BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78684_g1_i1 len=843 path=[1:0-842]

Length=843
                                                                      Score     E

ref|XP_002275043.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    157   6e-44   Vitis vinifera
dbj|BAH03328.1|  chloroplast protein 12                                 155   2e-43   Fagus crenata
ref|XP_008235152.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    155   7e-43   
gb|EYU46807.1|  hypothetical protein MIMGU_mgv1a016182mg                154   1e-42   
ref|XP_011079555.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    153   1e-42   
ref|XP_004495904.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    152   5e-42   
emb|CDP17070.1|  unnamed protein product                                148   1e-40   
ref|XP_006355835.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    147   4e-40   
ref|XP_003591401.1|  Calvin cycle protein CP12                          146   9e-40   
ref|XP_011082421.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    145   1e-39   
gb|KDP28257.1|  hypothetical protein JCGZ_14028                         145   1e-39   
ref|XP_002302764.2|  CP12 domain-containing family protein              145   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007201261.1|  hypothetical protein PRUPE_ppa013259mg             144   4e-39   
gb|AFK34703.1|  unknown                                                 144   4e-39   
ref|XP_008454293.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    144   4e-39   
ref|XP_007051103.1|  CP12 domain-containing protein 1                   146   6e-39   
ref|XP_006444494.1|  hypothetical protein CICLE_v10022841mg             144   7e-39   
ref|XP_004152225.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    144   7e-39   
emb|CDY25110.1|  BnaC06g18520D                                          144   8e-39   
ref|XP_009104385.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    143   9e-39   
emb|CDX67892.1|  BnaA07g19320D                                          143   1e-38   
ref|XP_010087241.1|  hypothetical protein L484_009750                   142   2e-38   
gb|ACJ85997.1|  unknown                                                 142   2e-38   Medicago truncatula
ref|XP_009339774.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    142   5e-38   
emb|CAA96570.1|  CP12                                                   140   2e-37   Pisum sativum [garden pea]
ref|XP_008359430.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    139   3e-37   
ref|XP_003625969.1|  CP12                                               139   4e-37   
ref|XP_011042247.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    139   6e-37   
ref|XP_002515284.1|  conserved hypothetical protein                     138   1e-36   Ricinus communis
ref|XP_008451482.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    137   1e-36   
ref|XP_002320298.1|  CP12 domain-containing family protein              137   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009378720.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    137   3e-36   
ref|XP_004494423.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    136   3e-36   
ref|XP_009774670.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    135   9e-36   
ref|XP_004300451.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    135   9e-36   
ref|XP_010321871.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    135   9e-36   
ref|XP_007163176.1|  hypothetical protein PHAVU_001G212900g             135   1e-35   
ref|XP_010267998.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    135   1e-35   
ref|XP_006402378.1|  hypothetical protein EUTSA_v10006414mg             135   1e-35   
gb|KHN19215.1|  Calvin cycle protein CP12                               135   1e-35   
ref|XP_003521594.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    135   2e-35   
ref|XP_008355495.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    134   3e-35   
ref|XP_003554549.2|  PREDICTED: calvin cycle protein CP12-2, chlo...    135   5e-35   
gb|ACU20479.1|  unknown                                                 133   7e-35   Glycine max [soybeans]
gb|KFK35421.1|  hypothetical protein AALP_AA5G282200                    132   2e-34   
ref|XP_009604948.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    132   2e-34   
ref|XP_002876674.1|  CP12-2                                             132   2e-34   
gb|ABK96294.1|  unknown                                                 131   3e-34   Populus trichocarpa x Populus deltoides
emb|CDX76635.1|  BnaC08g32210D                                          131   4e-34   
ref|XP_009116912.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    131   4e-34   
ref|XP_011041206.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    130   6e-34   
ref|XP_006292773.1|  hypothetical protein CARUB_v10019023mg             130   1e-33   
ref|XP_004135995.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    129   2e-33   
gb|KGN45014.1|  hypothetical protein Csa_7G407670                       131   2e-33   
ref|XP_010259310.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    129   3e-33   
ref|XP_004163144.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    129   3e-33   
ref|NP_191800.1|  calvin cycle protein CP12-2                           129   4e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63795.1|  CP12 protein precursor-like protein                     128   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512631.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    128   7e-33   
gb|ADZ23481.1|  chloroplast protein 12                                  127   2e-32   
gb|KFK37480.1|  hypothetical protein AALP_AA4G262800                    126   3e-32   
emb|CAA96568.1|  CP12                                                   126   3e-32   Spinacia oleracea
ref|XP_006397935.1|  hypothetical protein EUTSA_v10001682mg             126   4e-32   
ref|XP_010544968.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    125   7e-32   
ref|XP_010468958.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    125   8e-32   
ref|XP_010413280.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    125   1e-31   
ref|XP_010523926.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    124   2e-31   
ref|XP_009784434.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    124   2e-31   
ref|NP_001049890.1|  Os03g0306800                                       124   2e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89700.1|  hypothetical protein OsI_11237                          124   3e-31   Oryza sativa Indica Group [Indian rice]
gb|ABS17660.1|  chloroplast protein 12                                  122   5e-31   Arnebia euchroma
ref|XP_008781107.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    122   8e-31   
gb|EPS59920.1|  hypothetical protein M569_14886                         122   9e-31   
ref|XP_010038287.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    121   3e-30   
ref|XP_010507892.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    121   3e-30   
ref|NP_566100.2|  stroma protein CP12-1                                 121   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010497708.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   3e-30   
ref|XP_010506777.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   4e-30   
ref|XP_010069841.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   4e-30   
ref|XP_010413104.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   6e-30   
ref|XP_002880299.1|  cp12 domain-containing protein 1                   120   6e-30   
ref|XP_010413103.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    119   6e-30   
ref|XP_003558084.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   7e-30   
ref|XP_009616215.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   1e-29   
ref|XP_006295238.1|  hypothetical protein CARUB_v10024325mg             119   1e-29   
ref|XP_010518439.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    119   1e-29   
ref|XP_003535935.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    119   1e-29   
dbj|BAJ85428.1|  predicted protein                                      119   2e-29   
ref|XP_010921497.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    119   2e-29   
pdb|2LJ9|A  Chain A, Partial 3d Structure Of The C-Terminal Part ...    118   2e-29   
ref|XP_006651310.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    118   2e-29   
pdb|3QV1|G  Chain G, Crystal Structure Of The Binary Complex Of P...    117   3e-29   
ref|XP_003518788.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    118   3e-29   
ref|XP_009382502.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    118   3e-29   
gb|AAK97687.1|  At2g47400/T8I13.24                                      118   4e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAJ41166.1|  chloroplast protein 12 precursor                       118   8e-29   Cynara cardunculus var. scolymus [artichoke]
dbj|BAJ90516.1|  predicted protein                                      116   1e-28   
emb|CDY51422.1|  BnaA04g26990D                                          117   1e-28   
ref|XP_010679381.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    116   2e-28   
ref|XP_009142539.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    115   3e-28   
emb|CDY27491.1|  BnaC04g51320D                                          115   5e-28   
ref|XP_009118779.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    115   7e-28   
ref|XP_006349189.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    114   8e-28   
emb|CDX80101.1|  BnaA05g00550D                                          114   8e-28   
ref|XP_004984626.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    114   1e-27   
ref|XP_007145148.1|  hypothetical protein PHAVU_007G214200g             114   1e-27   
ref|XP_009133812.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    114   1e-27   
ref|XP_006840455.1|  hypothetical protein AMTR_s00045p00175560          114   1e-27   
emb|CDY55379.1|  BnaC04g51970D                                          114   1e-27   
emb|CDX95723.1|  BnaC03g26040D                                          114   2e-27   
ref|XP_008654881.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    113   2e-27   
gb|AAV63570.1|  auxin-induced putative CP12 domain-containing pro...    111   3e-27   Arachis hypogaea [goober]
ref|XP_008351460.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    113   3e-27   
ref|XP_004229393.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    113   3e-27   
ref|XP_002467982.1|  hypothetical protein SORBIDRAFT_01g037510          113   4e-27   Sorghum bicolor [broomcorn]
ref|XP_009411634.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    112   5e-27   
ref|XP_009403696.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    111   1e-26   
dbj|BAK03023.1|  predicted protein                                      108   1e-25   
gb|EAY73672.1|  hypothetical protein OsI_01556                          107   4e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_009383546.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    107   4e-25   
ref|XP_010230820.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    107   4e-25   
ref|NP_001042830.1|  Os01g0303000                                       107   4e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967659.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    106   1e-24   
ref|XP_002976377.1|  hypothetical protein SELMODRAFT_105078             103   5e-24   
gb|EMT01482.1|  hypothetical protein F775_29657                         102   5e-24   
ref|XP_006644110.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    103   1e-23   
gb|KHN30640.1|  Calvin cycle protein CP12                               102   2e-23   
gb|ACG43906.1|  CP12-1                                                  102   6e-23   Zea mays [maize]
ref|XP_008386781.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    100   2e-22   
ref|NP_001148040.1|  LOC100281649                                       100   2e-22   Zea mays [maize]
gb|ABK21319.1|  unknown                                                 100   3e-22   Picea sitchensis
ref|XP_002436694.1|  hypothetical protein SORBIDRAFT_10g007180        99.8    4e-22   Sorghum bicolor [broomcorn]
gb|EMS48211.1|  hypothetical protein TRIUR3_21408                     96.7    1e-21   
ref|XP_002953061.1|  hypothetical protein VOLCADRAFT_121134           90.5    5e-19   
ref|XP_009389615.1|  PREDICTED: calvin cycle protein CP12-2, chlo...  85.9    9e-17   
ref|XP_001756905.1|  predicted protein                                81.6    2e-16   
ref|XP_004300084.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  82.4    5e-16   
ref|XP_010266359.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  81.3    2e-15   
ref|XP_006849927.1|  hypothetical protein AMTR_s00022p00115740        80.9    2e-15   
ref|XP_001694345.1|  small protein associating with GAPDH and PRK     79.7    3e-15   Chlamydomonas reinhardtii
ref|XP_010088739.1|  hypothetical protein L484_016525                 79.3    3e-15   
gb|ABD37967.1|  CP12                                                  80.1    3e-15   Marchantia polymorpha
gb|ABK26381.1|  unknown                                               79.7    4e-15   Picea sitchensis
ref|WP_006453737.1|  hypothetical protein                             78.2    5e-15   
ref|WP_012306885.1|  MULTISPECIES: hypothetical protein               77.8    5e-15   
ref|XP_001773160.1|  predicted protein                                77.4    8e-15   
gb|KDP36727.1|  hypothetical protein JCGZ_08018                       79.0    9e-15   
ref|XP_002510743.1|  conserved hypothetical protein                   79.0    1e-14   Ricinus communis
ref|XP_006342197.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  78.6    1e-14   
ref|XP_002307003.2|  hypothetical protein POPTR_0005s27980g           79.0    1e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011034773.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  79.0    1e-14   
ref|XP_011041131.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  78.2    2e-14   
emb|CBI40783.3|  unnamed protein product                              76.6    2e-14   
emb|CAO03469.1|  CP12 protein                                         76.3    3e-14   Chlamydomonas reinhardtii
ref|WP_024544448.1|  hypothetical protein                             75.9    3e-14   
ref|XP_005644334.1|  CP12-domain-containing protein                   77.0    3e-14   
ref|XP_002301892.1|  CP12 domain-containing family protein            77.4    4e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006390179.1|  hypothetical protein EUTSA_v10019316mg           76.6    5e-14   
ref|XP_009372664.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  76.6    6e-14   
ref|XP_010539757.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  76.6    6e-14   
ref|XP_002276622.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  76.6    6e-14   Vitis vinifera
emb|CAA06467.1|  CP12                                                 73.9    7e-14   Chlamydomonas reinhardtii
ref|XP_009765560.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  75.5    1e-13   
ref|XP_009595948.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  75.5    1e-13   
ref|WP_015218820.1|  hypothetical protein                             74.3    1e-13   
ref|XP_007209751.1|  hypothetical protein PRUPE_ppa013090mg           75.9    1e-13   
ref|XP_008373345.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  75.5    1e-13   
ref|XP_008237890.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  75.5    2e-13   
ref|XP_006302985.1|  hypothetical protein CARUB_v10021134mg           75.5    2e-13   
ref|WP_015223198.1|  hypothetical protein                             72.8    4e-13   
emb|CDX88298.1|  BnaC06g37420D                                        74.3    5e-13   
ref|WP_010475694.1|  hypothetical protein                             72.8    5e-13   
ref|XP_009106324.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  74.3    5e-13   
ref|XP_001759510.1|  predicted protein                                72.4    5e-13   
emb|CDX87586.1|  BnaA07g32870D                                        73.9    6e-13   
ref|XP_002887645.1|  hypothetical protein ARALYDRAFT_895539           73.9    6e-13   
ref|NP_565134.1|  CP12 domain-containing protein 3                    73.6    6e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62589.1|  unknown                                               73.6    7e-13   Arabidopsis thaliana [mouse-ear cress]
ref|WP_008309502.1|  CP12 domain protein                              72.0    8e-13   
ref|WP_035991854.1|  hypothetical protein                             72.0    8e-13   
ref|WP_012162957.1|  hypothetical protein                             71.6    1e-12   
ref|XP_007010913.1|  CP12 domain-containing protein 3                 72.8    1e-12   
ref|WP_017651373.1|  hypothetical protein                             70.9    2e-12   
ref|WP_015136220.1|  hypothetical protein                             70.5    3e-12   
ref|WP_019501875.1|  hypothetical protein                             70.5    3e-12   
ref|WP_027842240.1|  hypothetical protein                             70.5    3e-12   
ref|WP_035156951.1|  hypothetical protein                             70.1    4e-12   
ref|XP_010479593.1|  PREDICTED: LOW QUALITY PROTEIN: calvin cycle...  71.2    4e-12   
ref|XP_010416576.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  71.2    5e-12   
emb|CDP07245.1|  unnamed protein product                              72.4    5e-12   
ref|WP_008197591.1|  hypothetical protein                             69.7    5e-12   
ref|XP_001774010.1|  predicted protein                                70.9    6e-12   
ref|WP_002792997.1|  hypothetical protein                             68.9    1e-11   
ref|WP_002739926.1|  calvin cycle protein CP12                        68.9    1e-11   
ref|XP_011074049.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  69.7    1e-11   
ref|WP_006511551.1|  CP12 domain protein                              68.6    1e-11   
ref|XP_010474367.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  70.5    1e-11   
ref|WP_019504562.1|  hypothetical protein                             68.6    2e-11   
ref|WP_015163984.1|  hypothetical protein                             68.6    2e-11   
ref|WP_017749890.1|  hypothetical protein                             68.2    2e-11   
ref|WP_018396801.1|  hypothetical protein                             68.2    2e-11   
gb|EMT03124.1|  hypothetical protein F775_44037                       68.2    2e-11   
gb|EYU36605.1|  hypothetical protein MIMGU_mgv1a014758mg              70.1    2e-11   
ref|WP_008274506.1|  hypothetical protein                             67.8    3e-11   
ref|WP_036000717.1|  hypothetical protein                             67.8    3e-11   
ref|WP_002751352.1|  hypothetical protein                             67.4    4e-11   
gb|KFM27918.1|  Calvin cycle protein CP12, chloroplastic              68.2    5e-11   
ref|XP_005706707.1|  small chloroplast protein                        68.2    5e-11   
ref|WP_006635891.1|  hypothetical protein                             67.0    5e-11   
ref|WP_010997001.1|  hypothetical protein                             67.0    6e-11   
gb|ABD37968.1|  CP12                                                  68.2    6e-11   Mesostigma viride
ref|WP_002743917.1|  hypothetical protein                             66.6    7e-11   
ref|WP_002770133.1|  hypothetical protein                             66.6    7e-11   
ref|WP_012361411.1|  hypothetical protein                             66.6    8e-11   
ref|WP_015194435.1|  protein of unknown function CP12                 66.6    8e-11   
ref|WP_015202341.1|  hypothetical protein                             66.2    1e-10   
ref|WP_002788843.1|  hypothetical protein                             66.2    1e-10   
ref|WP_019508336.1|  CP12 polypeptide                                 68.6    1e-10   
ref|WP_006516336.1|  CP12 domai nprotein                              65.9    1e-10   
ref|WP_009547808.1|  hypothetical protein                             65.9    1e-10   
ref|WP_018400793.1|  CP12 polypeptide                                 68.6    2e-10   
ref|WP_015207783.1|  CP12 domain protein                              65.9    2e-10   
ref|WP_011317898.1|  hypothetical protein                             65.9    2e-10   
ref|WP_012407493.1|  hypothetical protein                             65.9    2e-10   
ref|XP_008799141.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  67.0    2e-10   
ref|WP_015175385.1|  protein of unknown function CP12                 65.5    2e-10   
ref|WP_009785850.1|  hypothetical protein                             67.8    3e-10   
ref|WP_017297697.1|  hypothetical protein                             65.1    3e-10   
ref|WP_011143687.1|  hypothetical protein                             65.1    3e-10   
ref|WP_036481640.1|  hypothetical protein                             65.1    3e-10   
ref|WP_017293080.1|  hypothetical protein                             65.1    3e-10   
ref|XP_010061244.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  66.6    3e-10   
emb|CAB56831.1|  hypothetical protein                                 65.1    4e-10   Cyanophora paradoxa
ref|WP_029636735.1|  hypothetical protein [                           65.1    4e-10   
ref|WP_023072932.1|  protein regulation of calvin cycle via assoc...  64.7    4e-10   
ref|WP_015200789.1|  hypothetical protein                             64.7    4e-10   
ref|WP_039754825.1|  hypothetical protein                             64.7    4e-10   
ref|WP_015145579.1|  CP12 domain-containing protein                   64.7    4e-10   
ref|WP_023068047.1|  CBS domain protein                               67.0    4e-10   
ref|WP_015120210.1|  CP12 domain-containing protein                   64.3    5e-10   
ref|WP_009629451.1|  protein of unknown function CP12                 63.9    7e-10   
ref|WP_012594266.1|  MULTISPECIES: hypothetical protein               63.9    7e-10   
ref|WP_002781201.1|  hypothetical protein                             63.9    8e-10   
ref|WP_014275448.1|  hypothetical protein                             66.2    9e-10   
ref|WP_019493833.1|  hypothetical protein                             63.9    9e-10   
ref|WP_015137816.1|  CP12 domain-containing protein                   63.9    1e-09   
ref|WP_017717331.1|  CP12 polypeptide                                 65.9    1e-09   
ref|WP_015184117.1|  hypothetical protein                             65.9    1e-09   
ref|WP_037220753.1|  hypothetical protein                             63.5    1e-09   
ref|WP_006621675.1|  MULTISPECIES: hypothetical protein               65.9    1e-09   
ref|WP_035737555.1|  CBS domain-containing protein                    65.5    2e-09   
ref|WP_015123941.1|  CP12 domain-containing protein                   63.2    2e-09   
ref|XP_010932153.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  64.7    2e-09   
ref|WP_007304708.1|  hypothetical protein                             63.2    2e-09   
ref|WP_012629411.1|  hypothetical protein                             63.2    2e-09   
ref|WP_036530791.1|  hypothetical protein                             62.8    2e-09   
ref|WP_017313122.1|  hypothetical protein                             62.8    2e-09   
ref|WP_015126619.1|  hypothetical protein                             62.4    3e-09   
ref|WP_022604974.1|  CP12 domain protein                              62.4    3e-09   
ref|WP_016953179.1|  hypothetical protein                             62.4    4e-09   
ref|WP_015173769.1|  hypothetical protein                             62.8    4e-09   
ref|WP_013322083.1|  hypothetical protein                             64.3    4e-09   
ref|WP_008226771.1|  Protein CP12, regulation of Calvin cycle via...  62.0    4e-09   
ref|WP_015081465.1|  hypothetical protein                             62.0    4e-09   
ref|WP_002746099.1|  CBS domain pair family protein                   64.3    5e-09   
ref|WP_002790229.1|  Similar to tr|Q8YYT1|Q8YYT1                      64.3    5e-09   
ref|WP_007356495.1|  MULTISPECIES: hypothetical protein               61.6    5e-09   
ref|WP_006510010.1|  CBS domain-containing protein                    64.3    5e-09   
ref|WP_015187453.1|  protein of unknown function CP12                 62.0    5e-09   
ref|WP_009556279.1|  CP12 domain protein                              61.6    5e-09   
ref|WP_015167659.1|  CP12 domain-containing protein                   61.6    5e-09   
ref|WP_027404703.1|  hypothetical protein                             61.6    6e-09   
ref|WP_006106059.1|  CP12 domain protein                              63.9    6e-09   
ref|WP_038072409.1|  hypothetical protein                             61.2    7e-09   
ref|WP_015115885.1|  hypothetical protein                             61.6    7e-09   
ref|WP_015224274.1|  hypothetical protein                             61.2    7e-09   
ref|WP_039717133.1|  hypothetical protein                             60.8    1e-08   
ref|WP_028082844.1|  hypothetical protein                             60.8    1e-08   
ref|WP_002779902.1|  Similar to tr|Q8YYT1|Q8YYT1                      63.2    1e-08   
ref|WP_015147142.1|  hypothetical protein                             63.2    1e-08   
gb|AIE74165.1|  Protein CP12, regulation of Calvin cycle via asso...  60.8    1e-08   
ref|WP_017291480.1|  hypothetical protein                             60.5    1e-08   
ref|WP_010475692.1|  hypothetical protein                             60.8    1e-08   
ref|WP_004162604.1|  CP12 polypeptide                                 62.8    1e-08   
ref|WP_038086734.1|  CBS domain-containing protein                    62.8    2e-08   
ref|WP_026734552.1|  hypothetical protein                             60.5    2e-08   
ref|WP_026082867.1|  hypothetical protein                             60.5    2e-08   
ref|WP_024968588.1|  hypothetical protein                             62.8    2e-08   
ref|WP_015229190.1|  CP12 domain-containing protein                   60.1    2e-08   
ref|WP_006631471.1|  protein of unknown function CP12                 62.8    2e-08   
ref|WP_002770514.1|  Similar to tr|Q8YYT1|Q8YYT1                      62.4    2e-08   
ref|WP_006198106.1|  hypothetical protein                             60.1    2e-08   
ref|WP_039728056.1|  hypothetical protein                             60.1    2e-08   
ref|WP_009454249.1|  MULTISPECIES: hypothetical protein               59.7    3e-08   
ref|WP_017662908.1|  CP12 polypeptide                                 62.0    3e-08   
ref|WP_023171760.1|  putative CP12 gene family protein                59.7    3e-08   
ref|WP_013190766.1|  hypothetical protein                             59.7    3e-08   
ref|WP_029315317.1|  hypothetical protein                             58.9    4e-08   
ref|WP_015182394.1|  CP12 domain-containing protein                   59.3    5e-08   
ref|XP_005711763.1|  CP12 protein, chloroplast precursor, involve...  60.1    5e-08   
ref|WP_015956035.1|  hypothetical protein                             58.9    5e-08   
ref|WP_002801025.1|  CP12 polypeptide                                 61.2    5e-08   
ref|WP_002751597.1|  CP12 polypeptide                                 61.2    5e-08   
ref|WP_035158099.1|  hypothetical protein                             59.3    6e-08   
ref|WP_017714302.1|  hypothetical protein                             58.9    6e-08   
ref|WP_012267174.1|  CP12 polypeptide                                 61.2    7e-08   
ref|XP_005851203.1|  hypothetical protein CHLNCDRAFT_137886           59.3    7e-08   
ref|XP_005538561.1|  CP12 protein, chloroplast precursor              59.7    7e-08   
ref|WP_008199826.1|  CP12 polypeptide                                 60.8    8e-08   
gb|EPS73074.1|  hypothetical protein M569_01682                       58.5    9e-08   
ref|WP_016865922.1|  hypothetical protein                             58.5    9e-08   
ref|WP_002737762.1|  CBS domain pair family protein                   60.5    1e-07   
ref|WP_009454896.1|  MULTISPECIES: hypothetical protein               58.5    1e-07   
ref|WP_011057657.1|  MULTISPECIES: hypothetical protein               58.2    1e-07   
ref|WP_013323106.1|  hypothetical protein                             57.8    1e-07   
ref|WP_015155543.1|  hypothetical protein                             57.8    1e-07   
ref|WP_016878694.1|  hypothetical protein                             57.8    1e-07   
ref|WP_026719899.1|  hypothetical protein                             57.8    2e-07   
ref|WP_010872329.1|  hypothetical protein                             57.4    2e-07   
ref|WP_012627347.1|  hypothetical protein                             57.4    2e-07   
gb|KEI66577.1|  IMP dehydrogenase                                     59.7    2e-07   
ref|WP_026797084.1|  hypothetical protein                             59.7    2e-07   
ref|WP_015177778.1|  protein of unknown function CP12                 59.7    2e-07   
ref|WP_036267698.1|  CBS domain-containing protein                    59.3    2e-07   
ref|WP_026079866.1|  hypothetical protein                             57.4    2e-07   
ref|WP_026788812.1|  MULTISPECIES: hypothetical protein               59.3    3e-07   
ref|WP_034936777.1|  CBS domain-containing protein                    58.9    3e-07   
gb|ELR97775.1|  CBS domain-containing protein                         58.9    4e-07   
ref|WP_007354179.1|  MULTISPECIES: hypothetical protein               58.9    4e-07   
ref|WP_006528654.1|  CP12 domain protein                              56.6    4e-07   
ref|WP_015216100.1|  protein of unknown function CP12                 56.6    4e-07   
ref|WP_026785259.1|  MULTISPECIES: hypothetical protein               56.6    4e-07   
ref|WP_009782451.1|  hypothetical protein                             56.6    4e-07   
ref|WP_026086989.1|  hypothetical protein                             56.6    5e-07   
ref|WP_017328246.1|  hypothetical protein                             56.2    5e-07   
ref|WP_017716571.1|  hypothetical protein                             56.2    6e-07   
ref|WP_017289099.1|  hypothetical protein                             56.2    6e-07   
ref|WP_027845908.1|  hypothetical protein                             58.5    6e-07   
gb|KEI67100.1|  Cp12                                                  55.8    7e-07   
ref|WP_036265751.1|  hypothetical protein                             56.2    7e-07   
ref|WP_011612835.1|  hypothetical protein                             55.8    7e-07   
ref|WP_012361302.1|  hypothetical protein                             55.8    8e-07   
ref|WP_023067491.1|  CP12 domain protein                              55.5    1e-06   
ref|WP_006276771.1|  hypothetical protein                             55.5    1e-06   
ref|WP_009633049.1|  CP12 domain protein                              55.5    1e-06   
ref|WP_015132174.1|  hypothetical protein                             57.4    1e-06   
ref|WP_015119253.1|  CP12 domain-containing protein                   55.5    1e-06   
ref|WP_017321588.1|  hypothetical protein                             55.1    1e-06   
ref|WP_017653535.1|  CP12 polypeptide                                 57.0    2e-06   
ref|WP_006100550.1|  hypothetical protein                             54.7    2e-06   
ref|WP_011429904.1|  hypothetical protein                             54.7    2e-06   
ref|WP_015152195.1|  hypothetical protein                             55.1    2e-06   
ref|WP_029634590.1|  hypothetical protein [                           54.7    3e-06   
ref|WP_039749023.1|  CBS domain-containing protein                    56.6    3e-06   
ref|WP_017661922.1|  hypothetical protein                             53.9    3e-06   
ref|WP_011434185.1|  hypothetical protein                             53.9    3e-06   
ref|WP_039754353.1|  hypothetical protein                             54.3    4e-06   
ref|WP_015227641.1|  hypothetical protein                             56.2    4e-06   
ref|WP_026079653.1|  hypothetical protein                             55.8    4e-06   
ref|WP_009543040.1|  hypothetical protein                             53.5    5e-06   
gb|AAB53704.1|  unknown                                               55.5    5e-06   
ref|WP_036388153.1|  CBS domain-containing protein                    55.8    5e-06   
ref|WP_002764953.1|  hypothetical protein                             55.8    5e-06   
ref|WP_017711604.1|  hypothetical protein                             55.8    5e-06   
ref|WP_002793319.1|  hypothetical protein                             55.8    5e-06   
ref|WP_006276674.1|  CBS domain protein containing membrane protein   55.5    6e-06   
ref|WP_019493049.1|  hypothetical protein                             53.5    6e-06   
ref|WP_002796558.1|  hypothetical protein                             55.5    6e-06   
ref|WP_002782088.1|  hypothetical protein                             55.5    6e-06   
ref|WP_002756663.1|  hypothetical protein                             55.5    6e-06   
ref|WP_002734563.1|  CBS domain pair family protein                   55.5    6e-06   
dbj|GAL91780.1|  hypothetical protein N44_00068                       55.5    6e-06   
ref|WP_012268103.1|  CP12 polypeptide                                 55.5    6e-06   
ref|WP_002741613.1|  MULTISPECIES: CBS domain pair family protein     55.5    7e-06   
ref|WP_002777442.1|  hypothetical protein                             55.5    7e-06   
ref|WP_015954095.1|  hypothetical protein                             55.5    7e-06   
ref|WP_015119089.1|  hypothetical protein                             55.5    8e-06   
ref|WP_006621819.1|  hypothetical protein                             53.1    8e-06   
ref|WP_028088930.1|  hypothetical protein                             55.1    9e-06   
ref|WP_009341607.1|  CBS domain protein containing membrane protein   55.1    9e-06   
ref|WP_016874928.1|  CP12 polypeptide                                 55.1    1e-05   
gb|AHJ27947.1|  hypothetical protein NSP_16130                        53.1    1e-05   
ref|WP_006668828.1|  MULTISPECIES: hypothetical protein               52.8    1e-05   
ref|WP_015112530.1|  hypothetical protein                             54.7    1e-05   
emb|CAA06468.1|  CP12                                                 52.0    1e-05   
ref|WP_038296453.1|  CBS domain-containing protein [                  54.7    1e-05   
ref|WP_008275985.1|  hypothetical protein                             52.4    1e-05   
ref|WP_010994939.1|  hypothetical protein                             54.3    1e-05   
ref|XP_010064961.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  53.5    1e-05   
ref|WP_035997238.1|  CBS domain-containing protein                    54.3    2e-05   
ref|WP_006197267.1|  hypothetical protein                             52.4    2e-05   
ref|WP_021831474.1|  CP12 polypeptide                                 52.0    2e-05   
ref|WP_007306037.1|  hypothetical protein                             52.0    2e-05   
ref|WP_015216233.1|  protein of unknown function CP12                 53.9    2e-05   
ref|WP_016952406.1|  CP12 polypeptide                                 53.5    3e-05   
ref|WP_026735781.1|  hypothetical protein                             51.6    3e-05   
ref|WP_011321179.1|  hypothetical protein                             51.6    3e-05   
ref|WP_017326726.1|  hypothetical protein                             51.2    4e-05   
ref|WP_015138056.1|  hypothetical protein                             53.1    4e-05   
ref|WP_012407876.1|  hypothetical protein                             53.1    4e-05   
ref|WP_015131732.1|  hypothetical protein                             51.2    4e-05   
ref|WP_017749085.1|  hypothetical protein                             51.2    5e-05   
ref|WP_015079812.1|  CBS and CP12 domain-containing protein           53.1    5e-05   
ref|WP_015149967.1|  CP12 domain-containing protein                   50.4    7e-05   
ref|WP_027404529.1|  hypothetical protein                             52.4    7e-05   
ref|NP_001175656.1|  Os08g0513400                                     51.2    8e-05   
ref|WP_012408607.1|  hypothetical protein                             52.0    1e-04   
ref|WP_009453754.1|  MULTISPECIES: hypothetical protein               49.7    1e-04   
ref|WP_039717285.1|  hypothetical protein                             49.7    1e-04   
ref|WP_038089276.1|  hypothetical protein                             49.7    1e-04   
ref|WP_015216559.1|  CBS domain containing protein                    51.6    2e-04   
ref|WP_010995079.1|  hypothetical protein                             49.3    2e-04   
ref|WP_015199757.1|  hypothetical protein                             48.9    3e-04   
ref|WP_026735632.1|  hypothetical protein                             50.8    3e-04   
ref|WP_015140319.1|  CP12 domain-containing protein                   48.9    3e-04   
ref|WP_015115781.1|  hypothetical protein                             48.9    3e-04   
ref|WP_015143647.1|  hypothetical protein                             50.4    4e-04   
ref|WP_036798582.1|  CBS domain-containing protein                    50.1    4e-04   
ref|WP_015207732.1|  CP12 domain protein                              48.1    5e-04   
ref|WP_028085012.1|  hypothetical protein                             49.7    6e-04   
ref|WP_012411541.1|  hypothetical protein                             48.1    6e-04   
dbj|BAP16995.1|  hypothetical protein ETSB_0100                       47.8    6e-04   
ref|XP_004973898.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  48.5    6e-04   
ref|WP_027841754.1|  hypothetical protein                             49.7    7e-04   
ref|WP_015078667.1|  CP12 domain-containing protein                   47.8    8e-04   
ref|WP_017316356.1|  hypothetical protein                             47.4    8e-04   
ref|WP_015210963.1|  CBS domain-containing protein                    49.3    0.001   



