M  L +  GL +    R
Sbjct  468   GKEFAYRQMKIFSAVLLRYFAFKLSDDKKTVNYRTMINLHIDGGLHVRFFHR  519



>emb|CBI38797.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   424 bits (1089),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 323/528 (61%), Gaps = 32/528 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
              NP+   S+   + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++
Sbjct  8     CNPM---SLVFAISALTLVFLMKILVGKSTEKK---RRYHPIGGTVFNQLFNFNRLHHYM  61

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  
Sbjct  62    TDLAGKHRTYRLLSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTV  121

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             D E WR+QRK +S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ T
Sbjct  122   DDEKWRQQRKVSSYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASSNQTMDIQDLFMKAT  181

Query  1254  LDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FGVE+ ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L
Sbjct  182   LDSIFKVAFGVELDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATL  241

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDI  901
              +SI+ +DDF Y +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI
Sbjct  242   KRSIKVVDDFVYKLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDI  297

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDP  721
             +LNF+IAG+DTTAT LSW IYM+  H  + EK+  E+   E +  KE       Y+    
Sbjct  298   ILNFIIAGKDTTATALSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA----  347

Query  720   ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKA  541
                     +FA  +  + +  + +LH+ +TETLRLYPAVP D K    DD LPDG  V+ 
Sbjct  348   --------EFAASVTEEALENMQHLHAAITETLRLYPAVPVDAKICFSDDTLPDGFSVRK  399

Query  540   GGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDS  364
             G +V+Y PY+MGRM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ 
Sbjct  400   GDIVSYQPYAMGRMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEF  459

Query  363   AYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             AY QMK+  AIL   F FKL +   +V YR M  L +  GL +    R
Sbjct  460   AYRQMKIFSAILSGCFVFKLSDNKKAVNYRTMINLHIDGGLHVRAFHR  507



>ref|XP_010061882.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=524

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 231/488 (47%), Positives = 311/488 (64%), Gaps = 27/488 (6%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDW--LVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPN  1501
             P+ G    Q+ ++  + D+  L+    ++Y ++VP     YT  A P N+E++LKTNF N
Sbjct  59    PIGGPIFNQLIHFNDLFDYQTLLARRYSTYRLIVPTHSEIYT--ADPANIEYILKTNFSN  116

Query  1500  YPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFT  1321
             Y KGE     M    GDGIF  DGE WR+QRK AS EF++K L+DFST +F   ++KL  
Sbjct  117   YGKGEYNCGIMRDPFGDGIFAVDGEKWRQQRKLASYEFSTKVLKDFSTSIFLRNAVKLIM  176

Query  1320  ILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP-NLPENRFAKAFDAANIIVT  1144
              ++ A+   Q +DMQDLLM+ TLDSI KVGFGVE+ TL+  +   + F KAFD +N IV 
Sbjct  177   KISAAAGAKQIIDMQDLLMKSTLDSIFKVGFGVELNTLSGLDDSVSSFTKAFDESNAIVY  236

Query  1143  LRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILS  964
              R++D LWK+K+FLNVG EA L +++RTID+F + +IR +K ++     +  S K DILS
Sbjct  237   WRYVDILWKVKRFLNVGLEASLKRNLRTIDEFIFELIRHKKEQLRTGMID--SGKEDILS  294

Query  963   RF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELE  787
             RF I+   DPE  + DK LRDI LNF+IAGRDT+A TL+W  Y++  H  + +K+  +  
Sbjct  295   RFLIDSENDPEK-MTDKYLRDITLNFIIAGRDTSANTLTWFFYILCKHPYLQDKVAHD--  351

Query  786   SVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPA  607
              V      E+N+   ++     ES+ + A+            +++YLH+ +TETLRLYPA
Sbjct  352   -VRRATGSEDNISAEEFV----ESMTEEALD-----------RMHYLHAALTETLRLYPA  395

Query  606   VPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQN  427
             VP D K    DD+LPDG +VK G  V ++ Y+MGRM Y WG DA +F PERWL+DGVF+ 
Sbjct  396   VPVDGKCASADDILPDGFKVKKGDGVNHLTYAMGRMTYIWGDDAETFCPERWLEDGVFRP  455

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHG  247
              SPFKFTAFQAGPRICLGK+ A  QMK+  A+L  FFKF LV+G    YR M  L M  G
Sbjct  456   ESPFKFTAFQAGPRICLGKEFACRQMKILAALLVYFFKFNLVDGKEATYRTMFTLHMDGG  515

Query  246   LKLTVSPR  223
             L L   PR
Sbjct  516   LHLHALPR  523



>ref|XP_002270628.3| PREDICTED: cytochrome P450 704C1-like [Vitis vinifera]
Length=528

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 323/528 (61%), Gaps = 32/528 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
              NP+   S+   + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++
Sbjct  21    CNPM---SLVFAISALTLVFLVKILVGKSTEKK---RRYHPIGGTIFNQLFNFNRLHHYM  74

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  
Sbjct  75    TDLAGKHRTYRLLSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTV  134

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             D E WR+QRK +S EF++K LRDFS+VVFR    KL  ++++A+  N+ +D+Q L M+ T
Sbjct  135   DDEKWRQQRKVSSYEFSTKVLRDFSSVVFRKNGAKLAKVVSEAARSNRTMDIQGLFMKAT  194

Query  1254  LDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FGV++ ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L
Sbjct  195   LDSISKVAFGVKLDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATL  254

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDI  901
              +SI+ +DDF Y +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI
Sbjct  255   KRSIKVVDDFVYKLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDI  310

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDP  721
             +LNF+IAG+DTTAT LSW IYM+  H  + EK+  E+   E +  KE       Y+    
Sbjct  311   ILNFIIAGKDTTATALSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA----  360

Query  720   ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKA  541
                     +FA  +  + + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V+ 
Sbjct  361   --------EFAASVTEEALEKMQYLHAAITETLRLYPAVPFDAKICFSDDTLPDGFSVRK  412

Query  540   GGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDS  364
             G MV+Y PY+MGRM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ 
Sbjct  413   GDMVSYQPYAMGRMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEF  472

Query  363   AYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             AY QMK+  AIL   F FKL +   +V YR M  L +  GL +    R
Sbjct  473   AYRQMKILSAILSGCFVFKLSDDKKAVNYRTMITLLIDGGLHVRAFHR  520



>ref|XP_002320072.1| hypothetical protein POPTR_0014s06790g [Populus trichocarpa]
 gb|EEE98387.1| hypothetical protein POPTR_0014s06790g [Populus trichocarpa]
Length=509

 Score =   424 bits (1089),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 231/528 (44%), Positives = 326/528 (62%), Gaps = 33/528 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             SNP  +S++  L+L++  +      I +L+ +K    +  PV G    Q+ N+ R+H ++
Sbjct  8     SNPFTLSAL-VLILSIFTVQLS---IRKLN-KKQEKHKYHPVGGTVFNQLLNFNRLHHYM  62

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF +  Y A P NVE++LKTNF NY KG+  ++ +  LLGDGIF  
Sbjct  63    TDLAGKYKTYRLIAPFRSEVYTADPVNVEYILKTNFENYGKGDHNYNNLSGLLGDGIFTV  122

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             DG+ WR+QRK +S EF++K LRDFS+VVFR    KL  I+++A+  NQ +D+QDL M+ T
Sbjct  123   DGDKWRQQRKVSSHEFSTKVLRDFSSVVFRKNVAKLANIVSEAAKANQSMDIQDLFMKST  182

Query  1254  LDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FGVE+ ++  +  E  +F  AFD A+ +   R++D  WKIK+F N+GSEA L
Sbjct  183   LDSIFKVAFGVELDSMCGSNEEGVKFTSAFDDASALTLWRYVDVFWKIKRFFNIGSEAAL  242

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGK-DPENNINDKSLRDI  901
              ++++ ++DF Y +I K+   +  +++     K DILSRF+++ + DP        LRDI
Sbjct  243   KKNVKVVNDFVYKLINKKIELMRNSEEVSSLKKDDILSRFLQVTESDP------TYLRDI  296

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDP  721
             +LNFVIAG+DTTA  LSW IYM+  +  V +K+  E+   E  + KE    +  ++    
Sbjct  297   ILNFVIAGKDTTAAALSWFIYMLCKYPAVQKKVAQEVR--EATKVKE----ITNFA----  346

Query  720   ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKA  541
                     +FA  +N + + K+ YLH+ +TETLRLYP+VP D K    DD LPDG  V+ 
Sbjct  347   --------EFAASINDEALEKMNYLHAAITETLRLYPSVPVDAKVCFSDDTLPDGFNVRK  398

Query  540   GGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDS  364
             G MV Y PY+MGRM++ WG DA  +KPERWL +DGVFQ  SPFKFTAFQAGPRICLGK+ 
Sbjct  399   GDMVAYQPYAMGRMKFIWGDDAEEYKPERWLNEDGVFQQESPFKFTAFQAGPRICLGKEF  458

Query  363   AYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             AY QMK+  A+L   F FKL  E   V YR M  L +  GL +    R
Sbjct  459   AYRQMKIFAAVLLGSFIFKLADERKPVNYRTMINLHVDGGLHVCALHR  506



>ref|XP_008803291.1| PREDICTED: cytochrome P450 704C1-like [Phoenix dactylifera]
Length=506

 Score =   423 bits (1088),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 225/513 (44%), Positives = 318/513 (62%), Gaps = 26/513 (5%)
 Frame = -1

Query  1764  TLVLALGLI-MFCWVFIHRLSQRKGG-GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             +  +ALGL+ ++C   + R+ +R    G R  PV G    Q  N+ R+HD+         
Sbjct  11    SATVALGLLALYC---VSRIFRRGSSHGKRYPPVAGTVFHQFFNFRRLHDYHTELSRKHM  67

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +  +  PF    Y   P  +E++LKTNFPNY KG   +   + L GDGIF  DG+ WR Q
Sbjct  68    TFKLLAPFRQQIYTTDPTVIEYILKTNFPNYGKGLFNYQNSKDLFGDGIFAVDGDKWRHQ  127

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RK AS EF++K LRDFS  VF+  + KL  I++++++ N+++++QDL M+ T+DSI KVG
Sbjct  128   RKLASYEFSTKVLRDFSGAVFKSNAAKLAHIISESAVSNKKLNIQDLFMKSTMDSIFKVG  187

Query  1230  FGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDD  1051
             FG ++  L  +   + FA AFD ++  + LR+++  WKI K LN+GSEAIL + I+ ++D
Sbjct  188   FGTDLDCLHDSYDGSIFANAFDDSSEFIMLRYVNVFWKIMKLLNIGSEAILKERIKVVND  247

Query  1050  FTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRD  871
             F Y +I KR AE     +N+   K DIL RF+E  +    N++ + LRDIVLNF+IAG+D
Sbjct  248   FIYKLIDKR-AEQCSNGRNDLEKKEDILLRFLEESRRDPQNMSYQYLRDIVLNFLIAGKD  306

Query  870   TTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQF  691
             TTA TLSW  YM+  +  + EK+  E++ V E              +++  + +    +F
Sbjct  307   TTAGTLSWFFYMLCKNPSIQEKISQEVKEVTE--------------ANEDANFD----EF  348

Query  690   AGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYS  511
             A  +  +++ K++YLH+ ++ETLRLYPAVP D K    DD+LP+G  V+ G +V Y PY+
Sbjct  349   AKCITDESLNKMHYLHASLSETLRLYPAVPLDNKVCFSDDILPNGFNVRKGDVVFYQPYA  408

Query  510   MGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALA  334
             MGRMEY WG DA  F+PERWL D G FQ  SP+KFTAFQAGPRICLGK+ AY QMK+  A
Sbjct  409   MGRMEYLWGKDAECFRPERWLDDNGTFQAESPYKFTAFQAGPRICLGKEFAYRQMKIFAA  468

Query  333   ILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKL  238
             +L RFF FKL  EG    YR    L +  GL L
Sbjct  469   VLLRFFIFKLGDEGKVAHYRTTITLHIDQGLHL  501



>emb|CBI38795.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   423 bits (1088),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 231/516 (45%), Positives = 317/516 (61%), Gaps = 29/516 (6%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             + AL L+    + + + +++K    R  P+ G     + N+ R+H ++        +  +
Sbjct  17    ISALTLVFLMKILVGKSTEKK---RRYHPIGGTIFNHLFNFNRLHHYMTDVAGKHRTYRL  73

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               PF    + A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  74    LSPFRNEIFTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  133

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI K  FGVE
Sbjct  134   SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASFNQTMDIQDLFMKATLDSIFKFAFGVE  193

Query  1218  IGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             + ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L +SI+ +DDF Y
Sbjct  194   LDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATLKRSIKVVDDFVY  253

Query  1041  SVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTT  865
              +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI+LNF+ AG+DTT
Sbjct  254   KLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDIILNFITAGKDTT  309

Query  864   ATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAG  685
             ATTLSW IYM+  H  + EK+  E+   E +  KE       Y+            +FA 
Sbjct  310   ATTLSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA------------EFAA  351

Query  684   LLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMG  505
              +  + + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V+ G MV+Y PY+MG
Sbjct  352   SVTEEALEKMQYLHAAITETLRLYPAVPVDAKICFSDDTLPDGFSVRKGDMVSYQPYAMG  411

Query  504   RMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             RM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ AY QMK+  AIL
Sbjct  412   RMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEFAYRQMKILSAIL  471

Query  327   CRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
                F FK+ +   +V YR M  L +  GL +    R
Sbjct  472   SGCFVFKMSDDKKAVTYRTMITLLIDGGLHVRAFHR  507



>ref|XP_002270673.2| PREDICTED: cytochrome P450 704C1 [Vitis vinifera]
Length=528

 Score =   424 bits (1089),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 323/528 (61%), Gaps = 32/528 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
              NP+   S+   + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++
Sbjct  21    CNPM---SLVFAISALTLVFLMKILVGKSTEKK---RRYHPIGGTVFNQLFNFNRLHHYM  74

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  
Sbjct  75    TDLAGKHRTYRLLSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTV  134

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             D E WR+QRK +S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ T
Sbjct  135   DDEKWRQQRKVSSYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASSNQTMDIQDLFMKAT  194

Query  1254  LDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FGVE+ ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L
Sbjct  195   LDSIFKVAFGVELDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATL  254

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDI  901
              +SI+ +DDF Y +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI
Sbjct  255   KRSIKVVDDFVYKLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDI  310

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDP  721
             +LNF+IAG+DTTAT LSW IYM+  H  + EK+  E+   E +  KE       Y+    
Sbjct  311   ILNFIIAGKDTTATALSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA----  360

Query  720   ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKA  541
                     +FA  +  + +  + +LH+ +TETLRLYPAVP D K    DD LPDG  V+ 
Sbjct  361   --------EFAASVTEEALENMQHLHAAITETLRLYPAVPVDAKICFSDDTLPDGFSVRK  412

Query  540   GGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDS  364
             G +V+Y PY+MGRM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ 
Sbjct  413   GDIVSYQPYAMGRMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEF  472

Query  363   AYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             AY QMK+  AIL   F FKL +   +V YR M  L +  GL +    R
Sbjct  473   AYRQMKIFSAILSGCFVFKLSDNKKAVNYRTMINLHIDGGLHVRAFHR  520



>ref|XP_010109079.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXC20879.1| Cytochrome P450 704C1 [Morus notabilis]
Length=526

 Score =   424 bits (1089),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 327/523 (63%), Gaps = 30/523 (6%)
 Frame = -1

Query  1761  LVLAL-GLIMFCWV-----FIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLA  1600
              VLAL G+++F  V     F++   +      R  P+ G  +  + ++ ++ D+      
Sbjct  23    FVLALLGVLVFLTVAILATFLYAYIRESLSTERRPPIAGLVLNHLVHFNKLFDYQTAVAR  82

Query  1599  NSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELW  1420
                +  +  P  +  Y   P N+EH+LKTNF NY KG+   + M  L GDGIF  DGE W
Sbjct  83    KHRTYRMLTPSRSDIYTVDPTNIEHILKTNFLNYGKGDYNLAIMRDLFGDGIFAVDGEKW  142

Query  1419  RKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSIC  1240
             R QRK AS EF+++ LRDFST VFR  + KL + ++ +++  + +D+QD+LM+  LDSI 
Sbjct  143   RHQRKLASYEFSTRVLRDFSTNVFRVNAAKLVSKISVSAVAGEVIDLQDMLMKSALDSIF  202

Query  1239  KVGFGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIR  1063
             KV FGV++  L   +    RF KAFD +N+IV  R++D  WKIK+FLN+G EA L Q+++
Sbjct  203   KVAFGVDLNNLNGIDDFGKRFTKAFDDSNVIVFWRYVDFSWKIKRFLNIGLEASLKQNLK  262

Query  1062  TIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFV  886
              ID F + +IR+++ ++   + +  S K DILSRF+ E  KDPE N+ D+ LRDI+LNF+
Sbjct  263   IIDGFIFELIRRKREQMRNGKLD--SGKEDILSRFLMESTKDPE-NMTDQYLRDIILNFI  319

Query  885   IAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQ  706
             IAG+D++A TL+W  Y++  H  V E++  E+    E  A E+++         PE    
Sbjct  320   IAGKDSSANTLTWFSYLVCKHPLVQERIAQEVREAAE--AHEDSI--------SPE----  365

Query  705   RAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVT  526
                +F+ L+  + + K+ YLH+ +TETLRLYPAVP D K  +EDD+LPDG +VK G  +T
Sbjct  366   ---EFSELITEEALNKMQYLHAAITETLRLYPAVPLDGKAPVEDDILPDGYKVKKGDEIT  422

Query  525   YVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
             Y+ Y+MGRM   WG DA  F+PERWL  DGVF++ SPFKFTAF AGPRICLGK+ AY QM
Sbjct  423   YMAYAMGRMTNIWGDDAEEFRPERWLDDDGVFRSESPFKFTAFHAGPRICLGKEFAYRQM  482

Query  348   KMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             K+  A+L +FFKFK V E    +YR M  L M  GL L   PR
Sbjct  483   KILAALLLKFFKFKRVDERKEAKYRTMFTLQMDEGLHLYAFPR  525



>ref|XP_004231178.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Solanum lycopersicum]
Length=533

 Score =   424 bits (1089),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 230/532 (43%), Positives = 325/532 (61%), Gaps = 32/532 (6%)
 Frame = -1

Query  1779  VSSMETLVLALGLI-------MFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  1621
             + SME L  ++  I       +FC   +H L+++     R  P+ G    Q+ N+ R+H 
Sbjct  24    IVSMEILDCSIMSITATVVSFLFCGFIVHLLTRKLHDKRRYHPIGGTIFNQLINFHRLHH  83

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF    Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF
Sbjct  84    FMTDLAGKYKTYRLISPFRNEIYTSDPANVEYILKTNFDNYGKGWHSYSILKDLLGDGIF  143

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG+ WR+QRK +S EF+++ LRDFS+VVFR  + K   IL++    N+ VD+QDL M+
Sbjct  144   AVDGDKWREQRKLSSHEFSTRVLRDFSSVVFRKNAAKFAHILSELVKSNKIVDIQDLFMK  203

Query  1260  MTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDS+ KV FGVE+ ++   N     F  AFD A+ +   R++D  WKIK++L +GSEA
Sbjct  204   ATLDSVFKVAFGVELDSMCGSNEQGKNFNAAFDNASAMTLWRYVDVFWKIKRYLKIGSEA  263

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRD  904
              L ++I+ +D F   +IR++  ++   + +    K DILSRF+++     +  N K LRD
Sbjct  264   KLKENIKIVDAFVCKLIRRKTEQMSAPEADLSWKKEDILSRFLQI-----SGTNPKYLRD  318

Query  903   IVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDD  724
             I+LNFVIAG+DTTATTLSW IY++  +  V EK+  E   ++E   ++EN      ++D 
Sbjct  319   IILNFVIAGKDTTATTLSWFIYVLCKYPHVQEKVAQE---IKESTTEKEN------ATD-  368

Query  723   PESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVK  544
                       FA  ++ D + K+ YLH+ +TETLRLYPAVP DPK    DD LPDG  VK
Sbjct  369   -------ITDFAANVSEDALEKMQYLHAALTETLRLYPAVPVDPKICFSDDTLPDGFSVK  421

Query  543   AGGMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKD  367
              G MV+Y+PY+MGRM++ WG DA  +KPERWL  DG F+  +PFKFTAFQAGPRICLGK+
Sbjct  422   KGDMVSYLPYAMGRMKFIWGDDAEEYKPERWLDGDGFFRQENPFKFTAFQAGPRICLGKE  481

Query  366   SAYLQMKMALAILCRFFKFKLVEGH-SVEYRMMTVLSMAHGLKLTVSPRTHN  214
              AY QMK+  A+L   F FKL + + +  YR M  L +  GL + V  R  N
Sbjct  482   FAYRQMKIFSAVLLHHFVFKLSDDNKATNYRTMITLHIDGGLHVRVFSRQRN  533



>ref|XP_010058448.1| PREDICTED: cytochrome P450 704C1-like [Eucalyptus grandis]
Length=496

 Score =   422 bits (1085),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 228/487 (47%), Positives = 305/487 (63%), Gaps = 38/487 (8%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G    Q+  + R++D++   +  S +  +  P     Y     N+EH+LKTNF NY 
Sbjct  42    PIHGTVFGQLIYFNRLYDYMTKLVRRSPTFRLLEPDLNVIYTVDLRNIEHILKTNFDNYT  101

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG+     M+ LLG+GIF  DGE W+KQRK AS EFA++ LRDFS  VFR  + KL    
Sbjct  102   KGKYNIDIMKDLLGEGIFVVDGEKWKKQRKVASFEFATRVLRDFSCCVFRKDAAKL----  157

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLR  1138
                        ++D+LMR TLDSI KVGFGVE+  L  +  E R F KAFD AN ++  R
Sbjct  158   -----------VKDILMRCTLDSIFKVGFGVELNCLDGSSKEGRAFMKAFDEANALIYWR  206

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             F+DP WK+K+ LN+GSEA L  +I  +D+F + +IR ++ ++    + E + K DILSRF
Sbjct  207   FVDPSWKLKRLLNIGSEARLRNNITLMDNFVHQLIRTKRNQL--PGQREHNDKEDILSRF  264

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDPEN +NDK L+DI+LNF+IAG+DTTA TLSW +YM+  H  V +K+  E++ V
Sbjct  265   LLESEKDPEN-MNDKYLKDIILNFMIAGKDTTANTLSWFLYMLCKHPLVQQKIADEIKEV  323

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
                +A E N          P+   +R       +    + +++YLH+ +TETLRLYPAVP
Sbjct  324   MGDQASEAN----------PDCFVER-------ITDHVLDRMHYLHATLTETLRLYPAVP  366

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D +   +DD+LPDG  VK G  V Y+ YSMGRM+  WG DA  FKPERWL DG+FQN S
Sbjct  367   TDGRCAEKDDILPDGFHVKKGDCVYYLAYSMGRMQNIWGEDAEDFKPERWLNDGIFQNES  426

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKF AF AGPRICLGKD AY QMK+    L  FF+F+LV E   V Y++M  L + +GL
Sbjct  427   PFKFVAFNAGPRICLGKDFAYRQMKIVSIALLHFFRFRLVDETRPVTYKVMLTLHINNGL  486

Query  243   KLTVSPR  223
             +L V PR
Sbjct  487   QLRVVPR  493



>emb|CAN60189.1| hypothetical protein VITISV_002118 [Vitis vinifera]
Length=515

 Score =   423 bits (1087),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 322/528 (61%), Gaps = 32/528 (6%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
              NP+   S+   + AL L+    + + + +++K    R  P+ G    Q+ N+ R+H ++
Sbjct  8     CNPM---SLVFAISALTLVFLMKILVGKSTEKK---RRYHPIGGTVFNQLFNFNRLHHYM  61

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF    Y A P NVE++LKTNF NY KG   ++ +  LLGDGIF  
Sbjct  62    TDLAGKHRTYRLLSPFRNEIYTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTV  121

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             D E WR+QRK +S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ T
Sbjct  122   DDEKWRQQRKVSSYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASSNQTMDIQDLFMKAT  181

Query  1254  LDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FGVE+ ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L
Sbjct  182   LDSIFKVAFGVELDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATL  241

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDI  901
              +SI+ +DDF Y +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI
Sbjct  242   KRSIKVVDDFVYKLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDI  297

Query  900   VLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDP  721
             +LNF+IAG+DTTAT LSW IYM+  H  + EK+  E+   E +  KE       Y+    
Sbjct  298   ILNFIIAGKDTTATALSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA----  347

Query  720   ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKA  541
                     +FA  +  + +  + +LH+ +TETLRLYPAVP D K    DD LPDG  V+ 
Sbjct  348   --------EFAASVTEEALENMQHLHAAITETLRLYPAVPVDAKICFSDDTLPDGFSVRK  399

Query  540   GGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDS  364
             G  V+Y PY+MGRM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ 
Sbjct  400   GDXVSYQPYAMGRMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEF  459

Query  363   AYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             AY QMK+  AIL   F FKL +   +V YR M  L +  GL +    R
Sbjct  460   AYRQMKIFSAILSGCFVFKLSDNKKAVNYRTMINLHIDGGLHVRAFHR  507



>ref|XP_008777389.1| PREDICTED: cytochrome P450 704C1-like [Phoenix dactylifera]
Length=522

 Score =   423 bits (1087),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 237/524 (45%), Positives = 318/524 (61%), Gaps = 26/524 (5%)
 Frame = -1

Query  1785  LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  1606
             L V+    ++  L  I+   +F  + S +K   P   P+ G    Q+  +  + D+    
Sbjct  20    LSVTFAAIILYVLASIISFSIFYIKESIQKADRP---PIAGTVFHQLIYFNTLFDFQTNI  76

Query  1605  LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  1426
                  +  + MP  +    A P NVEH+LK+NF  Y KG+  +   + L GDGIF  DGE
Sbjct  77    ARRHQTFRLIMPSNSEICTADPANVEHILKSNFSKYSKGQYNYGITKDLFGDGIFAVDGE  136

Query  1425  LWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDS  1246
              WR QRK AS EF++K LRDFS+VVF+  + KL   ++        +D+QDLLM+ TLDS
Sbjct  137   KWRHQRKLASYEFSNKVLRDFSSVVFQQNAAKLVGKISDGVNTATVIDVQDLLMKSTLDS  196

Query  1245  ICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQS  1069
             I KVGFGVE+ TL+  N    RF+KAFD +N IV  R++D  W IK+ LN+G EA L ++
Sbjct  197   IFKVGFGVELDTLSGSNEFGVRFSKAFDDSNSIVFWRYVDIFWDIKRLLNIGLEAQLKRN  256

Query  1068  IRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELG-KDPENNINDKSLRDIVLN  892
             ++ IDDF Y +I  RK E  ++++ +KS K DILSRFI    KDPEN + D+ LRDI+LN
Sbjct  257   LKVIDDFVYQLIH-RKREQMKSRREDKS-KEDILSRFILASEKDPEN-MTDRYLRDIILN  313

Query  891   FVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESL  712
             F++AG+DT+A TLSW  +M+  H  V EK+  E+  V    A   ++             
Sbjct  314   FLVAGKDTSANTLSWFFFMLCKHPLVQEKIAIEIREVTRFEAGRTDI-------------  360

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
                 M+F+  L+ + + +++YLH+ +TETLRLYPAVP D K   EDDVLPDG +VK G  
Sbjct  361   ----MEFSASLSEEVIDRMHYLHAALTETLRLYPAVPMDGKTSDEDDVLPDGFKVKKGDG  416

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             V Y+ Y+MGRM Y WG DA  F+PERWL++GVF+  SPFKF AF AGPRICLGK+ AY Q
Sbjct  417   VNYLMYAMGRMTYLWGEDAEEFRPERWLENGVFRPESPFKFVAFNAGPRICLGKEFAYRQ  476

Query  351   MKMALAILCRFFKFKL-VEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             MK+  A L  FFKFKL  E  +  YR M  L M  GL L V  R
Sbjct  477   MKILAAALLHFFKFKLDDESKTAAYRTMFTLHMDKGLPLLVYHR  520



>ref|XP_002270594.3| PREDICTED: cytochrome P450 704C1 [Vitis vinifera]
Length=528

 Score =   423 bits (1087),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 231/516 (45%), Positives = 317/516 (61%), Gaps = 29/516 (6%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             + AL L+    + + + +++K    R  P+ G     + N+ R+H ++        +  +
Sbjct  30    ISALTLVFLMKILVGKSTEKK---RRYHPIGGTIFNHLFNFNRLHHYMTDVAGKHRTYRL  86

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               PF    + A P NVE++LKTNF NY KG   ++ +  LLGDGIF  D E WR+QRK +
Sbjct  87    LSPFRNEIFTADPANVEYILKTNFENYGKGSYNYNILRDLLGDGIFTVDDEKWRQQRKVS  146

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EF++K LRDFS+VVFR    KL  ++++A+  NQ +D+QDL M+ TLDSI K  FGVE
Sbjct  147   SYEFSTKVLRDFSSVVFRKNGAKLAIVVSEAASFNQTMDIQDLFMKATLDSIFKFAFGVE  206

Query  1218  IGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             + ++  +  E  +F  AFD A+ +   R++D  W IKK LN+GSEA L +SI+ +DDF Y
Sbjct  207   LDSMCGSNEEGTKFGSAFDDASAMTLYRYVDIFWTIKKSLNIGSEATLKRSIKVVDDFVY  266

Query  1041  SVIRKRKAEIEETQKNEKSMKH-DILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTT  865
              +I   K E+ +  +N+ SMK  DILSRF++L KD E  I+ K LRDI+LNF+ AG+DTT
Sbjct  267   KLIHS-KTELMKNSQNDSSMKKDDILSRFLQL-KDIE--IDPKYLRDIILNFITAGKDTT  322

Query  864   ATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAG  685
             ATTLSW IYM+  H  + EK+  E+   E +  KE       Y+            +FA 
Sbjct  323   ATTLSWFIYMLCKHPTIQEKVAQEVR--EAINLKEAT----NYA------------EFAA  364

Query  684   LLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMG  505
              +  + + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V+ G MV+Y PY+MG
Sbjct  365   SVTEEALEKMQYLHAAITETLRLYPAVPVDAKICFSDDTLPDGFSVRKGDMVSYQPYAMG  424

Query  504   RMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             RM + WG DA  F+PERWL + G+F   SPFKFTAFQAGPRICLGK+ AY QMK+  AIL
Sbjct  425   RMRFVWGDDAEEFRPERWLNEKGLFCPESPFKFTAFQAGPRICLGKEFAYRQMKILSAIL  484

Query  327   CRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
                F FK+ +   +V YR M  L +  GL +    R
Sbjct  485   SGCFVFKMSDDKKAVTYRTMITLLIDGGLHVRAFHR  520



>ref|XP_008777682.1| PREDICTED: cytochrome P450 704C1-like [Phoenix dactylifera]
Length=528

 Score =   423 bits (1087),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 228/488 (47%), Positives = 308/488 (63%), Gaps = 24/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G    Q+  +  +HD+     A   +  +  P  +  Y   P  VE++L+TN+ NY 
Sbjct  50    PLTGTVFHQILYFSTVHDYHTDLAARFKTFRLFSPTRSLIYTVDPAIVEYILRTNYTNYG  109

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   ++ ++ LLGDGIF  DGE WR QRK AS EF +KNLRDFS+ VFR  + +L  I+
Sbjct  110   KGSYNYNNLKDLLGDGIFAVDGEKWRHQRKLASYEFTTKNLRDFSSDVFRSNASRLSLII  169

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLR  1138
             ++A+  NQ +D+QDL M+ TLDSI K+GFG E+ TL+    E N FAKAFD ++ ++  R
Sbjct  170   SKAANSNQALDIQDLFMKSTLDSIFKIGFGEELDTLSGLSEEGNSFAKAFDDSSDLILWR  229

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WKIK+FL VGSEA L ++IR ID F Y +I  RK +    Q+N+   K DILSRF
Sbjct  230   YVDIFWKIKRFLGVGSEAELKKNIRLIDGFAYKLIH-RKTQSMSKQQNDTMKKEDILSRF  288

Query  957   -IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
              ++  KDP+ N+ND+ LRDI+LNF+IAGRDTTA TLSW  Y +  H  + EKL  E++  
Sbjct  289   LVQKTKDPK-NLNDQYLRDIILNFIIAGRDTTAVTLSWFFYTLCKHPSLQEKLAQEIKEA  347

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
              +              ++D  S+     +FA  L  + + K+ YLH+ +TETLR+YPAVP
Sbjct  348   TK--------------TNDSISI----AEFASRLTDEALDKMQYLHAALTETLRIYPAVP  389

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNA  424
             +DPK    DD LP G  VK G MV ++PYSMGRM++ WG DA  F+PERWL ++GVF+  
Sbjct  390   EDPKICFSDDTLPGGFDVKKGDMVCFLPYSMGRMKFLWGVDAEVFRPERWLDENGVFRPE  449

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHG  247
             +PFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF F L  E   V Y+    L +  G
Sbjct  450   NPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLIHFFTFMLSDERKDVNYKSTITLRIDQG  509

Query  246   LKLTVSPR  223
             L L    R
Sbjct  510   LHLLAYQR  517



>ref|XP_004229925.2| PREDICTED: cytochrome P450 704C1-like [Solanum lycopersicum]
Length=509

 Score =   422 bits (1085),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 222/507 (44%), Positives = 311/507 (61%), Gaps = 25/507 (5%)
 Frame = -1

Query  1734  FCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYT  1555
             FC    H L+++  G  R  P+ G    Q+ N+ R+H ++        +  +  PF    
Sbjct  25    FCGFIFHLLTKKVYGKKRYHPIGGTIFNQLINFHRLHHYMTDLACKYKTYRLISPFRNEI  84

Query  1554  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  1375
             Y + P NVE++LKTNF NY KG   +S ++ L GDGIF  DG+ W+ QRK +S EF+++ 
Sbjct  85    YTSDPANVEYILKTNFDNYGKGWYNYSILKDLFGDGIFTVDGDKWQGQRKLSSHEFSTRV  144

Query  1374  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PN  1198
             LRDFS+VVFR    KL  +L+ A+  N  VD+QDL M+ T DSI +V  GV++ ++   N
Sbjct  145   LRDFSSVVFRKNVAKLAHVLSNAANSNTTVDIQDLFMKSTQDSIFRVACGVDLDSICGSN  204

Query  1197  LPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKA  1018
                 +F  AFD AN + T R++D  WKIK+ LN+G EA L  +IRT+D F Y +I+++  
Sbjct  205   EESKKFGDAFDNANAMTTWRYVDVFWKIKRALNIGVEAKLRDNIRTVDVFVYKLIQRKTE  264

Query  1017  EIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIY  838
             ++ +   +    K DILSRF+++     +  N K LRDI+LNFVIAG+DTTATTLSW IY
Sbjct  265   QMTKPDADLSWKKEDILSRFLQI-----SGTNPKYLRDIILNFVIAGKDTTATTLSWFIY  319

Query  837   MIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAK  658
             ++  +  V EK+  E   ++E   ++EN                    FA  ++ D + K
Sbjct  320   VLCKYPHVQEKVAQE---IKESTTEKENA--------------TDITDFAANVSEDALEK  362

Query  657   LYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPD  478
             + YLH+ +TETLRLYP++P DPK    DD  PDG  V  G MV+Y+PY+MGRM++ WG D
Sbjct  363   MQYLHAALTETLRLYPSIPTDPKLCFSDDTFPDGFSVNKGDMVSYLPYAMGRMKFIWGDD  422

Query  477   AASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV  301
             A  +KPERWL + G F++ SPFKFTAFQAGPRICLGK  AY QMK+  A+L  +F FKL 
Sbjct  423   AEEYKPERWLDRHGFFRHESPFKFTAFQAGPRICLGKQFAYRQMKIFSAVLLHYFVFKLS  482

Query  300   EG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             +  ++V YR M  L +A GL + V  R
Sbjct  483   DDKNTVNYRTMISLQIAGGLHVDVFHR  509



>gb|KCW90796.1| hypothetical protein EUGRSUZ_A02863, partial [Eucalyptus grandis]
Length=470

 Score =   420 bits (1080),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 229/483 (47%), Positives = 309/483 (64%), Gaps = 27/483 (6%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDW--LVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPN  1501
             P+ G    Q+ ++  + D+  L+    ++Y ++VP     YT  A P N+E++LKTNF N
Sbjct  10    PIGGPIFNQLIHFNDLFDYQTLLARRYSTYRLIVPTHSEIYT--ADPANIEYILKTNFSN  67