>ref|XP_002275043.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Vitis 
vinifera]
Length=128

 Score =   157 bits (396),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 101/136 (74%), Gaps = 8/136 (6%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGV+L+T  P +LA +  +    T  +  L+ PWKR       F  GRMCV RPV 
Sbjct  1    MATIAGVSLST--PRVLARAADSPKSQTIQSPWLSNPWKRPS----RFGAGRMCV-RPVA  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPDS +SEKV +S+KNAEE C+ DP SGECVAAWDEVEELSAAASHARDKKK+S+PLE 
Sbjct  54   AAPDS-ISEKVVESIKNAEEKCSDDPASGECVAAWDEVEELSAAASHARDKKKESDPLET  112

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE EECRTY++
Sbjct  113  YCKDNPEDEECRTYED  128



>dbj|BAH03328.1| chloroplast protein 12 [Fagus crenata]
Length=130

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 12/139 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAG+NL+T  P +LA   +SPKA  QT K +  L+  WKR  +       GR   VR
Sbjct  1    MATIAGLNLST--PRVLAKSADSPKA--QTIK-SPWLSHSWKRPTL---FGYAGRSMQVR  52

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAP+  +S+KVA+S+K+AEEACAGDP SGECVAAWDEVEELSAAASHARDKKK S+P
Sbjct  53   PVSAAPEK-ISDKVAESIKDAEEACAGDPASGECVAAWDEVEELSAAASHARDKKKGSDP  111

Query  271  LEEFCKDNPESEECRTYDN  215
            LEE+CKDNPE+EECRTY++
Sbjct  112  LEEYCKDNPETEECRTYED  130



>ref|XP_008235152.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Prunus 
mume]
Length=169

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 101/135 (75%), Gaps = 8/135 (6%)
 Frame = -3

Query  616  VIAGVNLTTTSPGILANSPKAAAQTTKFT-TCLNRPWKRAGVTAGLFRPGRMCVVRPVCA  440
             +AGVNL+T  P +LA   KA      F    L+ PW+R+G +  L   GRM ++RPV A
Sbjct  42   TVAGVNLST--PRVLA---KATETPKAFQPAWLSNPWRRSG-SQQLLGGGRMTMIRPVSA  95

Query  439  APDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            APD  +SEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAAASHARD KK S+PLE F
Sbjct  96   APDK-ISEKVAESIKSAEETCSDDPASGECVAAWDEVEELSAAASHARDNKKTSDPLETF  154

Query  259  CKDNPESEECRTYDN  215
            CKDNPE++ECRTYDN
Sbjct  155  CKDNPETDECRTYDN  169



>gb|EYU46807.1| hypothetical protein MIMGU_mgv1a016182mg [Erythranthe guttata]
Length=131

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  619  VVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCA  440
            +  AGV++TT      A+S  + +    F+  LN PWK  G  A  F+  RM VVRPV A
Sbjct  1    MAAAGVSITTPKIFAKASSDSSRSHPINFSQ-LNSPWK--GCGAAQFKQSRMFVVRPVAA  57

Query  439  APDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            APD  LS+KV  S+K+A+EAC+GDP SGEC AAWDEVEELSAA SHA+DK KD++PLE +
Sbjct  58   APDQ-LSQKVEQSIKDAQEACSGDPVSGECAAAWDEVEELSAAVSHAKDKSKDTDPLETY  116

Query  259  CKDNPESEECRTYDN  215
            CKDNPE++ECRTYDN
Sbjct  117  CKDNPETDECRTYDN  131



>ref|XP_011079555.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Sesamum 
indicum]
Length=129

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 99/137 (72%), Gaps = 9/137 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILAN-SPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            M  +AGV++TT  P + A  S  +     KF+  LN PWKR       F  GRM  VRPV
Sbjct  1    MAAVAGVSITT--PKVFAKLSDSSKPHAVKFSL-LNSPWKRCTTQ---FSHGRM-YVRPV  53

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
             AAPD  +S+KV  S+KNA+EAC+ DP SGEC AAWDEVEELSAAASHARDK+K+S+PLE
Sbjct  54   AAAPDQ-ISDKVEQSIKNAQEACSDDPVSGECAAAWDEVEELSAAASHARDKQKESDPLE  112

Query  265  EFCKDNPESEECRTYDN  215
             FCKDNPE++ECRTYDN
Sbjct  113  NFCKDNPETDECRTYDN  129



>ref|XP_004495904.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cicer 
arietinum]
Length=132

 Score =   152 bits (384),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 9/135 (7%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKA--AAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCA  440
            +AGV L+  SP +L   P++   +   +F        +R G  +     GR+  +RPV A
Sbjct  5    MAGVTLS--SPRVLFKGPESLQKSHAIRFGPVFMLSQRRTGSVSS----GRILTIRPVRA  58

Query  439  APDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            APDS +SEKV +S+KNAEEAC+GD TSGECVAAWDEVEELSAAASHARDKKK+S+PL+E+
Sbjct  59   APDS-ISEKVEESIKNAEEACSGDATSGECVAAWDEVEELSAAASHARDKKKESDPLDEY  117

Query  259  CKDNPESEECRTYDN  215
            CKDNPES+ECRTYDN
Sbjct  118  CKDNPESDECRTYDN  132



>emb|CDP17070.1| unnamed protein product [Coffea canephora]
Length=127

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 102/136 (75%), Gaps = 9/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGV+L+T  P IL    KA+  T KF  CLN P K +  TA     G    VRP+ 
Sbjct  1    MAAIAGVSLST--PQILLF--KASHSTLKFP-CLNHPCK-SSTTAHFVHRG--LSVRPLA  52

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAP+  LS++VA+SVK+AEEACAGDP SGEC AAWDEVEELSAAASHARD+KK+++ LE+
Sbjct  53   AAPER-LSDQVAESVKHAEEACAGDPESGECAAAWDEVEELSAAASHARDRKKETDVLED  111

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE+EECRTYDN
Sbjct  112  YCKDNPETEECRTYDN  127



>ref|XP_006355835.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Solanum 
tuberosum]
Length=126

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 98/136 (72%), Gaps = 10/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGV++TT  P I ++SPK   Q  KF T LN PWK++G     F  GRM VV P  
Sbjct  1    MASIAGVSITT--PRISSDSPKI--QPLKFPT-LNSPWKKSG----QFSYGRMYVVVPR-  50

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
              PD  LS+ VA+SVK AEEACA DP SGEC AAWD VEE SAAASHARD+KK+S+ LE 
Sbjct  51   VVPDKKLSDLVAESVKEAEEACAEDPVSGECKAAWDVVEETSAAASHARDRKKESDVLEN  110

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE++ECRTYDN
Sbjct  111  YCKDNPETDECRTYDN  126



>ref|XP_003591401.1| Calvin cycle protein CP12 [Medicago truncatula]
 gb|ACJ83864.1| unknown [Medicago truncatula]
 gb|AES61652.1| calvin cycle protein CP12-1 [Medicago truncatula]
 gb|AFK43368.1| unknown [Medicago truncatula]
Length=131

 Score =   146 bits (368),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 14/137 (10%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTT----CLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            +AGV+L+  SP ++   P++  ++    +     LN+ W       G    GRM  +RPV
Sbjct  5    MAGVSLS--SPRVIFKGPESLQKSQAIRSGPVFMLNQRW------TGAVSSGRMVSIRPV  56

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
             A+PD  ++ KV +S+K+AEEACAGD TSGECVAAWDEVEELSAAASHARDKKK S+PLE
Sbjct  57   QASPD--ITGKVEESIKSAEEACAGDATSGECVAAWDEVEELSAAASHARDKKKTSDPLE  114

Query  265  EFCKDNPESEECRTYDN  215
            E+CKDNPE++ECRTYDN
Sbjct  115  EYCKDNPETDECRTYDN  131



>ref|XP_011082421.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Sesamum 
indicum]
Length=127

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 98/137 (72%), Gaps = 11/137 (8%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKF-TTCLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            M  IAGV++TT  P I A++   + + +    + LN PWK       ++       VRPV
Sbjct  1    MAAIAGVSITT--PKIFASASVRSPKPSPIKLSLLNSPWKSCTTHLRMY-------VRPV  51

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
             AAPD  LS+KV +S+KNA+EAC+ DP SGECVAAWDEVEELSAAASHA+DK KDS+PLE
Sbjct  52   AAAPDK-LSDKVEESIKNAQEACSEDPVSGECVAAWDEVEELSAAASHAKDKNKDSDPLE  110

Query  265  EFCKDNPESEECRTYDN  215
             +CKDNPE++ECRTYDN
Sbjct  111  NYCKDNPETDECRTYDN  127



>gb|KDP28257.1| hypothetical protein JCGZ_14028 [Jatropha curcas]
Length=126

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 95/136 (70%), Gaps = 10/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  +  +NL+T  P ++A +  A      F   LN PW R          GRM  ++P  
Sbjct  1    MATLTSLNLST--PRVVAKATDAPKAQPIFK--LNHPWNRTYQVGS----GRM-RMQPAR  51

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +SEKV  S+K AEEACAGDP SGECVAAWDEVEELSAAASHARDKKK+S+PLEE
Sbjct  52   AAPDR-ISEKVEKSIKEAEEACAGDPASGECVAAWDEVEELSAAASHARDKKKESDPLEE  110

Query  262  FCKDNPESEECRTYDN  215
            FCKDNPE++ECRTYDN
Sbjct  111  FCKDNPETDECRTYDN  126



>ref|XP_002302764.2| CP12 domain-containing family protein [Populus trichocarpa]
 gb|ABK95858.1| unknown [Populus trichocarpa]
 gb|EEE82037.2| CP12 domain-containing family protein [Populus trichocarpa]
Length=127

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 101/139 (73%), Gaps = 15/139 (11%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAG+NL+T  P +LA   + PKA A        LN+PW+R   T  L   GRM  +R
Sbjct  1    MATIAGLNLST--PRVLAKATDKPKAQALVK-----LNQPWRR---TYHLGSGGRM-QIR  49

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAPDS +SEKV  S+K+AE AC+ D  SGEC AAWDEVEELSAAASHA+DKKK S+P
Sbjct  50   PVRAAPDS-ISEKVEKSIKDAEAACSDDAASGECAAAWDEVEELSAAASHAKDKKKGSDP  108

Query  271  LEEFCKDNPESEECRTYDN  215
            LEE+CKDNPE++ECRTY++
Sbjct  109  LEEYCKDNPETDECRTYED  127



>ref|XP_007201261.1| hypothetical protein PRUPE_ppa013259mg [Prunus persica]
 gb|EMJ02460.1| hypothetical protein PRUPE_ppa013259mg [Prunus persica]
Length=132

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 100/135 (74%), Gaps = 8/135 (6%)
 Frame = -3

Query  616  VIAGVNLTTTSPGILANSPKAAAQTTKFT-TCLNRPWKRAGVTAGLFRPGRMCVVRPVCA  440
             +AGV+L+T  P +LA   KA      F    L+ PW+R+G    L   GRM ++RPV A
Sbjct  5    TVAGVSLST--PRMLA---KATETPKAFQPAWLSNPWRRSGGQQLLGG-GRMTMIRPVSA  58

Query  439  APDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            APD  +SEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAAASHARD KK S+PLE F
Sbjct  59   APDK-ISEKVAESIKSAEETCSDDPASGECVAAWDEVEELSAAASHARDNKKTSDPLETF  117

Query  259  CKDNPESEECRTYDN  215
            CKDNPE++ECRTYDN
Sbjct  118  CKDNPETDECRTYDN  132



>gb|AFK34703.1| unknown [Medicago truncatula]
Length=131

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 98/137 (72%), Gaps = 14/137 (10%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTT----CLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            +AGV+L+  SP ++   P++  ++    +     LN+ W       G    GRM  +RPV
Sbjct  5    MAGVSLS--SPRVIFKGPESLQKSQAIRSGPVFMLNQRW------TGAVSSGRMVSIRPV  56

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
             A+PD  ++ KV +S+K+AEE CAGD TSGECVAAWDEVEELSAAASHARDKKK S+PLE
Sbjct  57   QASPD--ITGKVEESIKSAEETCAGDATSGECVAAWDEVEELSAAASHARDKKKTSDPLE  114

Query  265  EFCKDNPESEECRTYDN  215
            E+CKDNPE++ECRTYDN
Sbjct  115  EYCKDNPETDECRTYDN  131



>ref|XP_008454293.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Cucumis 
melo]
Length=128

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I+GVN++  SP ILA     AAQT K    LN  W R               V PV 
Sbjct  1    MATISGVNIS--SPRILAK----AAQTPKVQP-LNVGWLRCSWKQSARVGAIRLRVPPVH  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +S+KV +S+KNAEEACAGDP SGEC AAWDEVEELSAAASHARD+KK+S+PLE 
Sbjct  54   AAPDK-ISDKVEESIKNAEEACAGDPVSGECAAAWDEVEELSAAASHARDRKKESDPLEN  112

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE+EECRTYDN
Sbjct  113  YCKDNPETEECRTYDN  128



>ref|XP_007051103.1| CP12 domain-containing protein 1 [Theobroma cacao]
 gb|EOX95260.1| CP12 domain-containing protein 1 [Theobroma cacao]
Length=208

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 99/138 (72%), Gaps = 7/138 (5%)
 Frame = -3

Query  628  AKMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRP  449
            A M  ++ +NL   SP ++AN   +   ++     LN+PWKR           RM V+RP
Sbjct  78   ATMATLSSLNLV--SPRVVANVLDSTKASSVKVPYLNQPWKRVSQLGS----RRMQVIRP  131

Query  448  VCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPL  269
            V AAPDS +S+KV  S+K AEEAC+GDP SGECVAAWDEVEELSAAASHAR+KKK ++PL
Sbjct  132  VRAAPDS-ISDKVEKSIKEAEEACSGDPASGECVAAWDEVEELSAAASHAREKKKGNDPL  190

Query  268  EEFCKDNPESEECRTYDN  215
            E +CKD+PE++ECRTY++
Sbjct  191  ENYCKDHPETDECRTYED  208



>ref|XP_006444494.1| hypothetical protein CICLE_v10022841mg [Citrus clementina]
 ref|XP_006492335.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR57734.1| hypothetical protein CICLE_v10022841mg [Citrus clementina]
 gb|KDO86998.1| hypothetical protein CISIN_1g032973mg [Citrus sinensis]
Length=130

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (73%), Gaps = 6/136 (4%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGVNL+T S       PK+  Q ++ +  LN P ++       FR GRM  ++P+ 
Sbjct  1    MATIAGVNLSTPSVFAKITDPKSKVQPSR-SLWLNNPSRK---RPAQFRTGRM-HMQPLR  55

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +SEKV  S+K+AEEAC GDP SGEC AAWDEVEELSAAASHAR++KKDS+PLE 
Sbjct  56   AAPDR-ISEKVEQSIKSAEEACEGDPASGECAAAWDEVEELSAAASHARERKKDSDPLEA  114

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE++ECRTY++
Sbjct  115  YCKDNPETDECRTYED  130



>ref|XP_004152225.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004156820.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN52853.1| Chloroplast protein 12 [Cucumis sativus]
Length=128

 Score =   144 bits (362),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 95/136 (70%), Gaps = 8/136 (6%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I+GVNL+  SP I+A     AA+T K    LN  W R               V PV 
Sbjct  1    MATISGVNLS--SPRIMAK----AAKTPKVQL-LNVGWLRCSWKQSAQLGAIRLRVPPVH  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +S+KV +S+KNAEEACAGDP SGEC AAWDEVEELSAAASHARD+KK+S+PLE 
Sbjct  54   AAPDK-ISDKVEESIKNAEEACAGDPVSGECAAAWDEVEELSAAASHARDRKKESDPLES  112

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE+EECRTYDN
Sbjct  113  YCKDNPETEECRTYDN  128



>emb|CDY25110.1| BnaC06g18520D [Brassica napus]
Length=129

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 5/102 (5%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW       G     RM  VRPV A P+  +S+KV  S+K+AEE CAGDP SGECVA
Sbjct  33   LNNPWN-----IGSRTTNRMVTVRPVKATPEGVISDKVEKSIKDAEETCAGDPVSGECVA  87

Query  343  AWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKKDS+PLEE+CKDNPE+ ECRTYD
Sbjct  88   AWDEVEELSAAASHARDKKKDSDPLEEYCKDNPETSECRTYD  129



>ref|XP_009104385.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Brassica 
rapa]
Length=129

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 5/102 (5%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM  VRPV A P+  +S+KV  S+K+AEE CAGDP SGECVA
Sbjct  33   LNNPWNLGSRTTN-----RMAAVRPVKATPEGVISDKVEKSIKDAEETCAGDPVSGECVA  87

Query  343  AWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKKDS+PLEE+CKDNPE+ ECRTYD
Sbjct  88   AWDEVEELSAAASHARDKKKDSDPLEEYCKDNPETNECRTYD  129



>emb|CDX67892.1| BnaA07g19320D [Brassica napus]
Length=129

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 5/102 (5%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM  VRPV A P+  +S+KV  S+K+AEE CAGDP SGECVA
Sbjct  33   LNNPWNLGSRTTN-----RMAAVRPVKATPEGVISDKVEKSIKDAEETCAGDPVSGECVA  87

Query  343  AWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKKDS+PLEE+CKDNPE+ ECRTYD
Sbjct  88   AWDEVEELSAAASHARDKKKDSDPLEEYCKDNPETSECRTYD  129



>ref|XP_010087241.1| hypothetical protein L484_009750 [Morus notabilis]
 ref|XP_010089346.1| hypothetical protein L484_000210 [Morus notabilis]
 gb|EXB28591.1| hypothetical protein L484_009750 [Morus notabilis]
 gb|EXC36196.1| hypothetical protein L484_000210 [Morus notabilis]
Length=131

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 6/133 (5%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAP  434
            +AGV+L+  +P I+A S   + +         +PW        L + GR+ VVRPV AAP
Sbjct  5    MAGVSLS--APRIVAKSGAESPKVPHAYIRTVQPW---NYNKRLSQYGRLMVVRPVMAAP  59

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            D  LS+KVA+SVKNAEEAC+ +P SGECVAAWDEVEELSAAASHARDKKK ++ LEE+CK
Sbjct  60   DK-LSDKVAESVKNAEEACSDNPASGECVAAWDEVEELSAAASHARDKKKSTDSLEEYCK  118

Query  253  DNPESEECRTYDN  215
            DNPE++ECRTY++
Sbjct  119  DNPEADECRTYED  131



>gb|ACJ85997.1| unknown [Medicago truncatula]
Length=131

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 98/137 (72%), Gaps = 14/137 (10%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTT----CLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            +AGV+L+  SP ++   P++  ++    +     LN+ W       G    GRM  +RPV
Sbjct  5    MAGVSLS--SPRVIFKGPESLQKSQAIRSGPVFMLNQRW------TGAVSSGRMVSIRPV  56

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
             A+PD  ++ KV +S+K+AEEACAGD TSGECVAAWDEVEELSAAASHARDKKK S+PLE
Sbjct  57   QASPD--ITGKVEESIKSAEEACAGDATSGECVAAWDEVEELSAAASHARDKKKTSDPLE  114

Query  265  EFCKDNPESEECRTYDN  215
            E+ KDNPE++ECRTYDN
Sbjct  115  EYRKDNPETDECRTYDN  131



>ref|XP_009339774.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=153

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 10/149 (7%)
 Frame = -3

Query  661  KEPFNSRTSLLAKMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGL  482
            ++P   R   +A    +AGV+L+T    +L+     A +  +    LN P  R+  + G 
Sbjct  15   RKPERKREGEMASSTTVAGVSLSTPR-SVLSK----ATEVPRAFHSLNVPTWRSYSSVG-  68

Query  481  FRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASH  302
                RM +VRPV AAPD  LSEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAA SH
Sbjct  69   ---RRMTIVRPVSAAPDK-LSEKVAESIKSAEETCSDDPASGECVAAWDEVEELSAAVSH  124

Query  301  ARDKKKDSNPLEEFCKDNPESEECRTYDN  215
             RD +K S+PLE FCKDNPE++ECRTYDN
Sbjct  125  KRDNEKSSDPLETFCKDNPETDECRTYDN  153



>emb|CAA96570.1| CP12 [Pisum sativum]
Length=127

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 100/136 (74%), Gaps = 9/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I+G++L+  +P +L NSP    QT K ++    P        G    GRM +V+PV 
Sbjct  1    MATISGLSLS--NPRLLFNSP-GFPQTIKISSA--SPLSTRQTLTG---SGRMKIVQPVR  52

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAP+  +S+KV +S+K+A+E CA DP SGECVAAWDEVEELSAAASHARD+KK+S+PLE+
Sbjct  53   AAPEQ-ISKKVEESIKSAQETCADDPVSGECVAAWDEVEELSAAASHARDRKKESDPLED  111

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE++EC+TYDN
Sbjct  112  YCKDNPETDECKTYDN  127



>ref|XP_008359430.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=129

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 97/139 (70%), Gaps = 10/139 (7%)
 Frame = -3

Query  631  LAKMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            +A  + +AGV+L+T    +L+     A +  +    LN P  R+  + G     RM +VR
Sbjct  1    MATSITVAGVSLSTPR-AVLSK----ATEVPRAFHSLNVPTWRSYSSVG----RRMTMVR  51

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAPD  LSEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAA SH RD +K S+P
Sbjct  52   PVSAAPDK-LSEKVAESIKSAEETCSDDPASGECVAAWDEVEELSAAVSHKRDNEKSSDP  110

Query  271  LEEFCKDNPESEECRTYDN  215
            LE FCKDNPE++ECRTYDN
Sbjct  111  LETFCKDNPETDECRTYDN  129



>ref|XP_003625969.1| CP12 [Medicago truncatula]
 gb|AES82187.1| calvin cycle protein CP12-1 [Medicago truncatula]
Length=128

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 99/137 (72%), Gaps = 12/137 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFT--TCLNRPWKRAGVTAGLFRPGRMCVVRP  449
            M  I G++ + ++P +L NS     QT K +  T L   W  AG        GRM VVRP
Sbjct  1    MATIGGLS-SLSNPKLLFNS-SGFPQTIKISPATPLQTRWGVAG-------SGRMTVVRP  51

Query  448  VCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPL  269
            V AAP+  +S+KV +S+K+A+E CA DP SGECVAAWDEVEELSAAASHARD+KKDS+PL
Sbjct  52   VRAAPEQ-ISKKVEESIKSAQETCADDPVSGECVAAWDEVEELSAAASHARDRKKDSDPL  110

Query  268  EEFCKDNPESEECRTYD  218
            E++CKDNPE++EC+T+D
Sbjct  111  EDYCKDNPETDECKTFD  127



>ref|XP_011042247.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Populus 
euphratica]
Length=126

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 98/139 (71%), Gaps = 16/139 (12%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAG+NL+T  P +LA   + P+A          LN+PW+R          GRM  +R
Sbjct  1    MATIAGLNLST--PRVLAKATDKPRAQPLIK-----LNQPWRRTYHLGS----GRM-QIR  48

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAPDS +SEKV  S+K+AE AC+ D  SGEC AAWDEVEELSAAASHA+DKKK S+P
Sbjct  49   PVRAAPDS-ISEKVEKSIKDAEAACSDDAASGECAAAWDEVEELSAAASHAKDKKKGSDP  107

Query  271  LEEFCKDNPESEECRTYDN  215
            LEE+CKDNPE++ECRTY++
Sbjct  108  LEEYCKDNPETDECRTYED  126



>ref|XP_002515284.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47268.1| conserved hypothetical protein [Ricinus communis]
Length=128

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 97/136 (71%), Gaps = 8/136 (6%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  +  +N++T +  ++A +  A      F   LN PWKRAG      R  RM  ++PV 
Sbjct  1    MATLTSLNISTPA-RVIAKATDAPKAQPIFK--LNNPWKRAGCQ---LRSQRM-QIKPVR  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPDS +SEKV +S+K+A++AC  DP SGECVAAWD VEELSAAASHARDK KDS+PLE 
Sbjct  54   AAPDS-ISEKVEESIKDAKQACEDDPASGECVAAWDTVEELSAAASHARDKAKDSDPLET  112

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE++ECRTY++
Sbjct  113  YCKDNPETDECRTYED  128



>ref|XP_008451482.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Cucumis 
melo]
Length=125

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 95/136 (70%), Gaps = 11/136 (8%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I G ++  T    + +SPK  +   + ++ L+ PWKR       +  GRM  V PV 
Sbjct  1    MAAITGSSMAATK--AVTDSPKIESPVHR-SSRLSYPWKR-------WTSGRMSAVGPVA  50

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +SEKV +S+KNAE  C+ DP SGEC AAWDEVEELSAAASHARD+ KD++PLE+
Sbjct  51   AAPDR-ISEKVVESIKNAEVTCSEDPASGECAAAWDEVEELSAAASHARDRLKDADPLED  109

Query  262  FCKDNPESEECRTYDN  215
            FCKDNPE+EECRTY++
Sbjct  110  FCKDNPETEECRTYED  125



>ref|XP_002320298.1| CP12 domain-containing family protein [Populus trichocarpa]
 gb|EEE98613.1| CP12 domain-containing family protein [Populus trichocarpa]
Length=126

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 100/139 (72%), Gaps = 16/139 (12%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAG+NL+T  P +LA   ++PKA     +    LN+ W+R+         GR+  VR
Sbjct  1    MATIAGLNLST--PRVLAKATDTPKA-----QPLIKLNQQWRRSYQLGS----GRV-QVR  48

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAP+  +SEKV  S+K AEEAC+GD  SGEC AAWDEVEELSAAASHA+DKKK S+P
Sbjct  49   PVRAAPEG-ISEKVEKSIKEAEEACSGDAASGECAAAWDEVEELSAAASHAKDKKKGSDP  107

Query  271  LEEFCKDNPESEECRTYDN  215
            LEE+CKDNPE++ECRTY++
Sbjct  108  LEEYCKDNPETDECRTYED  126



>ref|XP_009378720.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Pyrus 
x bretschneideri]
Length=129

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 93/131 (71%), Gaps = 9/131 (7%)
 Frame = -3

Query  595  TTTSPGILANSPKA----AAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDS  428
            TTT  G+  ++P+A    A +  +    LN P  R+  + G     RM +VRPV AAPD 
Sbjct  4    TTTVAGVSLSTPRAVLSKATEAPRAFQSLNIPTWRSYSSVG----RRMTMVRPVSAAPDK  59

Query  427  SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
             LSEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAAASH RD +K S+PLE FC DN
Sbjct  60   -LSEKVAESIKSAEEKCSDDPASGECVAAWDEVEELSAAASHKRDNQKSSDPLETFCNDN  118

Query  247  PESEECRTYDN  215
            PE++ECRTYD+
Sbjct  119  PETDECRTYDS  129



>ref|XP_004494423.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cicer 
arietinum]
Length=123

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 94/136 (69%), Gaps = 13/136 (10%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I  +NL+  +P +L NS K   Q  K ++             GL   G M   R V 
Sbjct  1    MATIGTLNLS--NPKLLINSSKFP-QAIKLSS---------ASPLGLTGSGGMRKFRAVR  48

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +SEKV +S+KNA+E CAGDPTSGECVAAWDEVEELSAAASHARDKKKDS+PLE+
Sbjct  49   AAPDK-ISEKVEESIKNAQETCAGDPTSGECVAAWDEVEELSAAASHARDKKKDSDPLED  107

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE+ EC+T+D+
Sbjct  108  YCKDNPETLECKTFDD  123



>ref|XP_009774670.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Nicotiana 
sylvestris]
Length=129

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 99/140 (71%), Gaps = 15/140 (11%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILAN---SPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAGV+LTT  P +LAN   SPK   +  KF  CLN PWK     +  F   RM  ++
Sbjct  1    MATIAGVSLTT--PRVLANKSNSPKV--EPFKFP-CLNNPWK----NSAQFGSSRM-YLK  50

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSN  275
            PV AAPD  LS+ VADSVK AEEAC+ +P SGEC AAWD VEE SAAASHARDK K++S+
Sbjct  51   PVSAAPDK-LSDLVADSVKGAEEACSENPASGECAAAWDVVEETSAAASHARDKQKQNSD  109

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CK+NPE++ECR YDN
Sbjct  110  PLEGYCKENPETDECRVYDN  129



>ref|XP_004300451.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=127

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 94/136 (69%), Gaps = 9/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  +AGV+  +T PG+ A     AA+T K        +   G + G    GRM ++RPV 
Sbjct  1    MASVAGVSSLST-PGVFAR----AAETPKVIKPAGVSF---GYSFGQVGSGRMRMIRPVA  52

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  LS+KV +S+K AE+AC+ DP SGECVAAWDEVEELSAAASH RD +K+ +PLE 
Sbjct  53   AAPDK-LSDKVRESIKEAEQACSEDPASGECVAAWDEVEELSAAASHKRDNEKNKDPLET  111

Query  262  FCKDNPESEECRTYDN  215
            +C DNPE++ECRTYDN
Sbjct  112  YCNDNPETDECRTYDN  127



>ref|XP_010321871.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Solanum 
lycopersicum]
Length=127

 Score =   135 bits (341),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 93/136 (68%), Gaps = 9/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGV++T   P I ++SPK   Q  K  T LN PWK++    G  R   + V R V 
Sbjct  1    MASIAGVSITI--PTISSDSPKI--QPLKLQT-LNSPWKKSS-QLGYRRMMYVVVPRVV-  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
              PD  LS+ VA+SVK AEE CA DP SGEC AAWD VEE SAAASHARDKKK+S+ LE 
Sbjct  54   --PDKKLSDLVAESVKEAEETCAEDPVSGECKAAWDVVEETSAAASHARDKKKESDVLEN  111

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE++ECRTYDN
Sbjct  112  YCKDNPETDECRTYDN  127



>ref|XP_007163176.1| hypothetical protein PHAVU_001G212900g [Phaseolus vulgaris]
 gb|ESW35170.1| hypothetical protein PHAVU_001G212900g [Phaseolus vulgaris]
Length=132

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 94/138 (68%), Gaps = 8/138 (6%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  + GV+L++      A+     A    F   L     R  +  G  + GR+  +RPV 
Sbjct  1    MATMTGVSLSSPRVWFNASGSPQNAHAINFALPL-----RQAMRPGGIQMGRVTRIRPVR  55

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKK--KDSNPL  269
            AAPD  +SEKV +S+K A+EACAGDPTSGECVAAWDEVEELSAAASHARDK+  KDS+PL
Sbjct  56   AAPDK-ISEKVEESIKQAQEACAGDPTSGECVAAWDEVEELSAAASHARDKQKEKDSDPL  114

Query  268  EEFCKDNPESEECRTYDN  215
            E +CKDNPE+ EC+T+D+
Sbjct  115  ENYCKDNPETIECKTFDD  132



>ref|XP_010267998.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Nelumbo 
nucifera]
Length=130

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 11/135 (8%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAP  434
            +AGV L+ T  G++A +     Q+  +  CLN PW+        FR GR+  VR +   P
Sbjct  5    VAGVTLSAT--GVVAKADSTKVQSFGYP-CLNHPWR----MNQCFRSGRL-YVRTMATTP  56

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHAR--DKKKDSNPLEEF  260
            +S +S+KV +S+KNA+E CA DP SGECVAAWDEVEELSAAASH R   K+KD++PLE F
Sbjct  57   ES-ISDKVNESIKNAQETCASDPASGECVAAWDEVEELSAAASHIRLKQKEKDADPLEHF  115

Query  259  CKDNPESEECRTYDN  215
            CKDNPE+EECRTY++
Sbjct  116  CKDNPETEECRTYED  130



>ref|XP_006402378.1| hypothetical protein EUTSA_v10006414mg [Eutrema salsugineum]
 dbj|BAJ34148.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43831.1| hypothetical protein EUTSA_v10006414mg [Eutrema salsugineum]
Length=131

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM  +RPV A P+  +++KV  S+K AEE CAGDP SGECVA
Sbjct  32   LNNPWNLGSRTTN-----RMVKIRPVKATPEGGITDKVEKSIKEAEETCAGDPVSGECVA  86

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYDN
Sbjct  87   AWDEVEELSAAASHARDKKKAGGSDPLEEYCKDNPETNECRTYDN  131



>gb|KHN19215.1| Calvin cycle protein CP12 [Glycine soja]
Length=132

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 100/140 (71%), Gaps = 12/140 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQT--TKFTTCLNRPWKRAGVTAGLFRPGRMCVVRP  449
            M  + GV+L+  SP +  N+  +   T   KF   L++     G+  G  R GR+  +RP
Sbjct  1    MATMTGVSLS--SPRVFFNASASPQNTYAVKFAVPLSQ-----GMRLGSVRLGRVMRIRP  53

Query  448  VCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHA--RDKKKDSN  275
            V AAP+  +SEKV +S+KNA+EACAGDPTSGECVAAWDEVEELSAAASHA  + K+KDS+
Sbjct  54   VRAAPER-ISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHAKYKQKEKDSD  112

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CKDNPE+ EC+T+++
Sbjct  113  PLETYCKDNPETIECKTFED  132



>ref|XP_003521594.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
Length=132

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 100/140 (71%), Gaps = 12/140 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQT--TKFTTCLNRPWKRAGVTAGLFRPGRMCVVRP  449
            M  + GV+L+  SP +  N+  +   T   KF   L++     G+  G  R GR+  +RP
Sbjct  1    MATMTGVSLS--SPRVFFNASPSPQNTYAVKFAVPLSQ-----GMRLGSVRLGRVMRIRP  53

Query  448  VCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHA--RDKKKDSN  275
            V AAP+  +SEKV +S+KNA+EACAGDPTSGECVAAWDEVEELSAAASHA  + K+KDS+
Sbjct  54   VRAAPER-ISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHAKYKQKEKDSD  112

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CKDNPE+ EC+T+++
Sbjct  113  PLETYCKDNPETIECKTFED  132



>ref|XP_008355495.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=145

 Score =   134 bits (338),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = -3

Query  595  TTTSPGILANSPKAAAQTT----KFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDS  428
            TTT  G+  ++P+A    T    +    LN P  R+  + G     RM +VRPV AAPD 
Sbjct  21   TTTLAGVSLSTPRAVLSKTTEAPRAFQSLNIPTWRSYSSVG----RRMTLVRPVTAAPDK  76

Query  427  SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
             LSEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAAASH R  +K S+PLE FCKDN
Sbjct  77   -LSEKVAESIKSAEEKCSDDPASGECVAAWDEVEELSAAASHKRANEKSSDPLETFCKDN  135

Query  247  PESEECRTYD  218
            PE++ECRTYD
Sbjct  136  PETDECRTYD  145



>ref|XP_003554549.2| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
 gb|KHN43459.1| Calvin cycle protein CP12 [Glycine soja]
Length=165

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 99/139 (71%), Gaps = 8/139 (6%)
 Frame = -3

Query  625  KMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            +M  + GV+L+       A++    A   KF+     P  +A V  G  + GR+  +RPV
Sbjct  33   RMATMTGVSLSCPRVFFNASASPQNAHAVKFSL----PPSQA-VRPGSIKLGRVMRIRPV  87

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKK--KDSNP  272
             AAP+  +SEKV +S+KNA+EACAGDPTSGECVAAWDEVEELSAAASHARDK+  KDS+P
Sbjct  88   RAAPER-ISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHARDKQKEKDSDP  146