Query  1500  YPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFT  1321
             Y KGE     M    GDGIF  DGE WR+QRK AS EF++K L+DFST +F   ++KL  
Sbjct  68    YGKGEYNCGIMRDPFGDGIFAVDGEKWRQQRKLASYEFSTKVLKDFSTSIFLRNAVKLIM  127

Query  1320  ILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAP-NLPENRFAKAFDAANIIVT  1144
              ++ A+   Q +DMQDLLM+ TLDSI KVGFGVE+ TL+  +   + F KAFD +N IV 
Sbjct  128   KISAAAGAKQIIDMQDLLMKSTLDSIFKVGFGVELNTLSGLDDSVSSFTKAFDESNAIVY  187

Query  1143  LRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILS  964
              R++D LWK+K+FLNVG EA L +++RTID+F + +IR +K ++     +  S K DILS
Sbjct  188   WRYVDILWKVKRFLNVGLEASLKRNLRTIDEFIFELIRHKKEQLRTGMID--SGKEDILS  245

Query  963   RF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELE  787
             RF I+   DPE  + DK LRDI LNF+IAGRDT+A TL+W  Y++  H  + +K+  +  
Sbjct  246   RFLIDSENDPEK-MTDKYLRDITLNFIIAGRDTSANTLTWFFYILCKHPYLQDKVAHD--  302

Query  786   SVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPA  607
              V      E+N+   ++     ES+ + A+            +++YLH+ +TETLRLYPA
Sbjct  303   -VRRATGSEDNISAEEFV----ESMTEEALD-----------RMHYLHAALTETLRLYPA  346

Query  606   VPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQN  427
             VP D K    DD+LPDG +VK G  V ++ Y+MGRM Y WG DA +F PERWL+DGVF+ 
Sbjct  347   VPVDGKCASADDILPDGFKVKKGDGVNHLTYAMGRMTYIWGDDAETFCPERWLEDGVFRP  406

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHSVEYRMMTVLSMAHG  247
              SPFKFTAFQAGPRICLGK+ A  QMK+  A+L  FFKF LV+G    YR M  L M  G
Sbjct  407   ESPFKFTAFQAGPRICLGKEFACRQMKILAALLVYFFKFNLVDGKEATYRTMFTLHMDGG  466

Query  246   LKL  238
             L L
Sbjct  467   LHL  469



>ref|XP_004976569.1| PREDICTED: cytochrome P450 704C1-like [Setaria italica]
Length=518

 Score =   422 bits (1084),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 235/503 (47%), Positives = 310/503 (62%), Gaps = 28/503 (6%)
 Frame = -1

Query  1704  QRKGGGPRSW---PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDN  1534
             QR+G G ++    PV G  + Q+ NY R+ ++         +  V  P     Y   P N
Sbjct  27    QRRGAGGKNRKYPPVAGTVLHQLLNYDRLMEYQTELSRRHRTFRVLTPTGNDVYTVDPAN  86

Query  1533  VEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTV  1354
             VEHVLKT+F +Y KG   H  ME LLGDGIFN DG+ WR QRK AS EF+ + LRD+S+ 
Sbjct  87    VEHVLKTSFADYGKGATMHDVMEDLLGDGIFNVDGDKWRHQRKVASHEFSVRVLRDYSSG  146

Query  1353  VFRDYSLKLFTILTQASLLNQ--QVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-R  1183
             VFRD + +L  I+  A+  +   +VD+ DLLMR TLDSI KVGFGV +G+L+    E   
Sbjct  147   VFRDTATELAGIVAAAARGDGGIRVDIADLLMRSTLDSIFKVGFGVNLGSLSGCSKEGAE  206

Query  1182  FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEET  1003
             FA+AFD A+  V  RF D LWK K+ LNV SEA + +S+RTI+DF Y+VI  RK E   +
Sbjct  207   FARAFDDASEQVMYRFFDLLWKAKRLLNVSSEAAMKRSVRTINDFVYAVI-DRKIEQMSS  265

Query  1002  QKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMT  826
              + E + K DILSRF +E  +DP    ++K LRDI+LNFVIAGRDTTA TL+W +Y++  
Sbjct  266   DQQEFAKKEDILSRFLLEREQDP-GCFDNKYLRDIILNFVIAGRDTTAGTLAWFLYVLCR  324

Query  825   HEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYL  646
             ++ + EK+  E+ +      ++                   A +F   L  D ++K+ YL
Sbjct  325   NQHIQEKVAREVRTAAATGDRDVG-----------------AQEFVASLTEDAISKMQYL  367

Query  645   HSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASF  466
             H+ +TETLRLYPAVP D K    DD LPDG  +K G  V Y PY+MGRM++ WG DA  F
Sbjct  368   HAALTETLRLYPAVPIDLKCCFSDDTLPDGYALKKGDAVHYQPYAMGRMDFLWGADAEEF  427

Query  465   KPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHS  289
             +PERWL  DGVF   SPFKFT FQAGPRICLGK+ AY QMK+  A+L   F+F++ + ++
Sbjct  428   RPERWLDDDGVFVPESPFKFTVFQAGPRICLGKEFAYRQMKIFAAVLLYLFRFEMWDANT  487

Query  288   VE-YRMMTVLSMAHGLKLTVSPR  223
              E YR M  L M   L +  SPR
Sbjct  488   TEGYRPMLTLKMDGPLYVRASPR  510



>ref|XP_001781614.1| predicted protein [Physcomitrella patens]
 gb|EDQ53570.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   421 bits (1081),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 220/510 (43%), Positives = 315/510 (62%), Gaps = 30/510 (6%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYL-ANSYSVVVPMP----FT  1564
             W+++  L +R+  GP  WP +G+ +E    +  M+DW + Y  A+  +    MP     T
Sbjct  2     WLWLLSL-RRRPPGPMIWPWLGSMLEIAPQFDTMNDWYLNYFSADVKTFSFGMPGFPSCT  60

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
              +     P  VEH+L TN   Y KG+     +   LG GIF ADGE WR+ RK AS EF+
Sbjct  61    KFVATVDPVIVEHIL-TNVYKYGKGDQLRDRLGDFLGRGIFLADGEDWRRHRKIASTEFS  119

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LR  S  VFR   +KL   L  A   +Q V++QDL +RMTLDSICKV FGVEIG+L+
Sbjct  120   TRKLRGHSASVFRGEGVKLANCLKVAMAADQPVEIQDLFLRMTLDSICKVAFGVEIGSLS  179

Query  1203  PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKR  1024
             P+LP+ +FAK FD A   ++ R + P++KI + L++G E     +  ++  F   VI KR
Sbjct  180   PDLPDVQFAKDFDNAQAHISKRVVRPMFKILRALDIGEEHHFRIATNSVHSFAMDVIAKR  239

Query  1023  KAEI---EETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTL  853
             + EI    +  +   S   D+LS+F+      EN+ +DK LRD++++F++AGRDTTA TL
Sbjct  240   RKEIAAAHDAGEEYVSYMDDLLSKFMANLTQDENSYDDKELRDVIISFMLAGRDTTAVTL  299

Query  852   SWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNY  673
             SW  Y +  H ++A+K++ E  +V       E+ + H                    L +
Sbjct  300   SWFTYEMCCHPEIADKIYEEGVAVIGKHTVVESAVEH--------------------LTH  339

Query  672   DTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEY  493
             + + +++YLH+ ++E+LRL+PAVP+D K +LE+DVLP+G +VK G  V YVPYSMGRM +
Sbjct  340   EALGQMHYLHAALSESLRLHPAVPRDGKCVLEEDVLPNGIKVKKGDFVQYVPYSMGRMPF  399

Query  492   NWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFK  313
              WGPDA  FKPERWLKDGV+Q+ SP+  +AFQAGPRICLGKDSAYLQ+K+  A++  FFK
Sbjct  400   LWGPDALEFKPERWLKDGVYQSVSPYIHSAFQAGPRICLGKDSAYLQLKVTAALITHFFK  459

Query  312   FKLVEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             F LV G  + Y    V+ +  GLK+T+SPR
Sbjct  460   FHLVPGQEIAYTTTLVMPIKKGLKVTLSPR  489



>ref|XP_010933914.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Elaeis guineensis]
Length=506

 Score =   421 bits (1082),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 228/522 (44%), Positives = 320/522 (61%), Gaps = 26/522 (5%)
 Frame = -1

Query  1779  VSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWP-VIGASVEQMTNYGRMHDWLVGYL  1603
             VS   T+ L L L+++C   + R+ +R     + +P V G    Q  N+ R+HD+     
Sbjct  8     VSLSATVALGL-LVLYC---VSRIFRRGSNHKKRYPPVAGTVFHQFHNFRRLHDYHTELS  63

Query  1602  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  1423
                 +  +  PF    Y + P  VE++L+TNFPNY KG   +  ++ L GDGIF  DG+ 
Sbjct  64    RKHKTFKLLAPFRQQIYTSDPTVVEYILRTNFPNYGKGLFNYQNLKDLFGDGIFAVDGDK  123

Query  1422  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  1243
             WR QRK AS EF +K LRDFS  VF+  + KL  I++++ ++N+ +++QDL M+ T+DSI
Sbjct  124   WRHQRKLASYEFTTKVLRDFSGAVFQSNAAKLAHIISKSVIVNKILNIQDLFMKSTMDSI  183

Query  1242  CKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIR  1063
              KVGFG+++  L  +   + FA AFD ++ ++ LR+++  WKI K LN+GSEAIL + I+
Sbjct  184   FKVGFGMDLDCLHDSNDGSIFANAFDDSSELIMLRYVNVFWKIMKLLNIGSEAILKERIK  243

Query  1062  TIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
              ++DF Y +I KR  E     +N+   K DILSRF+E  K    N+  + LRDIVLNF+I
Sbjct  244   VVNDFVYKLIDKR-VEQCSNGRNDLVKKDDILSRFLEESKKDPQNMTYQYLRDIVLNFLI  302

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AG+DTTA TLSW  YM+  +  + EK+  E++ V   +A E+         DD       
Sbjct  303   AGKDTTAGTLSWLFYMLCKNPSIQEKISQEVKQV--TKANEDATF------DD-------  347

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
                FA  +  +++ K++YLH+ ++ETLRLYPAVP D K    DD+LP+G  V+ G +V Y
Sbjct  348   ---FAKSITDESLNKMHYLHAALSETLRLYPAVPLDNKVCFSDDILPNGFNVRKGDIVFY  404

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMK  346
              PY+MGRMEY WG DA  F+PERWL D G+FQ  SP+KFTAFQAGPRICLGK+ AY QMK
Sbjct  405   QPYAMGRMEYLWGKDAECFRPERWLDDNGIFQAESPYKFTAFQAGPRICLGKEFAYRQMK  464

Query  345   MALAILCRFFKFKLVEGHSV-EYRMMTVLSMAHGLKLTVSPR  223
             +  A+L RFF F L +   V  YR    L +  GL L    R
Sbjct  465   IFAAVLLRFFVFTLSDEKKVANYRTTITLHIDQGLHLHAVLR  506



>gb|KCW72915.1| hypothetical protein EUGRSUZ_E01356, partial [Eucalyptus grandis]
Length=474

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 227/487 (47%), Positives = 300/487 (62%), Gaps = 44/487 (9%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G    Q+  + R++D++   +  S +  +  P     Y     N+EH+LKTNF NY 
Sbjct  26    PIHGTVFGQLIYFNRLYDYMTKLVRRSPTFRLLEPDLNVIYTVDLRNIEHILKTNFDNYT  85

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG+     M+ LLG+GIF  DGE W+KQRK AS EFA++ LRDFS   F           
Sbjct  86    KGKYNIDIMKDLLGEGIFVVDGEKWKKQRKVASFEFATRVLRDFSCCGF-----------  134

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLR  1138
                       DMQD+LMR TLDSI KVGFGVE+  L  +  E R F KAFD AN ++  R
Sbjct  135   ----------DMQDILMRCTLDSIFKVGFGVELNCLDGSSKEGRAFMKAFDEANALIYWR  184

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             F+DP WK+K+ LN+GSEA L  +I  +D+F + +IR ++ ++    + E + K DILSRF
Sbjct  185   FVDPSWKLKRLLNIGSEARLRNNITLMDNFVHQLIRTKRNQL--PGQREHNDKEDILSRF  242

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDPEN +NDK L+DI+LNF+IAG+DTTA TLSW +YM+  H  V +K+  E++ V
Sbjct  243   LLESEKDPEN-MNDKYLKDIILNFMIAGKDTTANTLSWFLYMLCKHPLVQQKIADEIKEV  301

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
                +A E N          P+   +R            + +++YLH+ +TETLRLYPAVP
Sbjct  302   MGDQASEAN----------PDCFVERITDHV-------LDRMHYLHATLTETLRLYPAVP  344

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D +   +DD+LPDG  VK G  V Y+ YSMGRM+  WG DA  FKPERWL DG+FQN S
Sbjct  345   TDGRCAEKDDILPDGFHVKKGDCVYYLAYSMGRMQNIWGEDAEDFKPERWLNDGIFQNES  404

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKF AF AGPRICLGKD AY QMK+    L  FF+F+LV E   V Y++M  L + +GL
Sbjct  405   PFKFVAFNAGPRICLGKDFAYRQMKIVSIALLHFFRFRLVDETRPVTYKVMLTLHINNGL  464

Query  243   KLTVSPR  223
             +L V PR
Sbjct  465   QLRVVPR  471



>gb|EYU25719.1| hypothetical protein MIMGU_mgv1a024571mg [Erythranthe guttata]
Length=497

 Score =   420 bits (1079),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/488 (46%), Positives = 308/488 (63%), Gaps = 38/488 (8%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G    Q+ N+ R+H ++        +  +  PF +  Y A P N+E++LKTNF NY 
Sbjct  40    PIGGTIFNQLMNFNRLHHYMTDLATKHKTYRLIAPFRSEVYTADPANIEYILKTNFENYG  99

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   +S ++ LLGDGIF  DGE W++QRK +SLEF++K LRD ST VF + ++KL  I+
Sbjct  100   KGWHNYSILKDLLGDGIFVVDGEKWKEQRKVSSLEFSTKALRDISTTVFIENAVKLAGIV  159

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLR  1138
             +++S  NQ  D+Q+L M+ TLDSI KV FGV++ +   +  E  RF++AFD A+ ++  R
Sbjct  160   SESSFSNQPFDIQELFMKSTLDSIFKVAFGVDLDSTGGSYEEGERFSRAFDDASAVIAWR  219

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WKIKK LN+GSEA L ++IR +D+F Y +IR  K    + ++N      DILSRF
Sbjct  220   YVDVFWKIKKALNIGSEAKLKENIRVVDEFVYKLIRN-KTNCVDLRRN------DILSRF  272

Query  957   IELGK-DPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             ++L + DP      K LRDI+LNFV+AG+DTTATTLSW  YM+  H  V EK+  E++ +
Sbjct  273   VKLSEADP------KYLRDIILNFVMAGKDTTATTLSWFFYMMCKHARVQEKVAREIKEI  326

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
                  + ENV                  +FA  L  + + K++YLH+ +TETLRLYP VP
Sbjct  327   N----RAENV-----------------SEFAANLREEALEKMHYLHAALTETLRLYPPVP  365

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNA  424
              +PK    DD LPDG RV+ G  V Y  Y+MGRM++ WG +A  FKPERWL  +G F + 
Sbjct  366   VNPKMCFSDDTLPDGFRVRKGDTVAYQSYAMGRMKFIWGDNAEEFKPERWLDFNGCFHHE  425

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHG  247
              PFKFTAFQAGPRICLGK+ AY QMK+  A+L RFF F+L  E   V+YR M  L +  G
Sbjct  426   CPFKFTAFQAGPRICLGKEFAYRQMKILSAVLMRFFVFRLSDESKKVKYRTMINLHIDGG  485

Query  246   LKLTVSPR  223
             L++    R
Sbjct  486   LRVRAFDR  493



>ref|XP_009593543.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Nicotiana tomentosiformis]
Length=522

 Score =   421 bits (1081),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 234/519 (45%), Positives = 327/519 (63%), Gaps = 34/519 (7%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQR---KGGGPRSWPVIGASV-EQMTNYGRMHDWLVGYLANSYSVV  1582
             L LI F ++ +H L+++   K G  R +  IG ++  Q+ N+ R+H ++        +  
Sbjct  25    LSLICFGFI-VHILTRKVLGKHGKKRLYHPIGGTIFNQLINFHRLHHYMTDLAGKYRTYR  83

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             +  PF    Y A P NVE++LKTNF NY +G  +HS +  LLGDGIF  DG+ WR+QRK 
Sbjct  84    LISPFRNEIYTADPVNVEYILKTNFDNYGRGRYHHSILTDLLGDGIFTVDGDEWREQRKL  143

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             +S EF+++ LRDFS+V+FR    KL  +L++A+  ++ VD+QDL M+ TLDSI +V FGV
Sbjct  144   SSHEFSTRVLRDFSSVIFRKNVAKLAHMLSEAANSSKIVDIQDLFMKATLDSIFRVAFGV  203

Query  1221  EIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFT  1045
             E+ ++  +  E  +F+ AFD A+ +   R++D  WKIK+ LN+GSEA L  +IRTID F 
Sbjct  204   ELDSMCGSNEEGKKFSDAFDNASEMTLWRYVDIFWKIKRALNIGSEAKLGDNIRTIDVFA  263

Query  1044  YSVIRKRKAEIEETQKN--EKSMKHDILSRFIEL-GKDPENNINDKSLRDIVLNFVIAGR  874
             Y +I ++  ++ + + N   +  K DILSRF+++ G DP      K LRDI+L+F+IAG+
Sbjct  264   YKLIHRKTEQMSKPEANLSLQWKKEDILSRFLQITGTDP------KFLRDIILSFIIAGK  317

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTATTLSW IYM+     V EK+  E   ++E   +E++ L                  
Sbjct  318   DTTATTLSWFIYMLCKFPYVQEKVAQE---IKEAVTEEQDAL--------------DITD  360

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
             FA  ++ DT+ K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V  G MV+Y PY
Sbjct  361   FAANVSEDTIEKMQYLHAALTETLRLYPAVPVDAKISFSDDTLPDGFSVNKGDMVSYQPY  420

Query  513   SMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             +MGRM + WG DA  +KPERWL  +G F+  SPFKFTAFQAGPRICLGK+ AY QMK+  
Sbjct  421   AMGRMRFIWGEDAEEYKPERWLDGNGFFRQESPFKFTAFQAGPRICLGKEFAYRQMKIFS  480

Query  336   AILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             A+L R+F FKL E   +V YR +  L +  GL + V  R
Sbjct  481   AVLLRYFAFKLSEDKKTVNYRTVINLHIDGGLHVRVFHR  519



>ref|XP_006339779.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
 ref|XP_006339784.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=515

 Score =   420 bits (1079),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 229/524 (44%), Positives = 323/524 (62%), Gaps = 29/524 (6%)
 Frame = -1

Query  1776  SSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLAN  1597
             SS+      L L+ FC   +H L+++  G  R  P+ G    Q+ N+ R+H ++      
Sbjct  15    SSISITATILSLV-FCVFLVHLLTRKLHGKKRYHPIGGTIFNQLINFHRLHHYMTDLAGK  73

Query  1596  SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWR  1417
               +  +  PF    Y + P NVE++LKTN  NY KG   +S ++ L GDGIF  DG+ WR
Sbjct  74    YKTYRLISPFRNKIYTSDPANVEYILKTNIDNYGKGWYNYSILKDLFGDGIFAVDGDKWR  133

Query  1416  KQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICK  1237
             +QRK  S EF+++ LRDFS+VVFR    KL  IL++A+  N+ VD+QDL ++ +LDSI +
Sbjct  134   EQRKLLSHEFSTRVLRDFSSVVFRKNVAKLAQILSEAANSNKTVDIQDLFIQTSLDSIFR  193

Query  1236  VGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRT  1060
             V FG E+  +  +  E  RF+ AFD AN + T R+ D  WKIK+ LN+G EA L  +IRT
Sbjct  194   VAFGAELDNMCGSNEEGKRFSDAFDNANAMTTWRYTDIFWKIKRALNIGVEAKLRDNIRT  253

Query  1059  IDDFTYSVIRKRKAEIEETQKNEKSM---KHDILSRFIELGKDPENNINDKSLRDIVLNF  889
             +D F Y +I  R  ++ + + ++ SM   K DILSRF+++      + + K LRDI+L+F
Sbjct  254   VDTFVYKLIHIRTEQMSKPETHDLSMQRKKEDILSRFLQI-----TDTDPKYLRDIILSF  308

Query  888   VIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLN  709
             +IAG+DT ATTLSW +Y++  +  V EK+  E++      A  EN    + ++D      
Sbjct  309   LIAGKDTAATTLSWFLYVLCKYPHVQEKVVQEIKE-----ATTEN----KDATD------  353

Query  708   QRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMV  529
                M FA  ++ + + K+ YLH+ +TETLRLYPAVP DPK    DD LPDG  V  G MV
Sbjct  354   --IMDFAANVSEEALEKMQYLHAALTETLRLYPAVPLDPKICFSDDTLPDGFSVNKGDMV  411

Query  528   TYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
              Y+PY+MGRM++ WG DA  +KPERWL  DG F+  +PFKFTAFQAGPRICLGK+ AY Q
Sbjct  412   CYLPYAMGRMKFIWGDDAEEYKPERWLDGDGFFRPENPFKFTAFQAGPRICLGKEFAYRQ  471

Query  351   MKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             MK+  A+L R+F FKL +   ++ YR M  L +  GL + V  R
Sbjct  472   MKIFSAVLLRYFVFKLSDDKKAINYRTMINLHIDGGLHVRVFRR  515



>ref|XP_009379287.1| PREDICTED: cytochrome P450 704C1-like [Pyrus x bretschneideri]
Length=503

 Score =   419 bits (1078),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 328/531 (62%), Gaps = 40/531 (8%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             SNP   +S+  L+      +  W    +L++RK   P   P+ G  + Q+ N+ R+HD++
Sbjct  5     SNPFLFTSLVLLLSIFTAQILAW----KLTKRKRKYP---PIAGTILHQLLNFKRLHDYM  57

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                 A   +  +  PF    Y ++P NVE++LKTNF NY KG   ++ ++ LLGDGIF  
Sbjct  58    TDLAAKYKTYRLIGPFRNEVYTSNPQNVEYILKTNFDNYGKGWYNYNMLKDLLGDGIFTV  117

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             DG+ WR+QRK +S EF+++ LR+FS+ VF+  + K+   L++ +  NQ +D+QD+ M+ T
Sbjct  118   DGDKWRQQRKISSHEFSTRMLREFSSAVFQKNAAKVADKLSEIAAANQTIDIQDMFMKST  177

Query  1254  LDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FG E+  +  +  E R F  AFD ++ +   R++D  W+IKKFLN+GSEA L
Sbjct  178   LDSIFKVAFGTELDNMCGSNEEGRSFGDAFDNSSALSLWRYVDVFWRIKKFLNLGSEAAL  237

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM----KHDILSRFIELGKDPENNINDKSL  910
              ++I+ I++F + +I  +   IE+ QKN+ S     + DILSRF++  +      N   L
Sbjct  238   RKNIKIINEFVFKLIHTK---IEQMQKNDNSSVTVDREDILSRFLQASE-----TNPLYL  289

Query  909   RDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSS  730
             RDI+LNF+IAG+DTTATTL+W IY++  H  V EK+  E++ V  M+       +  +S 
Sbjct  290   RDIILNFIIAGKDTTATTLAWFIYLLCKHPSVQEKIVHEVKQVTGMKR------ITSFS-  342

Query  729   DDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTR  550
                        + A  L+ D + K++YLH+ +TETLR+YPAVP D K    DD LPDG  
Sbjct  343   -----------ELADSLSEDVLEKMHYLHAAITETLRIYPAVPVDAKMCFSDDTLPDGYS  391

Query  549   VKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLG  373
             V+ G +V+Y PY+MGRM++ WG DA  F+PERWL ++GVFQ  SPFKFTAFQAGPRICLG
Sbjct  392   VRKGDLVSYQPYAMGRMKFIWGDDAEEFRPERWLNENGVFQPESPFKFTAFQAGPRICLG  451

Query  372   KDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             K+ AY Q+K+  A+L   F FKL  E   V YR M  L +  GL++    R
Sbjct  452   KEFAYRQLKIFSAVLLSCFVFKLSDENAVVTYRTMINLHIKGGLQVRAFHR  502



>ref|NP_001065111.1| Os10g0525000 [Oryza sativa Japonica Group]
 gb|AAM12483.1|AC074232_10 cytochrome P450-like protein [Oryza sativa Japonica Group]
 gb|AAP54709.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27025.1| Os10g0525000 [Oryza sativa Japonica Group]
 gb|EAZ16742.1| hypothetical protein OsJ_32218 [Oryza sativa Japonica Group]
 dbj|BAG91400.1| unnamed protein product [Oryza sativa Japonica Group]
Length=515

 Score =   420 bits (1079),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 219/488 (45%), Positives = 297/488 (61%), Gaps = 23/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLAN--SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPN  1501
             PV+G +  Q+ +  R+HD+         ++ ++VP       Y   P  VEH+L+TNF N
Sbjct  47    PVVGTAFHQLYHVRRVHDYHTALSREHMTFRLLVPAG-REQIYTCDPAVVEHILRTNFAN  105

Query  1500  YPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFT  1321
             Y KG   H  M  L GDGIF  DG+ W++QRK AS +F ++ LRDFS  VF+  + KL  
Sbjct  106   YGKGSFNHGNMSDLFGDGIFAVDGDKWKQQRKIASYDFTTRALRDFSGDVFKRNAAKLAG  165

Query  1320  ILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTL  1141
             +++  +  NQ +D Q  LMR T+DSI  + FG ++ TL  +    RFA AFD A+    L
Sbjct  166   VVSSHAASNQSMDFQGFLMRATMDSIFTIAFGQDLNTLDGSGEGRRFAAAFDDASEFTML  225

Query  1140  RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSR  961
             R+++P WK+ + LNVG+EA+L + I+ +D F Y +IR R  E+  T+ ++   + DIL+R
Sbjct  226   RYLNPFWKLSRLLNVGAEAMLKERIKVVDGFVYKLIRDRSDELSNTKAHDTDSRQDILTR  285

Query  960   FIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             FI+        ++ K LRDI+LN VIAG+DTTA +L+W +YM+  H +V EK+    E++
Sbjct  286   FIQATTSDSGTVDYKYLRDIILNIVIAGKDTTAGSLAWFLYMMCKHPEVQEKICH--EAM  343

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
             E   A E   +     S   E+LN                K++YLH+ +TETLRLYPAVP
Sbjct  344   EATNAGEAASIDEFSQSLTDEALN----------------KMHYLHAALTETLRLYPAVP  387

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNA  424
              D K    DDVLP+G  V  G +V Y+PY+MGRME  WG DA SF+PERWL ++GVFQ  
Sbjct  388   LDNKQCFSDDVLPNGFNVSKGDIVFYIPYAMGRMESLWGKDAESFRPERWLDENGVFQQE  447

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHG  247
             SPFKFTAFQAGPRICLGKD AY QMK+  A+L RFF  KL  E   + YR M  LS+  G
Sbjct  448   SPFKFTAFQAGPRICLGKDFAYRQMKIFAAVLLRFFVLKLRDEKEIISYRTMITLSVDQG  507

Query  246   LKLTVSPR  223
             L LT   R
Sbjct  508   LHLTAMAR  515



>ref|XP_010934571.1| PREDICTED: cytochrome P450 704C1-like [Elaeis guineensis]
Length=526

 Score =   419 bits (1078),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 230/524 (44%), Positives = 316/524 (60%), Gaps = 26/524 (5%)
 Frame = -1

Query  1785  LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  1606
             L ++    ++  +  I+   +F  + S +K   P   P+ G    Q+  +  + D+L   
Sbjct  24    LSIAFAAIILYVVASIISFSIFYIKESIQKTDRP---PIAGTIFHQLIYFNTLFDFLTSI  80

Query  1605  LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  1426
                  +  +  P  +  + A P N+EH+LK+NF  Y KG+  +  M+ L GDGIF  DG+
Sbjct  81    ARRHQTFRLIGPSHSEIFTADPANIEHILKSNFSKYSKGQYNYKIMKDLFGDGIFAVDGK  140

Query  1425  LWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDS  1246
              WR QRK AS EF++K LRD S+VVF+  + KL   ++ A      +D+QDLLMR+TLDS
Sbjct  141   KWRHQRKLASYEFSTKVLRDSSSVVFQQNAAKLVRKISDAVNTATMIDVQDLLMRLTLDS  200

Query  1245  ICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQS  1069
             I KVGFGVE+ TL+  N     F+KAFD +N IV  R+ D  W+IKK LN+G EA L ++
Sbjct  201   IFKVGFGVELDTLSGSNEFGVHFSKAFDDSNSIVFRRYADLFWEIKKLLNIGLEAQLKRN  260

Query  1068  IRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELG-KDPENNINDKSLRDIVLN  892
             ++ IDDF Y +I  ++ +++  Q  E   K DILSRFI    KDPEN + D+ LRDI+LN
Sbjct  261   LKLIDDFVYQLIHHKREQMKSRQ--ETKSKEDILSRFILASEKDPEN-MTDRYLRDIILN  317

Query  891   FVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESL  712
             F+IAG+DT+A TLSW  +M+  H  + EK+  E+  V +    + ++             
Sbjct  318   FLIAGKDTSANTLSWFFFMMCKHPLLQEKIAIEIREVTKFEGGKTDI-------------  364

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
                 M+F+  LN + + +++YLH+ + ETLRLYPAVP D K   EDDVLPDG +VK G  
Sbjct  365   ----MEFSACLNEEVIGRMHYLHAALAETLRLYPAVPVDVKISDEDDVLPDGFKVKKGDA  420

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             V Y+ Y+MGRM Y WG DA  F+PERWL++GVF+  SPFKF AF AGPRICLGK+ AY Q
Sbjct  421   VNYLTYAMGRMTYLWGEDAEDFRPERWLENGVFRPESPFKFVAFNAGPRICLGKEFAYRQ  480

Query  351   MKMALAILCRFFKFKL-VEGHSVEYRMMTVLSMAHGLKLTVSPR  223
             MK+  A L  FFKFKL  E  +  YR M  L M  GL L    R
Sbjct  481   MKILTAALLHFFKFKLDDESKTAAYRTMFTLHMDKGLPLLAYHR  524



>ref|XP_006652670.1| PREDICTED: cytochrome P450 704C1-like [Oryza brachyantha]
Length=507

 Score =   419 bits (1076),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 236/488 (48%), Positives = 307/488 (63%), Gaps = 24/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G    Q+ N+GR  ++         +  +  P   Y Y   P NVEH+LKTNF NY 
Sbjct  40    PVAGTVFHQLLNFGRFVEYQTDLSRRYRTFRMLTPTCNYVYTVEPANVEHILKTNFANYG  99

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG + H  ME LLGDGIFN DG +WR+QRK ASLEF+++ LRD+S+ VF D + +L  IL
Sbjct  100   KGPMTHEVMEDLLGDGIFNVDGGMWRQQRKVASLEFSTRVLRDYSSAVFGDTAAELAGIL  159

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLR  1138
              + +   +++DMQDLLMR TLDS  +VGFGV +G L+ +  E   FA+AFD A+  V  R
Sbjct  160   ERGAAGGERLDMQDLLMRATLDSFFRVGFGVNLGVLSGSSKEGAAFARAFDDASEQVLFR  219

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             F D LWK+K+FLN+ SEA + +SI TI+DF Y+VI  RK +    ++ E + K DILSRF
Sbjct  220   FFDLLWKVKRFLNISSEASMKKSISTINDFVYAVI-DRKIDQMSREQQEFAKKEDILSRF  278

Query  957   -IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
              +E  +DP +  ++K +RDI+LNFVIAGRDTTA TLSW +Y +  ++ V +K+  E   V
Sbjct  279   LLERERDP-SCFDNKYIRDIILNFVIAGRDTTAGTLSWFLYALCKNQRVQQKIARE---V  334

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
              E    + +V +                 F   L  D ++K+ YLH+ +TETLRLYP VP
Sbjct  335   REATTSDRDVGVQ---------------DFTAFLTEDAISKMQYLHAALTETLRLYPGVP  379

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNA  424
              D K    DD LPDG  VK G MV Y PY MGRME+ WG DA  F+PERWL D GVF   
Sbjct  380   IDVKYCFSDDTLPDGHAVKKGDMVNYQPYPMGRMEFLWGDDAGEFRPERWLDDSGVFVPE  439

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH-SVEYRMMTVLSMAHG  247
             SPFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF+F++ + + +V YR M  L M   
Sbjct  440   SPFKFTAFQAGPRICLGKEFAYRQMKIVSAVLLYFFRFEMWDDNATVGYRPMLTLKMDGP  499

Query  246   LKLTVSPR  223
             L L V  R
Sbjct  500   LYLRVLAR  507



>gb|KCW78249.1| hypothetical protein EUGRSUZ_D02437 [Eucalyptus grandis]
Length=448

 Score =   417 bits (1071),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 220/453 (49%), Positives = 293/453 (65%), Gaps = 26/453 (6%)
 Frame = -1

Query  1572  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  1393
             PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG  WR+QRK +S 
Sbjct  16    PFRSEVYTSDPANVEYMLKTNFENYGKGWYNNSLLKDLLGDGIFAVDGNKWRQQRKVSSY  75

Query  1392  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIG  1213
             EF+ K LRDFS+VVFR  + KL   L++A+  NQ VDMQDL M+ TLDSI KV FGVE+ 
Sbjct  76    EFSRKVLRDFSSVVFRRTAAKLANTLSEAASTNQIVDMQDLFMKSTLDSIFKVAFGVELD  135

Query  1212  TLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             ++     E   F++AFD A+ I   R++D  WKIKKFLN+GSEA L ++IR +D+F Y +
Sbjct  136   SMCGTNEEGAEFSRAFDDASAITLRRYVDISWKIKKFLNIGSEAALKKNIRIMDNFVYKL  195

Query  1035  IRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
             IR++  ++  +  +    K DILSRF+++        +   LRDI+LNF+IAG+DTTA T
Sbjct  196   IRRKIEQMHNSTDDPSMKKEDILSRFLQV-----TETDQTYLRDIILNFIIAGKDTTAAT  250

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSW IYM+  H  + EK+  E   V++M   EE   +  +++            FA  + 
Sbjct  251   LSWFIYMLCKHPTIQEKVAQE---VKQMSNVEE---ISDFAN------------FAASMG  292

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
              + + K++YLH+ +TETLRLYPAVP D K    DDV PDG  V+ G MV++ PY+MGRM+
Sbjct  293   EEALEKMHYLHATITETLRLYPAVPLDAKICFSDDVFPDGFNVRKGDMVSFQPYAMGRMK  352

Query  495   YNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
             + WG DA  F PERWL  +GVFQ  SPFKFTAFQAGPRICLGK+ AY QMK+   +L   
Sbjct  353   FIWGDDAEDFHPERWLDSNGVFQPESPFKFTAFQAGPRICLGKEFAYRQMKIFSVVLLSC  412

Query  318   FKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             F FKL  E   V YR M  L +  GL ++V+ R
Sbjct  413   FTFKLADEKKPVNYRTMINLHIDGGLPVSVTRR  445



>gb|KCW78252.1| hypothetical protein EUGRSUZ_D02439 [Eucalyptus grandis]
Length=446

 Score =   417 bits (1071),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 295/454 (65%), Gaps = 26/454 (6%)
 Frame = -1

Query  1572  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  1393
             PF +  Y + P NVE++LKTNF NY KG   +S ++ LLGDGIF  DG+ WR+QRK +S 
Sbjct  16    PFRSEVYTSDPANVEYMLKTNFENYGKGWYSYSLLKDLLGDGIFTVDGDKWRQQRKVSSY  75

Query  1392  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIG  1213
             EF++K LRDFS+VVFR  + KL  IL++A+  NQ VDMQDL M+ TLDSI KV FGVE+ 
Sbjct  76    EFSTKVLRDFSSVVFRRTAAKLANILSEAASTNQIVDMQDLFMKSTLDSIFKVAFGVELD  135

Query  1212  TLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
             ++     E   F++AFD A+ I   R++D  WKIKKFLN+GSEA L ++IR I++F Y +
Sbjct  136   SMCGTNEEGAEFSRAFDDASAITLWRYVDISWKIKKFLNIGSEAALMKNIRIINNFVYKL  195

Query  1035  IRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
             I ++  ++  +  +    K DILSRF+++        +   LRDI+LN +IAG+DTTA T
Sbjct  196   ITRKIEQMHNSTDDPSMKKEDILSRFLQV-----TETDQTYLRDIILNLIIAGKDTTAAT  250

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSW IYM+  H  + EK+  E   V++M   EE   +  +++            FA  + 
Sbjct  251   LSWFIYMLCKHPTIQEKVAQE---VKQMSNVEE---ISDFAN------------FAASMG  292

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
              + + K++YLH+ +TETLRLYPAVP D K    DDV PDG  V+ G MV++ PY+MGRM+
Sbjct  293   EEALEKMHYLHATITETLRLYPAVPFDAKICFSDDVFPDGFNVRKGDMVSFQPYAMGRMK  352

Query  495   YNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
             + WG DA  F PERWL  +GVFQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L   
Sbjct  353   FIWGDDAEDFHPERWLDSNGVFQPESPFKFTAFQAGPRICLGKEFAYWQMKIFSAVLLSC  412

Query  318   FKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             F FKL  E   V YR M  L +  GL ++V+ R 
Sbjct  413   FTFKLADEEKPVHYRTMITLHIDGGLHVSVTRRC  446



>ref|XP_008669003.1| PREDICTED: cytochrome P450 704C1-like [Zea mays]
 tpg|DAA36390.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=507

 Score =   418 bits (1075),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 233/500 (47%), Positives = 310/500 (62%), Gaps = 25/500 (5%)
 Frame = -1

Query  1704  QRKGGGP-RSWP-VIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNV  1531
             +R+GGG  RS+P V G  + Q+ N+GR+ ++         +  +  P  +Y Y   P NV
Sbjct  26    RRRGGGKNRSYPPVAGTVLHQLFNFGRLMEYQTALSRRYRTFRMLTPTCSYIYTVEPANV  85

Query  1530  EHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVV  1351
             E++LKTNF NY KG   H   E LLGDGIFN DG  WR QRK AS EF+++ LRD+ST V
Sbjct  86    EYILKTNFGNYGKGSTLHELSEDLLGDGIFNVDGAKWRHQRKVASHEFSTRVLRDYSTGV  145

Query  1350  FRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKA  1171
             FRD + +L  I+  A+   +++DMQ+LLMR TLDSI KVGFGV +G L+ +  E      
Sbjct  146   FRDTAAELAGIVAAAAAAGEKLDMQELLMRSTLDSIFKVGFGVNLGVLSGSSEEGAAFAK  205

Query  1170  FDAANIIVTL-RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKN  994
                      L RF+DP WK K+FLN+ SEA + +S+RTI+DF Y+V+  RK E     + 
Sbjct  206   AFDDASEQVLHRFLDPFWKAKRFLNLSSEAAMKRSLRTINDFVYAVV-DRKIEQMGRDQQ  264

Query  993   EKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHED  817
             E + K DILSRF +E   DP    ++K LRDI+LNFVIAGRDTTA TLSW +Y++  ++ 
Sbjct  265   EFAKKEDILSRFLVERESDP-GCFDNKYLRDIILNFVIAGRDTTAGTLSWFLYVLCKNQS  323

Query  816   VAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSV  637
             + +++       +E+RA          +S D   L   A +    L  D ++K++YLH+ 
Sbjct  324   IQDRI------AQEVRAA---------TSGDGGGLG--APELVACLTEDAISKMHYLHAA  366

Query  636   VTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPE  457
             +TETLRLYP+VP D K    DD LPDG  VK G MV Y PY MGRM + WG DA  F+PE
Sbjct  367   LTETLRLYPSVPIDVKCCFSDDTLPDGYAVKKGDMVNYQPYQMGRMRFLWGADAEEFRPE  426

Query  456   RWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH-SVE  283
             RWL D GVF   SPFKFTAFQAGPR+CLGK+ AY QMK+  A+L   F+F++ + + +V 
Sbjct  427   RWLDDAGVFVPESPFKFTAFQAGPRVCLGKEFAYRQMKIFAAVLLYLFRFEMWDANATVG  486

Query  282   YRMMTVLSMAHGLKLTVSPR  223
             YR M  L +   L L  S R
Sbjct  487   YRAMLTLKIDRPLYLRTSLR  506



>ref|XP_008343023.1| PREDICTED: cytochrome P450 704C1-like [Malus domestica]
Length=503

 Score =   418 bits (1075),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 226/531 (43%), Positives = 327/531 (62%), Gaps = 40/531 (8%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             S P   +S+  L+      +  W    +L++RK   P   PV G  + Q+ N+ R+HD++
Sbjct  5     SYPFLFTSLVLLLSIFTAQILAW----KLTKRKRKYP---PVAGTILHQLLNFNRLHDYM  57

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                 A   +  +  PF    Y ++P NVE++LKTNF NY KG   ++ ++ LLGDGIF  
Sbjct  58    TDLAAKYKTYRLIGPFRNEVYTSNPKNVEYILKTNFDNYGKGWYNYNLLKDLLGDGIFTV  117

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             DG+ WR+QRK +S EF+++ LR+FS+ VF+  + K+   L++ +  +Q +D+QD+ M+ T
Sbjct  118   DGDKWRQQRKISSHEFSTRMLREFSSAVFQKNAAKVADKLSEIATASQTIDIQDMFMKST  177

Query  1254  LDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI KV FG E+  +  +  E R F  AFD ++ +   R++D  W+IKKFLN+GSEA L
Sbjct  178   LDSIFKVAFGTELDNMCGSSQEGRSFGDAFDNSSALSLWRYVDVFWRIKKFLNLGSEAAL  237

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM----KHDILSRFIELGKDPENNINDKSL  910
              ++I+ ID+F + +I  +   IE+ QKN+ S     + DILSRF++      +  N   L
Sbjct  238   RKNIKIIDEFVFKLIHTK---IEQMQKNDNSSVTVDREDILSRFLQ-----ASETNPVYL  289

Query  909   RDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSS  730
             RDI+LNF+IAG+DTTATTL+W IY++  H  V EK+  E++ V  M+       +  +S 
Sbjct  290   RDIILNFIIAGKDTTATTLAWFIYLLCKHPSVQEKIVHEVKQVTGMKR------ITSFS-  342

Query  729   DDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTR  550
                        +FA  L+ D + K++YLH+ +TETLR+YPAVP D K    DD LPDG  
Sbjct  343   -----------EFADSLSEDVLEKMHYLHAAITETLRIYPAVPVDAKICFSDDTLPDGYS  391

Query  549   VKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLG  373
             V+ G MV+Y PY+MGRM++ WG DA  F+PERWL ++GVFQ  SPFKFTAFQAGPR+CLG
Sbjct  392   VRKGDMVSYQPYAMGRMKFIWGDDAEEFRPERWLNENGVFQPESPFKFTAFQAGPRMCLG  451

Query  372   KDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             K+ AY Q+K+  A+    F FKL  E   V YR M  L +  GL++    R
Sbjct  452   KEFAYRQLKIFSAVFLSCFVFKLSDENAVVTYRTMINLHIKGGLQVRAFHR  502



>ref|XP_008777558.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Phoenix dactylifera]
Length=528

 Score =   419 bits (1076),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 227/488 (47%), Positives = 306/488 (63%), Gaps = 24/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G    Q+  +  +HD+     A   +  +  P  +  Y   P  VE++L+TN+ NY 
Sbjct  50    PLTGTVFHQILYFSTVHDYHTDLAARFKTFRLFSPTRSLIYTVDPAIVEYILRTNYTNYG  109

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   ++ ++ LLGDGIF  DGE WR QRK AS EF +KNLRDFS+ VFR  + +L  I+
Sbjct  110   KGSYNYNNLKDLLGDGIFAVDGEKWRHQRKLASYEFTTKNLRDFSSDVFRSNASRLSLII  169

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLR  1138
             ++A+  NQ +D+QDL M+ TLDSI K+GFG E+ TL+    E N FAKAFD ++ ++  R
Sbjct  170   SKAANSNQALDIQDLFMKSTLDSIFKIGFGEELDTLSGLSEEGNSFAKAFDDSSDLILWR  229

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WKIK+FL VGSEA L ++IR ID F Y +I  RK +    Q+N+   K DILSRF
Sbjct  230   YVDIFWKIKRFLGVGSEAELKKNIRLIDGFAYKLIH-RKTQSMSKQQNDTMKKEDILSRF  288

Query  957   -IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
              ++  KDP+ N+ND+ LRDI+LNF+IAGRDTTA TLSW  YM+  H  + EKL  E++  
Sbjct  289   LVQKTKDPK-NLNDQYLRDIILNFIIAGRDTTAVTLSWFFYMLCKHPSLQEKLAQEIKEA  347

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
              +              ++D  S+     +F   L  + + K+ YLH+ +TETLR+YPA+P
Sbjct  348   TK--------------TNDSISI----AEFPSRLTDEALDKMQYLHAALTETLRIYPAIP  389

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNA  424
             QDPK    DD LP G  VK G MV ++PYSMGRM++ W  DA  F PERWL + GVF+  
Sbjct  390   QDPKICFSDDTLPGGFDVKKGDMVCFLPYSMGRMKFLWRVDAEVFHPERWLDEHGVFRPE  449

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHG  247
             +PFKFTAFQAGPRICLGK+ AY QMK+  A+L  FF F L  E   V+Y+    L +  G
Sbjct  450   NPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLIHFFTFMLSDERKDVKYKSTLTLRIDQG  509

Query  246   LKLTVSPR  223
             L L    R
Sbjct  510   LHLLAYQR  517



>ref|XP_011101147.1| PREDICTED: cytochrome P450 704C1-like [Sesamum indicum]
Length=524

 Score =   419 bits (1076),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/490 (46%), Positives = 304/490 (62%), Gaps = 26/490 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G  + Q+ ++ R+ D+ V      ++  +     +  Y   P NVE++LK NFPNY 
Sbjct  58    PVAGPMLNQLIHFNRLFDYQVTLARRYHTYRLITESHSEVYTTDPLNVEYILKANFPNYG  117

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KGE     M+ L GDGIF  DG  WR QRK AS EF++K LRDFS+ VFR  + KL   +
Sbjct  118   KGEKNCDLMKDLFGDGIFAVDGTKWRHQRKLASYEFSAKVLRDFSSSVFRSNAAKLALKV  177

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLR  1138
                +L  ++VD+QD+LM+  +D++ KVGFGV++ TL+  +   N+F KAFD +N+IV  R
Sbjct  178   NSEALAGREVDLQDMLMKSAMDTMFKVGFGVDLDTLSGSDETSNQFIKAFDDSNVIVYWR  237

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  WK+K+F N+G E  L  +I+ ID+F Y +I  ++   E+ +  + + K DILSRF
Sbjct  238   YVDVFWKVKRFFNIGLERNLKDNIKVIDNFVYMLIHHKR---EQMRNEQGTTKEDILSRF  294

Query  957   -IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
              IE  KD EN + DK LRDI+LNF+IAG+DT+A TL+W  YM+  H  + EK+  E++  
Sbjct  295   LIESEKDKEN-MTDKYLRDIILNFLIAGKDTSANTLAWFFYMLCRHPLIQEKVVREVKLA  353

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
              E++         Q S D          +F   L    + ++ YLH+ +TETLRLYP VP
Sbjct  354   TEVK--------DQISVD----------EFVVKLTEAALDRMQYLHATLTETLRLYPPVP  395

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K    DD+LPDG ++K G  +TY+PY+MGRM Y WG DA  F PERWL +G FQ  S
Sbjct  396   LDGKCSNADDILPDGHKIKKGDGITYMPYAMGRMTYIWGDDAEVFCPERWLGNGAFQAES  455

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             PFKFTAFQAGPRICLGK+ AY QMK+  A L  FF+FKLV E     YR M  L M +GL
Sbjct  456   PFKFTAFQAGPRICLGKEFAYTQMKIMAATLLFFFRFKLVDEAKEATYRTMFTLHMDNGL  515

Query  243   KLTVSPRTHN  214
              L   PR HN
Sbjct  516   HLYAYPR-HN  524



>ref|XP_006468806.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Citrus sinensis]
 ref|XP_006490272.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Citrus sinensis]
 ref|XP_006490718.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Citrus sinensis]
Length=523

 Score =   418 bits (1075),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 219/487 (45%), Positives = 305/487 (63%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G  +  + ++ R+ D+         +  +  P  +  +   P N+EH+LKTNF NY 
Sbjct  58    PVAGLMLNLLIHFSRLFDYQTSLAKKYRTFRLLQPSCSEIFTTDPVNIEHILKTNFSNYG  117

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG+   + M  L GDGIF  DG+ WR QRK AS EF++K LRDFS+ VFR  + KL +  
Sbjct  118   KGDYNWNLMRDLFGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVFRANAEKLTSKF  177

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP-ENRFAKAFDAANIIVTLR  1138
             + A+   Q +DMQD+L++ +LDSI KVGFGVE+ +L+ +    N+F KAFD +N IV  R
Sbjct  178   SVAAAAKQAIDMQDVLLKSSLDSIFKVGFGVELNSLSGSDDFGNQFTKAFDDSNFIVYCR  237

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  W++K++LN+G EA L ++I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  238   YVDVFWELKRYLNIGMEASLKRNIKLIDSFIFELIRCKREQMKNVELDRG--KEDILSRF  295

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDPE+ + DK LRDI LNF+IAG+DTTA TL+W  YM+  H  + EK   ++   
Sbjct  296   LLESEKDPES-MTDKYLRDITLNFIIAGKDTTANTLTWFFYMLCKHPLIQEKAALDVREA  354

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
              E +                   N  A +FA L+    + K++YLH+ ++ETLRLYPAVP
Sbjct  355   TEAQG------------------NLCADEFAKLVTEAALEKMHYLHAALSETLRLYPAVP  396

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  V Y+ Y+MGRM Y WG DA  F+PERWL +GVF++ S
Sbjct  397   VDGKNAAEDDILPDGFKVKKGDGVNYMTYAMGRMTYIWGEDAEEFRPERWLVNGVFRSES  456

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             P+KF AFQAGPRIC GK+ AY QMK+  A+L +FF+FKLV E     YR M  L +  GL
Sbjct  457   PYKFAAFQAGPRICPGKEFAYRQMKILAAVLLQFFRFKLVDETKEATYRTMFTLHVDKGL  516

Query  243   KLTVSPR  223
              L   PR
Sbjct  517   HLYAYPR  523



>ref|XP_006421783.1| hypothetical protein CICLE_v10004720mg [Citrus clementina]
 gb|ESR35023.1| hypothetical protein CICLE_v10004720mg [Citrus clementina]
Length=527

 Score =   418 bits (1075),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 219/487 (45%), Positives = 305/487 (63%), Gaps = 24/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G  +  + ++ R+ D+         +  +  P  +  +   P N+EH+LKTNF NY 
Sbjct  62    PVAGLMLNLLIHFSRLFDYQTSLAKKYRTFRLLQPSCSEIFTTDPVNIEHILKTNFSNYG  121

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG+   + M  L GDGIF  DG+ WR QRK AS EF++K LRDFS+ VFR  + KL +  
Sbjct  122   KGDYNWNLMRDLFGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVFRANAEKLTSKF  181

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP-ENRFAKAFDAANIIVTLR  1138
             + A+   Q +DMQD+L++ +LDSI KVGFGVE+ +L+ +    N+F KAFD +N IV  R
Sbjct  182   SVAAAAKQAIDMQDVLLKSSLDSIFKVGFGVELNSLSGSDDFGNQFTKAFDDSNFIVYCR  241

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             ++D  W++K++LN+G EA L ++I+ ID F + +IR ++ +++  + +    K DILSRF
Sbjct  242   YVDVFWELKRYLNIGMEASLKRNIKLIDSFIFELIRCKREQMKNVELDRG--KEDILSRF  299

Query  957   I-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESV  781
             + E  KDPE+ + DK LRDI LNF+IAG+DTTA TL+W  YM+  H  + EK   ++   
Sbjct  300   LLESEKDPES-MTDKYLRDITLNFIIAGKDTTANTLTWFFYMLCKHPLIQEKAALDVREA  358

Query  780   EEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
              E +                   N  A +FA L+    + K++YLH+ ++ETLRLYPAVP
Sbjct  359   TEAQG------------------NLCADEFAKLVTEAALEKMHYLHAALSETLRLYPAVP  400

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNAS  421
              D K   EDD+LPDG +VK G  V Y+ Y+MGRM Y WG DA  F+PERWL +GVF++ S
Sbjct  401   VDGKNAAEDDILPDGFKVKKGDGVNYMTYAMGRMTYIWGEDAEEFRPERWLVNGVFRSES  460

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             P+KF AFQAGPRIC GK+ AY QMK+  A+L +FF+FKLV E     YR M  L +  GL
Sbjct  461   PYKFAAFQAGPRICPGKEFAYRQMKILAAVLLQFFRFKLVDETKEATYRTMFTLHVDKGL  520

Query  243   KLTVSPR  223
              L   PR
Sbjct  521   HLYAYPR  527



>ref|XP_008777680.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Phoenix dactylifera]
Length=528

 Score =   418 bits (1075),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 225/515 (44%), Positives = 313/515 (61%), Gaps = 26/515 (5%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             ++A  ++  C     + +++K    R  P+ G    Q+  +  +HD+     A   +  +
Sbjct  26    LIATAIVCLCLHCFIKATRKK----RYPPLTGTIFHQILYFSTVHDYHTDLAARFKTFRL  81

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               P  +      P  VE++L+TN+ NY KG   H+ ++ LLGDGIF  DGE WR QRK A
Sbjct  82    FSPTRSLICTVDPAIVEYILRTNYTNYGKGSYNHNNLKDLLGDGIFAVDGEKWRHQRKLA  141

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EF +KNLRDFS  VFR  + +L  I+++A+  NQ +D+QDL M+ TLDSI K+GFG E
Sbjct  142   SYEFTTKNLRDFSCDVFRSNASRLSLIISKAANSNQAMDIQDLFMKSTLDSIFKIGFGEE  201

Query  1218  IGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             + TL+    E N FAKAFD ++ ++  R++D  WK+K+FL VGSEA L ++IR +D F Y
Sbjct  202   LDTLSGLSEEGNSFAKAFDDSSDLILWRYVDIFWKVKRFLGVGSEAELKKNIRVVDGFAY  261

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
              +I  RK +    Q+N+   K DILSRF+    +   N+ND+ LRDI+LNF+IAGRDTTA
Sbjct  262   KLIH-RKTQSMSKQQNDTMKKEDILSRFLVQKTEDPKNLNDQYLRDIILNFIIAGRDTTA  320

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
              TLSW  YM+  H  + EKL  E++   +              ++D  S+     +F   
Sbjct  321   VTLSWFFYMLCKHPSLQEKLAQEIKGATK--------------TNDSISI----AEFTSR  362

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L  + + K+ YLH+ +TETLR+YPAVP+DPK    DD LP G  VK G MV ++PYSMGR
Sbjct  363   LTDEALDKMQYLHAALTETLRIYPAVPEDPKICFSDDTLPGGFDVKKGDMVCFLPYSMGR  422

Query  501   MEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             M++ WG DA  F+PERWL ++G F+  +PFKFTAFQAGPRICLGK+ AY QM++  A+L 
Sbjct  423   MKFLWGVDAEVFRPERWLDENGAFRPENPFKFTAFQAGPRICLGKEFAYRQMEIFAAVLI  482

Query  324   RFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
              FF F L  E   V Y+    L +  GL L    R
Sbjct  483   HFFTFMLSDERKDVNYKNTITLRIDQGLHLLAYQR  517



>ref|XP_010934570.1| PREDICTED: cytochrome P450 704C1-like [Elaeis guineensis]
Length=526

 Score =   418 bits (1074),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 228/526 (43%), Positives = 316/526 (60%), Gaps = 26/526 (5%)
 Frame = -1

Query  1785  LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  1606
             L ++    ++  +  I+   +F  + S +K   P   P+ G    Q+  +  + D+    
Sbjct  24    LSIAFAAIILYVVASIISFSIFYIKESIQKADRP---PIAGTVFHQLIYFNTLFDFQTNI  80

Query  1605  LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  1426
                  +  +  P  +  + A P N+EH+LK+NF  Y KG+  +  M+ L GDGIF  DG+
Sbjct  81    ARRHQTCRLIGPSHSEIFTADPANIEHILKSNFSKYSKGQDNYLIMKDLFGDGIFVVDGK  140

Query  1425  LWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDS  1246
              WR QRK AS EF++K +RDFS+VVF+  + KL   ++ A      +DMQDLLMR+TLDS
Sbjct  141   KWRHQRKVASYEFSTKVIRDFSSVVFQQNAAKLVRKISDAVNTATMIDMQDLLMRLTLDS  200

Query  1245  ICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQS  1069
             I KVGFGVE+ TL+  N    RF+KAFD +N IV  R+ D  W+IK+ LN+G EA L ++
Sbjct  201   IFKVGFGVELDTLSGSNEFGVRFSKAFDDSNSIVFRRYADIFWEIKRLLNIGLEAQLKRN  260

Query  1068  IRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELG-KDPENNINDKSLRDIVLN  892
             ++ IDDF Y +I  ++ +++  +  E   K DILSRFI    KDPEN + D+ LRDI+LN
Sbjct  261   LKVIDDFVYQLIYHKREQLQSGR--EAKSKEDILSRFILASEKDPEN-MTDRYLRDIILN  317

Query  891   FVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESL  712
             F+IAG+DT+A TLSW  +M+  H  V EK+  E+  V +      ++             
Sbjct  318   FLIAGKDTSANTLSWFFFMLCKHPLVQEKIAIEIREVTKFEGGRTDI-------------  364

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
                 M+F+  L+ + + +++YLH+ +TETLRLYPAVP D K   EDDVLPDG ++K G  
Sbjct  365   ----MEFSACLSEEVIDRMHYLHAALTETLRLYPAVPVDVKIADEDDVLPDGFKIKKGDA  420

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             V Y+ Y+MGRM Y WG DA  F+PERWL++GVF+  SPFKF AF  GPRICLGK  AY Q
Sbjct  421   VNYLTYAMGRMTYLWGEDAEEFRPERWLENGVFRPESPFKFIAFNGGPRICLGKQFAYRQ  480

Query  351   MKMALAILCRFFKFKL-VEGHSVEYRMMTVLSMAHGLKLTVSPRTH  217
             MK+  A L  FFKFKL  E  +  YR M  L M  GL L    R +
Sbjct  481   MKILAAALLHFFKFKLDDESKTAAYRTMFTLHMDKGLPLLAYHRLY  526



>ref|XP_010092871.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXB52689.1| Cytochrome P450 704C1 [Morus notabilis]
Length=506

 Score =   417 bits (1071),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 233/533 (44%), Positives = 326/533 (61%), Gaps = 37/533 (7%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASV-EQMTNYGRMHDW  1618
             SNP+  +++ TL+L+L  +      ++     K    R +P IG ++  Q+ N+ R+H +
Sbjct  5     SNPVFFAAL-TLILSLLTVQILAKILN-----KSKPQRKYPPIGGTMFHQLLNFKRLHHY  58

Query  1617  LVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFN  1438
             +        +  +  PF    Y + P NVE++LKTNF NY KG      +  LLGDGIF 
Sbjct  59    MTELAEKHKTYRIISPFRNEIYTSDPVNVEYILKTNFENYGKGSYNCDILRDLLGDGIFA  118

Query  1437  ADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRM  1258
              DGE WR+QRK +S EF++K LRDFSTV+FR  + K+  IL++ +  N+ +D+QDL M+ 
Sbjct  119   VDGEKWRQQRKISSHEFSTKVLRDFSTVIFRKNAAKVADILSEIAKTNKTIDIQDLFMKA  178

Query  1257  TLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAI  1081
             TLDSI +V FGVE+ ++  +  E + F+ AFD A+ +   R++D  WK+KKFLN+GSEA 
Sbjct  179   TLDSIFQVAFGVELDSMCGSSEEGKSFSNAFDDASSLTLWRYVDAFWKLKKFLNIGSEAT  238

Query  1080  LDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMK-HDILSRFIELGK-DPENNINDKSLR  907
             L +    I+ F + +IR  K E  ++ K E SMK  DILSRF+++ + DP        LR
Sbjct  239   LKKKTDIINGFVFKLIRN-KIEQMKSSKEEYSMKREDILSRFLQVTETDP------TYLR  291

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+LNF+IAG+DTTATTL+W IY++  H  V +K+  EL   E   AKE    +      
Sbjct  292   DIILNFIIAGKDTTATTLAWFIYLLCKHPHVQDKIVKELR--ELTNAKEVTNFV------  343

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
                       +FA  L+ + +  + YLH+ +TETLR+YPAVP D K    DD+LPDG  V
Sbjct  344   ----------EFANSLSEEVLESMQYLHAAITETLRIYPAVPVDAKNCFSDDMLPDGFAV  393

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGK  370
             K G M+ Y PY+MGRM++ WG DA  F+PERWL + GVFQ  SPFKFTAFQAGPRICLGK
Sbjct  394   KKGDMMAYQPYAMGRMKFIWGDDAEEFRPERWLNEKGVFQPESPFKFTAFQAGPRICLGK  453

Query  369   DSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRTHN  214
             + AY Q+K+  A+L   F FK+  E   V YR M  L +  GL++ +  R  N
Sbjct  454   EFAYRQLKIFAAVLLSCFVFKMSDEEKIVHYRTMINLHIDGGLEVRIFRRNGN  506



>ref|XP_009400465.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. 
malaccensis]
Length=504

 Score =   416 bits (1070),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 224/489 (46%), Positives = 301/489 (62%), Gaps = 26/489 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV+G    Q  N+ R+HD+            +  P     Y   P  VE++LKTNF NY 
Sbjct  37    PVVGTIFHQFLNFRRLHDYHTQLSVKHKIFRLFSPLCHQIYTTDPAVVEYILKTNFDNYG  96

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   +  M+ L GDGIF  DG+ WR QRK AS  F++K LR+FS  +F+  ++KL  +L
Sbjct  97    KGWYNYGNMKDLFGDGIFAVDGDKWRHQRKLASFGFSTKVLREFSGAIFKRNAVKLAHVL  156

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR---FAKAFDAANIIVT  1144
             +  +  +++ DMQDLLM+ T+DSI K+GFG+E+  L  +  +NR   FAKAFD +N  + 
Sbjct  157   SSYATSDEKFDMQDLLMKSTMDSIFKIGFGLELNCLDDS--DNRGSEFAKAFDVSNEFIM  214

Query  1143  LRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILS  964
             +R+++  WK+ +FLN+GSE  L   ++ +DDF Y ++R R  E+   + ++   K DILS
Sbjct  215   MRYVNAFWKVMRFLNIGSEKTLKSKVKFVDDFIYKLLRIRVEEM-SNEGSDSEGKDDILS  273

Query  963   RFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELES  784
             RF+E  +    NI+ K LRDI+LNF+IAG+DTTA TL+W  Y I     V EK++ E++ 
Sbjct  274   RFLEESRKDPQNIDLKYLRDIILNFMIAGKDTTAGTLAWFFYSICKDPPVQEKIYQEIKE  333

Query  783   VEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAV  604
             V E  A E+        S D ESLN                 ++YLH+ ++ETLRLYPAV
Sbjct  334   VIE--ASEDAAFDAFAESIDDESLNN----------------MHYLHAALSETLRLYPAV  375

Query  603   PQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQN  427
             P + K    DD+LP G  V+ G +V Y PY+MGRMEY WG DA  F+PERWL D GVFQ 
Sbjct  376   PLENKVCFADDILPGGYNVRKGDIVFYQPYAMGRMEYLWGKDAEIFRPERWLDDGGVFQP  435

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAH  250
              SP+KF+AFQAGPRICLGK+ AY QMK+  A+L RFFKFKL  E   VEYR MT L +  
Sbjct  436   ESPYKFSAFQAGPRICLGKEFAYRQMKIFAAVLLRFFKFKLGDEKKDVEYRTMTTLHIDQ  495

Query  249   GLKLTVSPR  223
             GL L V  R
Sbjct  496   GLYLQVLHR  504



>ref|XP_009593545.1| PREDICTED: cytochrome P450 704C1-like [Nicotiana tomentosiformis]
Length=511

 Score =   416 bits (1069),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/492 (45%), Positives = 304/492 (62%), Gaps = 22/492 (4%)
 Frame = -1

Query  1689  GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTN  1510
              P+  PV+G    Q+  + R++D+       + +  +  P  + TY     N+EH+LKTN
Sbjct  37    NPKYAPVVGTVFHQLFYFNRLYDYQTEVAKKTPTSRLLSPEQSETYTTDSRNIEHILKTN  96

Query  1509  FPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLK  1330
             F  Y KG+     +  L G+GIF  DGE W++QRK +S EF+++ LRDFS  VFR  + K
Sbjct  97    FSKYSKGKRNQEVLRDLFGEGIFAVDGEKWKQQRKLSSFEFSARVLRDFSCTVFRKRATK  156

Query  1329  LFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTL-APNLPENRFAKAFDAANI  1153
             L + ++  SL NQ  DMQ+LLMR +LDSI KVGFGV++  L       N+F KAFD +N 
Sbjct  157   LVSKVSDFSLANQVFDMQELLMRSSLDSIFKVGFGVDLNCLNGSGGDNNKFIKAFDDSNE  216

Query  1152  IVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHD  973
             +   R++DP WK+K+F N+GSE +L ++I+ I +F   +IR R+ ++E   K +   K D
Sbjct  217   LTYWRYVDPFWKLKRFFNIGSEFLLKKNIKYIHEFVDELIRTRRKQLE--MKQDSMDKED  274

Query  972   ILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWS  796
             ILSRF +E  KDPE  +ND+ LRDI+LNF++AG+D++A TLSW  YM+     +  K+  
Sbjct  275   ILSRFLVESKKDPEK-MNDQYLRDIILNFMLAGKDSSANTLSWFFYMLCKSPLIQVKV--  331

Query  795   ELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRL  616
                 VEE+R       +  Y+  D ES++     F   +  + + K++YLH+ +TETLRL
Sbjct  332   ----VEEIRQ------VIGYNISDSESVDD----FVASITEEVLEKMHYLHATLTETLRL  377

Query  615   YPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGV  436
             YPAVP D +    DDVLPDG  ++ G  V Y+ Y+MGRM Y WG DA  F+PERWLKDG+
Sbjct  378   YPAVPVDGRCADADDVLPDGFHIRKGDGVYYISYAMGRMPYIWGNDAEDFRPERWLKDGI  437

Query  435   FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLS  259
             FQ  SPFKF AF AGPRICLGKD AY QMK+    L  FF+FKL +    V YR M  L 
Sbjct  438   FQPESPFKFIAFHAGPRICLGKDFAYRQMKILAIALLHFFRFKLSDDTKEVTYRTMFTLH  497

Query  258   MAHGLKLTVSPR  223
             +  GL +   PR
Sbjct  498   INEGLPVLAVPR  509



>gb|KDO65334.1| hypothetical protein CISIN_1g012536mg [Citrus sinensis]
Length=461

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 301/478 (63%), Gaps = 24/478 (5%)
 Frame = -1

Query  1647  MTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYM  1468
             + ++ R+ D+         +  +  P  +  +   P N+EH+LKTNF NY KG+   + M
Sbjct  5     LIHFSRLFDYQTSLAKKYRTFRLLQPSCSEIFTTDPVNIEHILKTNFSNYGKGDYNWNLM  64

Query  1467  EVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQ  1288
               L GDGIF  DG+ WR QRK AS EF++K LRDFS+ VFR  + KL +  + A+   Q 
Sbjct  65    RDLFGDGIFAVDGDKWRHQRKLASYEFSTKILRDFSSAVFRANAEKLTSKFSVAAAAKQA  124

Query  1287  VDMQDLLMRMTLDSICKVGFGVEIGTLAPNLP-ENRFAKAFDAANIIVTLRFIDPLWKIK  1111
             +DMQD+L++ +LDSI KVGFGVE+ +L+ +    N+F KAFD +N IV  R++D  W++K
Sbjct  125   IDMQDVLLKSSLDSIFKVGFGVELNSLSGSDDFGNQFTKAFDDSNFIVYCRYVDVFWELK  184

Query  1110  KFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFI-ELGKDPE  934
             ++LN+G EA L ++I+ ID F + +IR ++ +++  + +    K DILSRF+ E  KDPE
Sbjct  185   RYLNIGMEASLKRNIKLIDSFIFELIRCKREQMKNVELDRG--KEDILSRFLLESEKDPE  242

Query  933   NNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEEN  754
             + + DK LRDI LNF+IAG+DTTA TL+W  YM+  H  + EK   ++    E +     
Sbjct  243   S-MTDKYLRDITLNFIIAGKDTTANTLTWFFYMLCKHPLIQEKAALDVREATEAQG----  297

Query  753   VLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILED  574
                           N  A +FA L+    + K++YLH+ ++ETLRLYPAVP D K   ED
Sbjct  298   --------------NLCADEFAKLVTEAALEKMHYLHAALSETLRLYPAVPVDGKNAAED  343

Query  573   DVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQA  394
             D+LPDG +VK G  V Y+ Y+MGRM Y WG DA  F+PERWL +GVF++ SP+KF AFQA
Sbjct  344   DILPDGFKVKKGDGVNYMTYAMGRMTYIWGEDAEEFRPERWLVNGVFRSESPYKFAAFQA  403

Query  393   GPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             GPRIC GK+ AY QMK+  A+L +FF+FKLV E     YR M  L +  GL L   PR
Sbjct  404   GPRICPGKEFAYRQMKILAAVLLQFFRFKLVDETKEATYRTMFTLHVDKGLHLYAYPR  461



>ref|XP_003627670.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003636310.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003636831.1| Cytochrome P450 [Medicago truncatula]
 gb|AET02146.1| cytochrome P450 family protein [Medicago truncatula]
Length=515

 Score =   416 bits (1068),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 226/493 (46%), Positives = 303/493 (61%), Gaps = 20/493 (4%)
 Frame = -1

Query  1692  GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKT  1513
             G P+  PV G    Q+ N+  +  +       S +  +  P  +  Y     NVEH+LKT
Sbjct  37    GNPKYPPVKGTVFHQLINFKTLFHYFTKIAQTSPTFRLLAPKKSKIYTCDTKNVEHILKT  96

Query  1512  NFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSL  1333
              F  Y KG+  H  +  LLGDGIF  DG  WR QRK +SLEF+++ LRDFS  VFR  ++
Sbjct  97    QFHKYSKGKFNHDTIFDLLGDGIFAVDGAKWRHQRKLSSLEFSTRVLRDFSCNVFRRNAV  156

Query  1332  KLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAAN  1156
             KL  ++   S      D+QD++M+ TLDSI KVGFGVE+  L  +  E N F KAF+ +N
Sbjct  157   KLVRVVLGFSNAGLAFDIQDIVMKCTLDSIFKVGFGVELNCLEKSSKEANIFMKAFNDSN  216

Query  1155  IIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH  976
               V  R++DPLWK+K+ LN GSEA L ++I+ IDDF +S+I+ R+ E+   QK + S K 
Sbjct  217   AFVFKRYLDPLWKLKRVLNFGSEAALKKNIKIIDDFVHSLIKTRR-ELLSMQK-DFSDKE  274

Query  975   DILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWS  796
             DILSRF+   K   +N+ DK LRDI+LNF+IAG+DT+A TLSW  YM+  +  + EK+  
Sbjct  275   DILSRFLLESKKDSSNMTDKYLRDIILNFMIAGKDTSANTLSWFFYMLCKNPLIQEKVAQ  334

Query  795   ELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRL  616
             E+ +V    ++E N+ L ++ S+  ++               T+ K++YLH+ +TETLRL
Sbjct  335   EVINVTST-SQESNLNLDEFVSNISDA---------------TLDKMHYLHAALTETLRL  378

Query  615   YPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGV  436
             YPAVP   +   E D+LPDG  V  G  V Y+ Y+MGRM Y WG DA  F PERWLKDG+
Sbjct  379   YPAVPMSGRTAEEHDILPDGYIVNKGETVYYLSYAMGRMPYIWGDDAQEFLPERWLKDGI  438

Query  435   FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLS  259
             FQ  S FKF +F AGPRICLGKD AY QMK+    L RFF+FKL  E + V YR M  L 
Sbjct  439   FQPESSFKFISFHAGPRICLGKDFAYRQMKIVSMALVRFFRFKLENETNDVTYRTMFTLH  498

Query  258   MAHGLKLTVSPRT  220
             + HGL L  +PR 
Sbjct  499   IDHGLPLYATPRC  511



>ref|XP_011030004.1| PREDICTED: cytochrome P450 704C1-like [Populus euphratica]
Length=560

 Score =   417 bits (1071),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/488 (47%), Positives = 310/488 (64%), Gaps = 26/488 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G  +  + ++ R+ D+         +  +  P  +  Y   P NVE++LKT F NY 
Sbjct  94    PIAGPILNYLVHFNRLFDYQTSVAKKHSTFRLITPSHSDIYTVDPLNVEYILKTKFSNYE  153