Query  271  LEEFCKDNPESEECRTYDN  215
            LE +CKDNPE+ EC+T+++
Sbjct  147  LENYCKDNPETIECKTFED  165



>gb|ACU20479.1| unknown [Glycine max]
Length=132

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 99/140 (71%), Gaps = 12/140 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQT--TKFTTCLNRPWKRAGVTAGLFRPGRMCVVRP  449
            M  + GV+L+  SP    N+  +   T   KF   L++     G+  G  R GR+  +RP
Sbjct  1    MATMTGVSLS--SPRAFFNASPSLQNTYAVKFAVPLSQ-----GMRLGSVRLGRVMRIRP  53

Query  448  VCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHA--RDKKKDSN  275
            V AAP+  +SEKV +S+KNA+EACAGDPTSGECVAAWDEVEELSAAASHA  + K+KDS+
Sbjct  54   VRAAPER-ISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHAKYKQKEKDSD  112

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CKDNPE+ EC+T+++
Sbjct  113  PLETYCKDNPETIECKTFED  132



>gb|KFK35421.1| hypothetical protein AALP_AA5G282200 [Arabis alpina]
Length=132

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW  A  T       RM    PV A P+  +S+ V  S+K+A+E CAGDP SGECVA
Sbjct  33   LNNPWNLASRTTN-----RMVSFNPVKATPEGGISDIVEKSIKDAQETCAGDPVSGECVA  87

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE++ECRTYDN
Sbjct  88   AWDEVEELSAAASHARDKKKAGGSDPLEEYCKDNPETDECRTYDN  132



>ref|XP_009604948.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=129

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 9/137 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGV+LTT  P +LA +  ++        CLN PWK++      F   RM  ++PV 
Sbjct  1    MATIAGVSLTT--PRVLAKASNSSKVEPFKFPCLNNPWKKSA----QFGSRRM-YLKPVS  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLE  266
            AAPD  LS+ V DSVK AEEAC+ +P SGEC AAWD VEE SAAASHARDK K++S+PLE
Sbjct  54   AAPDK-LSDLVVDSVKGAEEACSENPASGECAAAWDVVEETSAAASHARDKQKQNSDPLE  112

Query  265  EFCKDNPESEECRTYDN  215
             +CK+NPE++ECR YDN
Sbjct  113  GYCKENPETDECRVYDN  129



>ref|XP_002876674.1| CP12-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52933.1| CP12-2 [Arabidopsis lyrata subsp. lyrata]
Length=131

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM  ++P+ AAP+  +S+ V  S+K A+E CAGDP SGECVA
Sbjct  32   LNNPWNLGSRTTN-----RMVKLKPIRAAPEGGISDVVEKSIKEAQETCAGDPVSGECVA  86

Query  343  AWDEVEELSAAASHARDKKKD--SNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYDN
Sbjct  87   AWDEVEELSAAASHARDKKKSDGSDPLEEYCKDNPETNECRTYDN  131



>gb|ABK96294.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96302.1| unknown [Populus trichocarpa x Populus deltoides]
Length=127

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 96/139 (69%), Gaps = 15/139 (11%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAG+NL+T  P +LA   ++PKA  Q         R W      +     GR+  VR
Sbjct  1    MATIAGLNLST--PRVLAKATDTPKA--QPPIKLNQQRRSW------SYQLGSGRV-QVR  49

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAP+  +SEKV  S+K AEEAC+GD  SGEC AAWDEVEELSAAASHA+DKKK S+P
Sbjct  50   PVRAAPEG-ISEKVEKSIKEAEEACSGDAASGECAAAWDEVEELSAAASHAKDKKKGSDP  108

Query  271  LEEFCKDNPESEECRTYDN  215
            LEE+CKDNPE++ECRTY++
Sbjct  109  LEEYCKDNPETDECRTYED  127



>emb|CDX76635.1| BnaC08g32210D [Brassica napus]
Length=129

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 7/104 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       R+   RPV +AP+  +S+KV  S+K+AEE CAGDP SGECVA
Sbjct  31   LNNPWNLGSRTTN-----RLVSFRPVKSAPEGVISDKVEKSIKDAEETCAGDPVSGECVA  85

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYD
Sbjct  86   AWDEVEELSAAASHARDKKKAEGSDPLEEYCKDNPETNECRTYD  129



>ref|XP_009116912.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Brassica 
rapa]
 gb|ABL97989.1| putative chloroplast protein CP12 [Brassica rapa]
 emb|CDY11420.1| BnaA09g39860D [Brassica napus]
Length=130

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 8/105 (8%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK         R  R+   RPV + P+  +S+KV  S+K+A+E+CA DP SGECVA
Sbjct  32   LNNPWKLGS------RTNRLVSFRPVKSTPEGVISDKVEKSIKDAKESCADDPVSGECVA  85

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE++ECRTYDN
Sbjct  86   AWDEVEELSAAASHARDKKKAGGSDPLEEYCKDNPETDECRTYDN  130



>ref|XP_011041206.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Populus 
euphratica]
Length=126

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 98/139 (71%), Gaps = 16/139 (12%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAG+NL+T  P +LA   ++PKA          LN+  +R+         GR+  +R
Sbjct  1    MATIAGLNLST--PRVLAKATDTPKAQPLIK-----LNQQRRRSY----QLWSGRV-QLR  48

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            PV AAP+  +SEKV  S+K AEEAC+GD  SGEC AAWDEVEELSAAASHA+DKKK S+P
Sbjct  49   PVRAAPEG-ISEKVEKSIKEAEEACSGDTASGECAAAWDEVEELSAAASHAKDKKKGSDP  107

Query  271  LEEFCKDNPESEECRTYDN  215
            LEE+CKDNPE++ECRTY++
Sbjct  108  LEEYCKDNPETDECRTYED  126



>ref|XP_006292773.1| hypothetical protein CARUB_v10019023mg [Capsella rubella]
 gb|EOA25671.1| hypothetical protein CARUB_v10019023mg [Capsella rubella]
Length=131

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM    PV AAP+  +S+ V  S+K A+E CAGDP SGECVA
Sbjct  32   LNNPWNLGSRTTS-----RMVKFSPVKAAPEGGISDVVEKSIKEAQETCAGDPESGECVA  86

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYDN
Sbjct  87   AWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN  131



>ref|XP_004135995.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Cucumis 
sativus]
Length=125

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 91/136 (67%), Gaps = 11/136 (8%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I G ++  +    + +SPK      + ++ L+ PWKR       +  GRM  V  V 
Sbjct  1    MAAITGSSMAASK--AVTDSPKIELPVLR-SSRLSYPWKR-------WTSGRMSAVGTVA  50

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +SEKV +S+KNAE  C+ DP SGEC AAWDEVEELSAAASHARD+   S+PLE+
Sbjct  51   AAPDR-ISEKVVESIKNAEVTCSEDPASGECAAAWDEVEELSAAASHARDRLSHSDPLED  109

Query  262  FCKDNPESEECRTYDN  215
            FCKDNPE+EECRTY++
Sbjct  110  FCKDNPETEECRTYED  125



>gb|KGN45014.1| hypothetical protein Csa_7G407670 [Cucumis sativus]
Length=181

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 94/147 (64%), Gaps = 11/147 (7%)
 Frame = -3

Query  655  PFNSRTSLLAKMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFR  476
            P   +     KM  I G ++  +    + +SPK      + ++ L+ PWKR       + 
Sbjct  46   PIKKQKRKEKKMAAITGSSMAAS--KAVTDSPKIELPVLR-SSRLSYPWKR-------WT  95

Query  475  PGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHAR  296
             GRM  V  V AAPD  +SEKV +S+KNAE  C+ DP SGEC AAWDEVEELSAAASHAR
Sbjct  96   SGRMSAVGTVAAAPDR-ISEKVVESIKNAEVTCSEDPASGECAAAWDEVEELSAAASHAR  154

Query  295  DKKKDSNPLEEFCKDNPESEECRTYDN  215
            D+   S+PLE+FCKDNPE+EECRTY++
Sbjct  155  DRLSHSDPLEDFCKDNPETEECRTYED  181



>ref|XP_010259310.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Nelumbo 
nucifera]
Length=128

 Score =   129 bits (324),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 89/139 (64%), Gaps = 11/139 (8%)
 Frame = -3

Query  631  LAKMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            +A  +  AGV+L+TT+  +LA       +      CLN PW+           GR   ++
Sbjct  1    MATTLTGAGVSLSTTTTRVLAKPDTGMLRPP----CLNHPWRLHKF------EGRRLRIQ  50

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
             +   P+  +SEKV +S+K AEE CAGDP SGEC AAWD VEELS+AASH R K K+S+P
Sbjct  51   AMATTPER-ISEKVVESIKTAEEVCAGDPVSGECAAAWDTVEELSSAASHERQKNKESDP  109

Query  271  LEEFCKDNPESEECRTYDN  215
            LE +CKDNPE++ECRTYDN
Sbjct  110  LETYCKDNPETDECRTYDN  128



>ref|XP_004163144.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Cucumis 
sativus]
Length=142

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 91/136 (67%), Gaps = 11/136 (8%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I G ++  +    + +SPK      + ++ L+ PWKR       +  GRM  V  V 
Sbjct  18   MAAITGSSMAASKA--VTDSPKIELPVLR-SSRLSYPWKR-------WTSGRMSAVGTVA  67

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            AAPD  +SEKV +S+KNAE  C+ DP SGEC AAWDEVEELSAAASHARD+   S+PLE+
Sbjct  68   AAPDR-ISEKVVESIKNAEVTCSEDPASGECAAAWDEVEELSAAASHARDRLSHSDPLED  126

Query  262  FCKDNPESEECRTYDN  215
            FCKDNPE+EECRTY++
Sbjct  127  FCKDNPETEECRTYED  142



>ref|NP_191800.1| calvin cycle protein CP12-2 [Arabidopsis thaliana]
 sp|Q9LZP9.1|CP122_ARATH RecName: Full=Calvin cycle protein CP12-2, chloroplastic; AltName: 
Full=CP12 domain-containing protein 2; AltName: Full=Chloroplast 
protein 12-2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB82955.1| CP12 protein precursor-like protein [Arabidopsis thaliana]
 gb|AAM20142.1| putative CP12 protein precursor [Arabidopsis thaliana]
 gb|AAM45071.1| putative CP12 protein precursor [Arabidopsis thaliana]
 gb|AEE80349.1| calvin cycle protein CP12-2 [Arabidopsis thaliana]
Length=131

 Score =   129 bits (323),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 80/116 (69%), Gaps = 9/116 (8%)
 Frame = -3

Query  535  FTTCLNRPWKRAG-------VTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEAC  377
            F T  NRP   AG          G     RM  ++P+ AAP+  +S+ V  S+K A+E C
Sbjct  16   FVTSENRPVCLAGPVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGISDVVEKSIKEAQETC  75

Query  376  AGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AGDP SGECVAAWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYDN
Sbjct  76   AGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN  131



>gb|AAM63795.1| CP12 protein precursor-like protein [Arabidopsis thaliana]
Length=131

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 80/116 (69%), Gaps = 9/116 (8%)
 Frame = -3

Query  535  FTTCLNRPWKRAG-------VTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEAC  377
            F T  NRP   AG          G     RM  ++P+ AAP+  +S+ V  S+K A+E C
Sbjct  16   FVTSENRPVCLAGPVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGISDVVEKSIKEAQETC  75

Query  376  AGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AGDP SGEC+AAWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYDN
Sbjct  76   AGDPVSGECIAAWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN  131



>ref|XP_010512631.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Camelina 
sativa]
Length=131

 Score =   128 bits (321),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM   RPV AAP+  +S+ V  S+K+A+E CA DP SGECVA
Sbjct  32   LNYPWNLGSRTTN-----RMVRFRPVKAAPEKGISDVVEKSIKDAQETCADDPVSGECVA  86

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYD
Sbjct  87   AWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYD  130



>gb|ADZ23481.1| chloroplast protein 12 [Stylosanthes guianensis]
Length=132

 Score =   127 bits (319),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 12/140 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPK--AAAQTTKFTTC--LNRPWKRAGVTAGLFRPGRMCVV  455
            M  I+G+ L++ +  +LA  P+    AQT KF+    LN+ W        L    R+  V
Sbjct  1    MATISGMTLSSPT-RVLAQGPEIPQKAQTVKFSPVVRLNQRW------PALTSSNRVSSV  53

Query  454  RPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSN  275
            R V AAPD  +SE+V  S+ +A+EAC  +P   EC AAWDEVEELSAAASHARDKKK+S+
Sbjct  54   RLVRAAPDR-ISERVEKSISDAQEACNDNPAGSECAAAWDEVEELSAAASHARDKKKESD  112

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CKDNPE++ECR YDN
Sbjct  113  PLENYCKDNPETDECRAYDN  132



>gb|KFK37480.1| hypothetical protein AALP_AA4G262800 [Arabis alpina]
Length=127

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IA  +L   +P  +     ++A+ T     LN PWK +          RM V++PV 
Sbjct  1    MTTIAATSLNVATPRAIFPPSSSSARLTAPVR-LNYPWKFSN---------RM-VMKPVK  49

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            A  +  +SEKV  S++ A+E CA DP SGECVAAWDEVEELSAAASHARDKKK   S+PL
Sbjct  50   ATSEGGISEKVEKSIQEAKETCADDPVSGECVAAWDEVEELSAAASHARDKKKAGGSDPL  109

Query  268  EEFCKDNPESEECRTYDN  215
            EE+C DNPE++ECRTYDN
Sbjct  110  EEYCNDNPETDECRTYDN  127



>emb|CAA96568.1| CP12 [Spinacia oleracea]
Length=124

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 86/133 (65%), Gaps = 9/133 (7%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAP  434
            +A ++L+ T   +L N+P         TT  + P     VT  L    R   +  V AAP
Sbjct  1    MASMSLSMTPKILLPNNP---------TTNFDAPKLANMVTYKLHGGRRSHGLVAVRAAP  51

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            D+ +SE V  S+K A+E C+ DP SGECVAAWD VEELSAAASHARDK KD  PLEE+CK
Sbjct  52   DNRISENVEKSIKEAQETCSDDPVSGECVAAWDVVEELSAAASHARDKAKDVEPLEEYCK  111

Query  253  DNPESEECRTYDN  215
            DNPE++ECRTYDN
Sbjct  112  DNPETDECRTYDN  124



>ref|XP_006397935.1| hypothetical protein EUTSA_v10001682mg [Eutrema salsugineum]
 gb|ESQ39388.1| hypothetical protein EUTSA_v10001682mg [Eutrema salsugineum]
Length=127

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 87/132 (66%), Gaps = 12/132 (9%)
 Frame = -3

Query  595  TTTSPGILANSPKAAAQTTKFTTC---LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSS  425
            T  + G+   +P+A  +     +    LN PW+   +        RM +V+P+ A  +  
Sbjct  3    TIAASGLNVATPRAVVRPAARLSAPVRLNYPWRFGSMN-------RMVMVKPIKATSEGG  55

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEFCKD  251
            +S+KV  S++ A+E CA DP SGECVAAWDEVEELSAAASHARDKKK   S+PLEE+C D
Sbjct  56   ISDKVEKSIQEAKETCADDPVSGECVAAWDEVEELSAAASHARDKKKAGGSDPLEEYCSD  115

Query  250  NPESEECRTYDN  215
            NPE++ECRTYDN
Sbjct  116  NPETDECRTYDN  127



>ref|XP_010544968.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Tarenaya 
hassleriana]
Length=130

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 91/138 (66%), Gaps = 10/138 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I+  N+ T  P ++AN    A +    +  L+ PWK   +  G  R G   V +   
Sbjct  1    MATISSFNVAT--PRVVANGSTQARRAGPVS--LSYPWK---MGTGTTRMGSGRVRQVRA  53

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            AAPD  +SEKV  S+K AEE C+ DP SGECVAAWDEVEELSAAASHARDK+K   ++PL
Sbjct  54   AAPDR-ISEKVEKSIKEAEETCSDDPASGECVAAWDEVEELSAAASHARDKQKAGGNDPL  112

Query  268  EEFCKDNPESEECRTYDN  215
            E +CKDNPE++ECRTYDN
Sbjct  113  ENYCKDNPEADECRTYDN  130



>ref|XP_010468958.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Camelina 
sativa]
Length=131

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 7/104 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM   RPV A P+  +S+ V  S+K+A++ CA DP SGECVA
Sbjct  32   LNNPWNLGSRTTS-----RMVRFRPVKAGPEKGISDVVEKSIKDAQKTCADDPVSGECVA  86

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKK   S+PLEE+CKDNPE+ ECRTYD
Sbjct  87   AWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYD  130



>ref|XP_010413280.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Camelina 
sativa]
Length=131

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 75/104 (72%), Gaps = 7/104 (7%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW     T       RM   RPV AAP+  +S+ V  S+K+A++ CA DP SGECVA
Sbjct  32   LNNPWNLGSRTTS-----RMVRFRPVKAAPEKGISDVVEKSIKDAQDTCADDPVSGECVA  86

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYD  218
            AWDEVEELSAAASHARDKKK   S+PLEE+CK+NPE+ ECRTYD
Sbjct  87   AWDEVEELSAAASHARDKKKADGSDPLEEYCKENPETNECRTYD  130



>ref|XP_010523926.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Tarenaya 
hassleriana]
Length=127

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IA +NL T  P ++AN+   A         LN PW+    +       R+   R V 
Sbjct  1    MATIASLNLAT--PRVVANNTTRARLAGPVR--LNYPWRSGSGST------RLVEARRVR  50

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            AAPD  +SEKV  S++ A+E CA DP SGECVAAWDEVEELSAAASHARDK+K   ++PL
Sbjct  51   AAPDR-ISEKVEKSIEEAKETCADDPKSGECVAAWDEVEELSAAASHARDKQKAGGNDPL  109

Query  268  EEFCKDNPESEECRTYDN  215
            E +CKDNPE++ECRTYDN
Sbjct  110  ENYCKDNPETDECRTYDN  127



>ref|XP_009784434.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Nicotiana 
sylvestris]
 emb|CAA96569.1| CP12 [Nicotiana tabacum]
 gb|AAK49535.2| chloroplast protein 12 [Nicotiana tabacum]
Length=132

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 103/140 (74%), Gaps = 12/140 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA---NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            M  IAGV++TT  P IL+   +SPK   QT KF + LN+PWK + +    F  G++  ++
Sbjct  1    MASIAGVSITT--PRILSKTSDSPKV--QTLKFQS-LNKPWKNSSLVQ--FGHGKL-YLK  52

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD-SN  275
             + A PD+ LS+ VA+SVK AEEACA +P SGEC AAWD VEE SAAASHARDKKK+ S+
Sbjct  53   AISATPDNKLSDLVAESVKEAEEACAENPVSGECAAAWDVVEEASAAASHARDKKKESSD  112

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CKDNPE++ECRTYDN
Sbjct  113  PLENYCKDNPETDECRTYDN  132



>ref|NP_001049890.1| Os03g0306800 [Oryza sativa Japonica Group]
 gb|ABF95532.1| CP12, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11804.1| Os03g0306800 [Oryza sativa Japonica Group]
 gb|EAZ26657.1| hypothetical protein OsJ_10560 [Oryza sativa Japonica Group]
 dbj|BAG96228.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -3

Query  472  GRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARD  293
            GR+ VV    +     L++KV++S+K AEE CAGDP  GEC AAWDEVEELSAAASHARD
Sbjct  46   GRLAVVVAAGSPTPPELAQKVSESIKQAEETCAGDPEGGECAAAWDEVEELSAAASHARD  105

Query  292  KKKDSNPLEEFCKDNPESEECRTYDN  215
            +KKDS+PLEE+CKDNPE++ECRTY++
Sbjct  106  RKKDSDPLEEYCKDNPETDECRTYED  131



>gb|EAY89700.1| hypothetical protein OsI_11237 [Oryza sativa Indica Group]
Length=131

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -3

Query  472  GRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARD  293
            GR+ VV    +     L++KV++S+K AEE CAGDP  GEC AAWDEVEELSAAASHARD
Sbjct  46   GRLAVVVAAGSPTPPELAQKVSESIKQAEETCAGDPEGGECAAAWDEVEELSAAASHARD  105

Query  292  KKKDSNPLEEFCKDNPESEECRTYDN  215
            +KKDS+PLEE+CKDNPE++ECRTY++
Sbjct  106  RKKDSDPLEEYCKDNPETDECRTYED  131



>gb|ABS17660.1| chloroplast protein 12, partial [Arnebia euchroma]
Length=86

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = -3

Query  475  PGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHAR  296
            PGRMCV RPV AA    LSEKVA+S+K+AEE C+ DP SGEC AAWDEVEELSAAASHA 
Sbjct  2    PGRMCV-RPV-AAVQEGLSEKVAESIKSAEETCSDDPVSGECAAAWDEVEELSAAASHAG  59

Query  295  DKKKDSNPLEEFCKDNPESEECRTYDN  215
            DK K+S+PLE  CKDN ++EECRTYD+
Sbjct  60   DKMKESDPLETLCKDNMDTEECRTYDD  86



>ref|XP_008781107.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Phoenix 
dactylifera]
Length=130

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 93/139 (67%), Gaps = 19/139 (14%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTTCLN---RPWKRAGVTAGLFRP-GRMCVVRPV  446
            +AGV+L+TT            A+ +K    L+    PW      AG   P GR  V+  V
Sbjct  5    LAGVSLSTTKVA------SKKAELSKLQQPLHGRILPW-----AAGHRTPIGRRMVL--V  51

Query  445  CAAPDS--SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
             ++P +   +SEKV+DS+K AEEAC G+  SGEC AAWDEVEELSAAASHARDK KDS+P
Sbjct  52   ASSPSTPPGISEKVSDSIKKAEEACEGNEVSGECAAAWDEVEELSAAASHARDKLKDSDP  111

Query  271  LEEFCKDNPESEECRTYDN  215
            LE++CKDNPE+EECRTY++
Sbjct  112  LEDYCKDNPETEECRTYED  130



>gb|EPS59920.1| hypothetical protein M569_14886, partial [Genlisea aurea]
Length=104

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 75/103 (73%), Gaps = 5/103 (5%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PW+R+       R      V  V AAPD  LS+KV +S+KNA+E CA DP SGEC A
Sbjct  7    LNTPWRRSSFRGRRIRSD----VVVVAAAPDR-LSDKVEESIKNAQETCADDPVSGECAA  61

Query  343  AWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAA HAR+KK +++PLE +CKDNPE +ECRTYDN
Sbjct  62   AWDEVEELSAAAGHAREKKLEADPLENYCKDNPEVDECRTYDN  104



>ref|XP_010038287.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50111.1| hypothetical protein EUGRSUZ_K03545 [Eucalyptus grandis]
Length=127