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   +  M  L GDGIF  DG  WR QRK AS EF+++ LRDFS+ VFR  + KL + +
Sbjct  154   KGAYNYGIMRDLFGDGIFAVDGHKWRHQRKLASYEFSTRVLRDFSSAVFRATAAKLVSKI  213

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE--NRFAKAFDAANIIVTL  1141
             T  +   +  D+QD+LM+ TLDSI KVGFG E+  L+  L E  +RF KAFD +N I+  
Sbjct  214   TVPATALKSTDLQDMLMKSTLDSIFKVGFGFELNALS-GLDEFGSRFTKAFDDSNSIIFW  272

Query  1140  RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSR  961
             R++D +W++K+FLN+GSEA L Q+I+ I+DF + +IR ++ +++ T K E   K DILSR
Sbjct  273   RYVDLIWELKRFLNIGSEASLKQNIKVINDFIFELIRCKREQMK-TGKLEGG-KEDILSR  330

Query  960   FI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELES  784
             F+ E  KDPEN + D+ LRDI LNF+IAG+DT+A TL+W  YM+  H  V EK+      
Sbjct  331   FLLESEKDPEN-MTDQYLRDITLNFIIAGKDTSANTLAWFFYMLCKHPLVQEKV------  383

Query  783   VEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAV  604
             V+E+R   E V + +  S D         +F+ L+  +T+ K+ YLH+ +TETLRLYPAV
Sbjct  384   VQEVR---EAVGIKESMSAD---------EFSKLMTEETVDKMQYLHASLTETLRLYPAV  431

Query  603   PQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNA  424
             P D K   EDD+LPDG +VK G  +TY+ Y+MGRM+  WG DA  F PER L DG+FQ  
Sbjct  432   PLDGKSATEDDILPDGFKVKKGDDITYMAYAMGRMKNIWGDDAEEFHPERSLHDGIFQPE  491

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH-SVEYRMMTVLSMAHG  247
             SPFKFTAF AGPRICLGK+ AY QMK+  A+L  FF+FKLV+      YR M  L +  G
Sbjct  492   SPFKFTAFHAGPRICLGKEFAYRQMKILAAVLLYFFRFKLVDARKEATYRTMFTLHLDKG  551

Query  246   LKLTVSPR  223
             L +  SPR
Sbjct  552   LHVYASPR  559



>ref|XP_008343043.1| PREDICTED: cytochrome P450 704C1 [Malus domestica]
Length=512

 Score =   415 bits (1066),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 220/511 (43%), Positives = 310/511 (61%), Gaps = 21/511 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             ++ FC++ +   + +    P   PV G   +Q+  + R++D+         +  +  P  
Sbjct  19    ILTFCFLLLKIFTGKSIRNPIYPPVKGTVFDQLFYFNRLYDYQTEVAKEQPTFRLLTPDQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y     N+EHVLKTNF  Y KG+     +  + G GIF  DGE W++QRK ASLEF+
Sbjct  79    SEVYTTDMRNIEHVLKTNFAKYSKGKYNQDIVSDVFGQGIFVVDGEKWKQQRKLASLEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  S KL  ++++    NQ  DMQD+LMR TLDSI KVGFG+++  L 
Sbjct  139   TRVLRDFSCSVFRRNSAKLVRVVSEILGSNQSFDMQDILMRCTLDSIIKVGFGIDLNCLE  198

Query  1203  PNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E   F KAFD +  +   RF+DP WK+K+ LN+GSEA L +++R +DDF + +I+ 
Sbjct  199   GSSKEGTAFMKAFDDSTALSYWRFVDPFWKLKRVLNIGSEAALRKNVRIMDDFVHQLIKS  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLS  850
             ++  +  T K + + + DILSRF+ E  KDPE  +ND  LRDI+LNF+IAG+DT+A TLS
Sbjct  259   KRTLV--TGKTDANDREDILSRFLLESEKDPEK-MNDTYLRDIILNFMIAGKDTSANTLS  315

Query  849   WAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYD  670
             W +YM+  +  + EK+  E+  V  +  +     + +   +  ++               
Sbjct  316   WFLYMLTKNPLIQEKVAHEVRDVVGITIQVNEANIDELVENITDA---------------  360

Query  669   TMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYN  490
              + K++YLH+ +TETLRLYPAVP D +    DD+LPDG R++ G  V Y+ Y+MGRM Y 
Sbjct  361   NLDKMHYLHATITETLRLYPAVPVDGRCAEVDDILPDGFRLRKGDGVYYMAYAMGRMPYI  420

Query  489   WGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKF  310
             WG DA  F+PERWLK+G+FQ  SPFKF AF AGPRICLGKD AY QMK+    L  FF+F
Sbjct  421   WGEDADDFRPERWLKNGIFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVSTALLFFFRF  480

Query  309   KLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             KL  E  +V YR M  L M  GL L  +PRT
Sbjct  481   KLADETKNVTYRTMFTLHMDGGLPLRATPRT  511



>ref|XP_010544373.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Tarenaya hassleriana]
Length=507

 Score =   415 bits (1066),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 223/520 (43%), Positives = 325/520 (63%), Gaps = 32/520 (6%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             V ALG I+   +FI R    K    +  PV G  + Q+ N+ R+H ++    +   +  +
Sbjct  10    VAALGAIL--TLFIVRFVSMKRQKKKYHPVGGTMLNQLLNFKRLHHYMTDLASQHKTYRL  67

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               PF    Y + P NVE++LK+NF NY KG   ++ +  LLGDGIF  DGE WR+QRK +
Sbjct  68    LAPFRNEVYTSDPVNVEYILKSNFDNYGKGLYNYTILSDLLGDGIFAVDGEKWRQQRKLS  127

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S +F+++ LRD+S+++F+  ++KL  I++ A+  ++ +D+QDL M+ TLDSI KV FG E
Sbjct  128   SHQFSTRFLRDYSSLIFQTNAVKLALIVSDAASSDRIIDIQDLFMKSTLDSIFKVAFGFE  187

Query  1218  IGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             + +L  +  E + F+ AFD A+ +   R++D  WK+K+F N+GSEA L ++++ ID+F Y
Sbjct  188   LDSLCGSTQEGKVFSSAFDNASALTLWRYVDFPWKMKRFFNLGSEAALKKNVKAIDEFVY  247

Query  1041  SVIRKRKAEIEETQK---NEKSMKHDILSRFIELGKDPENNIND-KSLRDIVLNFVIAGR  874
              +IR +  ++++  K   N    K DILSRF+++      + ND K LRDI+LNFVIAGR
Sbjct  248   KLIRFKIEQMDDDLKESDNSSMQKADILSRFLQV-----TDTNDLKYLRDIILNFVIAGR  302

Query  873   DTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQ  694
             DTTA TLSW IY +   +++ EK+       EE++    ++ +  ++            +
Sbjct  303   DTTAATLSWLIYSLCKEQEIQEKV------AEEVKEATGSIDITSFA------------E  344

Query  693   FAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPY  514
              A  L+ +T+ K++YLH+ +TETLRLYPAVP D K  L DD  PDG  V  G MV Y PY
Sbjct  345   LAESLSEETLEKMHYLHATITETLRLYPAVPVDAKICLSDDTFPDGFSVNKGDMVAYQPY  404

Query  513   SMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             +MGRM + WG DA  F+PERWL ++G F+  SPFKFTAFQAGPRICLGK+ AY QMK+  
Sbjct  405   AMGRMRFVWGDDAEEFRPERWLDENGKFRAESPFKFTAFQAGPRICLGKEFAYRQMKIFS  464

Query  336   AILCRFFKFKLVEGH-SVEYRMMTVLSMAHGLKLTVSPRT  220
             A++ R F+FKL   H  V Y+ M  L +  GL + VS R 
Sbjct  465   AVMLRCFQFKLSTDHKDVTYKTMINLHVDGGLHVLVSHRC  504



>ref|XP_011094593.1| PREDICTED: cytochrome P450 704C1 [Sesamum indicum]
Length=514

 Score =   415 bits (1066),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 235/527 (45%), Positives = 313/527 (59%), Gaps = 31/527 (6%)
 Frame = -1

Query  1779  VSSMETLVLALGLIMFCW----VFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLV  1612
             V  + T+ L L LI+F      +FI + S R    P   PV+G   +Q+  + R++D+  
Sbjct  7     VFCIITIALVLLLILFSASVLRIFIGK-SIRNLSYP---PVVGTVFDQLFYFNRLYDYQT  62

Query  1611  GYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNAD  1432
                    +  +  P  +  Y   P N+EH+LKTNF NY KG      +  L G GIF  D
Sbjct  63    EMAKRHKTSRLLTPDQSEIYTTEPRNIEHILKTNFSNYSKGHYNQDILTDLFGQGIFIVD  122

Query  1431  GELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTL  1252
             GE WR+QRK AS EF+++ LRDFS  VFR  + KL   + + S  NQ  D+Q LLMR TL
Sbjct  123   GEKWRQQRKLASFEFSTRVLRDFSCSVFRKNAAKLVGTIYELSKNNQVFDIQALLMRCTL  182

Query  1251  DSICKVGFGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILD  1075
             DSI KVGFGVE+  L   N   N F KAFD +N +V  R+ DP WK+K++LN+G EA L 
Sbjct  183   DSIFKVGFGVELNCLEGSNAEGNEFIKAFDDSNALVYWRYADPFWKLKRYLNIGGEATLK  242

Query  1074  QSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIV  898
             ++I+ I +F   VIR ++A++E+ Q      K DILSRF +E  KDP   + D+ LRDI+
Sbjct  243   KNIKFIHNFVDKVIRTKRAQMEKEQHCND--KEDILSRFLVESKKDPRT-MTDQYLRDII  299

Query  897   LNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPE  718
             LNF+IAG+DTTA TLSW IY +  +  + E +  E+  V      E+ V       +  E
Sbjct  300   LNFMIAGKDTTANTLSWFIYALCKNPLIQENVAQEVGRVIRSPQNEDCV------DNFVE  353

Query  717   SLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAG  538
             S+   A++           +++YLH+ +TETLRLYPAVP D +    DD LPDG ++K G
Sbjct  354   SITDEALE-----------EMHYLHATLTETLRLYPAVPVDGRCAETDDTLPDGFKLKKG  402

Query  537   GMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAY  358
               V Y+ Y+MGRM Y WG DA  FKPERWLK+G FQ  SPFKF AF AGPRICLGKD AY
Sbjct  403   DGVYYMAYAMGRMAYIWGDDAEEFKPERWLKNGTFQPESPFKFVAFNAGPRICLGKDFAY  462

Query  357   LQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPRT  220
              QMK+  A L  FF+F+L +   +V YR M  L ++  L +   PRT
Sbjct  463   RQMKIVSASLVHFFRFRLSDDTKNVTYRTMLTLHISGSLNIHAVPRT  509



>ref|XP_006339777.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=505

 Score =   414 bits (1065),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 226/524 (43%), Positives = 324/524 (62%), Gaps = 34/524 (6%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  1594
             S+  ++L+L   +FC   +  L+ +  G  R  PV G     + N+ R+H ++       
Sbjct  9     SITAIILSL---VFCVFILLLLTNKLNGKKRYHPVGGTIFNHLINFHRLHHYMTDLAGKY  65

Query  1593  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  1414
              +  +  PF    + + P NVE++LKTNF NY KG   ++ ++ L GDGIF  DG+ WR+
Sbjct  66    KTYRLVSPFRNDIFTSDPANVEYILKTNFENYGKGRYSYNILKDLFGDGIFTVDGDKWRE  125

Query  1413  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  1234
             QRK  S EF+++ LRDFS+VVFR  + KL  IL++A   ++ +D+QDL M+ TLDSI ++
Sbjct  126   QRKFLSHEFSARILRDFSSVVFRKDAAKLAHILSEAVKSSKIIDIQDLFMKATLDSIFRI  185

Query  1233  GFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTI  1057
              FGVE+ ++  +  E  +F  AFD A+ +   RF+D LWKIK+FLN+GSEA L  +IRTI
Sbjct  186   AFGVELDSMCGSNDEGKKFINAFDDASELTLWRFVDILWKIKRFLNIGSEAKLRDNIRTI  245

Query  1056  DDFTYSVIRKRKAEIE--ETQKNEKSMKHDILSRFIELGK-DPENNINDKSLRDIVLNFV  886
             D+F Y +I ++  ++   E   + +  K DILSRF+++ + DP      K LRDI+LNF+
Sbjct  246   DEFVYKLIHRKTEQMSKPEADLSLQWKKEDILSRFLQIAETDP------KYLRDIILNFI  299

Query  885   IAGRDTTATTLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDDPESLN  709
             IAG+DTTATTLSW IY++  +  V EK+  ++ E+  E +A  +                
Sbjct  300   IAGKDTTATTLSWFIYVLCKYPHVQEKVAQDIKEATNEKQAATD----------------  343

Query  708   QRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMV  529
                M FA  ++ D + K+ YLH+ +TETLRLYPAVP + K    DD LPDG  V  G +V
Sbjct  344   --IMDFAANVSEDALEKMQYLHAALTETLRLYPAVPVNGKICFSDDTLPDGFNVNKGDIV  401

Query  528   TYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
              Y  Y+MGRM++ WG DA  +KPERWL  DG F+  +PFKFTAFQAGPRICLGK+ AY Q
Sbjct  402   AYQSYAMGRMKFIWGDDAEEYKPERWLDGDGFFRPENPFKFTAFQAGPRICLGKEFAYRQ  461

Query  351   MKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             MK++ A+L R+F F+L +   +V YR M  L +  GL + V  R
Sbjct  462   MKISSALLLRYFVFRLSDDKKTVNYRTMINLHIDGGLHVRVFHR  505



>ref|XP_010413066.1| PREDICTED: cytochrome P450 704C1-like [Camelina sativa]
Length=510

 Score =   414 bits (1065),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 315/531 (59%), Gaps = 28/531 (5%)
 Frame = -1

Query  1800  VKSNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  1621
             ++S  L V S  T+VL+  + +   +F  +    K    R  PV     +   +   ++D
Sbjct  4     LRSIALTVLSAITIVLSFTIYLTIKIFTGKSRNDK----RYAPVHATVFDLFFHSHELYD  59

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             +         +     P  +  + A P NVEH+LKT F NY KG   +  +  LLG GIF
Sbjct  60    YETKIARTKPTFRFLSPQQSEIFTADPRNVEHILKTRFDNYSKGPSTNENLADLLGHGIF  119

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DGE W++QRK AS EF+++ +RDFS  VFR  + KL   LT+ +L  +  D QD+LMR
Sbjct  120   AVDGEKWKQQRKLASSEFSTR-VRDFSCSVFRRNASKLVGFLTEFALSGEAFDAQDMLMR  178

Query  1260  MTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              TLDSI KVGFGVE+  L     E   F KAFD  N+  + RF DPLWK+K+F N GS++
Sbjct  179   FTLDSIFKVGFGVELRCLDGFSKEGEEFMKAFDEGNVATSSRFTDPLWKLKRFFNTGSQS  238

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLR  907
              L +SI TID F YS+I  ++ E+ + Q  + +++ DILSRF +E  KDPEN +NDK LR
Sbjct  239   RLKKSIATIDKFVYSLITTKRKELAKEQ--DTAVREDILSRFLVESEKDPEN-MNDKYLR  295

Query  906   DIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSD  727
             DI+L+F+I G+DTTA +LSW +YM+  +    EK+  E+  V     K  ++ +   S  
Sbjct  296   DIILSFMIVGKDTTAASLSWFLYMLCKNTLFQEKIVQEIRDVTSTHEKTTDINVFTESIT  355

Query  726   DPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRV  547
             D E+L+Q                ++YLH+ ++ETLRLYP+VP D K    DD+LPDG RV
Sbjct  356   D-EALDQ----------------MHYLHATLSETLRLYPSVPVDMKCADSDDILPDGHRV  398

Query  546   KAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKD  367
               G  + Y+ Y+MGRM Y WG DA  FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD
Sbjct  399   NKGDNIYYIAYAMGRMTYIWGQDAEDFKPERWLKDGVFQPESPFKFISFHAGPRICLGKD  458

Query  366   SAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRTH  217
              AY QMK+    L  FF+FK+  E  +V Y+ M  L +  GL L   PRTH
Sbjct  459   FAYRQMKIVSIALLHFFRFKMADEVCNVRYKRMLTLHIKGGLHLCAIPRTH  509



>ref|NP_182075.1| cytochrome P450, family 704, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AAC06153.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO43566.1| At2g45510 [Arabidopsis thaliana]
 gb|AEC10564.1| cytochrome P450, family 704, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=511

 Score =   414 bits (1065),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 230/526 (44%), Positives = 310/526 (59%), Gaps = 26/526 (5%)
 Frame = -1

Query  1779  VSSMETLVLALGLIMFC---WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVG  1609
             ++S+   V     I+ C   ++ I   + +     R  PV     + + +   ++D+   
Sbjct  4     LTSIAITVATTIFIVLCFTIYLMIRIFTGKSRNDKRYAPVHATVFDLLFHSDELYDYETE  63

Query  1608  YLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADG  1429
                   +     P  +    A P NVEH+LKT F NY KG      M  LLG GIF  DG
Sbjct  64    IAREKPTYRFLSPGQSEILTADPRNVEHILKTRFDNYSKGHSSRENMADLLGHGIFAVDG  123

Query  1428  ELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLD  1249
             E WR+QRK +S EF+++ LRDFS  VFR  + KL   +++ +L  +  D QDLLMR TLD
Sbjct  124   EKWRQQRKLSSFEFSTRVLRDFSCSVFRRNASKLVGFVSEFALSGKAFDAQDLLMRCTLD  183

Query  1248  SICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQ  1072
             SI KVGFGVE+  L     E + F +AFD  N+  + RFIDPLWK+K F N+GS++ L +
Sbjct  184   SIFKVGFGVELKCLDGFSKEGQEFMEAFDEGNVATSSRFIDPLWKLKWFFNIGSQSKLKK  243

Query  1071  SIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVL  895
             SI TID F YS+I  ++ E+ + Q     ++ DILSRF +E  KDPEN +NDK LRDI+L
Sbjct  244   SIATIDKFVYSLITTKRKELAKEQNT--VVREDILSRFLVESEKDPEN-MNDKYLRDIIL  300

Query  894   NFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPES  715
             NF+IAG+DTTA  LSW +YM+  +  V EK+  E+  V            H+ ++D    
Sbjct  301   NFMIAGKDTTAALLSWFLYMLCKNPLVQEKIVQEIRDV---------TFSHEKTTD----  347

Query  714   LNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGG  535
                    F   +N + + +++YLH+ ++ETLRLYP VP D +    DDVLPDG RV  G 
Sbjct  348   ----VNGFVESINEEALDEMHYLHAALSETLRLYPPVPVDMRCAENDDVLPDGHRVSKGD  403

Query  534   MVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYL  355
              + Y+ Y+MGRM Y WG DA  FKPERWLKDG+FQ  SPFKF +F AGPRICLGKD AY 
Sbjct  404   NIYYIAYAMGRMTYIWGQDAEEFKPERWLKDGLFQPESPFKFISFHAGPRICLGKDFAYR  463

Query  354   QMKMALAILCRFFKFKLVEGHS-VEYRMMTVLSMAHGLKLTVSPRT  220
             QMK+    L  FF+FK+ + +S V Y+ M  L +  GL L   PRT
Sbjct  464   QMKIVSMALLHFFRFKMADENSKVYYKRMLTLHVDGGLHLCAIPRT  509



>gb|KDP28729.1| hypothetical protein JCGZ_14500 [Jatropha curcas]
Length=514

 Score =   414 bits (1065),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 222/505 (44%), Positives = 306/505 (61%), Gaps = 21/505 (4%)
 Frame = -1

Query  1728  WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYI  1549
             W+ +   + +    P   PV G    Q+  + R++D+         +  +  P  +  Y 
Sbjct  24    WLILKIYTGKSIKNPNYAPVYGTVFHQLFYFNRLYDYQTQVAKKQRTFRLLSPEGSEFYT  83

Query  1548  AHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLR  1369
                 N+EHVLKTNF  Y KG+     +  L G+GIF  DG+ WR+QRK AS EF+++ LR
Sbjct  84    TDTRNIEHVLKTNFDKYSKGKRNQDILTDLFGEGIFVVDGDKWRQQRKLASFEFSARILR  143

Query  1368  DFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             DFS  VFR  + KL  ++++ +  ++  DMQD+LMR TLDSI KVGFGVE+  L  +  E
Sbjct  144   DFSCSVFRRNAAKLVRLISKIANTDRVFDMQDILMRCTLDSIFKVGFGVELDCLEGSSRE  203

Query  1188  NR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
                F KAFD +N +V  R++DP WK+K++ N+GSEA L ++I TIDDF  +++R R+  +
Sbjct  204   GTAFMKAFDESNALVYWRYVDPFWKLKRYFNIGSEASLKKNIETIDDFVSNLVRTRRKLL  263

Query  1011  EETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
              E  +  +S K DILSRF+ E  KDPE  +NDK LRDI+LNF+IAG+DT+A TLSW  YM
Sbjct  264   AE--QRYQSFKEDILSRFLAESEKDPEK-MNDKYLRDIILNFMIAGKDTSANTLSWFFYM  320

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             +  +  V EK+  E+  V                S+  ++ ++    F   +    + ++
Sbjct  321   LCKNPLVQEKVAQEVREV--------------MGSNHGDNCSE-VEDFMAKITDSALEQM  365

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
             +YLH+ +TETLRLYPAVP D +    DDVLPDG R++ G  + Y+ Y+MGRM Y WG DA
Sbjct  366   HYLHASLTETLRLYPAVPVDGRCAEMDDVLPDGNRMEKGDGLYYMAYAMGRMPYIWGEDA  425

Query  474   ASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-E  298
               F+PERWL +GVFQ  SPFKF AF AGPRICLGKD AY QMK+    L RFF+FKL  +
Sbjct  426   EDFRPERWLNNGVFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVSMALLRFFRFKLADD  485

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPR  223
                V Y+ M  L +  GL L   PR
Sbjct  486   SRKVTYKTMFTLHIQDGLHLCAIPR  510



>ref|XP_010255770.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Nelumbo nucifera]
Length=553

 Score =   416 bits (1068),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 229/493 (46%), Positives = 304/493 (62%), Gaps = 30/493 (6%)
 Frame = -1

Query  1683  RSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT-TYTYIAHPDNVEHVLKTNF  1507
             R  P+ G    Q+ N+ R+H ++   LA+ Y        + +  Y A P NVE++LKTNF
Sbjct  76    RRHPIAGTIFNQLLNFSRLHHYMTE-LASKYGTYRLSRLSRSEIYTADPANVEYILKTNF  134

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              NY KG+  +  +  LLGDGIF  DGE WR+QRK +S EF+S NLR FS+ VFR  +  L
Sbjct  135   ANYGKGKHNNEILRDLLGDGIFAVDGEKWRQQRKLSSYEFSSSNLRGFSSTVFRRNAANL  194

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIV  1147
               IL QA+      D+QDL M+ TLDSI KVGFGVE+ +   +     FAKAFD ++ + 
Sbjct  195   AKILLQAATSGLSFDIQDLFMKSTLDSIFKVGFGVELDSSGGSTDGTMFAKAFDDSSALT  254

Query  1146  TLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIR---KRKAEIEETQKNEKSMKH  976
               R++D  WK+KKFLNVGSEA L ++++ ID F Y +I    ++      T  + +  K 
Sbjct  255   LWRYVDVFWKMKKFLNVGSEAELRENVKMIDKFVYRLISYKIQQXQNCNTTTGSHQMKKQ  314

Query  975   DILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWS  796
             DILSRF+EL     N  + K LRDI++NF+IAGRDTTATTLSW  YM+  H  + EK+  
Sbjct  315   DILSRFLEL-----NETDPKYLRDIIMNFIIAGRDTTATTLSWFFYMLCKHPYIQEKIAQ  369

Query  795   ELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRL  616
             E++  E ++ K+        SS D         + A  LN +++ K++YLH+ ++ETLRL
Sbjct  370   EVQ--EAIKEKDT-------SSYD---------ELADNLNDESLGKMHYLHAAISETLRL  411

Query  615   YPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-G  439
             YPA+P D K    DD LPDG  VK G MV Y PY+MGRM+  WG DA  F+PERWL + G
Sbjct  412   YPAIPVDMKVCFSDDTLPDGFNVKKGDMVAYQPYAMGRMKSIWGDDAEVFRPERWLNESG  471

Query  438   VFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH-SVEYRMMTVL  262
             +F+  S FKFTAFQAGPRICLGKD AY QMK+  A+L   F F+L +    V YR M  L
Sbjct  472   LFRQESQFKFTAFQAGPRICLGKDFAYRQMKIFSALLLSSFVFRLSDDQKEVGYRTMITL  531

Query  261   SMAHGLKLTVSPR  223
             ++  GL L VS R
Sbjct  532   NIDGGLHLQVSHR  544



>ref|XP_002880182.1| CYP704A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56441.1| CYP704A2 [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   414 bits (1064),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 230/525 (44%), Positives = 309/525 (59%), Gaps = 25/525 (5%)
 Frame = -1

Query  1785  LKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY  1606
             + ++   T+ + L   ++  + I   + +     R  PV     + + +   ++D+    
Sbjct  7     IAITVATTIFIVLSFTIYLTIRI--FTGKSRNDKRYAPVHATVFDLLIHRDELYDYETEI  64

Query  1605  LANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGE  1426
                  +     P  +    A P NVEH+LKT F NY KG      +  LLG GIF  DGE
Sbjct  65    ARTKPTYRFLSPGQSEILTADPRNVEHILKTRFDNYSKGPAGRENLADLLGHGIFAVDGE  124

Query  1425  LWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDS  1246
              WR+QRK AS EF+++ LRDFS  VFR  + KL   ++  +L  +  D QD+LMR TLDS
Sbjct  125   KWRQQRKLASFEFSTRVLRDFSCSVFRRNASKLIGFVSGVALSGKAFDAQDMLMRCTLDS  184

Query  1245  ICKVGFGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQS  1069
             I KVGFGVE+  L   +     F +AFD  N+  + R+IDPLWK+K FLN+GS++ L +S
Sbjct  185   IFKVGFGVELKCLDGFSKKGEEFMEAFDEGNVATSSRYIDPLWKLKWFLNIGSQSKLKKS  244

Query  1068  IRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLN  892
             I TID F YS+I  ++ E+ E Q     ++ DILSRF +E  KDPEN +NDK LRDI+LN
Sbjct  245   IATIDKFVYSLITTKRKELAEEQNT--VVREDILSRFLVESEKDPEN-MNDKYLRDIILN  301

Query  891   FVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESL  712
             F+IAG+DTTA +LSW +YM+  +  V EK+  E+  V     K  +V      +   ES+
Sbjct  302   FMIAGKDTTAASLSWFLYMLCKNPLVQEKIVQEIRDVTSSHEKTTDV------NGFIESI  355

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
             N+ A+            ++ YLH+ ++ETLRLYP VP D +    DDVLPDG RV  G  
Sbjct  356   NEEALD-----------QMQYLHAALSETLRLYPPVPVDTRYAENDDVLPDGHRVSKGDN  404

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             + Y+ Y+MGRM Y WG DA  FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD AY Q
Sbjct  405   IYYIAYAMGRMTYIWGQDAEEFKPERWLKDGVFQPESPFKFISFHAGPRICLGKDFAYRQ  464

Query  351   MKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             MK+    L  FF+FK+  E  +V Y+ M  L +  GL L   PRT
Sbjct  465   MKIVAMALLHFFRFKMADEKSNVCYKTMLTLHVEGGLHLCAIPRT  509



>ref|XP_009379286.1| PREDICTED: cytochrome P450 704C1-like [Pyrus x bretschneideri]
Length=512

 Score =   414 bits (1064),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 217/511 (42%), Positives = 308/511 (60%), Gaps = 21/511 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             ++ FC++ +   + +    P   PV G    Q+  + R++D+         +  +  P  
Sbjct  19    ILTFCFLLLKIFTGKSIRNPIYPPVKGTVFNQLFYFNRLYDYQTEVAKEQPTFRLLAPDQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y     N+EHVLKTNF  Y KG+     +  + G GIF  DGE W++QRK AS EF+
Sbjct  79    SEVYTTDMRNIEHVLKTNFAKYSKGKYNQDIVSDVFGQGIFVVDGEKWKQQRKLASFEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  S KL  ++++  + NQ  DMQD+LMR TLDSI KVGFG+++  L 
Sbjct  139   TRVLRDFSCSVFRRNSAKLVRVVSEILVSNQSFDMQDILMRCTLDSIIKVGFGIDLNCLE  198

Query  1203  PNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E   F KAFD +  +   R++DP WK+K+ LN+GSEA L +++R +DDF + +I+ 
Sbjct  199   GSSKEGTAFMKAFDDSTALSYWRYVDPFWKLKRVLNIGSEATLKKNVRIMDDFVHQLIKS  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLS  850
             ++  +  T K + + + DILSRF+ E  KDPE  +ND  LRDI+LNF+IAG+DT+A TLS
Sbjct  259   KRTLV--TGKTDANDREDILSRFLLESEKDPEK-MNDTYLRDIILNFMIAGKDTSANTLS  315

Query  849   WAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYD  670
             W +YM+  +  + EK+  E+  V     + +   + +   +  ++               
Sbjct  316   WFLYMLTKNPLIQEKVAQEVRDVVGFTIQVDEANIDELVENITDA---------------  360

Query  669   TMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYN  490
              + K++YLH+ +TETLRLYPAVP D +    DD+LPDG R++ G  V Y+ Y+MGRM Y 
Sbjct  361   NLDKMHYLHATITETLRLYPAVPVDGRCAEVDDILPDGFRLRKGDGVYYMAYAMGRMPYI  420

Query  489   WGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKF  310
             WG DA  F+PERWLK+G+FQ  SPFKF AF AGPRICLGKD AY QMK+    L RFF+F
Sbjct  421   WGEDAEDFRPERWLKNGIFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVAMALLRFFRF  480

Query  309   KLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             KL  E   V YR M  L +  GL +   PRT
Sbjct  481   KLADETKLVTYRTMFTLHIDGGLPMIAVPRT  511



>ref|XP_010255771.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Nelumbo nucifera]
Length=552

 Score =   415 bits (1067),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 229/492 (47%), Positives = 303/492 (62%), Gaps = 29/492 (6%)
 Frame = -1

Query  1683  RSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT-TYTYIAHPDNVEHVLKTNF  1507
             R  P+ G    Q+ N+ R+H ++   LA+ Y        + +  Y A P NVE++LKTNF
Sbjct  76    RRHPIAGTIFNQLLNFSRLHHYMTE-LASKYGTYRLSRLSRSEIYTADPANVEYILKTNF  134

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              NY KG+  +  +  LLGDGIF  DGE WR+QRK +S EF+S NLR FS+ VFR  +  L
Sbjct  135   ANYGKGKHNNEILRDLLGDGIFAVDGEKWRQQRKLSSYEFSSSNLRGFSSTVFRRNAANL  194

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIV  1147
               IL QA+      D+QDL M+ TLDSI KVGFGVE+ +   +     FAKAFD ++ + 
Sbjct  195   AKILLQAATSGLSFDIQDLFMKSTLDSIFKVGFGVELDSSGGSTDGTMFAKAFDDSSALT  254

Query  1146  TLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKS--MKHD  973
               R++D  WK+KKFLNVGSEA L ++++ ID F Y +I  +  + +       S   K D
Sbjct  255   LWRYVDVFWKMKKFLNVGSEAELRENVKMIDKFVYRLISYKIQQXQNCNTTTGSHMKKQD  314

Query  972   ILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSE  793
             ILSRF+EL     N  + K LRDI++NF+IAGRDTTATTLSW  YM+  H  + EK+  E
Sbjct  315   ILSRFLEL-----NETDPKYLRDIIMNFIIAGRDTTATTLSWFFYMLCKHPYIQEKIAQE  369

Query  792   LESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLY  613
             ++  E ++ K+        SS D         + A  LN +++ K++YLH+ ++ETLRLY
Sbjct  370   VQ--EAIKEKDT-------SSYD---------ELADNLNDESLGKMHYLHAAISETLRLY  411

Query  612   PAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GV  436
             PA+P D K    DD LPDG  VK G MV Y PY+MGRM+  WG DA  F+PERWL + G+
Sbjct  412   PAIPVDMKVCFSDDTLPDGFNVKKGDMVAYQPYAMGRMKSIWGDDAEVFRPERWLNESGL  471

Query  435   FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH-SVEYRMMTVLS  259
             F+  S FKFTAFQAGPRICLGKD AY QMK+  A+L   F F+L +    V YR M  L+
Sbjct  472   FRQESQFKFTAFQAGPRICLGKDFAYRQMKIFSALLLSSFVFRLSDDQKEVGYRTMITLN  531

Query  258   MAHGLKLTVSPR  223
             +  GL L VS R
Sbjct  532   IDGGLHLQVSHR  543



>ref|XP_002275114.1| PREDICTED: cytochrome P450 704C1 [Vitis vinifera]
Length=517

 Score =   414 bits (1063),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 222/506 (44%), Positives = 299/506 (59%), Gaps = 21/506 (4%)
 Frame = -1

Query  1731  CWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTY  1552
             C++ +   + +    P   PV+G    Q+  + +++D          +  +  P  +  Y
Sbjct  23    CFLLLRIFTNKSIKNPNYPPVMGTVFHQLLYFNKLYDHQAEVAEKHRTFRLLTPIQSEIY  82

Query  1551  IAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNL  1372
                  N+EHVLKTNF NY KG+        L G+GIF  DG  WR QRK AS EF+++ L
Sbjct  83    TTDTRNIEHVLKTNFANYSKGQHNRDIFMDLFGEGIFAVDGGAWRHQRKLASFEFSTRVL  142

Query  1371  RDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTL-APNL  1195
             RDFS  VFR  + KL   + + S   +  D+QD+LM+  LDSI KVGFGVE+  L   N 
Sbjct  143   RDFSCAVFRTNAAKLAGKVKEFSDAGRVFDVQDILMKCGLDSIFKVGFGVELNCLEGSNQ  202

Query  1194  PENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAE  1015
               N F KAFD +N +V  R++DPLW +K+FLN+GSEA L +SI+ +DDF Y++IR ++ +
Sbjct  203   EGNAFIKAFDDSNALVYWRYVDPLWTLKRFLNIGSEASLKKSIKVMDDFVYNLIRTKRKQ  262

Query  1014  IEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIY  838
             +   Q      K DILSRF+ E  KDPE  +ND+ LRDI+LNF IAG+D+TA TLSW  Y
Sbjct  263   LSIQQYTND--KEDILSRFLLESQKDPEQ-MNDRYLRDIILNFTIAGKDSTANTLSWFFY  319

Query  837   MIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAK  658
             ++  H  V EK+  E+  V +    ++    H Y              F   +    + K
Sbjct  320   VLTKHPLVQEKVVQEIREVMDCGDDDK---AHGYED------------FVAKITDGVLEK  364

Query  657   LYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPD  478
             + YLH+ +TETLRLYPAVP D +    DD+LPDG ++K G  V Y+ Y+MGRM Y WG D
Sbjct  365   MQYLHAALTETLRLYPAVPIDGRCADADDILPDGHKLKQGDGVYYMSYAMGRMSYIWGED  424

Query  477   AASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE  298
             A  F+PERWL +GVFQ  SPFKF AF AGPRICLGKD AY QMK++   L  FF+FKL +
Sbjct  425   AKEFRPERWLNNGVFQPESPFKFVAFHAGPRICLGKDFAYRQMKISAMTLLHFFRFKLED  484

Query  297   G-HSVEYRMMTVLSMAHGLKLTVSPR  223
                +V Y+ M  L +  GL L   PR
Sbjct  485   ATRNVTYKTMFTLHINGGLHLQAIPR  510



>ref|XP_009776442.1| PREDICTED: cytochrome P450 704C1-like [Nicotiana sylvestris]
Length=511

 Score =   413 bits (1062),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 302/492 (61%), Gaps = 22/492 (4%)
 Frame = -1

Query  1689  GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTN  1510
              P+  PV+G    Q+  + R++D+       + +  +  P  + TY     N+EH+LKTN
Sbjct  37    NPKYAPVVGTVFHQLFYFNRLYDYQTEVAKKTPTSRLLSPEQSETYTTDSRNIEHILKTN  96

Query  1509  FPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLK  1330
             F  Y KG+     +  L G+GIF  DGE W++QRK +S EF+++ LRDFS  VFR  + K
Sbjct  97    FSKYSKGKRNQEVLRDLFGEGIFAVDGEKWKQQRKLSSFEFSARVLRDFSCTVFRKRATK  156

Query  1329  LFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTL-APNLPENRFAKAFDAANI  1153
             L + ++  SL NQ  DMQ+LLM+ +LDSI KVGFGV++ +L       N F KAFD +N 
Sbjct  157   LVSKVSDFSLANQVFDMQELLMKSSLDSIFKVGFGVDLNSLDGSGGDNNNFIKAFDDSNE  216

Query  1152  IVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHD  973
             +   R++DP WK+K++ NVGSE  L ++I+ I +F   +IR R+ ++E   K +   K D
Sbjct  217   LTYWRYVDPFWKLKRYFNVGSEFHLKRNIKYIQEFVDELIRTRRKQLE--MKEDSMDKED  274

Query  972   ILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWS  796
             ILSRF +E  KDPE  +ND+ LRDI+LNF++AG+D++A TLSW  YM+  +  +  K+  
Sbjct  275   ILSRFLVESKKDPEK-MNDQYLRDIILNFMLAGKDSSANTLSWFFYMLCKNPLIQVKV--  331

Query  795   ELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRL  616
                 VEE+R    N +    S+DD          F   +  + + K++YLH+ +TETLRL
Sbjct  332   ----VEEIRQVIGNNIKDNGSTDD----------FVASITEEVLEKMHYLHATLTETLRL  377

Query  615   YPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGV  436
             YPAVP D +    DDVLPDG  ++ G  V Y+ Y+MGRM Y WG DA  F+PERWLKDG+
Sbjct  378   YPAVPVDGRCADADDVLPDGFHIRKGDGVYYISYAMGRMPYIWGNDAEDFRPERWLKDGI  437

Query  435   FQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLS  259
             FQ  SPFKF AF AGPRICLGKD AY QMK+    L  FF+FKL +    V YR M  L 
Sbjct  438   FQPESPFKFIAFHAGPRICLGKDFAYRQMKILATALLHFFRFKLSDDTKEVTYRTMFTLH  497

Query  258   MAHGLKLTVSPR  223
             +  GL +   PR
Sbjct  498   INEGLPVHAVPR  509



>ref|XP_003627676.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003636305.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003636837.1| Cytochrome P450 [Medicago truncatula]
 gb|AET02152.1| cytochrome P450 family protein [Medicago truncatula]
Length=510

 Score =   413 bits (1061),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 218/522 (42%), Positives = 312/522 (60%), Gaps = 21/522 (4%)
 Frame = -1

Query  1779  VSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLA  1600
             ++S+    LA+ L + C++ +     +  G P+  PV G    Q+ N+ ++HD+      
Sbjct  8     LTSIAFFFLAIFLAI-CFIMMTIFKGKSIGDPKYAPVKGTVFNQLFNFKKLHDYHAQLAK  66

Query  1599  NSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELW  1420
                ++ +  P  +  Y     N+EH+LKTNF  Y KG+     +  LLG+GIF  DG+ W
Sbjct  67    THPTMRLLAPNQSELYTIDVRNIEHILKTNFDKYSKGKYNKDIITDLLGEGIFAVDGDKW  126

Query  1419  RKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSIC  1240
             ++QRK AS EF+++ LRDFS  VFR  + KL  ++++ S      DMQDL MR  LDSI 
Sbjct  127   KQQRKIASYEFSTRVLRDFSCSVFRKNASKLVRVISEFSHEGLVFDMQDLQMRCALDSIF  186

Query  1239  KVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIR  1063
             KVGFG E+  L  +  E   F KAFD +N ++  R++DP+W +K+FLN+G EA L  +++
Sbjct  187   KVGFGTELNCLEGSSKEGTEFMKAFDESNALIYWRYVDPIWSLKRFLNIGGEAKLKHNVK  246

Query  1062  TIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVI  883
              IDDF   VI  +K+++E  Q  + ++K DILSRF+   K+ +  I DK LRDI+LNF+I
Sbjct  247   LIDDFVNGVINTKKSQLELQQ--DSNVKEDILSRFLMESKNGQTTITDKYLRDIILNFMI  304

Query  882   AGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQR  703
             AG+DTTA TLSW  YM+  +  V +K+  E+  V      E N            S+++ 
Sbjct  305   AGKDTTANTLSWFFYMLCKNPLVEDKIVQEIRDVTCSHESELN------------SIDEF  352

Query  702   AMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTY  523
                   L+    + K++YLH+ +TETLRLYP +P D +     DVLPDG +++ G  V Y
Sbjct  353   VANLTDLI----LDKMHYLHATLTETLRLYPVLPVDGRTADAPDVLPDGHKLEKGDGVYY  408

Query  522   VPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKM  343
             + Y+MGRM   WG DA  F+PERW+ DG+FQ  SPFKF AF AGPR+CLGKD AY QMK+
Sbjct  409   LAYAMGRMSSIWGEDADEFRPERWITDGIFQPESPFKFVAFHAGPRMCLGKDFAYRQMKI  468

Query  342   ALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPRT  220
                 +  FFKFKL  G  +V Y++M  L +  GL LT  PR+
Sbjct  469   VAMCVLNFFKFKLANGTQNVTYKVMFTLHLDKGLPLTAIPRS  510



>ref|XP_006339778.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
 ref|XP_006339782.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=499

 Score =   412 bits (1059),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 221/515 (43%), Positives = 325/515 (63%), Gaps = 29/515 (6%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             + L++FC    H L+++  G  R  P+ G     + N+ R+H ++        +  +  P
Sbjct  8     ISLLLFCVFIRHFLTKKLHGKKRYHPIGGTVFNLLINFHRVHHYMTDLAGKYKTYRLISP  67

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
             F    + + P NVE++LKTNF NY KG   +  ++ LLGDGIF  DG+ WR+QRK +S +
Sbjct  68    FKNRIFTSDPANVEYILKTNFENYGKGGYNYYILKDLLGDGIFTVDGDKWREQRKLSSHD  127

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             F+++ LRDFS+VVFR  + K   ILT+A   N+ VD+QDL M+ +LDSI +V FGVE+ +
Sbjct  128   FSTRVLRDFSSVVFRKNAAKFAHILTEAVKSNKIVDIQDLFMKASLDSIFRVAFGVELDS  187

Query  1209  LAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVI  1033
             +  +  E  +F+ AFD A+ +   R++D LWKIK+ LN+G E+ L ++IRT+D F + +I
Sbjct  188   MCGSNEEGKKFSDAFDDASALTVRRYVDILWKIKRSLNIGLESKLKENIRTVDVFIHKMI  247

Query  1032  RKRKAEIE--ETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             +++  E+   E   + +  + DILSRF+++      + + K LRDI+LNF+IAG+DTTAT
Sbjct  248   QRKTEEMSKPEADLSLQWKREDILSRFLQI-----TDTDPKYLRDIILNFIIAGKDTTAT  302

Query  858   TLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
             TLSW IY++  +  V EK+  E+ ESV E    +EN      ++D           FA  
Sbjct  303   TLSWFIYVLCKYPHVQEKIAQEIKESVTE----KEN------ATD--------VTDFASN  344

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             ++ D + K+ YLH+ +TETLRLYPAVP D K    DD LPDG  V  G  V+Y+PY+MGR
Sbjct  345   VSEDALEKMQYLHAALTETLRLYPAVPADTKLCFSDDTLPDGFSVNKGDTVSYLPYAMGR  404

Query  501   MEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             M++ WG DA  ++PERWL +DG F++ +PFKFTAFQAGPRICLGK+ AY QMK+  A+L 
Sbjct  405   MKFIWGDDAEEYEPERWLDRDGFFRHENPFKFTAFQAGPRICLGKEFAYRQMKIFSAVLL  464

Query  324   RFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
              +F F+L +   ++ YR M  L +  GL + V  R
Sbjct  465   HYFVFELSDDKKAINYRTMINLHIDGGLHVRVFRR  499



>gb|AHF22080.1| CYP704A87 [Artemisia annua]
Length=519

 Score =   413 bits (1061),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 225/483 (47%), Positives = 304/483 (63%), Gaps = 26/483 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT-TYTYIAHPDNVEHVLKTNFPNY  1498
             PV+G       ++  + D++   LA  Y     +  T +  Y A P NVE++LKTNF NY
Sbjct  53    PVVGPITNLFIHFHELFDYMTS-LAKKYPTFRFIELTHSEVYTADPVNVEYILKTNFANY  111

Query  1497  PKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTI  1318
             PKGE     M  L G+GIF  DG  WR QRK AS EF++KNLRDFSTV+F+  S  L   
Sbjct  112   PKGEYTIVRMNDLFGNGIFAVDGAKWRHQRKLASFEFSTKNLRDFSTVIFKSNSTVLAKK  171

Query  1317  LTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRFAKAFDAANIIVTL  1141
             ++  +   + +++QDLL++ TLDSI KVGFG ++ TL+  +   NRF KAFD +N +V  
Sbjct  172   ISFLAAAEKSMNLQDLLLKSTLDSIFKVGFGFDLDTLSGSDEASNRFMKAFDDSNELVYW  231

Query  1140  RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSR  961
             RF D LW++K++LN+G EA L ++I+ ID F Y +IR ++ +++   +N    K DILSR
Sbjct  232   RFADLLWRVKRYLNIGREAALKENIKIIDKFVYEIIRNKREQLK--NRNLYRNKEDILSR  289

Query  960   FI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELES  784
             FI E   DPEN ++D+ LRDI+LNF+IAG+DTTA TL+W  YM+  H  + EK+  +++ 
Sbjct  290   FITESDNDPEN-MSDEYLRDILLNFLIAGKDTTANTLTWFFYMLCKHPLIQEKVAEDVKV  348

Query  783   VEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAV  604
               E              +D    L+     F   L    + K++YLH+ ++ET+RLYPAV
Sbjct  349   ATE--------------ADSNTPLDA----FGFKLTEVAIDKMHYLHATLSETMRLYPAV  390

Query  603   PQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNA  424
             P + K + +DDVLPDG  +K G  + Y+PY MGRM Y WG DA  F+PERWL DGVF+  
Sbjct  391   PLNRKSVEKDDVLPDGFIIKKGDGLGYMPYPMGRMTYIWGEDAEDFRPERWLNDGVFRPE  450

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVE-GHSVEYRMMTVLSMAHG  247
             SPFKFTAFQAGPRICLGK+ AY QMK+  A L  FFKFKLV+      YR M  L M +G
Sbjct  451   SPFKFTAFQAGPRICLGKEFAYRQMKILAAFLVYFFKFKLVDPSKEATYRTMFTLHMDNG  510

Query  246   LKL  238
             L L
Sbjct  511   LPL  513



>ref|XP_007219030.1| hypothetical protein PRUPE_ppa004495mg [Prunus persica]
 gb|EMJ20229.1| hypothetical protein PRUPE_ppa004495mg [Prunus persica]
Length=507

 Score =   412 bits (1060),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/492 (45%), Positives = 303/492 (62%), Gaps = 25/492 (5%)
 Frame = -1

Query  1686  PRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNF  1507
             P   PV G  + Q+  + R++D+         +  +  P  +  Y     N+EHVLKTNF
Sbjct  35    PNYPPVKGTVLHQLLYFNRLYDYQTEVAKEHTTYRLLAPEHSAIYTTDTRNIEHVLKTNF  94

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              +Y KGE   + +  + G GIF  DGE W++QRK AS EF+++ LRD S  VFR  + KL
Sbjct  95    GSYSKGEYNQAILSDVFGQGIFIVDGEKWKQQRKLASFEFSTRVLRDVSCSVFRRNAAKL  154

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANII  1150
               ++++ S+  +  DMQDLLMR TLDSI KVGFG+++  L  +  E   F KAFD +  +
Sbjct  155   VKVISEISVSRRVFDMQDLLMRCTLDSIFKVGFGIDLNCLEGSSKEGTAFMKAFDESTAL  214

Query  1149  VTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDI  970
                R++DP WK+K+FLN+GSEA L + ++ IDDF + VIR ++  +EE  + + + K DI
Sbjct  215   TCFRYVDPFWKLKRFLNLGSEASLKKYVKVIDDFVHQVIRSKRKFLEE--QKDVNDKEDI  272

Query  969   LSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSE  793
             LSRF+ E  KDPE  +NDK LRDI+LNF+IAG+DT+A TLSW  Y++  +  + EK+  E
Sbjct  273   LSRFLLESKKDPEE-MNDKYLRDIILNFMIAGKDTSANTLSWFFYLLSKNPLIQEKIVQE  331

Query  792   LESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLY  613
             +  V   +  E  +                  +F   +   T+ +++YLH+ +TETLRLY
Sbjct  332   VRDVVGNQVGEAKI-----------------DEFVENITDGTLEQMHYLHAALTETLRLY  374

Query  612   PAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVF  433
             PAVP D +    DD+LPDG RV+ G +V Y  Y+MGRM Y WG DA  F+PERWL +G+F
Sbjct  375   PAVPIDGRCAEVDDILPDGFRVRKGDIVNYTAYAMGRMPYIWGKDAEDFRPERWLSNGIF  434

Query  432   QNASPFKFTAFQAGPRICLGKDSAYLQMKM-ALAILCRFFKFKLV-EGHSVEYRMMTVLS  259
             Q  SPFKF  F AGPRICLGKD AY QMK+ A+A+LC FF+FKL  E  +V YR M  L 
Sbjct  435   QPESPFKFVTFHAGPRICLGKDFAYRQMKIVAMALLC-FFRFKLADETKAVTYRTMFTLH  493

Query  258   MAHGLKLTVSPR  223
             +   L +   PR
Sbjct  494   IDGSLPMLAVPR  505



>ref|XP_009393311.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=516

 Score =   412 bits (1059),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 225/507 (44%), Positives = 311/507 (61%), Gaps = 25/507 (5%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             +G I+   VF  + S +    P   P+ G     + ++  + D+         +  +  P
Sbjct  25    VGWILLFIVFYVKESIQGSNRP---PIAGTVFHLLIHFNAVFDFQTAVARRHKTFRLIAP  81

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
               +  Y A P NVEHVLKTNF  Y KG+  ++ M  L GDGIF  DGE WR QRK AS E
Sbjct  82    PHSDIYTADPANVEHVLKTNFSKYSKGQGNYTVMRDLFGDGIFAVDGEKWRHQRKLASFE  141

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             F+++ LRDFS+VVFR  + KL   ++ A+      DMQDLLM+ TLDSI KVGFGVE+ T
Sbjct  142   FSARVLRDFSSVVFRSTAAKLAQKISDAAATASVFDMQDLLMKATLDSIFKVGFGVELDT  201

Query  1209  LA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVI  1033
             L+  +    RF++AFD AN IV  R++D LWK+K+ L+VG EA L ++I+ IDDF + +I
Sbjct  202   LSGSDELGARFSEAFDDANSIVFWRYVDVLWKVKRRLDVGIEARLKRNIKLIDDFVFQLI  261

Query  1032  RKRKAEIEETQKNEKSMKHDILSRFIELGKDPE-NNINDKSLRDIVLNFVIAGRDTTATT  856
             R+++ ++   ++++ S K DILSRFI L K+ E  + +D  LRD++LNF++AG+DTTA T
Sbjct  262   RRKRDQMNNGEEDKMS-KGDILSRFI-LAKEKEPESTSDSYLRDVILNFMMAGKDTTANT  319

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             L+W  Y++  H  + EK+ +E+E   +    + ++                  +FA  L 
Sbjct  320   LTWFFYLLCKHPSIQEKVAAEVEDATKAEGNKSDM-----------------AEFAMSLT  362

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
              + + K+ YLH+ +TETLRLYPAVP D K   EDDVLPDG  VK G  +TY+ Y+MGRM 
Sbjct  363   DEAIDKMQYLHAALTETLRLYPAVPVDGKSADEDDVLPDGFEVKKGDGITYLTYAMGRMT  422

Query  495   YNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFF  316
             Y WG DA  F+PERW+++G F+  SPFKF AF AGPR CLGKD AY QMK+  A   RFF
Sbjct  423   YIWGEDAEDFRPERWIENGSFKPQSPFKFVAFHAGPRSCLGKDFAYRQMKIVAAATLRFF  482

Query  315   KFKLV-EGHSVEYRMMTVLSMAHGLKL  238
             +F L  E  +  YR M  L +  GL L
Sbjct  483   RFHLEDESKTDRYRTMFTLHIRDGLPL  509



>ref|XP_006339781.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=506

 Score =   411 bits (1057),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 223/523 (43%), Positives = 320/523 (61%), Gaps = 32/523 (6%)
 Frame = -1

Query  1773  SMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANS  1594
             S+  ++L+L   +FC   +H L+++     R  PV G     + N+ R+H ++       
Sbjct  9     SITAIILSL---VFCVFILHLLTKKVHVKKRYHPVGGTIFNHLINFHRLHHYMTDLAGKY  65

Query  1593  YSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRK  1414
              +  +  PF    + + P NVE++LKTNF NY KG   ++ ++ L GDGIF  DG+ WR+
Sbjct  66    KTYRLISPFRNDIFTSDPANVEYILKTNFENYGKGRYSYNILKDLFGDGIFTVDGDKWRE  125

Query  1413  QRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKV  1234
             QRK  S EF+++ LRDFS+VVFR  + KL  IL++A   ++ +D+QDL M+ TLDSI ++
Sbjct  126   QRKFLSHEFSARILRDFSSVVFRKDAAKLAHILSEAVKSSKIIDIQDLFMKATLDSIFRI  185

Query  1233  GFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTI  1057
              FGVE+ ++  +  E  +F  AFD A+ +   RF+D LWKIK+FLN+GSEA L  +IRTI
Sbjct  186   AFGVELDSMCGSNDEGKKFINAFDDASELTLWRFVDILWKIKRFLNIGSEAKLRDNIRTI  245

Query  1056  DDFTYSVIRKRKAEIE--ETQKNEKSMKHDILSRFIELGK-DPENNINDKSLRDIVLNFV  886
             D+F Y +I ++  ++   E   + +  K D LSRF++  + DP      K LRDI+LNF+
Sbjct  246   DEFVYKLIHRKTEQMSKPEADLSLQWKKEDTLSRFLQTAETDP------KYLRDIMLNFI  299

Query  885   IAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQ  706
             IAG+DTTATTLSW IY++  +  V EK+  +++     +    ++               
Sbjct  300   IAGKDTTATTLSWFIYVLCKYPHVQEKVAQDIKEATNEKQDATDI---------------  344

Query  705   RAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVT  526
               M FA  ++ D + K+ YLH+ +TETLRLYPAVP + K    DD LPDG  V  G +V 
Sbjct  345   --MDFAANVSEDALEKMQYLHAALTETLRLYPAVPVNGKICFSDDTLPDGFNVNKGDIVA  402

Query  525   YVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
             Y  Y+MGRM++ WG DA  +KPERWL  DG F+  +PFKFTAFQAGPRICLGK+ AY QM
Sbjct  403   YQSYAMGRMKFIWGDDAEEYKPERWLDGDGFFRPENPFKFTAFQAGPRICLGKEFAYRQM  462

Query  348   KMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             K+  A+L R+F F+L  E  +V YR M  L +  GL + V  R
Sbjct  463   KILSALLLRYFVFRLSDEEKTVNYRTMISLHIDGGLHVRVFHR  505



>emb|CDX74746.1| BnaA05g04920D [Brassica napus]
Length=511

 Score =   412 bits (1058),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 284/446 (64%), Gaps = 23/446 (5%)
 Frame = -1

Query  1548  AHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLR  1369
             A P NVEH+LKT F NY KG+     +  LLG GIF  DGE W++QRK AS EF+++ LR
Sbjct  84    ADPRNVEHILKTRFDNYTKGQNNRENLGDLLGHGIFAVDGEKWKQQRKLASFEFSARVLR  143

Query  1368  DFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             DFS  VFR  ++K+   +++  L  +  D QD+LMR TLDSI KVGFGVE+  L     E
Sbjct  144   DFSCSVFRANAVKVVGFVSEFGLSQKSFDAQDMLMRCTLDSIFKVGFGVELKCLDGFSKE  203

Query  1188  NR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
                F +AFD  N   +LRFIDPLWK+K FLNVGS+A L +SI TID F Y +I  ++ E+
Sbjct  204   GEEFMEAFDEGNDATSLRFIDPLWKMKWFLNVGSQARLKKSIATIDKFVYRLISTKRKEL  263

Query  1011  EETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
                Q     ++ DILSRF +E  KDPE  +NDK LRDI+L+F+IAG+DTTA +LSW +YM
Sbjct  264   ANEQNT--GVREDILSRFLVESEKDPEK-MNDKYLRDIILSFMIAGKDTTAASLSWFLYM  320

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             +  +  V EK+  E+  V     +  +V      +   ES+++ A+            ++
Sbjct  321   LCKNPLVQEKIVQEIRDVTSSHERTTDV------NGFVESIDEEALD-----------QM  363

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ ++ETLRLYPAVP D +    DDVLPDG RVK G  V Y+ Y+MGRM Y WG DA
Sbjct  364   QYLHAALSETLRLYPAVPVDTRCAENDDVLPDGHRVKRGDNVYYISYAMGRMSYIWGQDA  423

Query  474   ASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-E  298
               FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD AY QMK+    L  FF+FK+  E
Sbjct  424   EEFKPERWLKDGVFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFRFKMADE  483

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
               +V Y+ M  L +  GL L   PRT
Sbjct  484   KSNVSYKRMLTLHIEGGLHLHAIPRT  509



>ref|XP_009133730.1| PREDICTED: cytochrome P450 704C1-like [Brassica rapa]
Length=512

 Score =   411 bits (1057),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 218/454 (48%), Positives = 286/454 (63%), Gaps = 23/454 (5%)
 Frame = -1

Query  1572  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  1393
             P  +  + A   NVEH+LKT F NY KG      +  LLG GIF  DG+ WR+QRK AS 
Sbjct  77    PGQSEIFTADARNVEHILKTRFENYSKGHSSRENLADLLGHGIFAVDGDKWRQQRKLASF  136

Query  1392  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIG  1213
             EF+++ LRDFS  VFR  + KL   +++ +L  +  D QD+LMR TL+SI KVGFGVE+ 
Sbjct  137   EFSTRVLRDFSCSVFRTNACKLVGFVSEFALSGKSFDAQDMLMRYTLESIFKVGFGVELK  196

Query  1212  TLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
              L     E   F + FD  N+  +LRFIDPLWK+K+FLN+GS+A L +SI TID F Y +
Sbjct  197   CLDEFSKEGEEFMEGFDEGNVATSLRFIDPLWKLKRFLNIGSQARLKKSIDTIDKFVYRL  256

Query  1035  IRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             I  ++ E+ + Q    +++ DILSRF +E  KDPEN +NDK LRDI+LNF+IAG+DTTA 
Sbjct  257   ITTKRKELAKEQNT--AVRDDILSRFLVESEKDPEN-MNDKYLRDIILNFMIAGKDTTAA  313

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             +LS  +YM+  +  V EK+  E+  V            H+ ++D           F   +
Sbjct  314   SLSLFLYMLCKNPLVQEKILQEIRGVTSS---------HERTTD--------VNSFVENI  356

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
             N + + ++ YLH+ ++ETLRLYP VP D +    DD+L DG RVK G  V Y+ Y+MGRM
Sbjct  357   NEEALDRMQYLHAALSETLRLYPPVPVDMRCAENDDILADGHRVKRGDNVYYMAYAMGRM  416

Query  498   EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
              Y WG DA  FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD AY QMK+   +L  F
Sbjct  417   TYVWGQDAEEFKPERWLKDGVFQPKSPFKFISFHAGPRICLGKDFAYRQMKIVSMVLLHF  476

Query  318   FKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             F+FK+  E  +V Y+ M  L +  GL L   PRT
Sbjct  477   FRFKMADEKSNVRYKRMLTLHIEGGLHLHAIPRT  510



>emb|CDY60682.1| BnaCnng36830D [Brassica napus]
Length=554

 Score =   412 bits (1060),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 218/454 (48%), Positives = 285/454 (63%), Gaps = 23/454 (5%)
 Frame = -1

Query  1572  PFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASL  1393
             P  +  + A   NVEH+LKT F NY KG      +  LLG GIF  DG+ WR+QRK AS 
Sbjct  119   PGQSEIFTADARNVEHILKTRFDNYSKGHSSRENLADLLGHGIFAVDGDKWRQQRKLASF  178

Query  1392  EFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIG  1213
             EF+++ LRDFS  VFR  + KL   +++ +L  +  D QD+LMR TL+SI KVGFGVE+ 
Sbjct  179   EFSTRVLRDFSCSVFRTNACKLVGFVSEFALSGKSFDAQDMLMRYTLESIFKVGFGVELK  238

Query  1212  TLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSV  1036
              L     E   F + FD  N+  +LRFIDPLWK+K+FLN+GS+A L +SI TID F Y +
Sbjct  239   CLDEFSKEGEEFMEGFDEGNVATSLRFIDPLWKLKRFLNIGSQARLKKSIATIDKFVYRL  298

Query  1035  IRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             I  ++ E+   Q    +++ DILSRF +E  KDPEN +NDK LRDI+LNF+IAG+DTTA 
Sbjct  299   ITTKRKELGREQNT--AVREDILSRFLVESEKDPEN-MNDKYLRDIILNFMIAGKDTTAA  355

Query  858   TLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLL  679
             +LSW +YM+  +  V EK+  E+  V            H+ ++D           F   +
Sbjct  356   SLSWFLYMMCKNPLVQEKILQEIRDVTSS---------HERTTD--------VNGFVQSI  398

Query  678   NYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRM  499
             N + + ++ YLH+ ++ETLRLYP VP D +    DD+L DG RVK G  V Y+ Y+MGRM
Sbjct  399   NEEALDQMQYLHAALSETLRLYPPVPVDMRCAENDDILADGHRVKRGDNVYYLAYAMGRM  458

Query  498   EYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRF  319
              Y WG DA  FKPERWLKDG FQ  SPFKF +F AGPRICLGKD AY QMK+   +L  F
Sbjct  459   TYVWGQDAEEFKPERWLKDGGFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMVLLHF  518

Query  318   FKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             F+FK+  E  +V Y+ M  L +  GL L   PRT
Sbjct  519   FRFKMADEKSNVRYKRMLTLHIEGGLHLHAIPRT  552



>ref|XP_009143150.1| PREDICTED: cytochrome P450 704C1-like [Brassica rapa]
Length=511

 Score =   411 bits (1056),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 284/446 (64%), Gaps = 23/446 (5%)
 Frame = -1

Query  1548  AHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLR  1369
             A P NVEHVLKT F NY KG+     +  LLG GIF  DGE W++QRK AS EF+++ LR
Sbjct  84    ADPRNVEHVLKTRFDNYTKGQNNRENLGDLLGHGIFAVDGEKWKQQRKLASFEFSARVLR  143

Query  1368  DFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             DFS  VFR  ++K+   +++  L  +  D QD+LMR TLDSI KVGFGVE+  L     E
Sbjct  144   DFSCSVFRTNAVKVVGFVSEFGLSQKSFDAQDMLMRCTLDSIFKVGFGVELKCLDGFSKE  203

Query  1188  NR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
                F +AFD  N   +LRFIDPLWK+K FLN+GS+A L +SI TID F Y +I  ++ E+
Sbjct  204   GEEFMEAFDEGNDATSLRFIDPLWKMKWFLNIGSQARLKKSIATIDKFVYRLITTKREEL  263

Query  1011  EETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
                Q     ++ DILSRF +E  KDPE  +NDK LRDI+L+F+IAG+DTTA +LSW +YM
Sbjct  264   ANEQNT--GVREDILSRFLVESEKDPEK-MNDKYLRDIILSFMIAGKDTTAASLSWFLYM  320

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             +  +  V EK+  E+  V     +  +V      +   ES+++ A+            ++
Sbjct  321   LCKNPLVQEKIVQEIRDVTSSHERTTDV------NGFVESIDEEALD-----------QM  363

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ ++ETLRLYPAVP D +    DDVLPDG RVK G  V Y+ Y+MGRM Y WG DA
Sbjct  364   QYLHAALSETLRLYPAVPVDTRCAENDDVLPDGHRVKRGDNVYYISYAMGRMSYIWGQDA  423

Query  474   ASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-E  298
               FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD AY QMK+    L  FF+FK+  E
Sbjct  424   EEFKPERWLKDGVFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFRFKMADE  483

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
               +V Y+ M  L +  GL L   PRT
Sbjct  484   KSNVSYKRMLTLHIEGGLHLHAIPRT  509



>gb|KDP28728.1| hypothetical protein JCGZ_14499 [Jatropha curcas]
Length=512

 Score =   410 bits (1055),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 225/491 (46%), Positives = 296/491 (60%), Gaps = 22/491 (4%)
 Frame = -1

Query  1686  PRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNF  1507
             P   PV G    Q   Y  ++D          +  +  P  +  Y     N+EHVLKT F
Sbjct  38    PNYAPVRGTVFYQFFYYNNLYDHQTEVAKKQKTFRLIGPLGSNLYTTDIRNIEHVLKTKF  97

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              NY KG+     +  LLG GIFN DG  W++QRK AS EF+++ LRDFS  VFR  + KL
Sbjct  98    YNYSKGQYNQFVLTNLLGQGIFNVDGNKWKQQRKLASFEFSARVLRDFSCSVFRKNATKL  157

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANII  1150
                ++  ++ +Q  DMQD+LMR TLDSI KVGFGVE+  L  +  E   F KAFD +N +
Sbjct  158   VGSISSVAIADQVFDMQDILMRCTLDSIFKVGFGVELNCLEGSSKEGTAFMKAFDDSNAL  217

Query  1149  VTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDI  970
             V  R++DP WK+KK+LN G EA+L ++I+ +DDF  +VI  R+    E Q+ E ++K DI
Sbjct  218   VYWRYVDPFWKLKKYLNFGCEALLRKNIKIVDDFVSNVISSRRKLFAE-QRYE-NVKEDI  275

Query  969   LSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSE  793
             LSRF +E  KDPE  ++DK LRDI+LNF+IAG+DT+A TLSW  YM+  +  + EK+  E
Sbjct  276   LSRFLVESEKDPET-MDDKYLRDIILNFMIAGKDTSAGTLSWFFYMLCKNPLIQEKVVQE  334

Query  792   LESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLY  613
             +  V                SD  + +      F   +   T+ + +YLH+ +TETLRLY
Sbjct  335   VRRVT--------------GSDQEDDIG--VEDFMAKITETTLEQTHYLHAALTETLRLY  378

Query  612   PAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVF  433
             PAVP D +    DDVLPDG ++K G  + Y+ Y+MGRM Y WG DA  F+PERWL +G+F
Sbjct  379   PAVPVDGRCAEVDDVLPDGYKMKKGDGLYYMAYAMGRMPYIWGEDAEEFRPERWLNNGIF  438

Query  432   QNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSM  256
             Q  SPFKF AF AGPRICLGKD AY QMK+    L RFF+FKL  E  +V YR M  L +
Sbjct  439   QPESPFKFIAFHAGPRICLGKDFAYRQMKIVSMALLRFFRFKLADETKNVTYRTMFTLHI  498

Query  255   AHGLKLTVSPR  223
               GL L   PR
Sbjct  499   HEGLHLRAIPR  509



>ref|NP_001169224.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACN32019.1| unknown [Zea mays]
 tpg|DAA46014.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=526

 Score =   411 bits (1056),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 215/496 (43%), Positives = 299/496 (60%), Gaps = 28/496 (6%)
 Frame = -1

Query  1683  RSWPVIGASVEQMTNYGRMHDWLVGYLA--NSYSVVVPMPFTTYTYIAHPDNVEHVLKTN  1510
             R  PV+G    Q+ +  R+HD+         ++ ++VP       Y   P  VEH+L+TN
Sbjct  50    RYAPVVGTVFHQLYHVRRLHDYHTDLFRERKTFQLLVPAG-RRQIYTCDPAVVEHILRTN  108

Query  1509  FPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLK  1330
             F NY KG   +  M  LLGDGIF  DG+ WR+QRK AS +F+++ LRDFS  VF+  + +
Sbjct  109   FANYGKGSFNYENMTDLLGDGIFAVDGDKWRQQRKIASYDFSTRALRDFSGSVFKRNAAR  168

Query  1329  LFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANII  1150
             L  I++  +   Q ++ Q L +R T+DSI  + FG+++ TL  +   +RFA AFD A+  
Sbjct  169   LAGIVSGKAASGQPMEFQGLALRATMDSIFTIAFGLDLDTLGGSAEGSRFAAAFDDASEF  228

Query  1149  VTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEE----TQKNEKSM  982
               LR+++  WK ++FL VGSEA L + ++ +D+F Y  IR+R  E+ +    T+      
Sbjct  229   TLLRYVNAFWKAQRFLGVGSEAALKKRVKVVDEFVYKRIRERAQELSDSKLATEDTVPDS  288

Query  981   KHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKL  802
             + D+LSRFI    +    ++ K LRDI+LN VIAG+DTTA  L+W +YM   H ++ EK+
Sbjct  289   RQDMLSRFIHTATNESGTVDYKYLRDIILNIVIAGKDTTAGALAWFLYMACKHPEIQEKI  348

Query  801   WSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETL  622
               E                   ++D  E+      +FA  L  + + K++YLH+ +TETL
Sbjct  349   CQEAAK----------------ATDASETAG--VDEFAQSLTDEALNKMHYLHAALTETL  390

Query  621   RLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-K  445
             RLYP+VP D K    DDVLPDG+ V  G +V YVPY+MGRMEY WG DA  F+PERWL +
Sbjct  391   RLYPSVPLDNKQCFGDDVLPDGSSVSKGDIVFYVPYAMGRMEYLWGKDAEVFRPERWLDQ  450

Query  444   DGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH--SVEYRMM  271
             DG FQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L RFF F+L +G   SV YR M
Sbjct  451   DGEFQQESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLLRFFVFRLRDGDKASVNYRTM  510

Query  270   TVLSMAHGLKLTVSPR  223
               L +  GL LT + R
Sbjct  511   ITLHIDEGLHLTATAR  526



>ref|XP_009400464.1| PREDICTED: cytochrome P450 704C1-like [Musa acuminata subsp. 
malaccensis]
Length=504

 Score =   410 bits (1054),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 219/487 (45%), Positives = 298/487 (61%), Gaps = 22/487 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV+G    Q+ N+ R+HD+         +  +  P     Y   P  VE++LKTNF NY 
Sbjct  37    PVVGTIFHQLLNFRRLHDYHTKLSLKHKTFRLLSPLCHQIYSTDPAVVEYILKTNFDNYG  96

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG   +   + L GDGIF  DG+ WR QRK AS  F++K LR+FS  +F+  ++KL  +L
Sbjct  97    KGWYNYGNTKELFGDGIFAVDGDKWRHQRKLASFGFSTKVLREFSGAIFKRNAVKLAHVL  156

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAANIIVTLR  1138
             +  +  N++ DMQDLLM+ T+DSI K+GFG+E+  L  +    + FAKAFD +N  + +R
Sbjct  157   SSYATSNEKFDMQDLLMKSTMDSIFKIGFGLELNCLDDSDNHGSEFAKAFDVSNEFIMMR  216

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF  958
             +++  WK+ +FLN+G E  L   ++ +DDF Y +IR R  E+   + ++   K DILSRF
Sbjct  217   YVNAFWKVMRFLNIGGEKTLKSKVKLVDDFIYKLIRIRVEEM-SNEGSDSEGKDDILSRF  275

Query  957   IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVE  778
             +E  +    NI+ K LRDI+LNF+IAG+D+TA TL+W  Y I  +  V EK++ E++ V 
Sbjct  276   LEESRKDPQNIDLKYLRDIILNFMIAGKDSTAGTLAWFFYSICKNPPVQEKIYQEIKEVI  335

Query  777   EMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQ  598
             E  A E+        S D ESLN                 ++YLH+ ++ETLRLYPAVP 
Sbjct  336   E--ASEDAAFDAFAESIDDESLNN----------------MHYLHAALSETLRLYPAVPL  377

Query  597   DPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVFQNAS  421
             + K    DD+LP G  V+ G +V Y PY+MGRMEY WG DA  F+PERWL D GVFQ  S
Sbjct  378   ENKVCFADDILPGGYNVRKGDIVFYQPYAMGRMEYLWGRDAEIFRPERWLDDGGVFQPES  437

Query  420   PFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             P+KF+AFQAGPRICLGK+ AY QMK+   +L RFFKFKL  E   VEYR M  L +  GL
Sbjct  438   PYKFSAFQAGPRICLGKEFAYRQMKIFAMVLLRFFKFKLGDEKKDVEYRTMMTLHIDQGL  497

Query  243   KLTVSPR  223
              L V  R
Sbjct  498   YLQVLHR  504



>ref|XP_003574226.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Brachypodium 
distachyon]
Length=515