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 9/136 (7%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I+ ++L+T  P  +  S +    +   +  LN PW+R+   A      RM VV    
Sbjct  1    MATISSISLST--PRAVPKSAEPQKLSASASPQLNYPWRRSCQLAAR---RRMVVVS---  52

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            +APD  + +KVA+S+K AEEAC+ +P SGECVAAWDEVEELSA ASH RDKK  S+PLE 
Sbjct  53   SAPDK-IEDKVAESIKGAEEACSDNPVSGECVAAWDEVEELSATASHLRDKKAASDPLEA  111

Query  262  FCKDNPESEECRTYDN  215
            +CKDNPE+ ECRTY++
Sbjct  112  YCKDNPETAECRTYED  127



>ref|XP_010507892.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=124

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK       L    RM VV+   A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWK-------LGSMNRMVVVK---ATSEGGISDKVEKSIQEAKETCADDPVSGECVA  79

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  80   AWDEVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  124



>ref|NP_566100.2| stroma protein CP12-1 [Arabidopsis thaliana]
 sp|O22914.1|CP121_ARATH RecName: Full=Calvin cycle protein CP12-1, chloroplastic; AltName: 
Full=CP12 domain-containing protein 1; AltName: Full=Chloroplast 
protein 12-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL32917.1| putative chloroplast protein CP12 [Arabidopsis thaliana]
 gb|AAM47914.1| putative chloroplast protein CP12 [Arabidopsis thaliana]
 gb|AEC10836.1| CP12 domain-containing protein 1 [Arabidopsis thaliana]
Length=124

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK   +        RM VV+   A  +  +SEKV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWKFGSMK-------RMVVVK---ATSEGEISEKVEKSIQEAKETCADDPVSGECVA  79

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  80   AWDEVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  124



>ref|XP_010497708.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=125

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 11/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK       L    RM VV  V A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWK-------LGSMNRMVVV--VKATSEGGISDKVEKSIQEAKETCADDPVSGECVA  80

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  81   AWDEVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  125



>ref|XP_010506777.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=125

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 75/105 (71%), Gaps = 11/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK       L    RM VV  V A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWK-------LGSMNRMVVV--VKATSEGGISDKVEKSIQEAKETCADDPVSGECVA  80

Query  343  AWDEVEELSAAASHARDKKKD--SNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  81   AWDEVEELSAAASHARDKKKAGVSDPLEEYCSDNPETDECRTYDN  125



>ref|XP_010069841.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW58333.1| hypothetical protein EUGRSUZ_H01016 [Eucalyptus grandis]
Length=122

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  457  VRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDS  278
             R V AA    + EKVA+S+K AEE C+ +P SGEC AAWDEVEELSAAASHARD+KK+S
Sbjct  42   TRLVAAAAPEQIEEKVAESIKEAEETCSENPVSGECAAAWDEVEELSAAASHARDRKKES  101

Query  277  NPLEEFCKDNPESEECRTYDN  215
            +PLE FCKDNPE++ECRTYDN
Sbjct  102  DPLESFCKDNPETDECRTYDN  122



>ref|XP_010413104.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=112

 Score =   120 bits (300),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK       L    RM VV+   A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  18   LNYPWK-------LGSMNRMVVVK---ATSEGGISDKVEKSIQEAKETCADDPVSGECVA  67

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  68   AWDEVEELSAAASHARDKKKAGGSDPLEEYCTDNPETDECRTYDN  112



>ref|XP_002880299.1| cp12 domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56558.1| cp12 domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=124

 Score =   120 bits (301),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK   +        RM VV+   A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWKFGSMK-------RMVVVK---ATSEGGISDKVEKSIQEAKETCADDPVSGECVA  79

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  80   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  124



>ref|XP_010413103.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic, partial 
[Camelina sativa]
Length=103

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK       L    RM VV+   A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  9    LNYPWK-------LGSMNRMVVVK---ATSEGGISDKVEKSIQEAKETCADDPVSGECVA  58

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  59   AWDEVEELSAAASHARDKKKAGGSDPLEEYCTDNPETDECRTYDN  103



>ref|XP_003558084.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Brachypodium 
distachyon]
Length=126

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -3

Query  472  GRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARD  293
            GR  V     A+    L++KV +S+K AEE CAGDP  GECVAAWDEVEELSAAASHARD
Sbjct  41   GRRLVAVAGSASTPPELAQKVTESIKQAEETCAGDPEGGECVAAWDEVEELSAAASHARD  100

Query  292  KKKDSNPLEEFCKDNPESEECRTYDN  215
            ++KDS+PLEE+CK++PES+ECRTY++
Sbjct  101  RQKDSDPLEEYCKESPESDECRTYED  126



>ref|XP_009616215.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=132

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 8/138 (6%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANS-PKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            M  IAGV++T  +P I A +   +  Q  KF  CLN+PWK +  ++  F  G++  ++ +
Sbjct  1    MASIAGVSIT--NPRIFAKTCDSSKVQALKFP-CLNKPWKNS--SSVQFGHGKL-YLKTI  54

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD-SNPL  269
             A PD+ LS+ VADSVK AEEACA +P SGEC AAWD VEE SAAASHARDKKK+ S+PL
Sbjct  55   GATPDNKLSDLVADSVKEAEEACAENPVSGECAAAWDVVEEASAAASHARDKKKESSDPL  114

Query  268  EEFCKDNPESEECRTYDN  215
            E +CKDNPE++ECRTYDN
Sbjct  115  ENYCKDNPETDECRTYDN  132



>ref|XP_006295238.1| hypothetical protein CARUB_v10024325mg [Capsella rubella]
 gb|EOA28136.1| hypothetical protein CARUB_v10024325mg [Capsella rubella]
Length=124

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 85/138 (62%), Gaps = 16/138 (12%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IA   L+  +P ++       +   +    LN PW+   +        RM VV    
Sbjct  1    MTTIAAAGLSVATPRVVVLPTARVSAPVR----LNYPWRFGSM-------NRMVVVN---  46

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD--SNPL  269
            A  +  +S+KV  S++ A+E CA DP SGECVAAWDEVEELSAAASHARDKKK   S+PL
Sbjct  47   ATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDEVEELSAAASHARDKKKAGVSDPL  106

Query  268  EEFCKDNPESEECRTYDN  215
            EE+C DNPE++ECRTYDN
Sbjct  107  EEYCNDNPETDECRTYDN  124



>ref|XP_010518439.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=124

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK       L    R+ VV+   A  +  +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWK-------LGSMNRLVVVK---ATSEGGISDKVEKSIQEAKETCADDPVSGECVA  79

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  80   AWDEVEELSAAASHARDKKKAGGSDPLEEYCTDNPETDECRTYDN  124



>ref|XP_003535935.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
Length=129

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 94/141 (67%), Gaps = 17/141 (12%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPG-ILANS----PKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCV  458
            MV IAG  ++ +SP  + AN+        AQ  +F   L+RP ++         PG +  
Sbjct  1    MVTIAG-GVSLSSPSRVFANAKGIDSAQKAQAVRFPA-LSRPIQK--------WPG-LVK  49

Query  457  VRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDS  278
             RPV A P+  +SEKV +S+K+AEEAC+G     EC AAWDEVEELSAAASHAR+K+K S
Sbjct  50   TRPVRATPEK-ISEKVEESIKSAEEACSGGGGDAECAAAWDEVEELSAAASHAREKQKQS  108

Query  277  NPLEEFCKDNPESEECRTYDN  215
            +PLE +CKDNPE++ECRTYDN
Sbjct  109  DPLENYCKDNPETDECRTYDN  129



>dbj|BAJ85428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 90/139 (65%), Gaps = 12/139 (9%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  I  +    T P     +P++ AQ +   T  +RP   +     +   GR  V   V 
Sbjct  1    MATITTMAFMATFP-----APRSVAQPS--ATLPSRPSVVSFAARAMRAHGRRLVA--VA  51

Query  442  AAPDS--SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD-SNP  272
             +P +   L++KV +S+K AEE CAGDP  GECVAAWDEVEELSAAASHARD+KK+ S+P
Sbjct  52   GSPSTPPELAQKVTESIKQAEETCAGDPVGGECVAAWDEVEELSAAASHARDRKKEHSDP  111

Query  271  LEEFCKDNPESEECRTYDN  215
            LEEFC+DNPE++ECRTYD+
Sbjct  112  LEEFCEDNPETDECRTYDS  130



>ref|XP_010921497.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Elaeis 
guineensis]
Length=128

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 89/135 (66%), Gaps = 14/135 (10%)
 Frame = -3

Query  598  LTTTSPGILANSPKAA---AQTTKFTTCLNR--PWKRAGVTAGLFRP-GRMCVVRPVCAA  437
            + TT  G+  ++PK A   A+  K      R  PW      AG   P GR  V+  V ++
Sbjct  1    MATTLAGVSLSTPKVASKKAELPKLQPLHGRILPW-----AAGHRTPMGRRVVL--VASS  53

Query  436  PDS-SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            P    +SEKV++S+K AEEAC  D  SGEC AAWDEVEELSAAASHARDK KDS+PLE +
Sbjct  54   PTPPRISEKVSESIKKAEEACEDDAASGECAAAWDEVEELSAAASHARDKLKDSDPLESY  113

Query  259  CKDNPESEECRTYDN  215
            CKDNPE+EECRTY++
Sbjct  114  CKDNPETEECRTYED  128



>pdb|2LJ9|A Chain A, Partial 3d Structure Of The C-Terminal Part Of The Free 
Arabidopsis Thaliana Cp12-2 In Its Oxidized Form
Length=99

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -3

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            AAP+  +S+ V  S+K A+E CAGDP SGECVAAWDEVEELSAAASHARDKKK   S+PL
Sbjct  22   AAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDPL  81

Query  268  EEFCKDNPESEECRTYDN  215
            EE+CKDNPE+ ECRTYDN
Sbjct  82   EEYCKDNPETNECRTYDN  99



>ref|XP_006651310.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Oryza 
brachyantha]
Length=108

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -3

Query  478  RPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHA  299
            RP  M   R    +    L++KV++S+K AEE CA DP  GEC AAWDEVEELSAAASHA
Sbjct  21   RPLAMVPARQNVVSTPPELAQKVSESIKQAEETCADDPEGGECAAAWDEVEELSAAASHA  80

Query  298  RDKKKDSNPLEEFCKDNPESEECRTYDN  215
            RD+KKDS+PLEE+CKDNPE++ECRTY++
Sbjct  81   RDRKKDSDPLEEYCKDNPETDECRTYED  108



>pdb|3QV1|G Chain G, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|H Chain H, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|I Chain I, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|I Chain I, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|J Chain J, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|K Chain K, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|L Chain L, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|M Chain M, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|N Chain N, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=82

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 66/78 (85%), Gaps = 2/78 (3%)
 Frame = -3

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            AAP+  +S+ V  S+K A+E CAGDP SGECVAAWDEVEELSAAASHARDKKK   S+PL
Sbjct  5    AAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDPL  64

Query  268  EEFCKDNPESEECRTYDN  215
            EE+CKDNPE+ ECRTYDN
Sbjct  65   EEYCKDNPETNECRTYDN  82



>ref|XP_003518788.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
 gb|KHN08637.1| Calvin cycle protein CP12 [Glycine soja]
Length=128

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 89/140 (64%), Gaps = 16/140 (11%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGR----MCVV  455
            M  IA   ++ +SP  +      +AQ  +    ++ P         LFRP +    +   
Sbjct  1    MATIATSGVSLSSPSTVLAMKSDSAQKAQ---AMSFP--------ALFRPIQKWPGLVKA  49

Query  454  RPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSN  275
            RPV A P+  +SEKV +S+K+AEEAC+G     EC AAWDEVEELSAAASHAR+K+K S+
Sbjct  50   RPVWATPEK-ISEKVEESIKSAEEACSGAGGDAECAAAWDEVEELSAAASHAREKQKQSD  108

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE +CKDNPE++ECRTYDN
Sbjct  109  PLENYCKDNPETDECRTYDN  128



>ref|XP_009382502.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=134

 Score =   118 bits (296),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 86/135 (64%), Gaps = 12/135 (9%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQT-TKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAA  437
            + GV+L+T     +   P    QT  +    L+R  +R        R   + V       
Sbjct  10   VCGVSLSTRRAVFVKAEPLRPRQTHARLLPLLDRGVRR--------RRSTVLVASAPSTP  61

Query  436  PDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEF  260
            PD  +SEKV++S+K AEEACAGD  +GEC AAWDEVEELSAAASHARDK K DS+PLE +
Sbjct  62   PD--ISEKVSESIKKAEEACAGDAVAGECAAAWDEVEELSAAASHARDKLKTDSDPLENY  119

Query  259  CKDNPESEECRTYDN  215
            CKDNPE++ECRTYDN
Sbjct  120  CKDNPETDECRTYDN  134



>gb|AAK97687.1| At2g47400/T8I13.24 [Arabidopsis thaliana]
 gb|AAN28735.1| At2g47400/T8I13.24 [Arabidopsis thaliana]
Length=124

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 74/105 (70%), Gaps = 12/105 (11%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK   +        RM VV+   A  +  +SEKV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWKFGSMK-------RMVVVK---ATSEGEISEKVEKSIQEAKETCADDPVSGECVA  79

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++E RTYDN
Sbjct  80   AWDEVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDEYRTYDN  124



>emb|CAJ41166.1| chloroplast protein 12 precursor [Cynara cardunculus var. scolymus]
Length=149

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 75/93 (81%), Gaps = 5/93 (5%)
 Frame = -3

Query  493  TAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSA  314
            T+   R GRM V     AAP+  LSEK+A S+++A+E+CA D  SGECVAAWDEVEELSA
Sbjct  6    TSTRMRSGRMYVR----AAPEG-LSEKIASSIESAKESCAEDLASGECVAAWDEVEELSA  60

Query  313  AASHARDKKKDSNPLEEFCKDNPESEECRTYDN  215
            A+SHARDK KD++PLE +CKDNPE++ECRTY++
Sbjct  61   ASSHARDKAKDTDPLETYCKDNPETDECRTYED  93



>dbj|BAJ90516.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=113

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 65/71 (92%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD-SNPLEEFCKDN  248
            L++KV +S+K AEE CAGDP  GECVAAWDEVEELSAAASHARD+KK+ S+PLEEFC+DN
Sbjct  43   LAQKVTESIKQAEETCAGDPVGGECVAAWDEVEELSAAASHARDRKKEHSDPLEEFCEDN  102

Query  247  PESEECRTYDN  215
            PE++ECRTYD+
Sbjct  103  PETDECRTYDS  113



>emb|CDY51422.1| BnaA04g26990D [Brassica napus]
Length=124

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 82/137 (60%), Gaps = 15/137 (11%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IA   L   +P +        +   +    LN PWK + +        RM  V  V 
Sbjct  1    MTTIAATGLNVATPRVFVRPVARLSAPVR----LNYPWKFSSM-------NRM--VMSVK  47

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            A  +  +S+KV  S++ A E CA DP SGECVAAWDEVEELSAAASHARDKKK   S+PL
Sbjct  48   ATSEGGISDKVEKSIQEATETCADDPVSGECVAAWDEVEELSAAASHARDKKKAGGSDPL  107

Query  268  EEFCKDNPESEECRTYD  218
            EE+C DNPE++ECRTYD
Sbjct  108  EEYCSDNPETDECRTYD  124



>ref|XP_010679381.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=123

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 85/133 (64%), Gaps = 10/133 (8%)
 Frame = -3

Query  613  IAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAP  434
            +A ++L+ +   +LAN P    +  K    +     R           R+ +VR   AAP
Sbjct  1    MASMSLSMSPKILLANKPSTNFEAPKLCNMVTYVKNRN------IHARRLVMVR---AAP  51

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            D  LS+ V  S+K A+E C+ DP S ECVAAWD VEE+SAAASHARDK K+++PLEE+CK
Sbjct  52   DK-LSDNVEKSIKEAQETCSDDPVSSECVAAWDVVEEVSAAASHARDKAKETDPLEEYCK  110

Query  253  DNPESEECRTYDN  215
            DNPE++EC+TYDN
Sbjct  111  DNPETDECKTYDN  123



>ref|XP_009142539.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Brassica 
rapa]
Length=127

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 72/105 (69%), Gaps = 10/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK        F   +  V+     +    +S+KV  S++ A+E CA DP SGECVA
Sbjct  31   LNYPWK--------FSSTKRMVMSVKATSEGEIISDKVEKSIQEAKETCADDPVSGECVA  82

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  83   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  127



>emb|CDY27491.1| BnaC04g51320D [Brassica napus]
Length=125

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 11/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK + +        RM  V  V A  +  +S+KV  S++ A+E CA D  SGECVA
Sbjct  30   LNYPWKFSSMN-------RM--VMSVKATSEGGISDKVEKSIQEAKETCADDTVSGECVA  80

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  81   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  125



>ref|XP_009118779.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Brassica 
rapa]
Length=124

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 81/137 (59%), Gaps = 15/137 (11%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IA   L   +P +        +   +    LN PWK + +        RM  V  V 
Sbjct  1    MTTIAATGLNVATPRVFVRPVARLSAPVR----LNYPWKFSSM-------NRM--VMSVK  47

Query  442  AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPL  269
            A  +  +S+KV  S++ A E CA DP SGECVAAWDE EELSAAASHARDKKK   S+PL
Sbjct  48   ATAEGGISDKVEKSIQEATETCADDPVSGECVAAWDEAEELSAAASHARDKKKAGGSDPL  107

Query  268  EEFCKDNPESEECRTYD  218
            EE+C DNPE++ECRTYD
Sbjct  108  EEYCSDNPETDECRTYD  124



>ref|XP_006349189.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Solanum 
tuberosum]
Length=124

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 92/137 (67%), Gaps = 16/137 (12%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILA-NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPV  446
            M  IAGV+LT  SP  LA NS    ++  KF  CLN PWK++    GL           V
Sbjct  1    MATIAGVSLT--SPKFLAKNSNSPNSKPFKFP-CLNNPWKKSSTKFGL-----------V  46

Query  445  CAA-PDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPL  269
            CAA PD+ LS+ VADSVK AEEAC  +P SGEC AAWD VEE SAAASHARDKKK  + L
Sbjct  47   CAATPDNKLSDLVADSVKGAEEACNENPASGECAAAWDVVEEASAAASHARDKKKQEDVL  106

Query  268  EEFCKDNPESEECRTYD  218
            E +CK+NPE++ECRTYD
Sbjct  107  ENYCKENPETDECRTYD  123



>emb|CDX80101.1| BnaA05g00550D [Brassica napus]
Length=126

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 10/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK + V        RM V+     +    +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWKFSSVK-------RM-VMSVKATSEGEIISDKVEKSIQEAKETCADDPVSGECVA  81

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  82   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|XP_004984626.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Setaria 
italica]
Length=130

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            LS KV++S+K+A+EACA DP SGEC AAWDEVEELSAAASHARD++K ++PLEE+CK+NP
Sbjct  61   LSNKVSESIKHAQEACADDPVSGECAAAWDEVEELSAAASHARDRQKGADPLEEYCKENP  120

Query  244  ESEECRTYDN  215
            E++ECRTY++
Sbjct  121  ETDECRTYED  130



>ref|XP_007145148.1| hypothetical protein PHAVU_007G214200g [Phaseolus vulgaris]
 gb|ESW17142.1| hypothetical protein PHAVU_007G214200g [Phaseolus vulgaris]
Length=131

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 89/143 (62%), Gaps = 19/143 (13%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRP-----GRMCV  458
            M  IAG        G+  +SP       K +   + P K   +   LFRP     G + V
Sbjct  1    MAAIAG--------GVSLSSPTRVFANAKGS---DTPLKAQPIRFPLFRPIQKWPGFVGV  49

Query  457  --VRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK  284
              VRP+ A P+  LSEKV +S+K+AEE C+G     EC AAWDEVEELSAAASHAR+K++
Sbjct  50   GKVRPIHATPEK-LSEKVEESIKSAEETCSGGGADAECAAAWDEVEELSAAASHAREKQQ  108

Query  283  DSNPLEEFCKDNPESEECRTYDN  215
             S+PLE +CK+NPE++ECRTYDN
Sbjct  109  QSDPLENYCKENPETDECRTYDN  131



>ref|XP_009133812.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic isoform 
X1 [Brassica rapa]
 ref|XP_009133813.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic isoform 
X2 [Brassica rapa]
 emb|CDX83329.1| BnaA03g21770D [Brassica napus]
Length=126

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 73/105 (70%), Gaps = 10/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK   +        RM V+     +    +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWKFGSMN-------RM-VMSVKATSEGGMISDKVEKSIQEAKETCADDPVSGECVA  81

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  82   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|XP_006840455.1| hypothetical protein AMTR_s00045p00175560 [Amborella trichopoda]
 gb|ERN02130.1| hypothetical protein AMTR_s00045p00175560 [Amborella trichopoda]
Length=126

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 88/132 (67%), Gaps = 14/132 (11%)
 Frame = -3

Query  607  GVNLTTTSPGILANSPKAAAQTTKFTTCLN-RPWKRAGVTAGLFRPGRMCVVRPVCAAPD  431
            GV+L+TTS   +   PK         T +N + W+      G     RM  +     +P 
Sbjct  8    GVSLSTTSTVAMQERPK-------LHTHVNCQSWR------GGLSMRRMVALVRATPSPS  54

Query  430  SSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
             ++SEK+++S+++A+E C+GD  SGECVAAWDEVEE+SAAAS AR K+K+S+PLE +CKD
Sbjct  55   QNISEKLSESIEHAKEVCSGDAVSGECVAAWDEVEEMSAAASDARLKEKESDPLETYCKD  114

Query  250  NPESEECRTYDN  215
            NPE++ECRTY++
Sbjct  115  NPETKECRTYED  126



>emb|CDY55379.1| BnaC04g51970D [Brassica napus]
Length=126

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 80/127 (63%), Gaps = 13/127 (10%)
 Frame = -3

Query  580  GILANSPKAAAQTTKFTTC---LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKV  410
            G+   +P+A  +T    +    LN PWK        F   +  V+     +    +S KV
Sbjct  8    GLNVATPRAFVRTAARLSAPVRLNYPWK--------FSLVKRMVMSVKATSEGEIISVKV  59

Query  409  ADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESE  236
              S++ A+E CA DP SGECVAAWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++
Sbjct  60   EKSIQEAKETCADDPVSGECVAAWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETD  119

Query  235  ECRTYDN  215
            ECRTYDN
Sbjct  120  ECRTYDN  126



>emb|CDX95723.1| BnaC03g26040D [Brassica napus]
Length=126

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 70/105 (67%), Gaps = 10/105 (10%)
 Frame = -3

Query  523  LNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            LN PWK        F      V      +    +S+KV  S++ A+E CA DP SGECVA
Sbjct  30   LNYPWK--------FGSMNRMVTSVKATSEGGMISDKVEKSIQEAKETCADDPVSGECVA  81