 Score =   410 bits (1054),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 222/515 (43%), Positives = 305/515 (59%), Gaps = 26/515 (5%)
 Frame = -1

Query  1755  LALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVP  1576
             L L ++  C      ++ RK    R  P  G    Q+ +  ++HD+  G      +  + 
Sbjct  19    LGLAVLAICSYMAVVVTGRK----RYPPAAGTVFHQVYHLRQLHDYYTGLFREHKTFRLL  74

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
              P     Y + P  VE++LKTNF NY KGE  +  M  LLGDGIF  DG+ W++QRK AS
Sbjct  75    APGRRLVYTSDPAVVEYILKTNFGNYGKGEFNYENMSDLLGDGIFAVDGQKWKEQRKIAS  134

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              +F+++ LRDFS  VF   + KL  I++  +   + +D Q LLM+ T+DSI  + FG+++
Sbjct  135   YDFSTRALRDFSGGVFNKNAAKLAHIVSDNTAAKKPMDFQGLLMKATMDSIFTIAFGLDL  194

Query  1215  GTLAPNL--PENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
              TL  ++    +RFA AFD A+    LR+++  WK+ + LNV +EA+L + I+ +D F Y
Sbjct  195   NTLGGSMYSEGSRFAAAFDDASEFSLLRYVNAFWKVARLLNVRAEAMLRERIKVVDGFVY  254

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
               IR R  EI     N    K D+LSRF+++ +     ++ K LRDI++N VIAG+DTTA
Sbjct  255   KHIRARADEISSDATNPHDSKQDLLSRFMKVTRSETGEVDYKYLRDIIMNIVIAGKDTTA  314

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
               L+W +YM+  H +V EK+  E          +E V   Q +S D          F+  
Sbjct  315   GALAWFLYMVCKHPEVQEKICQE---------TKEAVNAGQAASIDA---------FSQS  356

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L  + + K++YLH+ +TETLRLYP+VP D K    DDVLPDG  V  G +V YVPY+MGR
Sbjct  357   LTDEALNKMHYLHAALTETLRLYPSVPLDNKECFSDDVLPDGFSVGKGDIVFYVPYAMGR  416

Query  501   MEYNWGPDAASFKPERWLKD-GVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             ME  WG DA SF+PERWL + G+FQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L 
Sbjct  417   MERLWGEDAGSFRPERWLDEHGMFQPESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLL  476

Query  324   RFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             RFF   L  EG SV YR M  L +  GL LT +PR
Sbjct  477   RFFVLALRDEGASVNYRTMITLYIDQGLHLTATPR  511



>ref|XP_011034716.1| PREDICTED: cytochrome P450 704C1 isoform X2 [Populus euphratica]
Length=511

 Score =   410 bits (1053),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/521 (44%), Positives = 307/521 (59%), Gaps = 29/521 (6%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGG----GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             + A GL+     F++   Q   G     P   PV G    Q+  + R++D          
Sbjct  10    ITAAGLLFIIISFLYLTFQIYSGKSIKNPNYPPVKGTVFGQLFYFNRLYDHQTEVAKKQK  69

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +  +  P  +  Y     N+EHVLKTNF  Y KG+     +  L G GIF  DG+ WR+Q
Sbjct  70    TFRLLAPGQSELYTTDIRNIEHVLKTNFDKYTKGKYNQDVVTDLFGKGIFAVDGDKWRQQ  129

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RK AS EF+++ LRDFS  VFR  + KL  ++++ ++ +Q  DMQD LMR TLDSI KVG
Sbjct  130   RKLASFEFSTRVLRDFSCSVFRRNAAKLVRVVSEMAIADQIFDMQDTLMRCTLDSIFKVG  189

Query  1230  FGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             FGVE+      N     F KAFD +N +V  R++DPLWK+K++ N+ SEA L ++I+ ID
Sbjct  190   FGVELNCFEGSNKEGTEFMKAFDDSNSLVYRRYVDPLWKLKRYFNICSEASLKKNIKIID  249

Query  1053  DFTYSVI-RKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIA  880
             DF  ++I  KRK + EE   N+K    DILSRF +E  KDPE  +NDK LRDI+LNF+IA
Sbjct  250   DFVTNLIGTKRKLQAEERHYNDK---EDILSRFLVESKKDPEE-MNDKYLRDIILNFMIA  305

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             G+DT+A TLSW  YM+  +  + EK+  E+  V               S DD  ++ +  
Sbjct  306   GKDTSANTLSWFFYMLCKNPLIQEKVAQEVRDVTS-------------SQDDVVNVEE--  350

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
               F   +   T+ +++YLH+ +TETLRLYPAVP D +    DD+LPDG R+K G  + Y+
Sbjct  351   --FIANITDTTLEQMHYLHAALTETLRLYPAVPVDGRCAEVDDILPDGFRMKKGDGLYYM  408

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
              Y+MGRM Y WG DA  F+PERWL +G+FQ  SPFKF AF AGPRICLGKD AY QMK+ 
Sbjct  409   AYAMGRMPYIWGDDAEDFRPERWLNNGIFQPESPFKFIAFHAGPRICLGKDFAYRQMKIL  468

Query  339   LAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPRT  220
                L RFF+FKL +    + YR M  L +   L L    RT
Sbjct  469   SIALLRFFRFKLADDTRKITYRTMFTLHIEGSLHLRAIGRT  509



>gb|KFK37343.1| hypothetical protein AALP_AA4G244100 [Arabis alpina]
Length=420

 Score =   406 bits (1044),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 216/438 (49%), Positives = 279/438 (64%), Gaps = 23/438 (5%)
 Frame = -1

Query  1524  VLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFR  1345
             +LKT F NY KG+  H  +  LLG GIF  DGE W++QRK AS EF ++ LRDFS  VFR
Sbjct  1     MLKTRFDNYTKGDNTHENLADLLGHGIFAVDGERWKQQRKLASFEFTTRVLRDFSCSVFR  60

Query  1344  DYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAF  1168
               + KL   + + SL  +  D QD+LMR TLDSI KVGFGVE+  L     E   F +AF
Sbjct  61    RNASKLVGYVKECSLSKKAFDAQDMLMRFTLDSIFKVGFGVELRCLDGFSKEGEEFMEAF  120

Query  1167  DAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEK  988
             D  N+  + R+IDPLWK+K+FLN+GSE  L +S+ TID F YS+I  ++ E+   + N  
Sbjct  121   DEGNVATSSRYIDPLWKVKRFLNIGSEYRLKKSVATIDKFVYSLITTKRKELANEKDN--  178

Query  987   SMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVA  811
             +++ DILSRF +E  KDPEN +NDK LRDI+L+FVIAG+DTTA +LSW +YM+  H  V 
Sbjct  179   AVREDILSRFLVESEKDPEN-MNDKYLRDIILSFVIAGKDTTAASLSWLLYMLCKHPLVQ  237

Query  810   EKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVT  631
             EK+  E+  V     K  +V          ES+ + A+            ++ YLH+ ++
Sbjct  238   EKIVQEIRDVTSSHEKTIDV------DGFVESITEEALD-----------QMQYLHATLS  280

Query  630   ETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERW  451
             ETLRLYP+VP D +    DD+LPDG RV  G  + Y+ Y+MGRM Y WG DA  FKPERW
Sbjct  281   ETLRLYPSVPVDTRCAENDDILPDGYRVSKGDNLYYIAYAMGRMTYIWGQDAEEFKPERW  340

Query  450   LKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRM  274
             LKDGVFQ  SPFKF +F AGPRICLGKD AY QMK+    L  FF+FK+  E  +V Y+ 
Sbjct  341   LKDGVFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFRFKMADEKTNVHYKR  400

Query  273   MTVLSMAHGLKLTVSPRT  220
             M  L +  GL L  +PRT
Sbjct  401   MLTLHIEGGLHLCATPRT  418



>ref|XP_008237027.1| PREDICTED: cytochrome P450 704C1-like [Prunus mume]
Length=506

 Score =   409 bits (1052),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 221/493 (45%), Positives = 302/493 (61%), Gaps = 25/493 (5%)
 Frame = -1

Query  1686  PRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNF  1507
             P   PV G    Q+  + R++D+         +  +  P  +  Y     N+EHVLKTNF
Sbjct  34    PNYPPVKGTVFHQLLYFDRLYDYQTEVAKEHSTYRLLAPDHSAVYTTDTRNIEHVLKTNF  93

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              +Y KG+   + +  + G GIF  DGE W++QRK AS EF+++ LRD S  VFR  + KL
Sbjct  94    GSYSKGKYNQAILSDIFGQGIFVVDGEKWKQQRKLASFEFSTRVLRDVSCSVFRRNAAKL  153

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANII  1150
               ++ + S+     DMQDLLMR TLDSI KVGFG+++  L  +  E   F KAFD + ++
Sbjct  154   VKVIFEISVARGVFDMQDLLMRCTLDSIFKVGFGIDLNCLEGSSKEGTAFMKAFDESTVL  213

Query  1149  VTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDI  970
                R++DP WK+K+ LN+GSEA L + +  IDDF + VIR ++  +E  Q+ + + K DI
Sbjct  214   TNFRYVDPFWKLKRILNLGSEASLKKYVEVIDDFVHQVIRSKRKLLE--QQKDVNDKEDI  271

Query  969   LSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSE  793
             LSRF+ E  KDPE  INDK LRDI+LNF+IAG+DT+A TLSW  Y++  +  + EK+  E
Sbjct  272   LSRFLLESKKDPEE-INDKYLRDIILNFMIAGKDTSANTLSWFFYLLSKNPLMQEKVVQE  330

Query  792   LESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLY  613
             +  V   +A E  +                  +F   +   T+ +++YLH+ +TETLRLY
Sbjct  331   VRDVVGNQAGEAKI-----------------NEFVENITDATLEQMHYLHAALTETLRLY  373

Query  612   PAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVF  433
             PAVP D +    DD+LPDG RV+ G  V Y+ Y+MGRM Y WG DA  F+PERWLK+G+F
Sbjct  374   PAVPIDGRFAEVDDILPDGFRVRKGDGVNYMAYAMGRMPYIWGKDADDFRPERWLKNGIF  433

Query  432   QNASPFKFTAFQAGPRICLGKDSAYLQMKM-ALAILCRFFKFKLV-EGHSVEYRMMTVLS  259
             Q  SPFKF AF AGPRICLGKD AY QMK+ A+A+LC FF+FKL  E  +V YR M  L 
Sbjct  434   QPESPFKFVAFHAGPRICLGKDFAYRQMKIVAMALLC-FFRFKLADETKAVTYRTMFTLH  492

Query  258   MAHGLKLTVSPRT  220
             +   L +   PR 
Sbjct  493   IDGSLPMLAIPRA  505



>ref|XP_003528922.1| PREDICTED: cytochrome P450 704C1 isoform 1 [Glycine max]
 gb|KHN04573.1| Cytochrome P450 704C1 [Glycine soja]
Length=510

 Score =   409 bits (1052),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 218/517 (42%), Positives = 312/517 (60%), Gaps = 30/517 (6%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
              L+  L +     + R   ++    +  PV G    QM N+ R+H ++    A   +  +
Sbjct  16    ALSASLTLLVVQLLFRKLNKRHSRKKYHPVAGTIFNQMLNFNRLHHYMTDLAAKHRTYRL  75

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               PF    Y   P NVE++LKTNF NY KG   +  ++ LLGDGIF  DGE WR+QRK +
Sbjct  76    LNPFRYEVYTTEPTNVEYILKTNFENYGKGLYNYHNLKDLLGDGIFTVDGEKWREQRKIS  135

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EF++K LRDFS  +FR   +KL  I+++A+  N  +++QDLLM+ TLDSI +V FG E
Sbjct  136   SHEFSTKMLRDFSISIFRKNVVKLVNIVSEAATSNSTLEIQDLLMKSTLDSIFQVAFGTE  195

Query  1218  IGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             + ++  +  E + FA AFD ++ +   R++D  WKIKKFLN+GSEA L ++   +++F +
Sbjct  196   LDSMCGSSQEGKIFADAFDTSSALTLYRYVDVFWKIKKFLNIGSEAKLRKTTEILNEFVF  255

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGK-DPENNINDKSLRDIVLNFVIAGRDTT  865
              +I  R  +++ ++ +  S + DILSRF+++ + DP        LRDI+LNFVIAG+DTT
Sbjct  256   KLINTRILQMQISKGDSGSKRGDILSRFLQVKEYDP------TYLRDIILNFVIAGKDTT  309

Query  864   ATTLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             A TLSW +YM+  + +V EK   E+ E+    R    N  ++  + +  E +N       
Sbjct  310   AATLSWFMYMLCKYPEVQEKAAEEVKEATNTKRISSYNEFVYSVTDEALERMN-------  362

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
                         YLH+ +TETLRLYPAVP D K    DD LPDG  V  G MV+Y PY+M
Sbjct  363   ------------YLHAAITETLRLYPAVPVDAKICFSDDTLPDGYSVNKGDMVSYQPYAM  410

Query  507   GRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAI  331
             GRM++ WG DA  F+PERWL ++G+F+  SPFKFTAFQAGPRICLGK+ AY QMK+  A+
Sbjct  411   GRMKFIWGDDAEDFRPERWLDENGIFKPESPFKFTAFQAGPRICLGKEFAYRQMKIFAAV  470

Query  330   LCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             L   F+FKL  E  +V Y+ M  L +  GL++    R
Sbjct  471   LLGCFRFKLKDEKKNVTYKTMINLHIDEGLEIKAFNR  507



>ref|XP_011034707.1| PREDICTED: cytochrome P450 704C1 isoform X1 [Populus euphratica]
Length=512

 Score =   409 bits (1052),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 229/523 (44%), Positives = 310/523 (59%), Gaps = 28/523 (5%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGG----GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             + A GL+     F++   Q   G     P   PV G    Q+  + R++D          
Sbjct  10    ITAAGLLFIIISFLYLTFQIYSGKSIKNPNYPPVKGTVFGQLFYFNRLYDHQTEVAKKQK  69

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +  +  P  +  Y     N+EHVLKTNF  Y KG+     +  L G GIF  DG+ WR+Q
Sbjct  70    TFRLLAPGQSELYTTDIRNIEHVLKTNFDKYTKGKYNQDVVTDLFGKGIFAVDGDKWRQQ  129

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RK AS EF+++ LRDFS  VFR  + KL  ++++ ++ +Q  DMQD LMR TLDSI KVG
Sbjct  130   RKLASFEFSTRVLRDFSCSVFRRNAAKLVRVVSEMAIADQIFDMQDTLMRCTLDSIFKVG  189

Query  1230  FGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             FGVE+      N     F KAFD +N +V  R++DPLWK+K++ N+ SEA L ++I+ ID
Sbjct  190   FGVELNCFEGSNKEGTEFMKAFDDSNSLVYRRYVDPLWKLKRYFNICSEASLKKNIKIID  249

Query  1053  DFTYSVI-RKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIA  880
             DF  ++I  KRK + EE  ++ K+ K DILSRF +E  KDPE  +NDK LRDI+LNF+IA
Sbjct  250   DFVTNLIGTKRKLQAEE--RHYKNDKEDILSRFLVESKKDPEE-MNDKYLRDIILNFMIA  306

Query  879   GRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRA  700
             G+DT+A TLSW  YM+  +  + EK+  E+  V               S DD  ++ +  
Sbjct  307   GKDTSANTLSWFFYMLCKNPLIQEKVAQEVRDVTS-------------SQDDVVNVEE--  351

Query  699   MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
               F   +   T+ +++YLH+ +TETLRLYPAVP D +    DD+LPDG R+K G  + Y+
Sbjct  352   --FIANITDTTLEQMHYLHAALTETLRLYPAVPVDGRCAEVDDILPDGFRMKKGDGLYYM  409

Query  519   PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMA  340
              Y+MGRM Y WG DA  F+PERWL +G+FQ  SPFKF AF AGPRICLGKD AY QMK+ 
Sbjct  410   AYAMGRMPYIWGDDAEDFRPERWLNNGIFQPESPFKFIAFHAGPRICLGKDFAYRQMKIL  469

Query  339   LAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPRTHN  214
                L RFF+FKL +    + YR M  L +   L L    RT +
Sbjct  470   SIALLRFFRFKLADDTRKITYRTMFTLHIEGSLHLRAIGRTKS  512



>ref|XP_006397734.1| hypothetical protein EUTSA_v10001408mg [Eutrema salsugineum]
 gb|ESQ39187.1| hypothetical protein EUTSA_v10001408mg [Eutrema salsugineum]
Length=511

 Score =   409 bits (1051),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 219/446 (49%), Positives = 283/446 (63%), Gaps = 23/446 (5%)
 Frame = -1

Query  1548  AHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLR  1369
             A P NVEH+LKT F NY KG      +  LLG GIF  DGE WR+QRK AS EF+++ LR
Sbjct  84    ADPRNVEHMLKTRFDNYSKGHNSRQNLGDLLGHGIFAVDGEKWRQQRKLASFEFSARVLR  143

Query  1368  DFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             DFS  VFR  + K+   +T+ +L     D QD+LMR TLDSI KVGFGVE+  L     E
Sbjct  144   DFSCSVFRRNASKVVAFVTKFALTGNAFDAQDMLMRCTLDSIFKVGFGVELKCLDGFSKE  203

Query  1188  NR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
                F +AFD  N+  + RFIDPLWK+K FLN+GS++ L +SI TID F Y +I  ++ E+
Sbjct  204   GEEFMEAFDEGNVATSSRFIDPLWKLKWFLNIGSQSRLKKSIATIDKFVYRLITIKRKEL  263

Query  1011  EETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
              E Q    +++ DILSRF +E  KDPE  +NDK LRDI+L+F+IAG+DTTA +LSW +YM
Sbjct  264   AEEQNT--AVREDILSRFLVESEKDPEK-MNDKYLRDIILSFMIAGKDTTAASLSWFLYM  320

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             +  +  V EK+  E+  V     K  +V      +   ES+ + A+            ++
Sbjct  321   LCKNPLVQEKIVQEIREVTSTHEKTTDV------NSFVESITEEALD-----------QM  363

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ ++ETLRLYPAVP D +    DD+LPDG +V  G  + Y+ Y+MGRM Y WG DA
Sbjct  364   QYLHAALSETLRLYPAVPVDVRCAGNDDILPDGHKVNKGDNLYYIAYAMGRMTYIWGQDA  423

Query  474   ASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-E  298
               FKPERWLKDGVFQ+ SPFKF +F AGPRICLGKD AY QMK+    L  FF+FK+  E
Sbjct  424   EDFKPERWLKDGVFQHESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFRFKMADE  483

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
               +V Y+ M  L +  GL L   PRT
Sbjct  484   KSNVHYKRMLTLHIEGGLHLYAIPRT  509



>gb|KFK37344.1| hypothetical protein AALP_AA4G244200 [Arabis alpina]
Length=513

 Score =   409 bits (1050),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 288/455 (63%), Gaps = 31/455 (7%)
 Frame = -1

Query  1554  YIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKN  1375
             + A P NVEH+LKT F  Y KGE     +  LLG GIFN DGE W++QRK AS EF ++ 
Sbjct  78    FTADPRNVEHILKTRFEIYSKGESNRVNLFDLLGHGIFNTDGEKWKQQRKLASFEFTARV  137

Query  1374  LRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNL  1195
             LRDFS  VFR  + KL   +   ++  +  D QD+LMR +LDSI KVGFGVE+G L    
Sbjct  138   LRDFSCNVFRRNASKLVGFVNGLAISGKAFDAQDMLMRYSLDSIFKVGFGVELGCLDGFS  197

Query  1194  PENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKA  1018
              E   F +AFD AN+  + RF DPLWK+K FL +GS++ L++SI TID F Y +I  ++ 
Sbjct  198   KEGEEFMEAFDEANVASSSRFFDPLWKVKWFLKIGSQSRLEKSIATIDKFVYGLITTKRK  257

Query  1017  EIEETQKNEK----SMKHDILSRFIELG-KDPENNINDKSLRDIVLNFVIAGRDTTATTL  853
             E+ E  +  K    +++ DILSRF+    KDPEN +NDK LRDI+L+F+IAG+DTTA TL
Sbjct  258   ELAEEHELAKEHNVAVREDILSRFLVASEKDPEN-MNDKYLRDIILSFMIAGKDTTAATL  316

Query  852   SWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL---  682
             SW +YM+  +  V EK+      V+E+R              D  S N++ +   G    
Sbjct  317   SWFLYMLCKNPLVQEKI------VQEIR--------------DVTSSNEKTIDVDGFVQS  356

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             +  + + ++ YLH+ ++ETLRLYP VP D K   +DD+LPDG RV  G  V+YV Y+MGR
Sbjct  357   ITEEVLERVQYLHAALSETLRLYPPVPVDTKCAEDDDILPDGHRVSKGDNVSYVGYAMGR  416

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             M Y WG DA  FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD AY QMK+    L  
Sbjct  417   MTYIWGEDAEEFKPERWLKDGVFQPESPFKFISFHAGPRICLGKDFAYRQMKIISMALLH  476

Query  321   FFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             FF+FK+  E  +V Y+ M  L +  GL L  +PRT
Sbjct  477   FFRFKMADEKTNVHYQTMLTLHLEGGLHLCATPRT  511



>ref|XP_002511745.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50414.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   409 bits (1050),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 224/513 (44%), Positives = 309/513 (60%), Gaps = 23/513 (4%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             L ++ F +V +   + +    P   PVIG    Q+  +  ++D          +  +  P
Sbjct  17    LFVLTFLYVMLKVYTGKSINNPDYAPVIGTVFGQLFYFSYLYDHQAELAKTHKTFRLLGP  76

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
               +  Y     N+EHVLKTNF  Y KG+     +  L G+GIF  DG+ WR+QRK AS E
Sbjct  77    EESELYTTDVRNIEHVLKTNFDKYSKGKYNQDVLTDLFGEGIFAVDGDKWRQQRKLASFE  136

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             F+++ LR+FS  VFR  + KL  ++++ ++ ++  DMQD+LMR TLDSI KVGFGVE+  
Sbjct  137   FSARVLREFSCSVFRTNTAKLVRVMSKVAVPDKVFDMQDILMRCTLDSIFKVGFGVELNC  196

Query  1209  L-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVI  1033
             L   +  E  F +AFD +N +V  R++DP WK+K+F NVG EA L ++I+TID+F  ++I
Sbjct  197   LEGSSKKETAFTRAFDDSNELVYWRYVDPFWKLKRFFNVGCEASLRKNIKTIDEFVSNLI  256

Query  1032  RKRKAEIEETQKNEKSMKHDILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATT  856
               R+  + E  +  +++K DILSRF+ E  KDPE  +NDK LRDI+LNF++AG+D++A T
Sbjct  257   GTRRKLLAE--QRYQNVKEDILSRFLTESEKDPEK-MNDKYLRDIILNFMLAGKDSSANT  313

Query  855   LSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLN  676
             LSW  YM+  +  V EK+  E+  V             Q S+ D E        F   + 
Sbjct  314   LSWFFYMLCKNPIVQEKVAQEVTQVTG----------SQDSTVDVED-------FMAKIT  356

Query  675   YDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRME  496
                + K++YLH+ +TETLRLYPAVP D +    DDVLPDG R+K G  + Y+ Y+MGRM 
Sbjct  357   DTVLEKMHYLHATLTETLRLYPAVPVDGRCAEVDDVLPDGFRMKKGDGLYYMAYAMGRMR  416

Query  495   YNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFF  316
             Y WG DA  F+PERWL +G+FQ  SPFKF AF AGPR CLGKD AY QMK+    L RFF
Sbjct  417   YIWGEDAEEFRPERWLNNGIFQPESPFKFIAFHAGPRTCLGKDFAYRQMKIVSMALLRFF  476

Query  315   KFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPRT  220
             +FKL +    V YR M  L +  GL L   PRT
Sbjct  477   RFKLDDDTRKVTYRTMFTLHINGGLYLRAIPRT  509



>ref|XP_011076303.1| PREDICTED: cytochrome P450 704C1-like [Sesamum indicum]
Length=504

 Score =   408 bits (1049),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 217/489 (44%), Positives = 299/489 (61%), Gaps = 29/489 (6%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G     + N+G+++D+L      + +  +        Y + P NVE+ LKTNF NY 
Sbjct  39    PVRGTIFHLLFNFGQIYDYLTNLTRKNSTFRILYLDNVEIYTSDPANVEYFLKTNFANYG  98

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG  +H  +E LLGDGIF  DGE WR QRK +S EF+++NLR+FS  VF+  + KL  I+
Sbjct  99    KGSFHHDILEGLLGDGIFTVDGERWRHQRKMSSYEFSTRNLREFSNGVFKTNAAKLARIV  158

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTLRF  1135
             + A   +Q +++QDL M+  LDS+ KV  GV++ ++      ++F+KAFD A+ +   R+
Sbjct  159   SAAVTSDQAIEIQDLFMKSALDSVFKVVLGVDLDSMRGTNEGSQFSKAFDEASEMTCFRY  218

Query  1134  IDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFI  955
             +D  W IKKFLN+GSEA L + ++ +D F Y VI+ +  +I +  +N    K DILSRF+
Sbjct  219   VDMTWPIKKFLNIGSEATLKKCMKIVDGFVYKVIQSKIEQISKPNENLTVNKGDILSRFL  278

Query  954   ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEE  775
             E+     N  + K L+DI+L+F+IAG+DTTA+TLSW  YM+  H  + EK+ +E+     
Sbjct  279   EM-----NETDPKYLKDIILSFIIAGKDTTASTLSWFFYMMCKHPHIQEKIVTEV-----  328

Query  774   MRAKEENVLLHQYSSDDP--ESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVP  601
                  E   L +YSS D   ES+ + A+            K+ YLH+ ++ETLRLYPAVP
Sbjct  329   ----REAAKLGEYSSVDEIVESITEEALD-----------KMQYLHAALSETLRLYPAVP  373

Query  600   QDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNA  424
              D K    DD  PDG  VK G +V YVPYSMGRM+  WG DA  F+P+RWL ++GVFQ  
Sbjct  374   SDGKVCFADDTFPDGFSVKKGNLVAYVPYSMGRMKSLWGEDAEEFRPDRWLNENGVFQQE  433

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHG  247
             S FKFTAFQAGPRICLGK+ AY QMK+  ++L   F F L  E   V YR M  L +  G
Sbjct  434   SSFKFTAFQAGPRICLGKEFAYRQMKVFASVLLSAFSFTLADENRPVHYRTMLTLQIDGG  493

Query  246   LKLTVSPRT  220
             L L  S RT
Sbjct  494   LHLRPSFRT  502



>ref|XP_003581548.1| PREDICTED: cytochrome P450 704C1-like [Brachypodium distachyon]
Length=511

 Score =   408 bits (1048),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 221/489 (45%), Positives = 303/489 (62%), Gaps = 21/489 (4%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             P+ G  + Q+ N+GR+ ++         +  +  P  +Y Y   P NVEH+L+TNF NY 
Sbjct  32    PIAGTVLHQLLNFGRLVEYQTELSRKHRTYRMLTPTCSYVYTVEPANVEHILRTNFANYG  91

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG + H  +E LLGDGIFN DG  WR QRK AS EF+++ LR++ST VFRD + +L  I+
Sbjct  92    KGAMTHDVLEDLLGDGIFNVDGAKWRHQRKAASFEFSTRVLREYSTGVFRDTAAELAGIV  151

Query  1314  TQASLLNQQ-VDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAA-NIIVTL  1141
               A+   ++ VDMQDLLMR TLDSI ++GFGV +G L+ +  E           +  V  
Sbjct  152   AVAAARGERAVDMQDLLMRSTLDSIFQIGFGVRLGALSGSNEEGAAFARAFDDASEQVLY  211

Query  1140  RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSR  961
             RF D LWK K+ LNV SEA + +S+RTI+DF Y+VI K+  ++   Q +E + K DILSR
Sbjct  212   RFFDLLWKAKRLLNVSSEAAMKRSVRTINDFVYAVIDKKIEQMARDQ-HEFAKKEDILSR  270

Query  960   FI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELES  784
             F+ E  KDP    ++K LRDI+LNFVIAGRDT+A TLSW +Y++  ++ + +K+  E+  
Sbjct  271   FLLEREKDP-GCFDNKYLRDIILNFVIAGRDTSAGTLSWFLYVLCNNQHIQDKVAREVRE  329

Query  783   VEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAV  604
                              + D ++      +F   L+ D ++K+ YLH+ +TETLRLYPAV
Sbjct  330   AT--------------GTGDSDAAPAGVQEFIECLDEDAISKMQYLHAALTETLRLYPAV  375

Query  603   PQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQN  427
             P D K    DD LPDG  ++ G MV Y PY MGRM++ WG DA  F+PERWL  DG F  
Sbjct  376   PIDVKYCFSDDTLPDGHAIRKGDMVNYQPYPMGRMKFLWGDDAEEFRPERWLDDDGAFVP  435

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHS-VEYRMMTVLSMAH  250
              SP+KFTAFQAGPRICLGK+ AY QMK+  A+L   F+F++ E +S + +R M  L M  
Sbjct  436   ESPYKFTAFQAGPRICLGKEFAYRQMKIFAAVLLYLFRFEMWERNSTMGFRPMLTLKMDG  495

Query  249   GLKLTVSPR  223
              L + V PR
Sbjct  496   PLNVRVLPR  504



>ref|XP_006339519.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=515

 Score =   408 bits (1049),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/523 (42%), Positives = 317/523 (61%), Gaps = 28/523 (5%)
 Frame = -1

Query  1764  TLVLALGLIMFCWV-----FIHRLSQRKG-GGPRSWPVIGASVEQMTNYGRMHDWLVGYL  1603
             T+ +++ +++F  V      I R+   K    P+  PV G    Q+  + R++D+     
Sbjct  6     TIFISIAILLFICVTPLLILIVRIYAGKSIRNPKYAPVEGTVFHQLLYFNRVYDYQTELA  65

Query  1602  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  1423
               + +     P  + TY     N+E++LKTNF  Y KG+     +  L G+GIF  DGE 
Sbjct  66    KKTPTFRFLAPEQSETYTTDSRNIEYILKTNFSKYSKGKRNQEVIMDLFGEGIFAVDGEK  125

Query  1422  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  1243
             W++QRK AS EF+++ LRDFS  VFR  + KL + +++ SL NQ  DMQ+LLMR +L+SI
Sbjct  126   WKQQRKLASFEFSARVLRDFSCKVFRKGATKLVSKVSELSLANQVFDMQELLMRCSLESI  185

Query  1242  CKVGFGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSI  1066
              KVGFGV++  L   +  +N+F KAFD +N +   R++DP WK+K++ N+GSE +L ++I
Sbjct  186   FKVGFGVDLNCLEGSSGDDNKFIKAFDDSNALSYWRYVDPFWKLKRYFNIGSEFLLKKNI  245

Query  1065  RTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNF  889
             + I +F   +IR R+ ++E   K +   K DILSRF +E  KDPE   N + LRDI+LNF
Sbjct  246   KFIQEFVDELIRTRRKQLE--MKQDSMDKEDILSRFLVESKKDPEKMTN-RYLRDIILNF  302

Query  888   VIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLN  709
             ++AG+D+TA TLSW  Y++  +  +  K+      VEE+R   +N +    S DD     
Sbjct  303   MLAGKDSTANTLSWFFYVLCKNPLIQIKI------VEEIREVIDNNMKDNGSVDD-----  351

Query  708   QRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMV  529
                  F   +  + + K++YLH+ +TETLRLYPAVP D +    DDVLPDG  +K G  V
Sbjct  352   -----FVASITEEVLEKMHYLHATLTETLRLYPAVPVDGRCADADDVLPDGFHIKKGDGV  406

Query  528   TYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
              Y+ Y+MGRM Y WG DA  F+PERWLKDG+FQ  SPFKF AF AGPR+CLGKD AY +M
Sbjct  407   YYMSYAMGRMPYVWGDDAEDFRPERWLKDGIFQPESPFKFIAFHAGPRLCLGKDFAYRKM  466

Query  348   KMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             K+    L  FF+FKL +    V YR M  L +  GL++   PR
Sbjct  467   KIVSMALLHFFRFKLSDDTKEVTYRTMFTLHIKEGLQVRAVPR  509



>emb|CDP03436.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   408 bits (1048),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 218/501 (44%), Positives = 309/501 (62%), Gaps = 30/501 (6%)
 Frame = -1

Query  1707  SQRKGGGPRS--WPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT-TYTYIAHPD  1537
             S R+G   +    PV G     + N+ R+H +L   LA  Y     + F+    Y + P 
Sbjct  29    SMRRGSREKKKYTPVGGTVFHMLLNFDRLHHYLTD-LARKYKTFRMLNFSRCEVYTSDPA  87

Query  1536  NVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFST  1357
             NVE++LKTNF NY +G  +HS +E LLGDGIF  DGE WR QRKT+S EF++K LRDFS+
Sbjct  88    NVEYILKTNFANYGRGPYHHSVLEDLLGDGIFTVDGEKWRNQRKTSSYEFSTKILRDFSS  147

Query  1356  VVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA-PNLPENRF  1180
              VFR  + KL  ++++A   NQ +D+QDL M+  LDS+ KV  GVE+ ++   N    RF
Sbjct  148   GVFRTNASKLARLVSEAVASNQTMDVQDLFMKSALDSVFKVVLGVELDSMCGTNEEGTRF  207

Query  1179  AKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQ  1000
             ++ FD A+ I   R++D  WK+K+FLN+GSEA L  +++ ID++ Y +IR +  ++ +++
Sbjct  208   SRCFDEASAITLYRYVDLPWKLKRFLNLGSEAKLRNNVKVIDEYVYKIIRSKTEQLHKSR  267

Query  999   KNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHE  820
              +    K DILSRF+E      N  + K L+DI+L+F+IAG+DTTA+TLSW  YM+  H 
Sbjct  268   DDWLMKKEDILSRFLE-----NNETDPKYLKDIILSFIIAGKDTTASTLSWFFYMMCKHP  322

Query  819   DVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHS  640
              + E++  E+        K  NV  +  + +   S+ + A+            K+ YLH+
Sbjct  323   HMQERIADEV-------VKATNVKGNPLTDELANSITEEALD-----------KMQYLHA  364

Query  639   VVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKP  460
              +TETLRLYPAVP D K    DD  PDG  ++ G  ++Y P++MGRM++ WG DA  F+P
Sbjct  365   ALTETLRLYPAVPLDGKFCFSDDTFPDGLSIRKGDTISYQPWAMGRMKFIWGEDAEDFRP  424

Query  459   ERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHS-V  286
             ERWL ++GVFQ  SPFKF AFQAGPRICLGK+ AY QMK+  A+L   F FKL +    V
Sbjct  425   ERWLNENGVFQQESPFKFPAFQAGPRICLGKEFAYRQMKIFSAVLLGSFTFKLSDKQKVV  484

Query  285   EYRMMTVLSMAHGLKLTVSPR  223
             +Y+ M  L +  GL L  SPR
Sbjct  485   KYKTMLTLHVDGGLHLQASPR  505



>ref|XP_007219038.1| hypothetical protein PRUPE_ppa004579mg [Prunus persica]
 gb|EMJ20237.1| hypothetical protein PRUPE_ppa004579mg [Prunus persica]
Length=502

 Score =   407 bits (1046),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 222/532 (42%), Positives = 327/532 (61%), Gaps = 42/532 (8%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             SNP+ +++   LVLAL  I    +   +L++ K   P   P+ G  + Q+ N+ R+HD++
Sbjct  5     SNPIFLTA---LVLALS-IFTAQILAGKLTKAKKKHP---PIAGTVLHQLLNFNRVHDYM  57

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +   F    Y ++P NVE++LKTNF NY KG   ++ ++ LLG+GIF  
Sbjct  58    TDLAGKHGTYRLLGLFRNEIYTSNPANVEYILKTNFDNYGKGWYNYNILKDLLGEGIFAV  117

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             DGE WR+QRK +S +F++K LRDFS+V+FR  + KL   +++ +  NQ +D+QDL M+ +
Sbjct  118   DGEKWRQQRKISSHDFSTKMLRDFSSVIFRKNAAKLADKVSEIATSNQAIDIQDLFMKSS  177

Query  1254  LDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI +V FG+E+  +  +  E + F  AFD ++ +   R++D  W+IKKFLN+GSEA L
Sbjct  178   LDSIFQVAFGIELDNMCGSNEEGKSFGDAFDNSSALTLWRYVDVFWRIKKFLNLGSEAAL  237

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM----KHDILSRFIEL-GKDPENNINDKS  913
              ++ + ++DF + +I  +   IE+ QK +       + DILSRF+++ G DP        
Sbjct  238   RKNTKIVNDFVFKLIHNK---IEQMQKKDNCPATVDREDILSRFLQVTGTDP------IY  288

Query  912   LRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYS  733
             LRDI+LNF+IAG+DTTATTL+W  Y++  H  V EK+  E++    M+       +  +S
Sbjct  289   LRDIILNFIIAGKDTTATTLAWFFYLLCKHPSVQEKIVQEVKQATGMKK------ITNFS  342

Query  732   SDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGT  553
                         +FA  ++ D + K+ YLH+ +TETLR+YPAVP+D K    DD LPDG 
Sbjct  343   ------------EFASGVSEDALEKMQYLHAAITETLRIYPAVPEDAKICFSDDTLPDGY  390

Query  552   RVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICL  376
              V+ G M+ Y PY+MGRM+  WG DA  F+PERWL ++GVFQ  SPFKF+AFQAGPRICL
Sbjct  391   SVRKGDMIAYQPYAMGRMKVIWGDDAEKFRPERWLNENGVFQPESPFKFSAFQAGPRICL  450

Query  375   GKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             GK+ AY QMK+  A+L   F FK+  E   V YR M  L +  GL++    R
Sbjct  451   GKEFAYRQMKIFSAVLLSCFMFKISDENKVVTYRTMINLHILGGLEVRAFHR  502



>gb|KHN04093.1| Cytochrome P450 704C1 [Glycine soja]
Length=497

 Score =   407 bits (1045),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 213/502 (42%), Positives = 298/502 (59%), Gaps = 26/502 (5%)
 Frame = -1

Query  1692  GGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKT  1513
             G P   PV G    Q+  +  +HD+       + +  +  P  +  Y A P N+EH+LKT
Sbjct  11    GDPDYAPVKGTVFNQLLYFNTLHDYHAQVAKTNPTFRLLAPDQSELYTADPRNIEHILKT  70

Query  1512  NFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSL  1333
             NF  Y KG+     +  L G+GIF  DG+ WR+QRK AS EF+++ LRDFS  VFR  + 
Sbjct  71    NFDKYSKGKYNQDIVTDLFGEGIFAVDGDKWRQQRKLASFEFSTRVLRDFSCSVFRRNAA  130

Query  1332  KLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-NRFAKAFDAAN  1156
             KL  ++++ S   Q  DMQD+LMR TLDSI KVGFG E+  L  +  E + F KAFD +N
Sbjct  131   KLVRVISEFSHQGQVFDMQDILMRCTLDSIFKVGFGTELNCLNGSSKEGSEFMKAFDESN  190

Query  1155  IIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI----EETQKNEK  988
              ++  R++DP WK+K+FLN+G EA L ++++ IDDF + VI+ RKA++    E   ++  
Sbjct  191   ALIYWRYVDPFWKLKRFLNIGCEATLKRNVKIIDDFVHGVIKTRKAQLALQQEYVSRSIA  250

Query  987   SMKHDI-----LSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTH  823
             S+   I      +RF+   K  +  + D+ LRDI+LNF+IAG+DT+A TLSW  YM+  +
Sbjct  251   SVPPSISLMSKRTRFLIESKKDQKTMTDQYLRDIILNFMIAGKDTSANTLSWFFYMLCKN  310

Query  822   EDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLH  643
               + EK+  E+  V    + E    + +               F   +  DT+ +++YLH
Sbjct  311   PLIEEKIVQEVRDVSCSCSHESEPNIEE---------------FVAKITDDTLDRMHYLH  355

Query  642   SVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFK  463
             + +TETLRLYPAVP D +     D+LPDG ++K G  V Y+ Y MGRM   WG DA  F+
Sbjct  356   AALTETLRLYPAVPADGRTAEAHDILPDGHKLKKGDGVYYLAYGMGRMCSIWGEDAEEFR  415

Query  462   PERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEG-HSV  286
             PERWL +G+FQ  SPFKF AF AGPRICLGKD AY  MK+    L RFF+FKL  G  +V
Sbjct  416   PERWLNNGIFQPESPFKFVAFHAGPRICLGKDFAYRPMKIVAMALVRFFRFKLANGTQNV  475

Query  285   EYRMMTVLSMAHGLKLTVSPRT  220
              Y++M  L +  GL L   PR+
Sbjct  476   TYKVMFTLHIDKGLLLCAIPRS  497



>ref|XP_002465041.1| hypothetical protein SORBIDRAFT_01g031080 [Sorghum bicolor]
 gb|EER92039.1| hypothetical protein SORBIDRAFT_01g031080 [Sorghum bicolor]
Length=521

 Score =   407 bits (1046),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 217/509 (43%), Positives = 302/509 (59%), Gaps = 26/509 (5%)
 Frame = -1

Query  1719  IHRLSQR-KGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPF-TTYTYIA  1546
             + R  QR K    R  PV+G    Q+ +  R+HD+         +V +  P      Y  
Sbjct  29    VGRRGQRSKQPKKRYAPVVGTVFHQLYHVRRLHDYHADLFRKRKTVQLLAPAGRRQIYTC  88

Query  1545  HPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRD  1366
              P  VEH+L+TNF NY KG   +  M  L GDGIF  DG+ WR+QRK AS +F+++ LRD
Sbjct  89    DPAVVEHILRTNFANYGKGTFNYENMADLFGDGIFAVDGDKWRQQRKIASYDFSTRALRD  148

Query  1365  FSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE-  1189
             FS  VF+  + +L  I+   +   Q ++ Q L +R T+DSI  + FG+++ TL     + 
Sbjct  149   FSGAVFKRNAARLAGIVAGNAASGQPMEFQGLALRATMDSIFTIAFGLDLDTLMGGSEKG  208

Query  1188  NRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIE  1009
             +RFA AFD A+    LR+++  WK ++FL VGSEA L Q ++ +D+F Y  IR R  E+ 
Sbjct  209   SRFAAAFDDASEFTLLRYVNAFWKAQRFLGVGSEAKLRQRVKVVDEFVYKCIRDRAQELS  268

Query  1008  ETQKNEKSM----KHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAI  841
              ++  E ++    + D+LSRFI    +    ++ K LRDI+LN VIAG+DTTA  L+W +
Sbjct  269   HSKATEDAVPEDSRQDMLSRFIRTATNESGTVDYKYLRDIILNIVIAGKDTTAGALAWFL  328

Query  840   YMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMA  661
             YM   H ++ EK+  E   V               +S+   ++ +    FA  L  + + 
Sbjct  329   YMACKHPEIQEKVVQEATRVTNA------------ASETAATVEE----FAQSLTDEALN  372

Query  660   KLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGP  481
             K++YLH+ +TETLRLYP+VP D K    DDVLPDG+ V  G +V YVPY+MGRMEY WG 
Sbjct  373   KMHYLHAALTETLRLYPSVPLDNKQCFGDDVLPDGSSVSKGDIVFYVPYAMGRMEYLWGK  432

Query  480   DAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKL  304
             DA  F+PERWL ++G FQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L RFF F+L
Sbjct  433   DAEVFRPERWLDQNGEFQQESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLLRFFVFRL  492

Query  303   VEGH--SVEYRMMTVLSMAHGLKLTVSPR  223
              +G   +V YR M  L +  GL LT + R
Sbjct  493   RDGEKATVNYRTMITLHIDEGLHLTATAR  521



>ref|XP_009393320.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=529

 Score =   407 bits (1047),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 227/519 (44%), Positives = 312/519 (60%), Gaps = 36/519 (7%)
 Frame = -1

Query  1749  LGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMP  1570
             +G I+   VF  + S +    P   P+ G     + ++  + D+         +  +  P
Sbjct  25    VGWILLFIVFYVKESIQGSNRP---PIAGTVFHLLIHFNAVFDFQTAVARRHKTFRLIAP  81

Query  1569  FTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLE  1390
               +  Y A P NVEHVLKTNF  Y KG+  ++ M  L GDGIF  DGE WR QRK AS E
Sbjct  82    PHSDIYTADPANVEHVLKTNFSKYSKGQGNYTVMRDLFGDGIFAVDGEKWRHQRKLASFE  141

Query  1389  FASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGT  1210
             F+++ LRDFS+VVFR  + KL   ++ A+      DMQDLLM+ TLDSI KVGFGVE+ T
Sbjct  142   FSARVLRDFSSVVFRSTAAKLAQKISDAAATASVFDMQDLLMKATLDSIFKVGFGVELDT  201

Query  1209  LA-PNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVI  1033
             L+  +    RF++AFD AN IV  R++D LWK+K+ L+VG EA L ++I+ IDDF + +I
Sbjct  202   LSGSDELGARFSEAFDDANSIVFWRYVDVLWKVKRRLDVGIEARLKRNIKLIDDFVFQLI  261

Query  1032  RKRKAEI---EETQKNEKSM---------KHDILSRFIELGKDPE-NNINDKSLRDIVLN  892
             R+++ ++   EE + N++           K DILSRFI L K+ E  + +D  LRD++LN
Sbjct  262   RRKRDQMNNGEEDKVNDQEHLQNISFAMSKGDILSRFI-LAKEKEPESTSDSYLRDVILN  320

Query  891   FVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESL  712
             F++AG+DTTA TL+W  Y++  H  + EK+ +E+E   +    + ++             
Sbjct  321   FMMAGKDTTANTLTWFFYLLCKHPSIQEKVAAEVEDATKAEGNKSDM-------------  367

Query  711   NQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGM  532
                  +FA  L  + + K+ YLH+ +TETLRLYPAVP D K   EDDVLPDG  VK G  
Sbjct  368   ----AEFAMSLTDEAIDKMQYLHAALTETLRLYPAVPVDGKSADEDDVLPDGFEVKKGDG  423

Query  531   VTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQ  352
             +TY+ Y+MGRM Y WG DA  F+PERW+++G F+  SPFKF AF AGPR CLGKD AY Q
Sbjct  424   ITYLTYAMGRMTYIWGEDAEDFRPERWIENGSFKPQSPFKFVAFHAGPRSCLGKDFAYRQ  483

Query  351   MKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKL  238
             MK+  A   RFF+F L  E  +  YR M  L +  GL L
Sbjct  484   MKIVAAATLRFFRFHLEDESKTDRYRTMFTLHIRDGLPL  522



>ref|XP_008232704.1| PREDICTED: cytochrome P450 704C1 [Prunus mume]
Length=509

 Score =   407 bits (1045),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 226/517 (44%), Positives = 306/517 (59%), Gaps = 28/517 (5%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVV  1579
             VL+L  + FC++ +   + +    P   PV G   +Q+  + R++D+         +   
Sbjct  15    VLSL-FLTFCFLILRIFTGKSIRNPIYPPVKGTVFDQLFYFNRLYDYQTEIAKEHPTFRF  73

Query  1578  PMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTA  1399
               P  +  Y  +  N+EHVLKTNF  Y KG+     +  + G GIF  DGE W++QRK A
Sbjct  74    LAPEQSEVYTTNTRNIEHVLKTNFSKYSKGKYNQDIVSDIFGQGIFVVDGEKWKQQRKLA  133

Query  1398  SLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVE  1219
             S EF+++ LRDFS  VFR  + KL   + + S   +  DMQD+LMR TLDSI KVGFG++
Sbjct  134   SFEFSTRVLRDFSCSVFRRNAAKLVRAVFEISGATKSFDMQDILMRCTLDSIFKVGFGID  193

Query  1218  IGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             +  L  +  E   F KAFD +  +   R++DP WK+K+FLN+GSEA L ++++ IDDF +
Sbjct  194   LNCLEGSSKEGTAFMKAFDDSTALAYWRYVDPFWKLKRFLNIGSEAALRKNVKVIDDFVH  253

Query  1041  SVIR-KRKAEIEETQKNEKSMKHDILSRFIELG-KDPENNINDKSLRDIVLNFVIAGRDT  868
              +IR KRK    +   N+K    DILSRF+  G KDPE  +ND  LRDI+LNF+IAG+DT
Sbjct  254   QLIRSKRKLLAGQKDPNDK---EDILSRFLLEGEKDPEE-MNDTYLRDIILNFMIAGKDT  309

Query  867   TATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFA  688
             +A TLSW +YM+  +  + EK+  E+  V   +              DP+ L       A
Sbjct  310   SANTLSWFLYMLCKNPLIQEKVAQEVRDVVGGQV------------GDPDELVANITDAA  357

Query  687   GLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSM  508
                    + K++YLH+ +TETLRLYPAVP D +    DD+LPDG R+K G  + Y+ Y+M
Sbjct  358   -------LEKMHYLHAAITETLRLYPAVPVDGRCAEIDDILPDGFRLKKGDGIYYMAYAM  410

Query  507   GRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAIL  328
             GRM Y WG DA  F+PERWLK+GVFQ  SPFKF AF AGPRICLGKD AY QMK+    L
Sbjct  411   GRMPYIWGEDAEDFRPERWLKNGVFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVSTAL  470

Query  327   CRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
               FF+F L  E  +V Y+ M  L M  GL L    RT
Sbjct  471   LSFFRFNLADETKTVTYKTMFTLHMDGGLPLRAVART  507



>ref|XP_004983864.1| PREDICTED: cytochrome P450 704C1-like [Setaria italica]
Length=525

 Score =   407 bits (1046),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 216/492 (44%), Positives = 295/492 (60%), Gaps = 27/492 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLAN--SYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPN  1501
             PV+G    Q+ +  R+HD+         ++ ++ P       Y   P  VEH+L+TNF N
Sbjct  53    PVVGTVFHQLYHVRRLHDYHTDLFRKRKTFQLLAPAG-RRQIYTCDPAVVEHILRTNFAN  111

Query  1500  YPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFT  1321
             Y KG   +  M  LLGDGIF  DG+ W++QRK AS +F+++ LRDFS  VF+  + KL +
Sbjct  112   YGKGAFNYENMTDLLGDGIFAVDGDKWKQQRKIASYDFSTRALRDFSGSVFKRNAAKLAS  171

Query  1320  ILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENRFAKAFDAANIIVTL  1141
             I+  ++   Q +D Q L +R T+DSI  + FG+++ TL  +    RFA AFD A+    L
Sbjct  172   IVAGSAASGQSMDFQGLALRATMDSIFTIAFGLDLDTLGGSGDGTRFAAAFDDASEFTLL  231

Query  1140  RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNE---KSMKHDI  970
             R+++  WK  +FLNVGSEA L   ++ +D+F Y  IR R  E+ ++++ +    S + D+
Sbjct  232   RYVNAFWKALRFLNVGSEAALKDRVKVVDEFVYKRIRDRARELADSKEQDPVTDSRQEDM  291

Query  969   LSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSEL  790
             LSRFI+        ++ K LRDI+LN VIAG+DTTA  L+W +YM   H +V EK+    
Sbjct  292   LSRFIQTATSESGTVDYKYLRDIILNIVIAGKDTTAGALAWFLYMACKHPEVQEKV----  347

Query  789   ESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYP  610
                EE R K  N            S      +FA  L  + +  ++YLH+ +TETLRLYP
Sbjct  348   --CEEAR-KATNA-----------SETATVDEFAQSLTDEALNNMHYLHAALTETLRLYP  393

Query  609   AVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKD-GVF  433
             +VP D K    DDVLPDG+ V  G +V YVPY+MGRMEY WG DA  F+PERWL D G F
Sbjct  394   SVPLDNKQCFGDDVLPDGSSVSKGDIVFYVPYAMGRMEYLWGEDAGVFRPERWLDDSGEF  453

Query  432   QNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGH--SVEYRMMTVLS  259
             Q  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L R F F+L +G   +V YR M  L 
Sbjct  454   QQQSPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLLRSFAFRLRDGDKATVNYRTMITLH  513

Query  258   MAHGLKLTVSPR  223
             +  GL LT + R
Sbjct  514   IDQGLHLTATAR  525



>ref|XP_010518171.1| PREDICTED: cytochrome P450 704C1-like [Camelina sativa]
Length=511

 Score =   407 bits (1045),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 228/520 (44%), Positives = 310/520 (60%), Gaps = 25/520 (5%)
 Frame = -1

Query  1764  TLVLALGLIMFCWVF--IHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             T+V  + +++F  ++  I   + +     R  PV     + + +   ++D+         
Sbjct  10    TVVTTIFVVLFFAIYLTIRIFTGKSRNDKRYAPVHATVFDLLFHSDDLYDYETEIAREKP  69

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +     P  +    A P NVEH+LKT F  Y KG      +  LLG GIF  DG+ W++Q
Sbjct  70    TYRFLSPGQSEILTADPRNVEHILKTRFDKYSKGHSSRENLTDLLGHGIFAVDGDKWKQQ  129

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RK AS EF+++ LRDFS  VFR  + KL   +T+ +L  +  D QD+LMR TLD+I KVG
Sbjct  130   RKLASFEFSTRVLRDFSCSVFRKNASKLVDFVTEFALSGKAFDAQDMLMRFTLDAIFKVG  189

Query  1230  FGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             FGVE+  L     E   F +AFD +N+  + RF+DPLWK+K FLN+GS++ L +SI TID
Sbjct  190   FGVELKCLDGFSKEGEEFMEAFDESNVATSSRFLDPLWKLKWFLNIGSQSKLKKSIATID  249

Query  1053  DFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAG  877
              F YS+I  ++ ++ + Q    +++ DILSRF +E  KDPEN +NDK LRDI+LNF+IAG
Sbjct  250   KFVYSLITTKRNDLAKEQNT--AVREDILSRFLVESEKDPEN-MNDKYLRDIILNFMIAG  306

Query  876   RDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAM  697
             +DTTA +LSW +YM+  +  V EK+  E+  V     K  +V          ES+N+ A+
Sbjct  307   KDTTAASLSWFLYMLCKNPLVQEKVVQEIRDVTSSHEKTTDV------DGFVESINEEAL  360

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
                         ++ YLH+ ++ETLRLYP VP D +    DDVLPDG RVK G  V Y+ 
Sbjct  361   D-----------QMQYLHAALSETLRLYPPVPVDMRCAEIDDVLPDGYRVKKGDNVYYIA  409

Query  516   YSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             Y+MGRM Y WG DA  FKPERWLKDGVFQ  S FKF +F AGPRICLGKD AY QMK+  
Sbjct  410   YAMGRMTYIWGQDAEEFKPERWLKDGVFQPESLFKFISFHAGPRICLGKDFAYRQMKIVS  469

Query  336   AILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
               L  FF+FK+  E  +V Y+ M  L +  GL L   PRT
Sbjct  470   MALLHFFRFKMADEKSNVCYKRMLTLHVEGGLHLCAIPRT  509



>ref|XP_011091066.1| PREDICTED: cytochrome P450 704C1-like [Sesamum indicum]
Length=515

 Score =   407 bits (1045),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 223/525 (42%), Positives = 317/525 (60%), Gaps = 32/525 (6%)
 Frame = -1

Query  1794  SNPLK--VSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHD  1621
             +NP+   +S    +   L  ++F  + +  LS++  G  R  P+ G    Q+ N+ R+HD
Sbjct  2     ANPIDFLLSPTPYVATTLLYVLFSVLIVRFLSRKLLGKKRYHPIGGTVFNQLLNFYRLHD  61

Query  1620  WLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIF  1441
             ++        +  +  PF T  Y + P NVEH+LKTNF +Y KG    S +  L G+GIF
Sbjct  62    YMADLAGKYKTYRLIAPFRTEVYTSDPANVEHMLKTNFESYGKGPYNCSILGDLFGEGIF  121

Query  1440  NADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMR  1261
               DG  WR+QRK +SLEF+++ LRD+S++VFR  +++L  IL+ A+  NQ VD+QDL M+
Sbjct  122   AIDGHKWREQRKVSSLEFSTRVLRDYSSIVFRKNAVRLAKILSGAATSNQPVDIQDLFMK  181

Query  1260  MTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEA  1084
              T DSI +V  GVE+ +L  +  E  +F+ A D  ++    R++D LWK+K+ LNVGSEA
Sbjct  182   STFDSISEVALGVELDSLGGSNEEGAKFSIAADDVSMRTLWRYVDVLWKLKRALNVGSEA  241

Query  1083  ILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM---KHDILSRFIELGKDPENNINDKS  913
              L +S++ +D+F Y +I  R  ++     N+  M   K DILSRF++L          K 
Sbjct  242   KLKKSLQVVDEFVYKLIHSRTQQM-NMPGNDSVMQLKKDDILSRFLQL-----TEATPKY  295

Query  912   LRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYS  733
             LRDI ++F++AG+DTTATTLSW IYM+  +  V EK+  E++     +   +        
Sbjct  296   LRDITISFIVAGKDTTATTLSWFIYMLCKYPHVQEKVEQEIKDATGCKEVAD--------  347

Query  732   SDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGT  553
                         +F+  +  + + K++YLH+ +TETLR+YPAV  D K  L DD++PDG 
Sbjct  348   ----------ISEFSACVTEEALGKMHYLHAALTETLRIYPAVAVDAKQCLCDDIMPDGF  397

Query  552   RVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICL  376
              VK G MV Y PY+MGRM+  WG DA  FKPERWL K+G FQ ASPFKFTAFQAGPR+CL
Sbjct  398   SVKKGDMVAYQPYAMGRMKSIWGNDAEEFKPERWLDKNGCFQQASPFKFTAFQAGPRLCL  457

Query  375   GKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGL  244
             G++ AY QMK+  AIL RFF  KL  E  +V YR M  L +  GL
Sbjct  458   GQEFAYRQMKIFSAILLRFFTMKLSDERKTVNYRPMLTLLIDGGL  502



>ref|XP_004229915.2| PREDICTED: cytochrome P450 704C1-like [Solanum lycopersicum]
Length=515

 Score =   406 bits (1044),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 319/536 (60%), Gaps = 36/536 (7%)
 Frame = -1

Query  1791  NPLKVSSMETL------VLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGR  1630
             N + V SM+TL         +  ++FC   +H L+++  G  R  P+ G    Q+ N+ R
Sbjct  3     NDILVVSMDTLKSSITISSIILSLVFCVFLVHLLTRKLHGKKRYHPIGGTIFNQLINFQR  62

Query  1629  MHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGD  1450
             +H ++    A   +  +  PF    Y + P NVE++LKTN  NY KG   +S ++ LLG+
Sbjct  63    LHHYMTDLAAKYKTYRLISPFRNKIYTSDPANVEYILKTNIDNYGKGWYNYSILKDLLGN  122

Query  1449  GIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDL  1270
             GIF  DG+ WR+QRK  S EF+++  RDFS+VVFR    KL  IL++++  N+ VD+QDL
Sbjct  123   GIFAVDGDKWREQRKLLSHEFSTRVSRDFSSVVFRKNVAKLAQILSESANSNKAVDIQDL  182

Query  1269  LMRMTLDSICKVGFGVEI-GTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVG  1093
              M+ +LDSI  V FG E+  T   N  + RF  AFD AN   T R+ D  WKIK+ LN+G
Sbjct  183   FMQSSLDSIIGVAFGAELDNTCGSNEEDKRFIDAFDNANATTTWRYTDIFWKIKRALNIG  242

Query  1092  SEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSM---KHDILSRFIEL-GKDPENNI  925
              E  L  +IRT+D F Y +I  R  ++ + + +  SM   K DILSR +++   DP    
Sbjct  243   VEGKLRDNIRTVDAFVYKLIHIRTEQMSKPENHVLSMQWKKEDILSRLLQITDTDP----  298

Query  924   NDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLL  745
               K LRDI+L+ +++G+DTT+TTLSW IY++  +  V EK+  E++     +    ++  
Sbjct  299   --KYLRDIILSILLSGKDTTSTTLSWFIYVLCKYPHVQEKVVQEIKEATTEKTNATDI--  354

Query  744   HQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVL  565
                             +FA  ++ + + K+ YLH+ +TETLRLYPAVP DPK    DD L
Sbjct  355   ---------------TEFAANVSEEALVKMQYLHAALTETLRLYPAVPLDPKICFSDDTL  399

Query  564   PDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGP  388
             PDG  V  G +V Y+PY+MGRM++ WG DA  +KPERWL +DG F+  +PFKFTAFQAGP
Sbjct  400   PDGFSVNKGDVVCYLPYAMGRMKFIWGDDAEEYKPERWLDRDGFFRPENPFKFTAFQAGP  459

Query  387   RICLGKDSAYLQMKMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             RICLGK+ AY QMK+  A+L  +F FKL +   ++ YR M  L +  GL + V  R
Sbjct  460   RICLGKEFAYRQMKIFSAVLLSYFVFKLSDDKKAINYRTMINLHIDGGLHVRVFRR  515



>gb|EAY79269.1| hypothetical protein OsI_34384 [Oryza sativa Indica Group]
Length=495

 Score =   405 bits (1042),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 219/515 (43%), Positives = 310/515 (60%), Gaps = 30/515 (6%)
 Frame = -1

Query  1752  ALGLIMFC-WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDW--LVGYLANSYSVV  1582
             AL L+  C ++ +    Q++   P   PV+G    Q+ N  R+HD+   +     ++ ++
Sbjct  6     ALALVAICSYLAVTSNKQKRRRRP---PVVGTVFHQLYNVRRIHDYHTALSREHTTFRML  62

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VP       Y   P  VEH+LKTNF NY KG   H   + L GDGIF  DGE W++QRK 
Sbjct  63    VPAG-GDQIYTCDPAVVEHILKTNFANYGKGPFNHGNAKDLFGDGIFAIDGEKWKQQRKI  121

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS +F+++ LRDFS  VF+  + KL  I++  +  NQ +D Q L++R T+DSI  + FG 
Sbjct  122   ASYDFSTRALRDFSCAVFKRNAAKLAGIVSNHAASNQSMDFQGLMLRATMDSIFTIAFGT  181

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             ++ TL  +   +RFA AFD A+    LR+I PLWK+ + LNVG EA+L + I+ +D+F Y
Sbjct  182   DLNTLDGSGEGSRFAAAFDDASEFTMLRYISPLWKLARLLNVGVEAMLKERIKVVDEFVY  241

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
              +IR R  E+  +  ++   + DILSRF++     ++ ++ K LRDI+LN VIAG+DTTA
Sbjct  242   RLIRARSDEL--SNSHDSGSRQDILSRFLQ-ATTSDSGVDYKYLRDIILNIVIAGKDTTA  298

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
               L+W +YM+  H +V EK+  E               +   S+ D  S++    +F   
Sbjct  299   GALAWFLYMVCKHPEVQEKICHE--------------AMVATSAGDTASVD----EFLQS  340

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L    +  ++YLH+ +TETLRLYP+VP + K    DDVLP+G  V  G +V ++PY+MGR
Sbjct  341   LTDQALNNMHYLHAALTETLRLYPSVPMENKQCFSDDVLPNGFNVSKGDIVFFIPYAMGR  400

Query  501   MEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             ME  WG DA  F+PERWL ++GVFQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L 
Sbjct  401   MESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLL  460

Query  324   RFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             RFF  KL  E   V YR    L++  GL LT + R
Sbjct  461   RFFVLKLRDEKEIVGYRTTLTLAIDQGLHLTATAR  495



>ref|XP_006445220.1| hypothetical protein CICLE_v10023337mg, partial [Citrus clementina]
 gb|ESR58460.1| hypothetical protein CICLE_v10023337mg, partial [Citrus clementina]
Length=535

 Score =   407 bits (1046),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 218/509 (43%), Positives = 303/509 (60%), Gaps = 21/509 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             L  F  + I   S +    P   PV G    Q+  + R++D+         +  +  P  
Sbjct  44    LSTFSLLIIKIYSGKSIKDPSYPPVNGTVFHQLLYFNRLYDYQTEVAKKQPTFRLLGPAQ  103

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y     N+EHVLK  F  Y KGE     +E L G GIF  DG+ WR+QRK AS EF+
Sbjct  104   SEIYTTDIRNIEHVLKAKFDKYSKGEYNQDILEDLFGQGIFAVDGDKWRQQRKLASFEFS  163

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  + KL  +++  +++ + +DMQD+LMR TLDSI KVGFGV++  L 
Sbjct  164   TRVLRDFSCAVFRTNAAKLVKVVSGFAVVGRVLDMQDMLMRCTLDSIFKVGFGVDLNCLD  223

Query  1203  PNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E   F KAFD +N +V  R++DP WK+K+  N+GSEA L ++I+ IDDF +++I  
Sbjct  224   GSSGEGTEFMKAFDESNALVYWRYVDPFWKLKRISNIGSEASLKKNIKVIDDFVHNLIST  283

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             ++  +   Q + +  K DILSRF+   +   + ++D+ LRDI+LNF+IAG+DT+A+TLSW
Sbjct  284   KRNLLAMQQDSNE--KEDILSRFLLASEKDPDKMDDQYLRDIILNFMIAGKDTSASTLSW  341

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               Y++  +  + EK+  E+  V   +  E N+       DD          F   L  +T
Sbjct  342   FFYLLCKNPLIQEKIEQEVRDVTGGQKNETNI-------DD----------FVAKLTDET  384

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + K+ YLH+ +TETLRLYPAVP D +    DD+LPDG RVK G  V Y+ Y+MGRM   W
Sbjct  385   LEKMNYLHAALTETLRLYPAVPSDGRCAETDDILPDGYRVKKGDGVYYMAYAMGRMPSIW  444

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G +A  F+PERWL++G+FQ  SPFKF AF AGPRICLGKD AY QMK+  A L RFF+FK
Sbjct  445   GENAEEFRPERWLENGIFQPESPFKFIAFHAGPRICLGKDFAYRQMKIVSAALLRFFRFK  504

Query  306   LVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             L +    V YR M  L M  GL +    R
Sbjct  505   LTDDTRDVTYRTMFTLHMDGGLHVYAISR  533



>ref|XP_006490953.1| PREDICTED: cytochrome P450 704C1-like isoform X1 [Citrus sinensis]
Length=510

 Score =   406 bits (1043),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 218/509 (43%), Positives = 303/509 (60%), Gaps = 21/509 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             L  F  + I   S +    P   PV G    Q+  + R++D+         +  +  P  
Sbjct  19    LSTFSLLIIKIYSGKSIKDPSYPPVNGTVFHQLLYFNRLYDYQTEVAKKQPTFRLLGPAQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y     N+EHVLK  F  Y KGE     +E L G GIF  DG+ WR+QRK AS EF+
Sbjct  79    SEIYTTDIRNIEHVLKAKFDKYSKGEYNQDILEDLFGQGIFAVDGDKWRQQRKLASFEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  + KL  +++  +++ + +DMQD+LMR TLDSI KVGFGV++  L 
Sbjct  139   TRVLRDFSCAVFRTNAAKLVKVVSGFAVVGRVLDMQDMLMRCTLDSIFKVGFGVDLNCLD  198

Query  1203  PNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E   F KAFD +N +V  R++DP WK+K+  N+GSEA L ++I+ IDDF +++I  
Sbjct  199   GSSGEGTEFMKAFDESNALVYWRYVDPFWKLKRISNIGSEASLKKNIKVIDDFVHNLIST  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             ++  +   Q + +  K DILSRF+   +   + ++D+ LRDI+LNF+IAG+DT+A+TLSW
Sbjct  259   KRNLLAMQQDSNE--KEDILSRFLLASEKDPDKMDDQYLRDIILNFMIAGKDTSASTLSW  316

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               Y++  +  + EK+  E+  V   +  E N+       DD          F   L  +T
Sbjct  317   FFYLLCKNPLIQEKIEQEVRDVTGGQKNETNI-------DD----------FVAKLTDET  359

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + K+ YLH+ +TETLRLYPAVP D +    DD+LPDG RVK G  V Y+ Y+MGRM   W
Sbjct  360   LEKMNYLHAALTETLRLYPAVPSDGRCAETDDILPDGYRVKKGDGVYYMAYAMGRMPSIW  419

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G +A  F+PERWL++G+FQ  SPFKF AF AGPRICLGKD AY QMK+  A L RFF+FK
Sbjct  420   GENAEEFRPERWLENGIFQPESPFKFIAFHAGPRICLGKDFAYRQMKIVSAALLRFFRFK  479

Query  306   LVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             L +    V YR M  L M  GL +    R
Sbjct  480   LTDDTRDVTYRTMFTLHMDGGLHVYAISR  508



>gb|AAM12494.1|AC074232_21 cytochrome P450-like protein [Oryza sativa Japonica Group]
 gb|EAZ16741.1| hypothetical protein OsJ_32217 [Oryza sativa Japonica Group]
Length=495

 Score =   405 bits (1041),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 219/515 (43%), Positives = 310/515 (60%), Gaps = 30/515 (6%)
 Frame = -1

Query  1752  ALGLIMFC-WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDW--LVGYLANSYSVV  1582
             AL L+  C ++ +    Q++   P   PV+G    Q+ N  R+HD+   +     ++ ++
Sbjct  6     ALALVAICSYLAVTSNKQKRRRRP---PVVGTVFHQLYNVRRIHDYHTALSREHTTFRML  62

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VP       Y   P  VEH+LKTNF NY KG   H   + L GDGIF  DGE W++QRK 
Sbjct  63    VPAG-GDQIYTCDPAVVEHILKTNFANYGKGPFNHGNAKDLFGDGIFAIDGEKWKQQRKI  121

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS +F+++ LRDFS  VF+  + KL  I++  +  NQ +D Q L++R T+DSI  + FG 
Sbjct  122   ASYDFSTRALRDFSCAVFKRNAAKLAGIVSNHAASNQSMDFQGLMLRATMDSIFTIAFGT  181

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             ++ TL  +   +RFA AFD A+    LR+I PLWK+ + LNVG EA+L + I+ +D+F Y
Sbjct  182   DLNTLDGSGEGSRFAAAFDDASEFTMLRYISPLWKLARLLNVGVEAMLKERIKVVDEFVY  241

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
              +IR R  E+  +  ++   + DILSRF++     ++ ++ K LRDI+LN VIAG+DTTA
Sbjct  242   RLIRARSDEL--SNSHDSGSRQDILSRFLQ-ATTSDSVVDYKYLRDIILNIVIAGKDTTA  298

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
               L+W +YM+  H +V EK+  E               +   S+ D  S++    +F   
Sbjct  299   GALAWFLYMVCKHPEVQEKICHE--------------AMVATSAGDTASVD----EFLQS  340

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L    +  ++YLH+ +TETLRLYP+VP + K    DDVLP+G  V  G +V ++PY+MGR
Sbjct  341   LTDQALNNMHYLHAALTETLRLYPSVPMENKQCFSDDVLPNGFNVSKGDIVFFIPYAMGR  400

Query  501   MEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             ME  WG DA  F+PERWL ++GVFQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L 
Sbjct  401   MESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLL  460

Query  324   RFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             RFF  KL  E   V YR    L++  GL LT + R
Sbjct  461   RFFVLKLRDEKEIVSYRTTLTLAIDQGLHLTATAR  495



>ref|XP_007220949.1| hypothetical protein PRUPE_ppa026124mg [Prunus persica]
 gb|EMJ22148.1| hypothetical protein PRUPE_ppa026124mg [Prunus persica]
Length=509

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 222/489 (45%), Positives = 296/489 (61%), Gaps = 27/489 (6%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYP  1495
             PV G   +Q+  + R++D+         +V +  P  +  Y  +  N+EHVLKTNF  Y 
Sbjct  42    PVKGTVFDQLFYFNRLYDYQTEMAKEHPTVRLLAPEQSEVYTTNTRNIEHVLKTNFSKYS  101

Query  1494  KGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTIL  1315
             KG+     +  + G GIF  DGE W++QRK AS EF+++ LRDFS  VFR  + KL   +
Sbjct  102   KGKYNQDIVSDIFGQGIFVVDGEKWKQQRKLASFEFSTRVLRDFSCSVFRRNAAKLVRAV  161

Query  1314  TQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLR  1138
              + S   +  DMQD+LMR TLDSI KVGFG+++  L  +  E   F KAFD +  +   R
Sbjct  162   FEISGATKSFDMQDILMRCTLDSIFKVGFGIDLNCLEGSSKEGTAFMKAFDDSTALAYWR  221

Query  1137  FIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIR-KRKAEIEETQKNEKSMKHDILSR  961
             ++DP WK+K+FLN+GSEA L ++++ IDDF + +IR KRK    +   N+K    DILSR
Sbjct  222   YVDPFWKLKRFLNIGSEAALRKNVKVIDDFVHQLIRSKRKLLAGQKDPNDK---EDILSR  278

Query  960   FIELG-KDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELES  784
             F+  G KDPE  +ND  LRDI+LNF+IAG+DT+A TLSW +YM+  +  + EK+  E+  
Sbjct  279   FLLEGEKDPEE-MNDTYLRDIILNFMIAGKDTSANTLSWFLYMLCKNPLIQEKVAQEVRD  337