Query  343  AWDEVEELSAAASHARDKKK--DSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDKKK   S+PLEE+C DNPE++ECRTYDN
Sbjct  82   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|XP_008654881.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Zea mays]
 tpg|DAA45009.1| TPA: hypothetical protein ZEAMMB73_901738 [Zea mays]
Length=126

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            L++KV++S+K A+E CA DP SGECVAAWDEVEELSAAASH RD++K ++PLEE+CKDNP
Sbjct  57   LAKKVSESIKQAQETCADDPVSGECVAAWDEVEELSAAASHLRDRQKGADPLEEYCKDNP  116

Query  244  ESEECRTYDN  215
            E++ECRTY++
Sbjct  117  ETDECRTYED  126



>gb|AAV63570.1| auxin-induced putative CP12 domain-containing protein [Arachis 
hypogaea]
Length=73

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            +SEKV  S+K AEEAC  +P S EC AAWDEVEELSAAASHARDKKK+S+PLE +CKDNP
Sbjct  4    ISEKVEKSIKEAEEACTDNPASNECAAAWDEVEELSAAASHARDKKKESDPLENYCKDNP  63

Query  244  ESEECRTYDN  215
            E++ECRTYDN
Sbjct  64   ETDECRTYDN  73



>ref|XP_008351460.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=129

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -3

Query  466  MCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKK  287
            M +VRPV AAP   LSEKVA+S+K  EE C+ DP +GECV AWD+VEELSAAASH R  +
Sbjct  47   MTLVRPVSAAP-VKLSEKVAESIKIVEEKCSDDPENGECVVAWDKVEELSAAASHKRANE  105

Query  286  KDSNPLEEFCKDNPESEECRTYDN  215
            + S+PLE  CKDNPE++ECRTY+N
Sbjct  106  ESSDPLETLCKDNPETDECRTYNN  129



>ref|XP_004229393.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Solanum 
lycopersicum]
Length=124

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 88/137 (64%), Gaps = 14/137 (10%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVC  443
            M  IAGV+LT  SP  LA +  +         CLN PWK++    GL           VC
Sbjct  1    MATIAGVSLT--SPKFLAKNSNSPNFKPFKLPCLNNPWKKSSTKFGL-----------VC  47

Query  442  -AAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
             AAPD+ LS+ VADSVK AEE C  +P SGEC AAWD VEE SAAASHARDKKK  + LE
Sbjct  48   SAAPDNKLSDLVADSVKGAEETCNENPASGECAAAWDVVEEASAAASHARDKKKQEDVLE  107

Query  265  EFCKDNPESEECRTYDN  215
             +CK+NPE++ECRTYDN
Sbjct  108  NYCKENPETDECRTYDN  124



>ref|XP_002467982.1| hypothetical protein SORBIDRAFT_01g037510 [Sorghum bicolor]
 gb|EER94980.1| hypothetical protein SORBIDRAFT_01g037510 [Sorghum bicolor]
Length=130

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 82/130 (63%), Gaps = 10/130 (8%)
 Frame = -3

Query  574  LANSPKAAAQTTKFT---TCLNRPWK---RAGVTAGLFRPGR----MCVVRPVCAAPDSS  425
            +A S  A A    F+   + L RP +   R  V +    P R    +  V     A    
Sbjct  1    MATSVSAVAALAVFSAPRSLLQRPAQLPSRQNVVSFFVGPARAHRRLVAVAASSPATPPD  60

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            L+ KV++S+K A+E CA DP S ECVAAWDEVEELSAAASHARD++K  +PLEE+CKDNP
Sbjct  61   LANKVSESIKQAKETCADDPVSAECVAAWDEVEELSAAASHARDRQKGVDPLEEYCKDNP  120

Query  244  ESEECRTYDN  215
            E++ECRTY++
Sbjct  121  ETDECRTYED  130



>ref|XP_009411634.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=128

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFCKDN  248
            +S+KV++S+K AE+AC+GD  SGEC AAWDEVEELSAAASHARDK K +S+PLE +CKDN
Sbjct  58   ISDKVSESIKKAEDACSGDAVSGECAAAWDEVEELSAAASHARDKLKANSDPLENYCKDN  117

Query  247  PESEECRTYDN  215
            PE++ECRTYDN
Sbjct  118  PETDECRTYDN  128



>ref|XP_009403696.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=129

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            +SEKV +S+K AEE CA D  SGEC AAWDEVEELSAAASHARDK K S+PLEE+CKDNP
Sbjct  60   ISEKVVESIKKAEETCAEDAASGECAAAWDEVEELSAAASHARDKLKTSDPLEEYCKDNP  119

Query  244  ESEECRTYDN  215
            E++ECRTY++
Sbjct  120  ETDECRTYED  129



>dbj|BAK03023.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04975.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=129

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            S +S+K+++S+K A+E C+ D  SGEC AAWDEVEELSAAASHARDK KDS+PLE +CK+
Sbjct  58   SGISDKMSESIKEAQETCSEDAASGECAAAWDEVEELSAAASHARDKLKDSDPLENYCKE  117

Query  250  NPESEECRTYDN  215
            NPE++ECRTYD+
Sbjct  118  NPETDECRTYDS  129



>gb|EAY73672.1| hypothetical protein OsI_01556 [Oryza sativa Indica Group]
Length=124

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = -3

Query  598  LTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGR--MCVVRPVCAAPDSS  425
            + +T   +  ++P AAA +      L RP   AG      R GR     VR    A    
Sbjct  1    MASTLTNVGLSTPAAAASS------LVRPVTGAGRVV-FPRVGRGGFAAVRASGPATPPD  53

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFCKDN  248
            +S+K+++S+  A+EACA D  SGEC AAWDEVEELSAAASHARDK K+ S+PLE +CKDN
Sbjct  54   ISDKMSESIDKAKEACAEDTASGECAAAWDEVEELSAAASHARDKLKETSDPLEAYCKDN  113

Query  247  PESEECRTYDN  215
            PE++ECRTYDN
Sbjct  114  PETDECRTYDN  124



>ref|XP_009383546.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=129

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 88/140 (63%), Gaps = 20/140 (14%)
 Frame = -3

Query  616  VIAGVNLTTTSPGILANS----PKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRP  449
            V+AG++++   P +L ++    PK     T+       PW  +G      R G       
Sbjct  4    VLAGISISI--PRVLVSTKAELPKPPLSRTRLP-----PWT-SGHRVNSRRAGL------  49

Query  448  VCAAPDS--SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSN  275
            V +AP    ++SEKVA+S+KNAE  CA D  SGEC AAWDEVEELSAAASHARDK K  +
Sbjct  50   VASAPSMPPNISEKVAESIKNAEATCAEDAASGECAAAWDEVEELSAAASHARDKLKVDD  109

Query  274  PLEEFCKDNPESEECRTYDN  215
            PLE FCKD+P++EECRTY++
Sbjct  110  PLESFCKDSPDNEECRTYED  129



>ref|XP_010230820.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Brachypodium 
distachyon]
Length=127

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            +S+K+++S+K A+EAC+ D  SGEC AAWDEVEELSAAASHARDK K+S+PLE +CK+NP
Sbjct  58   ISDKMSESIKEAQEACSEDSASGECAAAWDEVEELSAAASHARDKLKESDPLENYCKENP  117

Query  244  ESEECRTYDN  215
            E++ECRTYD+
Sbjct  118  ETDECRTYDS  127



>ref|NP_001042830.1| Os01g0303000 [Oryza sativa Japonica Group]
 dbj|BAB19776.1| P0035H10.18 [Oryza sativa Japonica Group]
 dbj|BAB93161.1| putative CP12 [Oryza sativa Japonica Group]
 dbj|BAF04744.1| Os01g0303000 [Oryza sativa Japonica Group]
 gb|EAZ11584.1| hypothetical protein OsJ_01448 [Oryza sativa Japonica Group]
 dbj|BAG95340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86845.1| unnamed protein product [Oryza sativa Japonica Group]
Length=124

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 84/131 (64%), Gaps = 10/131 (8%)
 Frame = -3

Query  598  LTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGR--MCVVRPVCAAPDSS  425
            + +T   +  ++P AAA +      L RP   AG      R GR     VR    A    
Sbjct  1    MASTLTNVGLSTPAAAASS------LVRPVAGAGRVV-FPRVGRGGFAAVRASGPATPPD  53

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFCKDN  248
            +S+K+++S+  A+EACA D  SGEC AAWDEVEELSAAASHARDK K+ S+PLE +CKDN
Sbjct  54   ISDKMSESIDKAKEACAEDTASGECAAAWDEVEELSAAASHARDKLKETSDPLEAYCKDN  113

Query  247  PESEECRTYDN  215
            PE++ECRTYDN
Sbjct  114  PETDECRTYDN  124



>ref|XP_004967659.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Setaria 
italica]
Length=125

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 4/104 (4%)
 Frame = -3

Query  514  PWKRAGVTAGLFRPG---RMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVA  344
            P +R      ++ P    R   VR    A    +S++V++S+K AE+ C G+  SGEC A
Sbjct  22   PMRRKAAAGRVWFPAAARRGFAVRSSGPATPPGISDQVSESIKKAEQTCEGEEGSGECAA  81

Query  343  AWDEVEELSAAASHARDK-KKDSNPLEEFCKDNPESEECRTYDN  215
            AWDEVEELSAAASHARDK K+D++PLE++CK+NPE++ECRTYDN
Sbjct  82   AWDEVEELSAAASHARDKLKEDNDPLEKYCKENPETDECRTYDN  125



>ref|XP_002976377.1| hypothetical protein SELMODRAFT_105078 [Selaginella moellendorffii]
 ref|XP_002987219.1| hypothetical protein SELMODRAFT_125533 [Selaginella moellendorffii]
 gb|EFJ11795.1| hypothetical protein SELMODRAFT_125533 [Selaginella moellendorffii]
 gb|EFJ22637.1| hypothetical protein SELMODRAFT_105078 [Selaginella moellendorffii]
Length=80

 Score =   103 bits (256),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 59/77 (77%), Gaps = 3/77 (4%)
 Frame = -3

Query  445  CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLE  266
            CA+P   L  KV +S+K AEE CA +P S ECV AWDEVEE+SAAASH RDK K  +PLE
Sbjct  7    CASP---LEGKVEESIKQAEEVCAENPASAECVVAWDEVEEVSAAASHQRDKDKGKDPLE  63

Query  265  EFCKDNPESEECRTYDN  215
             FCKDNPE++ECR YDN
Sbjct  64   AFCKDNPETDECRVYDN  80



>gb|EMT01482.1| hypothetical protein F775_29657 [Aegilops tauschii]
Length=66

 Score =   102 bits (255),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = -3

Query  412  VADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEE  233
            ++DS+K A+E C+ D  SGEC AAWDEVEELSAAASHARDK KDS+PLE +CK+NPE++E
Sbjct  1    MSDSIKEAQETCSEDAASGECAAAWDEVEELSAAASHARDKLKDSDPLENYCKENPETDE  60

Query  232  CRTYDN  215
            CRTYD+
Sbjct  61   CRTYDS  66



>ref|XP_006644110.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Oryza 
brachyantha]
Length=124

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 64/71 (90%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFCKDN  248
            +S+K+++S+  A+EACA D  SGEC AAWDEVEELSAAASHARDK K++S+PLE++CK+N
Sbjct  54   ISDKMSESIDKAKEACAEDNASGECAAAWDEVEELSAAASHARDKLKENSDPLEKYCKEN  113

Query  247  PESEECRTYDN  215
            PE++ECRTYDN
Sbjct  114  PETDECRTYDN  124



>gb|KHN30640.1| Calvin cycle protein CP12 [Glycine soja]
Length=120

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 86/141 (61%), Gaps = 26/141 (18%)
 Frame = -3

Query  622  MVVIAGVNLTTTSPG-ILANS----PKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCV  458
            MV IAG  ++ +SP  + AN+        AQ  +F   L+RP ++         PG +  
Sbjct  1    MVTIAG-GVSLSSPSRVFANAKGIDSAQKAQAVRFPA-LSRPIQK--------WPG-LVK  49

Query  457  VRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDS  278
             RPV A P+  +SEK         EACAG     EC AAWDEVEELSAAASHAR+K+K S
Sbjct  50   TRPVRATPEK-ISEK---------EACAGAGGDAECAAAWDEVEELSAAASHAREKQKQS  99

Query  277  NPLEEFCKDNPESEECRTYDN  215
            +PLE +CKDNPE++ECRTYDN
Sbjct  100  DPLENYCKDNPETDECRTYDN  120



>gb|ACG43906.1| CP12-1 [Zea mays]
 gb|AFW85340.1| CP12-1 [Zea mays]
Length=140

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 11/109 (10%)
 Frame = -3

Query  508  KRAGVTAGLFRP-------GRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTS-GE  353
            +RAG    ++ P       GR+  VR    A    +S+KV++S+K AEE CA D     E
Sbjct  32   RRAGAKRVVWFPAAARRGGGRLVAVRSSGPATPPEISDKVSESIKQAEETCADDQKGDAE  91

Query  352  CVAAWDEVEELSAAASHARDKKKDSN---PLEEFCKDNPESEECRTYDN  215
            C AAWDEVEELSA ASHARD  K++N   PLE++CKDNP+SEECR YDN
Sbjct  92   CAAAWDEVEELSATASHARDSLKETNANDPLEKYCKDNPDSEECRIYDN  140



>ref|XP_008386781.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=114

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 10/119 (8%)
 Frame = -3

Query  631  LAKMVVIAGVNLTTTSPGILANSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVR  452
            +A  + +AGV+L+T    +L+     A +  +    LN P  R+  + G     RM +VR
Sbjct  1    MATSITVAGVSLSTPR-AVLSK----ATEVPRAFHSLNVPTWRSYSSVGR----RMTMVR  51

Query  451  PVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSN  275
            PV AAPD  LSEKVA+S+K+AEE C+ DP SGECVAAWDEVEELSAA SH RD +K S+
Sbjct  52   PVSAAPDK-LSEKVAESIKSAEETCSDDPASGECVAAWDEVEELSAAVSHKRDNEKSSD  109



>ref|NP_001148040.1| LOC100281649 [Zea mays]
 gb|ACG29564.1| CP12-1 [Zea mays]
Length=144

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = -3

Query  472  GRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTS-GECVAAWDEVEELSAAASHAR  296
            GR+  VR    A    +S+KV++S+K AEE CA D     EC AAWDEVEELSA ASHAR
Sbjct  55   GRLVAVRSSGPATPPEISDKVSESIKQAEETCADDQKGDAECAAAWDEVEELSATASHAR  114

Query  295  DKKKDSN---PLEEFCKDNPESEECRTYDN  215
            D  K++N   PLE++CKDNP+SEECR YDN
Sbjct  115  DSLKETNANDPLEKYCKDNPDSEECRIYDN  144



>gb|ABK21319.1| unknown [Picea sitchensis]
 gb|ABK22351.1| unknown [Picea sitchensis]
 gb|ABK23864.1| unknown [Picea sitchensis]
 gb|ABK25624.1| unknown [Picea sitchensis]
 gb|ACN40458.1| unknown [Picea sitchensis]
Length=141

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -3

Query  427  SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            ++SE V +S+K A E CA D TSGEC A+WDEVEELSAA SH R+K K  +PLEEFCKDN
Sbjct  71   NISEVVEESIKKAIETCAEDSTSGECAASWDEVEELSAARSHMREKDKAKDPLEEFCKDN  130

Query  247  PESEECRTYDN  215
            PE++ECRTY++
Sbjct  131  PETDECRTYED  141



>ref|XP_002436694.1| hypothetical protein SORBIDRAFT_10g007180 [Sorghum bicolor]
 gb|EER88061.1| hypothetical protein SORBIDRAFT_10g007180 [Sorghum bicolor]
Length=129

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 74/105 (70%), Gaps = 5/105 (5%)
 Frame = -3

Query  514  PWKRAGVTAGLFRP----GRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECV  347
            P ++A  T  ++ P    G    VR    A  S++S+K+++S+K AEE CA +  + EC 
Sbjct  25   PRRKAAATGRVWFPVARRGGGFAVRSTGPATPSNISDKLSESIKEAEETCADEKGTAECA  84

Query  346  AAWDEVEELSAAASHARDK-KKDSNPLEEFCKDNPESEECRTYDN  215
            AAWD VEE+SAAASHARD  K++S+PLE++CK+NPE++ECR YDN
Sbjct  85   AAWDNVEEISAAASHARDNLKENSDPLEKYCKENPETDECRIYDN  129



>gb|EMS48211.1| hypothetical protein TRIUR3_21408 [Triticum urartu]
Length=85

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = -3

Query  394  NAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYDN  215
             A+E C+ D  SGEC AAWDEVEELSAAASHARDK KDS+PLE +CK+NPE++ECRTYD+
Sbjct  26   QAQETCSEDAASGECAAAWDEVEELSAAASHARDKLKDSDPLENYCKENPETDECRTYDS  85



>ref|XP_002953061.1| hypothetical protein VOLCADRAFT_121134 [Volvox carteri f. nagariensis]
 gb|ABM47308.1| calvin cycle protein CP12 [Volvox carteri f. nagariensis]
 gb|EFJ45983.1| hypothetical protein VOLCADRAFT_121134 [Volvox carteri f. nagariensis]
Length=108

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = -3

Query  529  TCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGEC  350
            T L+RP  R   T    RP R  VVR     P   L +KV D+VK+AEEACA   TS +C
Sbjct  7    TLLSRPQVRPAAT----RPRRAVVVR-ASGQPAVDLGKKVEDAVKDAEEACAKG-TSQDC  60

Query  349  VAAWDEVEELSAAASHARDKKKD---SNPLEEFCKDNPESEECRTYDN  215
              AWD VEELSAAASH +D  K    S+PLE++C+D P+++ECR Y++
Sbjct  61   AVAWDTVEELSAAASHKKDAAKADALSDPLEKYCQDAPDADECRVYED  108



>ref|XP_009389615.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=194

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 61/90 (68%), Gaps = 14/90 (16%)
 Frame = -3

Query  472  GRMCVVR---PVCAAPDS--SLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAA  308
            GR    R   PV ++P +  ++SEKV +S+KNA+E CA D  SGEC AAWDEVEELSAAA
Sbjct  114  GRRASYRRLAPVASSPPTPPNISEKVVESIKNAQETCAEDAASGECAAAWDEVEELSAAA  173

Query  307  SHARDKKKDSNPLEEFCKDNPESEECRTYD  218
            SHARD+ K          DNPE++E RTY+
Sbjct  174  SHARDRLK---------ADNPETDEGRTYE  194


 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNP  272
            +SEKVA+S++NAEE CA D  SGEC AAWDEVEELSAAASHARDK K   P
Sbjct  60   MSEKVAESIRNAEETCAEDAASGECAAAWDEVEELSAAASHARDKLKVGGP  110



>ref|XP_001756905.1| predicted protein [Physcomitrella patens]
 gb|EDQ78136.1| predicted protein [Physcomitrella patens]
Length=70

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 55/70 (79%), Gaps = 1/70 (1%)
 Frame = -3

Query  421  SEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDS-NPLEEFCKDNP  245
            S ++ +++  A++AC  DPTS  C  AWDEVEEL+A A+H RD++K S +PLE++C DNP
Sbjct  1    SAQIPNAIAEAQKACEEDPTSAPCAVAWDEVEELTAEAAHQRDREKTSGDPLEKYCADNP  60

Query  244  ESEECRTYDN  215
            ES+ECRTY++
Sbjct  61   ESDECRTYED  70



>ref|XP_004300084.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=129

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACA-GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L+E +   V  A+E C  GDP + EC  AWDEVEE+S A +  R K KDS+PLE FC+DN
Sbjct  59   LTEMIEKKVLEAKEVCGEGDPITDECKVAWDEVEEVSQAKADLRLKLKDSDPLESFCQDN  118

Query  247  PESEECRTYDN  215
            PE++ECR Y++
Sbjct  119  PETDECRIYED  129



>ref|XP_010266359.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Nelumbo 
nucifera]
Length=144

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   V+ A++ C GD TS EC  AWDEVEE+S A +  R K +  +PLE FC+
Sbjct  72   EKHLTEMIEKKVQEAQQVCEGDQTSDECKVAWDEVEEVSQAKADLRRKLEKQDPLESFCQ  131

Query  253  DNPESEECRTYDN  215
            DNPE++ECR Y++
Sbjct  132  DNPETDECRIYED  144



>ref|XP_006849927.1| hypothetical protein AMTR_s00022p00115740 [Amborella trichopoda]
 gb|ERN11508.1| hypothetical protein AMTR_s00022p00115740 [Amborella trichopoda]
Length=136

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   +  A+E C GD TS EC  AWDEVEE+S A +  R K +  +PLE FC+
Sbjct  64   EQKLTEMIEKKITEAKEVCKGDLTSDECKVAWDEVEEVSQAKADLRRKMEKEDPLESFCQ  123

Query  253  DNPESEECRTYDN  215
            +NPE++ECR YD+
Sbjct  124  ENPETDECRIYDD  136



>ref|XP_001694345.1| small protein associating with GAPDH and PRK [Chlamydomonas reinhardtii]
 sp|A6Q0K5.2|CP12_CHLRE RecName: Full=Calvin cycle protein CP12, chloroplastic; AltName: 
Full=CP12 domain-containing protein; AltName: Full=Chloroplast 
protein 12; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|EDP02778.1| small protein associating with GAPDH and PRK [Chlamydomonas reinhardtii]
Length=107

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 57/89 (64%), Gaps = 5/89 (6%)
 Frame = -3

Query  469  RMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK  290
            R  VV      P   L++KV D+VK AE+ACA   TS +C  AWD VEELSAA SH +D 
Sbjct  20   RRAVVVRASGQPAVDLNKKVQDAVKEAEDACAK-GTSADCAVAWDTVEELSAAVSHKKDA  78

Query  289  KKD----SNPLEEFCKDNPESEECRTYDN  215
             K     ++PLE FCKD P+++ECR Y++
Sbjct  79   VKADVTLTDPLEAFCKDAPDADECRVYED  107



>ref|XP_010088739.1| hypothetical protein L484_016525 [Morus notabilis]
 gb|EXB36920.1| hypothetical protein L484_016525 [Morus notabilis]
Length=90

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   VK A E C GD  S EC  AWDEVEE+S A +  R K +  +PLE FC+
Sbjct  18   EKQLNEMIEKKVKEATEVCGGDEKSAECKVAWDEVEEISQAKADFRLKLQKEDPLESFCQ  77

Query  253  DNPESEECRTYDN  215
            ++PE++ECR YDN
Sbjct  78   EHPETDECRLYDN  90



>gb|ABD37967.1| CP12 [Marchantia polymorpha]
Length=130

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%), Gaps = 5/84 (6%)
 Frame = -3

Query  460  VVRPVCAAPDSS--LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKK  287
            VVR   ++P+S+  L  KVA+S+K A E C G+ TS ECV AWDE EELSAA +  + K 
Sbjct  50   VVRA--SSPNSADDLQAKVAESIKAATEVCKGNETSEECVVAWDETEELSAAYADKKRKA  107

Query  286  KDSNPLEEFCKDNPESEECRTYDN  215
            K ++PLE +C DNPE++ECR Y++
Sbjct  108  K-ADPLETYCADNPETDECRVYED  130



>gb|ABK26381.1| unknown [Picea sitchensis]
Length=135

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  LS+ + + V  A+E C G+ +S EC  AWDEVEE+S A +H R + +  +PLE +CK
Sbjct  63   EQKLSDLIVEKVGEAQEVCQGNESSDECRVAWDEVEEVSQAKAHLRQRSQKDDPLEAYCK  122

Query  253  DNPESEECRTYDN  215
            +NPE++ECR Y++
Sbjct  123  ENPETDECRIYED  135



>ref|WP_006453737.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX83993.1| hypothetical protein S7335_1690 [Synechococcus sp. PCC 7335]
Length=74

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGE-CVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + EK+   ++ A EAC+ D    E C AAWD VEEL A ASH R KK + +P +++C 
Sbjct  2    SDIQEKIKTEIEAAREACSADNNDAEGCAAAWDAVEELQAEASHQRTKKPEKSPFDQYCD  61

Query  253  DNPESEECRTYDN  215
            DNPE++ECR YDN
Sbjct  62   DNPEADECRVYDN  74



>ref|WP_012306885.1| MULTISPECIES: hypothetical protein [Synechococcus]
 ref|YP_001734518.1| CP12 domain-containing protein [Synechococcus sp. PCC 7002]
 gb|ACA99262.1| CP12 domain protein [Synechococcus sp. PCC 7002]
Length=73

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            +++ +K+      A EAC+ D TS EC AAWD VEEL A A+H R+K+ + +PLE+FC D
Sbjct  2    TNIHQKIEQERDAAREACSTDSTSAECAAAWDAVEELQAEAAHQREKEPEKSPLEKFCDD  61

Query  250  NPESEECRTYDN  215
            NP+++ECR Y++
Sbjct  62   NPDADECRLYED  73



>ref|XP_001773160.1| predicted protein [Physcomitrella patens]
 gb|EDQ62013.1| predicted protein [Physcomitrella patens]
Length=68

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 1/68 (1%)
 Frame = -3

Query  415  KVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK-DSNPLEEFCKDNPES  239
            ++ +++  A++ C  DPTS  C  AWD VEEL+A A+H RD+ K +S+PLE +C DNPE+
Sbjct  1    QIPEAIAEAQKTCEDDPTSAPCAVAWDNVEELTAEAAHQRDRNKANSDPLETYCADNPET  60

Query  238  EECRTYDN  215
            +ECRTY++
Sbjct  61   DECRTYED  68



>gb|KDP36727.1| hypothetical protein JCGZ_08018 [Jatropha curcas]
Length=142

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   V  A+E C GD TS EC  AWDEVEE+S A ++ R K +  +PLE FC+
Sbjct  70   EKQLTEMIEQKVIEAKEVCEGDRTSDECKVAWDEVEEVSEAKANFRLKLEKRDPLEYFCQ  129

Query  253  DNPESEECRTYDN  215
            DNPE++ECR Y++
Sbjct  130  DNPETDECRIYED  142



>ref|XP_002510743.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52930.1| conserved hypothetical protein [Ricinus communis]
Length=142

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 75/149 (50%), Gaps = 19/149 (13%)
 Frame = -3

Query  631  LAKMVVIAGVNLTTTSPGILANS---PKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMC  461
            +A   ++A ++       IL++S   P++    T  + CL R  +  G        G   
Sbjct  1    MASNSLVAVLSAPARGTSILSSSSFLPRSCNIFTNSSICLKRRTENKG--------GMNL  52

Query  460  VVRPVCAAP--------DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAAS  305
             V  +  AP        +  L+E +   V  A+E C GD TS EC  AWDEVEE+S A +
Sbjct  53   RVEAMGGAPKFKGTQMREKHLTEMIEKKVMEAKEVCEGDQTSDECKVAWDEVEEVSQAKA  112

Query  304  HARDKKKDSNPLEEFCKDNPESEECRTYD  218
              R K +  +PLE FC+DNPE++ECR Y+
Sbjct  113  DFRLKLEKRDPLEYFCQDNPETDECRVYE  141



>ref|XP_006342197.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Solanum 
tuberosum]
Length=122

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFC  257
            +  L+E +   VK A+E C  D  S EC  AWDEVEE+S A +H R K + + +PLE +C
Sbjct  49   EKQLTEMIEKKVKEAKEVCGEDARSDECKVAWDEVEEVSQAKAHLRIKLQLNQDPLEPYC  108

Query  256  KDNPESEECRTYDN  215
            +DNP+++ECRTYD+
Sbjct  109  QDNPDADECRTYDH  122



>ref|XP_002307003.2| hypothetical protein POPTR_0005s27980g [Populus trichocarpa]
 gb|EEE93999.2| hypothetical protein POPTR_0005s27980g [Populus trichocarpa]
Length=142

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            L+E + + V  A+EAC GD TS EC  AWDEVEE+S A +  R + +  +PLE +C+DNP
Sbjct  73   LTEMIEEKVIEAKEACKGDATSVECKVAWDEVEEVSQAKADFRLRLEKQDPLEYYCQDNP  132

Query  244  ESEECRTYDN  215
            E++ECR Y++
Sbjct  133  ETDECRIYED  142



>ref|XP_011034773.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Populus 
euphratica]
Length=144

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E + + V  A+E C GD TS EC  AWDEVEE+S A +  R + +  +PLE +C+
Sbjct  72   EKQLTEMIEEKVVEAKEVCQGDETSDECKVAWDEVEEVSQAKADFRRRLEKQDPLEYYCQ  131

Query  253  DNPESEECRTYDN  215
            DNPE++ECR Y++
Sbjct  132  DNPETDECRVYED  144



>ref|XP_011041131.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Populus 
euphratica]
Length=142

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNP  245
            L+E +   V  A+EAC GD TS EC  AWDEVEE+S A +  R + +  +PLE +C+DNP
Sbjct  73   LTEMIEKKVIEAKEACKGDATSVECKVAWDEVEEVSQAKADFRLRLEKQDPLEYYCQDNP  132

Query  244  ESEECRTYDN  215
            E++ECR Y++
Sbjct  133  ETDECRIYED  142



>emb|CBI40783.3| unnamed protein product [Vitis vinifera]
Length=94

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   V  A++ C GD TS EC  AWDEVEE+S A +  R K +  +PLE +C+
Sbjct  22   EKQLTELIEKKVLEAKQVCEGDETSDECKVAWDEVEEVSQAKADLRRKMEKEDPLESYCQ  81

Query  253  DNPESEECRTYDN  215
            +NPE+EECR Y++
Sbjct  82   ENPENEECRIYED  94



>emb|CAO03469.1| CP12 protein [Chlamydomonas reinhardtii]
Length=80

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 5/78 (6%)
 Frame = -3

Query  436  PDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD----SNPL  269
            P   L++KV D+VK AE+ACA   TS +C  AWD VEELSAA SH +D  K     ++PL
Sbjct  4    PAVDLNKKVQDAVKEAEDACAK-GTSADCAVAWDTVEELSAAVSHKKDAVKADVTLTDPL  62

Query  268  EEFCKDNPESEECRTYDN  215
            E FCKD P+++ECR Y++
Sbjct  63   EAFCKDAPDADECRVYED  80



>ref|WP_024544448.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=73

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            +++ +K+    + A EAC  + TS EC AAWD VEEL A ASH R+++ + +PLE+FC D
Sbjct  2    TNIHQKIEQEREAAREACNTNATSAECAAAWDAVEELQAEASHQREQEPEKSPLEKFCDD  61

Query  250  NPESEECRTYDN  215
            NP+++ECR Y++
Sbjct  62   NPDADECRLYED  73



>ref|XP_005644334.1| CP12-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19790.1| CP12-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=116

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 67/119 (56%), Gaps = 15/119 (13%)
 Frame = -3

Query  568  NSPKAAAQTTKFTTCLNRPWKRAGVTAGLFRPGRMCVVRPVCAAPD-SSLSEKVADSVKN  392
             SP  A+QTT+          R  V A + R   +    P  A    S L   +A++ K 
Sbjct  12   RSPAVASQTTQAV--------RPRVLARVSRRSVLTRAEPTAAQKTLSELERAIAEARKQ  63

Query  391  AEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYDN  215
             +EA     T+GEC AAWD VEELSAA SH + + K ++PLEEFC DNPE++ECR Y++
Sbjct  64   CDEA-----TAGECAAAWDTVEELSAAISHKKAQAK-ADPLEEFCDDNPEADECRVYED  116



>ref|XP_002301892.1| CP12 domain-containing family protein [Populus trichocarpa]
 gb|EEE81165.1| CP12 domain-containing family protein [Populus trichocarpa]
Length=148

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   V  A+E C GD TS EC  AWDEVEE+S A +  R + +  +PLE +C+
Sbjct  76   EKQLAEMIEKKVVEAKEVCEGDETSDECKVAWDEVEEVSQAKADFRRRLEKQDPLEYYCQ  135

Query  253  DNPESEECRTYDN  215
            DNPE++ECR Y++
Sbjct  136  DNPETDECRVYED  148



>ref|XP_006390179.1| hypothetical protein EUTSA_v10019316mg [Eutrema salsugineum]
 gb|ESQ27465.1| hypothetical protein EUTSA_v10019316mg [Eutrema salsugineum]
Length=129

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE +   VK A E C GD  S EC  AWDEVEE+S A +  R K K  + +PLE F
Sbjct  55   EEKLSEMIEKKVKEATEVCEGDERSEECRVAWDEVEEVSQAKADLRIKLKLLNQDPLESF  114

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  115  CQENPETDECRIYED  129



>ref|XP_009372664.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Pyrus 
x bretschneideri]
Length=136

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFC  257
            +  L+E +   V  A E C GDP + EC  AWDEVEE+S A +  R K +K  +PLE FC
Sbjct  63   EKQLTEMIEKKVMEAREVCEGDPKTDECKVAWDEVEEVSQAKADLRLKLEKHKDPLESFC  122

Query  256  KDNPESEECRTYDN  215
            ++NPE++ECR Y++
Sbjct  123  RENPETDECRIYED  136



>ref|XP_010539757.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Tarenaya 
hassleriana]
Length=139

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   VK A E CA D  S EC  AWDEVEE+S A +  R K +  +PLE FC+
Sbjct  67   EEKLTEMIERKVKEATEVCAADEGSEECRVAWDEVEEVSQAKADLRLKLQKQDPLEGFCQ  126

Query  253  DNPESEECRTYDN  215
            +NP+++ECR YD+
Sbjct  127  ENPDTDECRIYDD  139



>ref|XP_002276622.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Vitis 
vinifera]
Length=134

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +  L+E +   V  A++ C GD TS EC  AWDEVEE+S A +  R K +  +PLE +C+
Sbjct  62   EKQLTELIEKKVLEAKQVCEGDETSDECKVAWDEVEEVSQAKADLRRKMEKEDPLESYCQ  121

Query  253  DNPESEECRTYDN  215
            +NPE+EECR Y++
Sbjct  122  ENPENEECRIYED  134



>emb|CAA06467.1| CP12 [Chlamydomonas reinhardtii]
Length=40

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = -3

Query  367  PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            P SGECV AWDEVEELSAAASHARD+KK+S+PLE++CKDN
Sbjct  1    PVSGECVRAWDEVEELSAAASHARDRKKESDPLEDYCKDN  40



>ref|XP_009765560.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Nicotiana 
sylvestris]
Length=126

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFC  257
            +  L+E +   VK A+  C  D  S EC  AWDEVEE+S A +H R K + + +PLE FC
Sbjct  53   EKQLTEMIEKKVKEAKAVCGEDARSDECKVAWDEVEEVSQAKAHLRIKLQLNQDPLESFC  112

Query  256  KDNPESEECRTYDN  215
            +DNPE++ECR Y++
Sbjct  113  QDNPETDECRIYED  126



>ref|XP_009595948.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Nicotiana 
tomentosiformis]
Length=123

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFC  257
            +  L+E +   VK A+  C  D  S EC  AWDEVEE+S A +H R K + + +PLE FC
Sbjct  50   EKQLTEMIEKKVKEAKAVCGEDARSDECKVAWDEVEEVSQAKAHLRIKLQLNQDPLESFC  109

Query  256  KDNPESEECRTYDN  215
            +DNPE++ECR Y++
Sbjct  110  QDNPETDECRIYED  123



>ref|WP_015218820.1| hypothetical protein [Cyanobacterium aponinum]
 ref|YP_007161133.1| hypothetical protein Cyan10605_0959 [Cyanobacterium aponinum 
PCC 10605]
 gb|AFZ53089.1| protein of unknown function CP12 [Cyanobacterium aponinum PCC 
10605]
Length=74

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAG-DPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +++ + +K+A E C   D  SGEC AAWD VEEL A ASH + K+   N LE++C 
Sbjct  2    SNIQDQIQEELKHAREVCDSPDSNSGECAAAWDAVEELQAEASHQKTKEPKKNSLEQYCS  61

Query  253  DNPESEECRTYDN  215
            +NPE+ ECR YD+
Sbjct  62   ENPEAAECRLYDD  74



>ref|XP_007209751.1| hypothetical protein PRUPE_ppa013090mg [Prunus persica]
 gb|EMJ10950.1| hypothetical protein PRUPE_ppa013090mg [Prunus persica]
Length=140

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 10/98 (10%)
 Frame = -3

Query  505  RAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVE  326
            ++G   G F+  +M          +  L+E +   V  A++ C GDP + EC  AWDEVE
Sbjct  52   KSGGVQGKFKGTQM---------REKQLTEMIEKKVMEAKQVCEGDPIADECKVAWDEVE  102

Query  325  ELSAAASHARDK-KKDSNPLEEFCKDNPESEECRTYDN  215
            E+S A +  R K + + +PLE FC+DNPE++ECR Y++
Sbjct  103  EVSQAKADLRLKLETNKDPLESFCQDNPETDECRIYED  140



>ref|XP_008373345.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Malus 
domestica]
Length=136

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFC  257
            +  L+E +   V  A E C GDP + EC  AWDEVEE+S A +  R K +K  +PLE FC
Sbjct  63   EKQLTEMIEKKVXEATEVCEGDPKTDECKVAWDEVEEVSQAKADLRLKLEKHKDPLESFC  122

Query  256  KDNPESEECRTYDN  215
            ++NPE++ECR Y++
Sbjct  123  QENPETDECRIYED  136



>ref|XP_008237890.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Prunus 
mume]
Length=141

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 58/98 (59%), Gaps = 10/98 (10%)
 Frame = -3

Query  505  RAGVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVE  326
            ++G   G F+  +M          +  L+E +   V  A++ C GDP + EC  AWDEVE
Sbjct  53   KSGGVQGKFKGTQM---------REKQLTEMIEKKVMEAKQVCEGDPIADECKVAWDEVE  103

Query  325  ELSAAASHARDK-KKDSNPLEEFCKDNPESEECRTYDN  215
            E+S A +  R K + + +PLE FC+DNPE++ECR Y++
Sbjct  104  EVSQAKADLRLKLETNKDPLESFCQDNPETDECRIYED  141



>ref|XP_006302985.1| hypothetical protein CARUB_v10021134mg [Capsella rubella]
 gb|EOA35883.1| hypothetical protein CARUB_v10021134mg [Capsella rubella]
Length=133

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A S  R K K  + +PLE F
Sbjct  59   EEKLSEMIEEKVKEATEVCETDERSEECRVAWDEVEEVSQARSDLRIKLKLLNQDPLESF  118

Query  259  CKDNPESEECRTYDN  215
            C+ NPE++ECR Y++
Sbjct  119  CQQNPETDECRLYED  133



>ref|WP_015223198.1| hypothetical protein [Cyanobacterium stanieri]
 ref|YP_007165531.1| hypothetical protein Cyast_1929 [Cyanobacterium stanieri PCC 
7202]
 gb|AFZ47882.1| protein of unknown function CP12 [Cyanobacterium stanieri PCC 
7202]
Length=74

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +++ + +K A E C+ +  TSG+C AAWD VEEL A ASH +  +K    LE++C 
Sbjct  2    SNIQDQIQEELKQAREVCSTEGATSGDCAAAWDAVEELQAEASHQQQGEKKKTSLEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAAECRVYDD  74



>emb|CDX88298.1| BnaC06g37420D [Brassica napus]
Length=134

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A +  R K +  + +PLE F
Sbjct  60   EEKLSEMIVEKVKEATEVCEADVRSEECKVAWDEVEEVSQARADLRIKLRLLNQDPLESF  119

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  120  CQENPETDECRIYED  134



>ref|WP_010475694.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=75

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHAR-DKKKDSNPLEEFC  257
            S++ EK+   ++ A E C     TSGEC AAWD VEEL A ASH R    +D N LE++C
Sbjct  2    SNIQEKIEKELEQARETCDTSGATSGECAAAWDAVEELQAEASHQRKSNNEDKNSLEQYC  61

Query  256  KDNPESEECRTYDN  215
             DNP++ ECR YD+
Sbjct  62   DDNPDAAECRIYDD  75



>ref|XP_009106324.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Brassica 
rapa]
Length=136

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A +  R K K  + +PLE F
Sbjct  62   EEKLSEMIEEKVKEATEVCEADVRSEECKVAWDEVEEVSQARADLRIKLKFLNQDPLESF  121

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  122  CQENPETDECRIYED  136



>ref|XP_001759510.1| predicted protein [Physcomitrella patens]
 gb|EDQ75812.1| predicted protein [Physcomitrella patens]
Length=67

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -3

Query  412  VADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDS-NPLEEFCKDNPESE  236
            +  ++  A+  C  DP S  C  AWD VEEL+A A+H RD++K S +PLE++C DNPE++
Sbjct  1    IPSAIAEAQLTCEEDPNSAPCAVAWDNVEELTAEAAHQRDREKSSGDPLEKYCADNPETD  60

Query  235  ECRTYDN  215
            ECRTY++
Sbjct  61   ECRTYED  67



>emb|CDX87586.1| BnaA07g32870D [Brassica napus]
Length=135

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A +  R K K  + +PLE F
Sbjct  61   EEKLSEMIEEKVKEATEVCEADVRSEECKVAWDEVEEVSQARADLRIKLKFLNQDPLESF  120

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  121  CQENPETDECRIYED  135



>ref|XP_002887645.1| hypothetical protein ARALYDRAFT_895539 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63904.1| hypothetical protein ARALYDRAFT_895539 [Arabidopsis lyrata subsp. 
lyrata]
Length=135

 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  +  S EC  AWDEVEE+S A +  R K K  + +PLE F
Sbjct  61   EEKLSEMIEEKVKEATEVCEAEERSEECRVAWDEVEEVSQARADLRVKLKLLNQDPLESF  120

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  121  CQENPETDECRIYED  135



>ref|NP_565134.1| CP12 domain-containing protein 3 [Arabidopsis thaliana]
 sp|Q9C9K2.1|CP123_ARATH RecName: Full=Calvin cycle protein CP12-3, chloroplastic; AltName: 
Full=CP12 domain-containing protein 3; AltName: Full=Chloroplast 
protein 12-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51942.1|AC015450_3 hypothetical protein; 64587-64991 [Arabidopsis thaliana]
 gb|AAO44019.1| At1g76560 [Arabidopsis thaliana]
 dbj|BAE99820.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35859.1| CP12 domain-containing protein 3 [Arabidopsis thaliana]
Length=134

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  +  S EC  AWDEVEE+S A +  R K K  + +PLE F
Sbjct  60   EEKLSEMIEEKVKEATEVCEAEEMSEECRVAWDEVEEVSQARADLRIKLKLLNQDPLESF  119

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  120  CQENPETDECRIYED  134



>gb|AAM62589.1| unknown [Arabidopsis thaliana]
Length=134

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  +  S EC  AWDEVEE+S A +  R K K  + +PLE F
Sbjct  60   EEKLSEMIEEKVKEATEVCEAEEMSEECRVAWDEVEEVSQARADLRIKLKLLNQDPLESF  119

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  120  CQENPETDECRIYED  134



>ref|WP_008309502.1| CP12 domain protein [Leptolyngbya sp. PCC 6406]
Length=74

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + EK+   +K+A +AC      S EC AAWD VEEL A A+H R+++K    LE+FC 
Sbjct  2    SDIQEKIQQELKSARDACDVSGSNSQECAAAWDAVEELQAEAAHQRNQQKPQTSLEKFCD  61

Query  253  DNPESEECRTYDN  215
            DNPE+ ECR Y++
Sbjct  62   DNPEAAECRIYED  74



>ref|WP_035991854.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=75

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  427  SLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            ++ E++   ++ A  AC A    S EC AAWD VEEL A ASH RDK  D   LE +C  
Sbjct  4    NIKERIEKEIEGARAACDASGSGSQECAAAWDAVEELQAEASHQRDKGTDRTSLEAYCDS  63

Query  250  NPESEECRTYDN  215
            NPE++ECR YDN
Sbjct  64   NPEADECRVYDN  75



>ref|WP_012162957.1| hypothetical protein [Acaryochloris marina]
 ref|YP_001516811.1| CP12 domain-containing protein [Acaryochloris marina MBIC11017]
 gb|ABW27497.1| CP12 domain protein [Acaryochloris marina MBIC11017]
Length=75

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARD-KKKDSNPLEEFC  257
            +++ EK+   ++ A E C     TSGEC AAWD VEEL A ASH R    +D N LE++C
Sbjct  2    TNIQEKIEKELEQARETCDTSGATSGECAAAWDAVEELQAEASHQRKGNNEDKNSLEQYC  61

Query  256  KDNPESEECRTYDN  215
             DNP++ ECR YD+
Sbjct  62   DDNPDAAECRIYDD  75



>ref|XP_007010913.1| CP12 domain-containing protein 3 [Theobroma cacao]
 gb|EOY19723.1| CP12 domain-containing protein 3 [Theobroma cacao]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 50/77 (65%), Gaps = 6/77 (8%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK----KKDSNPLE  266
            +  L+E +   V  A+E C GD TS EC  AWDEVEE+S A +  R +    KKD  PLE
Sbjct  61   EKQLAEMIEKKVTEAKEVCEGDETSDECKVAWDEVEEVSQAKADLRLRLEIEKKD--PLE  118

Query  265  EFCKDNPESEECRTYDN  215
             FC++NPE+EECR Y++
Sbjct  119  FFCQENPETEECRVYED  135



>ref|WP_017651373.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=73

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + EK+ D V+ A   C     +S EC AAWD VEEL A ASH R  K+  N LE++C 
Sbjct  2    SDIQEKIQDEVEQARTVCDTSGSSSAECAAAWDAVEELQAEASHQRQSKQ-KNSLEKYCD  60