Query  783   VEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAV  604
             V   +              DP+ L       A       + K++YLH+ +TETLRLYPAV
Sbjct  338   VVGGQV------------GDPDELVANITDAA-------LEKMHYLHAAITETLRLYPAV  378

Query  603   PQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNA  424
             P D +    DD+LPDG R+K G  + Y+ Y+MGRM Y WG DA  F+PERWLK+GVFQ  
Sbjct  379   PVDGRCAEIDDILPDGFRLKKGDGIYYMAYAMGRMPYIWGEDAEDFRPERWLKNGVFQPE  438

Query  423   SPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHG  247
             SPFKF AF AGPRICLGKD AY QMK+    L  FF+FKL  E  +V Y+ M  L M  G
Sbjct  439   SPFKFVAFHAGPRICLGKDFAYRQMKIVSTALLSFFRFKLADETKTVTYKTMFTLHMDGG  498

Query  246   LKLTVSPRT  220
             L L    RT
Sbjct  499   LPLRAVART  507



>emb|CDM81564.1| unnamed protein product [Triticum aestivum]
Length=697

 Score =   412 bits (1059),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/489 (46%), Positives = 305/489 (62%), Gaps = 24/489 (5%)
 Frame = -1

Query  1674  PVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTT-YTYIAHPDNVEHVLKTNFPNY  1498
             PV GA ++Q+ N+GR+ D++   L+  Y     +     + +   P NVE++L+TNF NY
Sbjct  223   PVAGAMIQQLLNWGRLPDYMT-ELSRRYGTFRMLTLNCNWVFTVDPANVEYILRTNFANY  281

Query  1497  PKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTI  1318
              KG + H  +E LLGDGIFN DG  WR QRK AS EF ++ LR++S+ VFRD   +L  I
Sbjct  282   GKGAMTHDALEDLLGDGIFNVDGAKWRHQRKVASFEFTTRALREYSSGVFRDMGAELAGI  341

Query  1317  LTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANIIVTL  1141
             +  A+   ++VDM++L MR TLDS   +GFGV +G+L+ +  E   FA+AFD A+     
Sbjct  342   VAAAAAAGKKVDMENLFMRSTLDSTFTIGFGVNLGSLSGSNQEGAAFARAFDEASEQSLY  401

Query  1140  RFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSR  961
             RF+DPLWK K+ L V SEA + +S+RTI+ F Y+VI K+  ++   Q+ E + K DILSR
Sbjct  402   RFLDPLWKAKRLLGVSSEAAMKRSVRTINHFVYTVIDKKIDQMGRNQQ-EFAKKGDILSR  460

Query  960   F-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELES  784
             F +E  KDP    ++K LRDI+LNFVIAGRDT A TLSW +Y++   + + +K+  E+  
Sbjct  461   FLLEREKDP-GCFDNKYLRDIILNFVIAGRDTMAGTLSWFLYVLCKDQRIQDKIGQEV--  517

Query  783   VEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAV  604
                   +E     HQ              +F   L  D +  ++YLH+ +TETLRLYPAV
Sbjct  518   ------REATTGDHQDVGG--------VQEFTACLTEDAIGSMHYLHAALTETLRLYPAV  563

Query  603   PQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWL-KDGVFQN  427
             P D K    DD LPDG  V+ G MV Y PY+MGRM++ WG DA  F+PERWL  DGVF  
Sbjct  564   PTDVKCCFSDDTLPDGHAVRRGDMVNYHPYAMGRMKFLWGDDADEFRPERWLDDDGVFVP  623

Query  426   ASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLVEGHS-VEYRMMTVLSMAH  250
              SP+KFTAFQAGPRICLGK+ AY QMK+  A+L   F+F++ E  S V YR M  L M  
Sbjct  624   ESPYKFTAFQAGPRICLGKEFAYRQMKIFAAMLLYLFRFEMWERDSTVGYRPMLTLKMDG  683

Query  249   GLKLTVSPR  223
              L +  SPR
Sbjct  684   PLYVRASPR  692


 Score =   122 bits (305),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 91/148 (61%), Gaps = 0/148 (0%)
 Frame = -1

Query  1686  PRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNF  1507
             P+  PV G  + Q+ N  R+ +++        +  +  P   Y Y   P NVE++L+TNF
Sbjct  31    PKYPPVAGTMLHQLLNLVRLPEYMTELSRGHRTFRMLTPTCNYVYTVDPANVEYILRTNF  90

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              NY KG + H  +E LLGDGIFN DG  WR QRK AS EF ++ LR++S+ VFRD + +L
Sbjct  91    ANYGKGTMTHDALEDLLGDGIFNVDGAKWRHQRKEASFEFTTRALREYSSGVFRDVAAEL  150

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSI  1243
               IL  A++  ++VDM+ L MR TLDSI
Sbjct  151   AGILAAAAVAGERVDMEGLFMRSTLDSI  178



>ref|NP_001141345.1| uncharacterized protein LOC100273436 [Zea mays]
 gb|ACF86132.1| unknown [Zea mays]
 gb|AFW75367.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=522

 Score =   406 bits (1043),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 232/515 (45%), Positives = 316/515 (61%), Gaps = 30/515 (6%)
 Frame = -1

Query  1749  LGLIMFCWVFIH-RLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGY-LANSYSVVVP  1576
             LG +    VF     ++R  G P   P+ G  + Q+ N+ R+ D  V Y LA+  S +V 
Sbjct  32    LGAVASFAVFCAGEFARRDPGRP---PLTGTMLRQLKNFDRLFDEHVRYALAHRTSRLV-  87

Query  1575  MPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTAS  1396
              P  +  + A P  VEHVL+TNF  Y KG      M+ L GDGIF  DG+ WR QRK AS
Sbjct  88    YPGHSELFTADPAVVEHVLRTNFSKYSKGAYNIGVMKDLFGDGIFAIDGDSWRHQRKLAS  147

Query  1395  LEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEI  1216
              EF++K LR+FS+VVFR  + +L   ++ A+     ++MQDLLM+ T+DSI KVGFG E+
Sbjct  148   HEFSTKVLREFSSVVFRANATRLVDKISSAAANRTILNMQDLLMKTTMDSIFKVGFGFEL  207

Query  1215  GTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYS  1039
              TL+ +   + +F+ AFD AN IV  R++D  W++K++ N+GSEA L ++I+ IDDF  +
Sbjct  208   NTLSGSDKSSVQFSNAFDEANCIVYHRYVDLFWQLKRYFNIGSEAKLRKNIQIIDDFVMN  267

Query  1038  VIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTAT  859
             +I +++   E+    +   + DILSRFI   K+    IND  LRDIVLNF+IAG+DTT  
Sbjct  268   LIHQKR---EQMNGQDNKAREDILSRFIIASKEDPEMINDCYLRDIVLNFLIAGKDTTGN  324

Query  858   TLSWAIYMIMTHEDVAEKLWSEL-ESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
             TLSW +YM+  +  V +K+  E+ ESVE   A+E+N        D    LN RA+     
Sbjct  325   TLSWFLYMLCKNPIVQDKVALEIKESVEW--AEEDN-----NREDFTARLNDRAID----  373

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
                    K++YLH+ ++ETLRLYPAVP D K   +DDVLP+G +V  G  + Y+ Y+MGR
Sbjct  374   -------KMHYLHAAISETLRLYPAVPVDGKMAEDDDVLPNGYKVIKGDGINYMIYAMGR  426

Query  501   MEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCR  322
             M Y WG DA  F+PERW+ +GVFQ  SP+KF +F AGPR CLGKD AY QMK+  A L  
Sbjct  427   MTYLWGEDAEDFRPERWIANGVFQQESPYKFVSFNAGPRTCLGKDFAYRQMKIMAATLIH  486

Query  321   FFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             FF+FKL  E     Y+ M  L M  GLKL   PR+
Sbjct  487   FFRFKLTDESKDATYKTMFTLHMDKGLKLYAYPRS  521



>gb|AAP54707.2| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
Length=511

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 219/515 (43%), Positives = 310/515 (60%), Gaps = 30/515 (6%)
 Frame = -1

Query  1752  ALGLIMFC-WVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDW--LVGYLANSYSVV  1582
             AL L+  C ++ +    Q++   P   PV+G    Q+ N  R+HD+   +     ++ ++
Sbjct  22    ALALVAICSYLAVTSNKQKRRRRP---PVVGTVFHQLYNVRRIHDYHTALSREHTTFRML  78

Query  1581  VPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKT  1402
             VP       Y   P  VEH+LKTNF NY KG   H   + L GDGIF  DGE W++QRK 
Sbjct  79    VPAG-GDQIYTCDPAVVEHILKTNFANYGKGPFNHGNAKDLFGDGIFAIDGEKWKQQRKI  137

Query  1401  ASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGV  1222
             AS +F+++ LRDFS  VF+  + KL  I++  +  NQ +D Q L++R T+DSI  + FG 
Sbjct  138   ASYDFSTRALRDFSCAVFKRNAAKLAGIVSNHAASNQSMDFQGLMLRATMDSIFTIAFGT  197

Query  1221  EIGTLAPNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTY  1042
             ++ TL  +   +RFA AFD A+    LR+I PLWK+ + LNVG EA+L + I+ +D+F Y
Sbjct  198   DLNTLDGSGEGSRFAAAFDDASEFTMLRYISPLWKLARLLNVGVEAMLKERIKVVDEFVY  257

Query  1041  SVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTA  862
              +IR R  E+  +  ++   + DILSRF++     ++ ++ K LRDI+LN VIAG+DTTA
Sbjct  258   RLIRARSDEL--SNSHDSGSRQDILSRFLQ-ATTSDSVVDYKYLRDIILNIVIAGKDTTA  314

Query  861   TTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGL  682
               L+W +YM+  H +V EK+  E               +   S+ D  S++    +F   
Sbjct  315   GALAWFLYMVCKHPEVQEKICHE--------------AMVATSAGDTASVD----EFLQS  356

Query  681   LNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGR  502
             L    +  ++YLH+ +TETLRLYP+VP + K    DDVLP+G  V  G +V ++PY+MGR
Sbjct  357   LTDQALNNMHYLHAALTETLRLYPSVPMENKQCFSDDVLPNGFNVSKGDIVFFIPYAMGR  416

Query  501   MEYNWGPDAASFKPERWL-KDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILC  325
             ME  WG DA  F+PERWL ++GVFQ  SPFKFTAFQAGPRICLGK+ AY QMK+  A+L 
Sbjct  417   MESLWGKDAEYFRPERWLDENGVFQQESPFKFTAFQAGPRICLGKEFAYRQMKIFAAVLL  476

Query  324   RFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             RFF  KL  E   V YR    L++  GL LT + R
Sbjct  477   RFFVLKLRDEKEIVSYRTTLTLAIDQGLHLTATAR  511



>ref|XP_006339520.1| PREDICTED: cytochrome P450 704C1-like [Solanum tuberosum]
Length=515

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/523 (43%), Positives = 314/523 (60%), Gaps = 28/523 (5%)
 Frame = -1

Query  1764  TLVLALGLIMF-C----WVFIHRLSQRKG-GGPRSWPVIGASVEQMTNYGRMHDWLVGYL  1603
             T+  ++ +++F C     V I R+   K    P+  PV G    Q+  + RM+D+     
Sbjct  6     TMFTSIAILLFICVTPILVLIVRIYAGKSIRNPKYAPVEGTVFHQLLYFNRMYDYQTELA  65

Query  1602  ANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGEL  1423
               + +     P  +  Y     NVE +LKTNF  Y KGE     +  L G+GIF  DGE 
Sbjct  66    KKAPTFRFLAPDQSEIYTTDSRNVEDILKTNFGKYSKGERNQEIIMDLFGEGIFAVDGEK  125

Query  1422  WRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSI  1243
             W+KQRK AS EF+++ LRDFS  VFR  + KL + +++ SL NQ  DMQ+LLMR +LDSI
Sbjct  126   WKKQRKLASFEFSARALRDFSCKVFRKGAAKLVSKVSEFSLANQVFDMQELLMRGSLDSI  185

Query  1242  CKVGFGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSI  1066
              KVGFGV++  L   +  +N+F  AFD +N +   R++DP WK+K++ N+GSE +L ++I
Sbjct  186   FKVGFGVDLNCLEGSSGNDNKFITAFDDSNALSYWRYVDPFWKLKRYFNIGSEFLLKKNI  245

Query  1065  RTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNF  889
             + I +F   +IR R+ ++E   K +   K DILSRF +E  KDPE  + D+ LRDI+LNF
Sbjct  246   KFIREFVDELIRTRRKQLE--MKQDSMDKEDILSRFLVESKKDPEK-MTDQYLRDIILNF  302

Query  888   VIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLN  709
             ++AG+D+ A TLSW  Y++  +  +  K+      VEE+R    N +    S DD     
Sbjct  303   MLAGKDSAANTLSWFFYVLCKNPLIQIKI------VEEIREVIGNNMKDNGSVDD-----  351

Query  708   QRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMV  529
                  F   +  + + K++YLH+ +TETLRLYPAVP D +    DDVLPDG  +K G  V
Sbjct  352   -----FVASITEEVLEKMHYLHATLTETLRLYPAVPLDGRCADADDVLPDGFHIKKGDGV  406

Query  528   TYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQM  349
              Y+ Y+MGRM Y WG DA  F+PERWLKDG+FQ  SPFKF AF AGPR+CLGKD AY QM
Sbjct  407   YYMSYAMGRMPYVWGDDAEDFRPERWLKDGIFQPESPFKFIAFHAGPRLCLGKDFAYRQM  466

Query  348   KMALAILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             K+    L  FF+FKL +   +V YR M  L +  GL++   PR
Sbjct  467   KIISMALLHFFRFKLSDDTKAVTYRTMFTLHIKEGLQVHAVPR  509



>ref|XP_008232706.1| PREDICTED: cytochrome P450 704C1-like isoform X2 [Prunus mume]
Length=507

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 229/495 (46%), Positives = 309/495 (62%), Gaps = 29/495 (6%)
 Frame = -1

Query  1686  PRSWPVIGASVEQMTNYGRMHDWL--VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKT  1513
             P   PV G    Q     R++D+   V    ++Y ++ P     YT  A   NVEHVLKT
Sbjct  35    PNYPPVKGTVYHQFLYLNRLYDYQTEVAKTQSTYRLLAPHHSELYTTDAR--NVEHVLKT  92

Query  1512  NFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSL  1333
             NF +Y KG    + +  + G GIF  DGE W++QRK AS EF+++ LRD S  VFR  + 
Sbjct  93    NFASYSKGAYTQAILSDVFGQGIFVVDGEKWKQQRKLASFEFSTRVLRDVSCSVFRRNAA  152

Query  1332  KLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAAN  1156
             KL  ++ + S  N   DMQDLLMR TLDSI KVGFG+++  L  +  E   F KAFD + 
Sbjct  153   KLVKVVFEISGSNGVFDMQDLLMRCTLDSIFKVGFGIDLNCLEGSSKEGTAFMKAFDEST  212

Query  1155  IIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKH  976
              +   R++DP WK+K+FLN+GSEA L + I+ IDDF + VIR ++  +EE  + + + K 
Sbjct  213   ALSYFRYVDPFWKLKRFLNLGSEASLKKYIKVIDDFVHQVIRSKRKLLEE--QKDVNDKD  270

Query  975   DILSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLW  799
             DILSRF+ E  KDPE  +NDK LRDI+LNF+IAG+DT+A TLSW  Y++  +  + EK+ 
Sbjct  271   DILSRFLLESEKDPEE-MNDKYLRDIILNFMIAGKDTSANTLSWFFYLLSKNPLIQEKV-  328

Query  798   SELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLR  619
                  V+E+R    +V+ +Q           +  +F   +   T+ +++YLH+ +TETLR
Sbjct  329   -----VQEVR----DVVGNQIG-------KVKIDEFVANITDATLEQMHYLHATLTETLR  372

Query  618   LYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDG  439
             L+PAVP D +    DD+LPDG RV+ G  V Y+ Y+MGRM Y WG DA  F+PERWL +G
Sbjct  373   LFPAVPIDGRYAEVDDILPDGFRVRKGDGVNYMTYAMGRMPYIWGKDADDFRPERWLNNG  432

Query  438   VFQNASPFKFTAFQAGPRICLGKDSAYLQMKM-ALAILCRFFKFKLV-EGHSVEYRMMTV  265
             +FQ  SPFKF AF AGPRICLGKD AY QMK+ A+A+LC FF+FKL  E  SV YR M  
Sbjct  433   IFQPESPFKFVAFHAGPRICLGKDFAYRQMKIVAIALLC-FFRFKLADETKSVTYRTMFT  491

Query  264   LSMAHGLKLTVSPRT  220
             L +   L +   PRT
Sbjct  492   LHIDGSLPMLAVPRT  506



>ref|XP_010508159.1| PREDICTED: cytochrome P450 704C1-like [Camelina sativa]
Length=511

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 218/446 (49%), Positives = 284/446 (64%), Gaps = 23/446 (5%)
 Frame = -1

Query  1548  AHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLR  1369
             A P NVEH+LKT+F  Y KG      +  LLG GIF  DG+ W++QRK AS EF+++ LR
Sbjct  84    ADPRNVEHILKTSFDKYSKGHSSRENLTDLLGHGIFAVDGDKWKQQRKLASFEFSTRVLR  143

Query  1368  DFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPE  1189
             DFS  VFR  + KL   +T+ +L  +  D QD+LMR TLDSI KVGFGVE+  L     E
Sbjct  144   DFSCSVFRKNASKLVGFVTEFALSGKAFDAQDMLMRFTLDSIFKVGFGVELKCLEGFSKE  203

Query  1188  NR-FAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEI  1012
                F +AFD +N+  + RFIDPLWK+K FLN+GS++ L +S  TID F YS+I  ++ ++
Sbjct  204   GEEFMEAFDESNVATSSRFIDPLWKLKWFLNIGSQSKLKKSNATIDRFVYSLITSKRKDL  263

Query  1011  EETQKNEKSMKHDILSRF-IELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYM  835
              + Q    +++ DILSRF +E  +DPEN +NDK LRDI+LNF+IAG+DTTA +LSW +YM
Sbjct  264   AKEQNT--AVREDILSRFLVESERDPEN-MNDKYLRDIILNFMIAGKDTTAASLSWFLYM  320

Query  834   IMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKL  655
             +  +  V E +  E+  V     K  +V          ES+N+ A+            ++
Sbjct  321   LCKNPLVQENIVREIRDVTSSHEKTTDV------DGFVESINEEALD-----------QM  363

Query  654   YYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDA  475
              YLH+ ++ETLRLYP VP D +    DDVLPDG RV+ G  V Y+ Y+MGRM Y WG DA
Sbjct  364   QYLHAALSETLRLYPPVPVDMRCAEIDDVLPDGYRVRKGDNVYYIAYAMGRMTYIWGQDA  423

Query  474   ASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-E  298
               FKPERWLKDGVFQ  SPFKF +F AGPRICLGKD AY QMK+    L  FF+FK+  E
Sbjct  424   EEFKPERWLKDGVFQPESPFKFISFHAGPRICLGKDFAYRQMKIVSMALLHFFRFKMADE  483

Query  297   GHSVEYRMMTVLSMAHGLKLTVSPRT  220
               +V Y+ M  L +  GL L   PRT
Sbjct  484   KSNVCYKRMLTLHVEGGLHLCAIPRT  509



>ref|XP_007217935.1| hypothetical protein PRUPE_ppa004947mg [Prunus persica]
 gb|EMJ19134.1| hypothetical protein PRUPE_ppa004947mg [Prunus persica]
Length=484

 Score =   404 bits (1039),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 227/478 (47%), Positives = 305/478 (64%), Gaps = 29/478 (6%)
 Frame = -1

Query  1635  GRMHDWL--VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEV  1462
             G+++D+   V    ++Y ++ P     YT  A   NVEHVLKTNF +Y KG    + +  
Sbjct  29    GKLYDYQTEVAKTESTYRLLAPHHSELYTTDAR--NVEHVLKTNFASYSKGAYTQAILSD  86

Query  1461  LLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVD  1282
             + G GIF  DGE W++QRK AS EF+++ LRD S  VFR  + KL  ++ + S  N   D
Sbjct  87    VFGQGIFVVDGEKWKQQRKLASFEFSTRVLRDVSCSVFRRNAAKLVKVVFEISGSNGVFD  146

Query  1281  MQDLLMRMTLDSICKVGFGVEIGTLAPNLPENR-FAKAFDAANIIVTLRFIDPLWKIKKF  1105
             MQDLLMR TLDSI KVGFG+++  L  +  E   F KAFD +  +   R++DP WK+K+F
Sbjct  147   MQDLLMRCTLDSIFKVGFGIDLNCLEGSSKEGTAFMKAFDESTALSYFRYVDPFWKLKRF  206

Query  1104  LNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFI-ELGKDPENN  928
             LN+GSEA L + I+ IDDF + VIR ++  +EE QK+    K DILSRF+ E  KDPE  
Sbjct  207   LNLGSEASLKKYIKVIDDFVHQVIRSKRKLLEE-QKDVND-KEDILSRFLLESEKDPEE-  263

Query  927   INDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVL  748
             +NDK LRDI+LNF+IAG+DT+A TLSW  Y++  +  + EK+      V+E+R    +V+
Sbjct  264   MNDKYLRDIILNFMIAGKDTSANTLSWFFYLLSKNPLIQEKV------VQEVR----DVV  313

Query  747   LHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDV  568
              +Q           +  +F   +   T+ +++YLH+ +TETLRLYPAVP D +    DD+
Sbjct  314   GNQIG-------KAKIDEFVANITDATLEQMHYLHAALTETLRLYPAVPIDGRYAEVDDI  366

Query  567   LPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGP  388
             LPDG RV+ G  V Y+ Y+MGRM Y WG DA  F+PERWL +G+FQ  SPFKF AF AGP
Sbjct  367   LPDGFRVRKGDGVNYMTYAMGRMPYIWGKDADDFRPERWLNNGIFQPESPFKFVAFHAGP  426

Query  387   RICLGKDSAYLQMKM-ALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPRT  220
             RICLGKD AY QMK+ A+A+LC FF+FKL  E  SV YR M  L +   L +   PRT
Sbjct  427   RICLGKDFAYRQMKIVAIALLC-FFRFKLADETRSVTYRTMFTLHIDGSLPMIAVPRT  483



>ref|XP_002320071.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE98386.1| cytochrome P450 family protein [Populus trichocarpa]
Length=511

 Score =   405 bits (1041),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 226/522 (43%), Positives = 304/522 (58%), Gaps = 27/522 (5%)
 Frame = -1

Query  1758  VLALGLIMFCWVFIHRLSQRKGG----GPRSWPVIGASVEQMTNYGRMHDWLVGYLANSY  1591
             V A GL+     F++   Q   G     P   PV G    Q+  + R++D          
Sbjct  10    VTAAGLLFIIISFLYLTFQTYSGKSIKNPNYPPVNGTVFGQLFYFNRLYDHQTEVARKQK  69

Query  1590  SVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQ  1411
             +  +  P  +  Y     N+EHVLKT F  Y KG+        L G GIF  DG+ WR+Q
Sbjct  70    TFRLLAPGQSELYTTDIRNIEHVLKTKFDKYTKGKYNQDIATDLFGKGIFAVDGDKWRQQ  129

Query  1410  RKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVG  1231
             RK AS EF+++ LRDFS  VFR  + KL  ++++ ++ +Q  DMQD LMR TLDSI KVG
Sbjct  130   RKLASFEFSTRVLRDFSCSVFRRNAAKLVRVVSEMAIADQIFDMQDTLMRCTLDSIFKVG  189

Query  1230  FGVEIGTLAPNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTID  1054
             FGVE+  L  +  E   F KAFD +N +V  R++DPLWK+K++ N+ SEA L ++I+ ID
Sbjct  190   FGVELNCLEGSNKEGIEFMKAFDDSNALVYRRYVDPLWKLKRYFNICSEASLKKNIKIID  249

Query  1053  DFTYSVI-RKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAG  877
             DF  ++I  KRK + EE   N+K    DILSRF+   K     +NDK LRDI+LNF+IAG
Sbjct  250   DFVTNLIGTKRKLQAEERLYNDK---EDILSRFLVESKKDAEEMNDKYLRDIILNFMIAG  306

Query  876   RDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAM  697
             +DT+A TLSW  YM+  +  + EK+  E+  V               S DD  ++ +   
Sbjct  307   KDTSANTLSWFFYMLCKNPLIQEKVAQEVRDVTS-------------SQDDVVNVEE---  350

Query  696   QFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVP  517
              F   +   T+ +++YLH+ +TETLRLYPAVP D +    DD+LPDG R+K G  + Y+ 
Sbjct  351   -FIANITDTTLEQMHYLHAALTETLRLYPAVPVDGRCAEVDDILPDGFRMKKGDGLYYMA  409

Query  516   YSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMAL  337
             Y+MGRM Y WG DA  F+PERWL +G+FQ  SPFKF AF AGPRICLGKD AY QMK+  
Sbjct  410   YAMGRMPYIWGDDAEDFRPERWLNNGIFQPESPFKFIAFHAGPRICLGKDFAYRQMKILS  469

Query  336   AILCRFFKFKLVEG-HSVEYRMMTVLSMAHGLKLTVSPRTHN  214
               L RFF+FKL +    + YR M  L +   L L    RT +
Sbjct  470   IALLRFFRFKLADDTRKITYRTMFTLHIEGSLHLRAIGRTKS  511



>gb|KDO85878.1| hypothetical protein CISIN_1g035793mg [Citrus sinensis]
Length=510

 Score =   405 bits (1040),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 218/509 (43%), Positives = 302/509 (59%), Gaps = 21/509 (4%)
 Frame = -1

Query  1743  LIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFT  1564
             L  F  + I   S +    P   PV G    Q+  + R++D+         +  +  P  
Sbjct  19    LSTFSLLIIKIYSGKSIKDPSYPPVNGTVFHQLLYFNRLYDYQTEVAKKQPTFRLLGPAQ  78

Query  1563  TYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFA  1384
             +  Y     N+EHVLK  F  Y KGE     +E L G GIF  DG+ WR+QRK AS EF+
Sbjct  79    SEIYTTDIRNIEHVLKAKFDKYSKGEYNQDILEDLFGQGIFAVDGDKWRQQRKLASFEFS  138

Query  1383  SKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLA  1204
             ++ LRDFS  VFR  + KL  +++  ++  + +DMQD+LMR TLDSI KVGFGV++  L 
Sbjct  139   TRVLRDFSCAVFRTNAAKLVKVVSGFAVAGRVLDMQDMLMRCTLDSIFKVGFGVDLNCLD  198

Query  1203  PNLPEN-RFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRK  1027
              +  E   F KAFD +N +V  R++DP WK+K+  N+GSEA L ++I+ IDDF +++I  
Sbjct  199   GSSGEGTEFMKAFDESNALVYWRYVDPFWKLKRISNIGSEASLKKNIKVIDDFVHNLIST  258

Query  1026  RKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSW  847
             ++  +   Q + +  K DILSRF+   +   + ++D+ LRDI+LNF+IAG+DT+A+TLSW
Sbjct  259   KRNLLAMQQDSNE--KEDILSRFLLASEKDPDKMDDQYLRDIILNFMIAGKDTSASTLSW  316

Query  846   AIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDT  667
               Y++  +  + EK+  E+  V   +  E N+       DD          F   L  +T
Sbjct  317   FFYLLCKNPLIQEKIEQEVRDVTGGQKNETNI-------DD----------FVAKLTDET  359

Query  666   MAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNW  487
             + K+ YLH+ +TETLRLYPAVP D +    DD+LPDG RVK G  V Y+ Y+MGRM   W
Sbjct  360   LEKMNYLHAALTETLRLYPAVPSDGRCAETDDILPDGYRVKKGDGVYYMAYAMGRMPSIW  419

Query  486   GPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFK  307
             G +A  F+PERWL++G+FQ  SPFKF AF AGPRICLGKD AY QMK+  A L RFF+FK
Sbjct  420   GENAEEFRPERWLENGIFQPESPFKFIAFHAGPRICLGKDFAYRQMKIVSAALLRFFRFK  479

Query  306   LVEG-HSVEYRMMTVLSMAHGLKLTVSPR  223
             L +    V YR M  L M  GL +    R
Sbjct  480   LTDDTRDVTYRTMFTLHMDGGLHVYAISR  508



>ref|XP_008438128.1| PREDICTED: cytochrome P450 704C1-like [Cucumis melo]
Length=503

 Score =   404 bits (1039),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 220/527 (42%), Positives = 323/527 (61%), Gaps = 35/527 (7%)
 Frame = -1

Query  1794  SNPLKVSSMETLVLALGLIMFCWVFIHRLSQRKGGGPRSWPVIGASVEQMTNYGRMHDWL  1615
             S P+ V++    VL L  I+   +  H+L ++K       P+ G    Q+ N+ R+HD++
Sbjct  5     SKPILVAA----VLLLISIVVRLILTHKLRKKK-----YHPIAGTVFHQLLNFHRLHDYM  55

Query  1614  VGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNFPNYPKGEVYHSYMEVLLGDGIFNA  1435
                     +  +  PF    Y + P NVE++L+TNF N+ KG   H  +  LLGDGIF  
Sbjct  56    TDLARKHKTYKLLGPFRDEVYTSDPPNVEYMLRTNFENFGKGSHNHRILRDLLGDGIFTV  115

Query  1434  DGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKLFTILTQASLLNQQVDMQDLLMRMT  1255
             DGE WR+QRK +S EF++K LRD+S+V+FR  ++KL  I+++A++ N+ +D+QDL M+ T
Sbjct  116   DGEKWREQRKISSYEFSTKVLRDYSSVIFRKTAVKLANIVSEAAISNRVIDIQDLFMKST  175

Query  1254  LDSICKVGFGVEIGTL-APNLPENRFAKAFDAANIIVTLRFIDPLWKIKKFLNVGSEAIL  1078
             LDSI  V FG+++ +L   N   ++F  AF+A++     R++D  W IKK LN+GSEA+L
Sbjct  176   LDSIFYVSFGIDLDSLHGSNEEISKFCSAFEASSTNTLWRYVDVSWPIKKALNIGSEAVL  235

Query  1077  DQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDILSRFIELGKDPENNINDKSLRDIV  898
              ++++ +D++ Y +I     + ++   +    + +I+SRF++         + K LRDI+
Sbjct  236   KENMKIVDEYIYKLIHSALEQRQKLGDDALMRRENIVSRFLQ-----AETTDPKYLRDII  290

Query  897   LNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSELESVEEMRAKEENVLLHQYSSDDPE  718
             LNFVIAG+DTTA TL+W IYM+  H  V E++  E+E       +E NV        D  
Sbjct  291   LNFVIAGKDTTAVTLAWFIYMLCKHPSVQERVAREIE-------EETNV-------GDVT  336

Query  717   SLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAG  538
               +    +FA  L  + + K+ +L + + ETLRLYPAVP D K    DD LPDG  V+ G
Sbjct  337   DFS----EFAARLTEEALEKMQFLIATINETLRLYPAVPVDAKICFSDDTLPDGFSVRKG  392

Query  537   GMVTYVPYSMGRMEYNWGPDAASFKPERWLK-DGVFQNASPFKFTAFQAGPRICLGKDSA  361
              MV+Y PY+MGRM++ WG DA  F+PERWL  DG FQ  SPFKFTAFQAGPRICLGK+ A
Sbjct  393   DMVSYQPYAMGRMKFVWGDDAEEFRPERWLDGDGKFQPQSPFKFTAFQAGPRICLGKEFA  452

Query  360   YLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSMAHGLKLTVSPR  223
             Y Q+K+  A+L  +FKFK+  E   VEY+ M  L +  GL++ V PR
Sbjct  453   YRQIKIFSALLLVYFKFKMSDEKKIVEYQPMINLLIKGGLQVCVIPR  499



>ref|XP_010092868.1| Cytochrome P450 704C1 [Morus notabilis]
 gb|EXB52686.1| Cytochrome P450 704C1 [Morus notabilis]
Length=671

 Score =   410 bits (1054),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 220/492 (45%), Positives = 302/492 (61%), Gaps = 21/492 (4%)
 Frame = -1

Query  1686  PRSWPVIGASVEQMTNYGRMHDWLVGYLANSYSVVVPMPFTTYTYIAHPDNVEHVLKTNF  1507
             P   PV G    Q+ ++ +++D+ + +     +  + +P  +  Y   P N+EH+LKTNF
Sbjct  196   PSYPPVKGTIFHQLFHFNKLYDYYIHFATVCPTFRMLVPQHSEIYTTEPRNIEHILKTNF  255

Query  1506  PNYPKGEVYHSYMEVLLGDGIFNADGELWRKQRKTASLEFASKNLRDFSTVVFRDYSLKL  1327
              NY KGE     M    G GIF  +GE WR+QRK AS EF+++ +RDFS  VFR  + +L
Sbjct  256   SNYSKGEYEQEIMIDFFGQGIFAVNGEPWRQQRKLASFEFSTRVVRDFSCEVFRRNASRL  315

Query  1326  FTILTQASLLNQQVDMQDLLMRMTLDSICKVGFGVEIGTLAPNLPEN-RFAKAFDAANII  1150
                ++  S   +  DMQDLLMR TLDSI KVGFGV++  L  +  E   F KAFD  N +
Sbjct  316   VRAVSGISASGRVFDMQDLLMRSTLDSIFKVGFGVQLNCLEGSTKEGTEFMKAFDETNAL  375

Query  1149  VTLRFIDPLWKIKKFLNVGSEAILDQSIRTIDDFTYSVIRKRKAEIEETQKNEKSMKHDI  970
             ++ R++DP WK+KK  N+GSEA L ++++ ID F   VI K++  + E  +++ + K DI
Sbjct  376   ISWRYVDPFWKLKKIFNIGSEASLKKNVKVIDRFVNQVISKKRELLVE--RHDCNDKEDI  433

Query  969   LSRFI-ELGKDPENNINDKSLRDIVLNFVIAGRDTTATTLSWAIYMIMTHEDVAEKLWSE  793
             LSRF+ E  K+PE  +ND+ LRDI+LNF+ AG+DT+A TLSW  YM+  +  V EK+  E
Sbjct  434   LSRFLMESEKNPEQ-MNDQYLRDIILNFISAGKDTSAITLSWFFYMLCKNPLVQEKIVQE  492

Query  792   LESVEEMRAKEENVLLHQYSSDDPESLNQRAMQFAGLLNYDTMAKLYYLHSVVTETLRLY  613
             +      +AK+     ++ S DD          F   ++ + + +++YLH+ +TETLRLY
Sbjct  493   IRDAIGDKAKD-----NESSIDD----------FVAAISDEVLERMHYLHASLTETLRLY  537

Query  612   PAVPQDPKGILEDDVLPDGTRVKAGGMVTYVPYSMGRMEYNWGPDAASFKPERWLKDGVF  433
             PAVP D +    DD LPDG RVK G  V Y+ Y+MGRM Y WG DA  F+PERWLKDG+F
Sbjct  538   PAVPVDGRFADADDTLPDGFRVKKGDAVYYMSYAMGRMPYIWGEDAQDFRPERWLKDGIF  597

Query  432   QNASPFKFTAFQAGPRICLGKDSAYLQMKMALAILCRFFKFKLV-EGHSVEYRMMTVLSM  256
             Q  SPFKF AF AGPRICLGKD AY QMK+    L RFF+FKL  +     YR+M  L +
Sbjct  598   QPESPFKFIAFHAGPRICLGKDFAYRQMKILSIALLRFFRFKLADDSKPANYRIMLTLHI  657

Query  255   AHGLKLTVSPRT  220
                L L    RT
Sbjct  658   DGELPLCAVSRT  669


 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 75/150 (50%), Gaps = 48/150 (32%)
 Frame = -1

Query  699  MQFAGLLNYDTMAKLYYLHSVVTETLRLYPAVPQDPKGILEDDVLPDGTRVKAGGMVTYV  520
            + F   ++  T+ +++YLH+ +TETLRLYPAVP D +    DD+LPDG +VK G      
Sbjct  85   VDFVAAISDATLDRMHYLHAALTETLRLYPAVPVDGRRADRDDILPDGFKVKQG------  138

Query  519  PYSMGRMEYNWGPDAASFKPERWLKDGVFQNASPFKFTAFQAGPRICLGKDSAYLQMK-M  343
                                     DG              AGPRICLGK+ AY QMK +
Sbjct  139  -------------------------DG--------------AGPRICLGKEFAYRQMKIL  159

Query  342  ALAILCRFFKFKLVEG-HSVEYRMMTVLSM  256
            ++A+LC FF+FKL +    V YR M  L +
Sbjct  160  SIALLC-FFRFKLADDTKPVNYRTMFTLHI  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5647130314986