Query  253  DNPESEECRTYDN  215
            DNPE++ECR Y++
Sbjct  61   DNPEADECRLYED  73



>ref|WP_015136220.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 ref|YP_007073342.1| hypothetical protein Lepto7376_4400 [Leptolyngbya sp. PCC 7376]
 gb|AFY40508.1| protein of unknown function CP12 [Leptolyngbya sp. PCC 7376]
Length=73

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            +++ +++      A EAC  D TSGEC AAWD VEEL A ASH R+++ +   L++FC  
Sbjct  2    TNIQQQIEKERDAAREACNTDATSGECAAAWDAVEELQAEASHQREQEPEKTELDKFCDA  61

Query  250  NPESEECRTYDN  215
            NP+++ECR Y++
Sbjct  62   NPDADECRIYED  73



>ref|WP_019501875.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=74

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +++ EK+ + ++ A EAC A  P S EC AAWD VEEL A ASH + ++K  N L+++C 
Sbjct  3    TNIQEKIQEELQGAREACEANGPGSKECAAAWDAVEELQAEASHQK-QEKGKNSLQQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDAAECRIYED  74



>ref|WP_027842240.1| hypothetical protein [Mastigocoleus testarum]
Length=73

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC--AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFC  257
            S +  K+++ VK A E C  +GD +S EC AAWD VEEL A ASH R +K+ ++  E++C
Sbjct  2    SDIQNKISEEVKQAREVCDTSGD-SSAECAAAWDAVEELQAEASHQRQEKQKTS-FEKYC  59

Query  256  KDNPESEECRTYDN  215
             DNPE+ ECR YD+
Sbjct  60   DDNPEAAECRVYDD  73



>ref|WP_035156951.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB85537.1| hypothetical protein IJ00_23715 [Calothrix sp. 336/3]
Length=73

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 47/75 (63%), Gaps = 6/75 (8%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSG---ECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            S + EK+ + V+ A   C  D T G   EC AAWD VEEL A ASH R  K+  N LE++
Sbjct  2    SDIQEKIQEEVEQARAVC--DVTGGNSPECAAAWDAVEELQAEASHQRQTKQ-KNSLEQY  58

Query  259  CKDNPESEECRTYDN  215
            C DNPE+ ECR YD+
Sbjct  59   CDDNPEAAECRVYDD  73



>ref|XP_010479593.1| PREDICTED: LOW QUALITY PROTEIN: calvin cycle protein CP12-3, 
chloroplastic-like [Camelina sativa]
Length=134

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A S  R K K  + +PLE  
Sbjct  60   EEKLSEMIEEKVKEATEVCDADERSEECRVAWDEVEEVSQARSDLRIKLKLLNQDPLESV  119

Query  259  CKDNPESEECRTYDN  215
             +DNPE++ECR Y++
Sbjct  120  YQDNPETDECRVYED  134



>ref|XP_010416576.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Camelina 
sativa]
Length=134

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A S  R K K  + +PLE F
Sbjct  60   EEKLSEMIEEKVKEATEVCDTDERSEECRVAWDEVEEVSQARSDLRIKLKLLNQDPLESF  119

Query  259  CKDNPESEECRTYDN  215
             ++NPE++ECR Y +
Sbjct  120  WQENPETDECRVYQD  134



>emb|CDP07245.1| unnamed protein product [Coffea canephora]
Length=193

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  L+E +   V+ A+E C  D  S EC  AWDEVEE+S A +  R K +    +PLE F
Sbjct  119  EKQLTEMIEKKVREAKEVCGEDGKSDECKVAWDEVEEVSQAKADLRLKLEIMHQDPLESF  178

Query  259  CKDNPESEECRTYDN  215
            C+DNPE++ECR Y++
Sbjct  179  CQDNPETDECRIYED  193



>ref|WP_008197591.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI30892.1| Calvin cycle protein CP12 [Microcystis sp. T1-4]
Length=74

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ +  KNA   C+ +  TSGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEERKNARAVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKTYFEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAAECRVYDD  74



>ref|XP_001774010.1| predicted protein [Physcomitrella patens]
 gb|EDQ61200.1| predicted protein [Physcomitrella patens]
Length=126

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 55/84 (65%), Gaps = 7/84 (8%)
 Frame = -3

Query  466  MCVVRPV-CAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK  290
            +C+  P   + P  +  +KVA  +++A+E CAGD  S EC AAWDEVE      + A+++
Sbjct  48   VCMATPTGSSGPAINTDDKVATKIEDAQEVCAGDNQSEECAAAWDEVE------AAAKEQ  101

Query  289  KKDSNPLEEFCKDNPESEECRTYD  218
             K  +P++++C DNPE++ECR Y+
Sbjct  102  AKTEDPIDKYCNDNPEADECRVYN  125



>ref|WP_002792997.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI23400.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9808]
 emb|CCI35153.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9701]
 gb|EPF19562.1| CP12 domain protein [Microcystis aeruginosa SPC777]
 gb|EPF21098.1| CP12 domain protein [Microcystis aeruginosa SPC777]
Length=74

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +  TSGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEELENARTVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKTYFEKYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAAECRVYDD  74



>ref|WP_002739926.1| calvin cycle protein CP12 [Microcystis aeruginosa]
 gb|ELP52274.1| calvin cycle protein CP12 [Microcystis aeruginosa TAIHU98]
Length=74

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +  TSGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEELENARAVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKTYFEKYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAAECRVYDD  74



>ref|XP_011074049.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Sesamum 
indicum]
Length=125

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK--KKDSNPLEEF  260
            +  L+E +   V  A++ C  D TS EC  AWDEVEE+S A +  R K      +PLE F
Sbjct  51   EQRLTEMIEQKVAEAKQVCGEDETSDECKVAWDEVEEVSQAKADLRLKIHHLQQDPLEHF  110

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  111  CQENPETDECRIYED  125



>ref|WP_006511551.1| CP12 domain protein [Xenococcus sp. PCC 7305]
 gb|ELS01336.1| CP12 domain protein [Xenococcus sp. PCC 7305]
Length=74

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            + L +++      A E C+ +  TSGEC AAWD VEEL A ASH R      N LE++C 
Sbjct  2    TDLKDQIQQETAQAREVCSTEGATSGECAAAWDAVEELQAEASHQRQNHPAKNSLEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDALECRVYED  74



>ref|XP_010474367.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Camelina 
sativa]
Length=161

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKK--DSNPLEEF  260
            +  LSE + + VK A E C  D  S EC  AWDEVEE+S A S  R K K  + +PLE F
Sbjct  60   EEKLSEMIEEKVKEATEVCQTDEGSEECRVAWDEVEEVSQARSDLRIKLKLLNQDPLESF  119

Query  259  CKDNPESEECRTY  221
            C++NPE++EC  Y
Sbjct  120  CQENPETDECSGY  132



>ref|WP_019504562.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=73

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            S + E++    ++A E C  D TS EC AAWD VEELSA A+H +      + LE++C D
Sbjct  2    SDIQEQIQKERQSAREVCDLDATSAECAAAWDAVEELSAEAAHQKQNAPQKSSLEKYCDD  61

Query  250  NPESEECRTYDN  215
            NP++ ECR Y++
Sbjct  62   NPDALECRVYED  73



>ref|WP_015163984.1| hypothetical protein [Pseudanabaena sp. PCC 7367]
 ref|YP_007101438.1| hypothetical protein Pse7367_0708 [Pseudanabaena sp. PCC 7367]
 gb|AFY69010.1| protein of unknown function CP12 [Pseudanabaena sp. PCC 7367]
Length=73

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 51/75 (68%), Gaps = 6/75 (8%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT---SGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            S++  K+ + +++A EAC  D T   S EC AAWD VEEL A ASH R++K   N LE+F
Sbjct  2    SNIQNKIQEELESAREAC--DTTGADSKECAAAWDAVEELQAEASHQREEKP-KNSLEQF  58

Query  259  CKDNPESEECRTYDN  215
            C DNP++ ECR YD+
Sbjct  59   CDDNPDAAECRVYDD  73



>ref|WP_017749890.1| hypothetical protein [Scytonema hofmanni]
Length=73

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+   V+ A   C     TSGEC AAWD VEEL A ASH R  K+  N LE++C 
Sbjct  2    SNIQDKIDQEVEQARATCDVTGSTSGECAAAWDAVEELQAEASHQRQAKR-KNSLEQYCD  60

Query  253  DNPESEECRTYDN  215
             NPE++ECR Y++
Sbjct  61   ANPEADECRVYED  73



>ref|WP_018396801.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=74

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDP-TSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ E++    KNA   C+ +   SG+C AAWD VEEL A ASH R  K     LE++C 
Sbjct  2    SNIDEQIEQERKNARTVCSTEGGESGDCAAAWDAVEELQAEASHQRQTKPKKTSLEQYCD  61

Query  253  DNPESEECRTYD  218
            DNP++ ECR YD
Sbjct  62   DNPDAVECRVYD  73



>gb|EMT03124.1| hypothetical protein F775_44037 [Aegilops tauschii]
Length=64

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 39/40 (98%), Gaps = 1/40 (3%)
 Frame = -3

Query  331  VEELSAAASHARDKKKD-SNPLEEFCKDNPESEECRTYDN  215
            VEELSAAASHARD+KK+ S+PLEEFC+DNPE++ECRTYD+
Sbjct  25   VEELSAAASHARDRKKEHSDPLEEFCEDNPETDECRTYDS  64



>gb|EYU36605.1| hypothetical protein MIMGU_mgv1a014758mg [Erythranthe guttata]
Length=179

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK--KKDSNPLEEF  260
            +  L+E +   V  A++ C  D TS EC  AWDEVEE+S A +  R K      +PLE F
Sbjct  105  EQRLTEMIEKKVMEAKQVCGEDETSDECKVAWDEVEEVSQAKADLRLKLHHLQQDPLEHF  164

Query  259  CKDNPESEECRTYDN  215
            C++NPE++ECR Y++
Sbjct  165  CQENPETDECRIYED  179



>ref|WP_008274506.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92293.1| CP12 polypeptide [Cyanothece sp. CCY0110]
Length=74

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +++    +NA+  C+ D + SG C AAWD VEEL A ASH R K+   +  E++C 
Sbjct  2    SNIDDQIQQERENAKNVCSTDGSDSGNCAAAWDAVEELQAEASHQRQKQTPKSNFEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAVECRVYDD  74



>ref|WP_036000717.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=75

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 48/73 (66%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +++ E++    + A EAC  + T S EC AAWD VEEL A ASH R+K+   N  +++C 
Sbjct  3    NNIQEQIEKERQEAREACEVNGTNSPECAAAWDAVEELQAEASHQREKEPPKNAFQQYCD  62

Query  253  DNPESEECRTYDN  215
             NPE++ECR YDN
Sbjct  63   ANPEADECRVYDN  75



>ref|WP_002751352.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH95173.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9432]
Length=74

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +   SGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEELENARAVCSTEGAASGECAAAWDAVEELQAEAAHQRQDHPQKTYFEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAAECRVYDD  74



>gb|KFM27918.1| Calvin cycle protein CP12, chloroplastic [Auxenochlorella protothecoides]
Length=117

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = -3

Query  499  GVTAGLFRPGRMCVVRPVCAAPDSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEEL  320
            G++    RP  M  + P  A PD+     +  ++  A++ACA   T  EC AAWD VEEL
Sbjct  23   GLSRACARPRPMQRMVPR-ATPDTQKG-PIEGAITEAQDACATGSTD-ECAAAWDTVEEL  79

Query  319  SAAASHARDKKK---DSNPLEEFCKDNPESEECRTYDN  215
            SAAA+H RD  K    S+PLE++C+  P+++ECR Y++
Sbjct  80   SAAAAHKRDNAKTAQQSDPLEQYCEGAPDADECRVYED  117



>ref|XP_005706707.1| small chloroplast protein [Galdieria sulphuraria]
 emb|CAI34857.1| small chloroplast protein [Galdieria sulphuraria]
 emb|CAI34858.1| small chloroplast protein [Galdieria sulphuraria]
 gb|EME30187.1| small chloroplast protein [Galdieria sulphuraria]
Length=129

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = -3

Query  418  EKVADSVKNAEEACAG-DPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNPE  242
            +++ +S+K AEEA       S E  AAWD VEEL A ASH R ++K ++PLE FC ++PE
Sbjct  62   QQIQESIKKAEEATKKFGRDSKEAAAAWDAVEELDAEASHQRVRQK-TDPLETFCDESPE  120

Query  241  SEECRTYDN  215
            +EECR YDN
Sbjct  121  AEECRVYDN  129



>ref|WP_006635891.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK83626.1| protein of unknown function CP12 [Microcoleus vaginatus FGP-2]
Length=78

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = -3

Query  436  PDSSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            P S++ EK+ + +++A   C     TSGEC AAWD VEEL A ASH + + K  N  E++
Sbjct  5    PPSNIQEKIEEELESARTVCDVKGATSGECAAAWDAVEELQAEASHQK-QVKPKNSFEKY  63

Query  259  CKDNPESEECRTYD  218
            C DNP++ ECR YD
Sbjct  64   CDDNPDAAECRIYD  77



>ref|WP_010997001.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486890.1| hypothetical protein asl2850 [Nostoc sp. PCC 7120]
 dbj|BAB74549.1| asl2850 [Nostoc sp. PCC 7120]
Length=78

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 4/71 (6%)
 Frame = -3

Query  424  LSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHAR-DKKKDSNPLEEFCKD  251
            + +++ + V+ A   C      S EC AAWD VEEL A ASH R DKKK  N LE++C D
Sbjct  9    IQDQIQEEVEQARAVCDISGSNSAECAAAWDAVEELQAEASHQRQDKKK--NSLEQYCDD  66

Query  250  NPESEECRTYD  218
            NPE+ ECR YD
Sbjct  67   NPEAAECRVYD  77



>gb|ABD37968.1| CP12 [Mesostigma viride]
Length=131

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = -3

Query  412  VADSVKNAEEACAGDPTSGECVAAWDEVEEL---SAAASHARDKKKDSNPLEEFCKDNPE  242
            VA S+K+AEE CA   T+GEC AAWDEVEEL   ++       +    +PLE+FC+DNPE
Sbjct  64   VAKSIKDAEETCASG-TTGECAAAWDEVEELSAAASDKKKKEKEIAKKDPLEKFCEDNPE  122

Query  241  SEECRTYDN  215
            ++ECR Y++
Sbjct  123  TDECRVYED  131



>ref|WP_002743917.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO87254.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCI07063.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 7941]
 gb|ELS47967.1| CP12 domain protein [Microcystis aeruginosa DIANCHI905]
Length=74

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +   SGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEELENARAVCSTEGAASGECAAAWDAVEELQAEAAHQRQDHPQKTYFEKYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAAECRVYDD  74



>ref|WP_002770133.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI03837.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9443]
Length=74

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +  TSGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEELENARAVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKTYFEKYCA  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDAAECRLYED  74



>ref|WP_012361411.1| hypothetical protein [Cyanothece sp. ATCC 51142]
 ref|YP_001802046.1| putative CP12 [Cyanothece sp. ATCC 51142]
 gb|ACB49980.1| putative CP12 [Cyanothece sp. ATCC 51142]
Length=81

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +++    +NA+  C+ + + SG C AAWD VEEL A ASH R K+      E++C 
Sbjct  9    SNIDDQIQQERENAKNVCSTEGSDSGNCAAAWDAVEELQAEASHQRQKQTPKTNFEQYCD  68

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  69   DNPDAVECRVYDD  81



>ref|WP_015194435.1| protein of unknown function CP12 [Stanieria cyanosphaera]
 ref|YP_007133739.1| protein of unknown function CP12 [Stanieria cyanosphaera PCC 
7437]
 gb|AFZ36773.1| protein of unknown function CP12 [Stanieria cyanosphaera PCC 
7437]
Length=74

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ E++      A+  C  +  TSGEC AAWD VEEL A ASH R K  +   LE++C 
Sbjct  2    SNIQEQIEQEKAQAKAVCDLEGATSGECAAAWDAVEELQAEASHQRQKHPEKTSLEQYCD  61

Query  253  DNPESEECRTYDN  215
            +NP++ ECR YD+
Sbjct  62   NNPDALECRVYDD  74



>ref|WP_015202341.1| hypothetical protein [Crinalium epipsammum]
 ref|YP_007141729.1| hypothetical protein Cri9333_1321 [Crinalium epipsammum PCC 9333]
 gb|AFZ12219.1| protein of unknown function CP12 [Crinalium epipsammum PCC 9333]
Length=75

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFC  257
            ++ + +K+    + A +AC      SGEC AAWD VEEL A ASH R  K   N LE+FC
Sbjct  3    NTDIQQKIEQEREQARQACDVNGANSGECAAAWDAVEELQAEASHQRTTKP-KNSLEKFC  61

Query  256  KDNPESEECRTYDN  215
             DNPE+ ECR Y++
Sbjct  62   DDNPEAAECRLYED  75



>ref|WP_002788843.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI18803.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9807]
Length=74

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +  TSGEC AAWD VEEL A A+H R         E++C 
Sbjct  2    SNIQDKIQEELENARAVCSIEGSTSGECAAAWDAVEELQAEAAHQRQDHPQKTYFEKYCA  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDAAECRLYED  74



>ref|WP_019508336.1| CP12 polypeptide [Pleurocapsa sp. PCC 7319]
Length=204

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = -3

Query  364  TSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYDN  215
            TS EC AAWD+VEEL AAA+H R +KK  + LE +C +NP++EECR Y++
Sbjct  155  TSPECAAAWDQVEELQAAAAHKRQEKKSMSSLEAYCAENPDAEECRIYED  204



>ref|WP_006516336.1| CP12 domai nprotein [Leptolyngbya sp. PCC 7375]
 gb|EKV01948.1| CP12 domai nprotein [Leptolyngbya sp. PCC 7375]
Length=74

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + EK+++ +K A + C  D + S  C AAWD VEEL A ASH R+ +K     E +C 
Sbjct  2    SDIQEKISEEIKAARDVCTTDGSGSDACAAAWDAVEELQAEASHQRESEKPKTNFETYCD  61

Query  253  DNPESEECRTYDN  215
            +NPE++ECR Y++
Sbjct  62   ENPEADECRIYED  74



>ref|WP_009547808.1| hypothetical protein [Cyanothece sp. ATCC 51472]
Length=74

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +++    +NA+  C+ + + SG C AAWD VEEL A ASH R K+      E++C 
Sbjct  2    SNIDDQIQQERENAKNVCSTEGSDSGNCAAAWDAVEELQAEASHQRQKQTPKTNFEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR YD+
Sbjct  62   DNPDAVECRVYDD  74



>ref|WP_018400793.1| CP12 polypeptide [filamentous cyanobacterium ESFC-1]
Length=203

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACA-GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L EK+ ++  +A + CA   PTS EC AAWD VEEL A A+H RD++ +    EE+C++ 
Sbjct  133  LQEKIIEARDSARQICAEKGPTSPECAAAWDVVEELQAEAAHRRDQRLEKTHFEEYCEEY  192

Query  247  PESEECRTYDN  215
            P++ E R YD+
Sbjct  193  PDALEARMYDS  203



>ref|WP_015207783.1| CP12 domain protein [Cylindrospermum stagnale]
 ref|YP_007147209.1| CP12 domain protein [Cylindrospermum stagnale PCC 7417]
 gb|AFZ24529.1| CP12 domain protein [Cylindrospermum stagnale PCC 7417]
Length=81

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFC  257
            +S + EK+ D V+ A   C      S EC AAWD VEEL A ASH R  K+  N LE++C
Sbjct  9    NSDIQEKIQDEVEQARTVCDISGSNSAECAAAWDAVEELQAEASHQRQSKQ-KNSLEQYC  67

Query  256  KDNPESEECRTYDN  215
             DNP++ ECR YD+
Sbjct  68   DDNPDAIECRVYDD  81



>ref|WP_011317898.1| hypothetical protein [Anabaena variabilis]
 ref|YP_321569.1| hypothetical protein Ava_1050 [Anabaena variabilis ATCC 29413]
 gb|ABA20674.1| Protein of unknown function CP12 [Anabaena variabilis ATCC 29413]
Length=78

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = -3

Query  424  LSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            + +++ + V+ A   C      S EC AAWD VEEL A ASH R  KK  N LE++C DN
Sbjct  9    IQDQIQEEVEQARAVCDISGSNSAECAAAWDAVEELQAEASHQRQDKK-KNSLEQYCDDN  67

Query  247  PESEECRTYD  218
            P++ ECR YD
Sbjct  68   PDAAECRVYD  77



>ref|WP_012407493.1| hypothetical protein [Nostoc punctiforme]
 ref|YP_001864411.1| hypothetical protein Npun_R0716 [Nostoc punctiforme PCC 73102]
 gb|ACC79468.1| protein of unknown function CP12 [Nostoc punctiforme PCC 73102]
Length=81

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 8/76 (11%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC----AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEE  263
            S + EK+ + V+ A   C    +G P   EC AAWD VEEL A ASH R + K  N LE+
Sbjct  10   SDIQEKIQEEVEQARTVCDINGSGSP---ECAAAWDAVEELQAEASHKR-QSKPKNSLEQ  65

Query  262  FCKDNPESEECRTYDN  215
            +C DNP++ ECR YD+
Sbjct  66   YCDDNPDAIECRVYDD  81



>ref|XP_008799141.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Phoenix 
dactylifera]
Length=143

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGE--CVAAWDEVEELSAAASHARDK--KKDSNPLE  266
            +  L+  +   V+ A+ AC G+   G   C  AWDEVEE+S A +H R +  + D +PLE
Sbjct  67   EEKLAGMIERKVEEAKAACEGEEGKGSDGCKVAWDEVEEVSQAMAHLRRRLAESDRDPLE  126

Query  265  EFCKDNPESEECRTYDN  215
             FC+DNPE++ECR Y++
Sbjct  127  SFCQDNPETDECRVYED  143



>ref|WP_015175385.1| protein of unknown function CP12 [Oscillatoria nigro-viridis]
 ref|YP_007114483.1| protein of unknown function CP12 [Oscillatoria nigro-viridis 
PCC 7112]
 gb|AFZ06067.1| protein of unknown function CP12 [Oscillatoria nigro-viridis 
PCC 7112]
Length=78

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = -3

Query  436  PDSSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEF  260
            P  ++ EK+ + +++A   C     TSGEC AAWD VEEL A ASH + + K  N  E++
Sbjct  5    PAGNIQEKIEEELESARTVCDLKGATSGECAAAWDAVEELQAEASHQK-QVKPKNSFEKY  63

Query  259  CKDNPESEECRTYD  218
            C DNP++ ECR YD
Sbjct  64   CDDNPDAAECRIYD  77



>ref|WP_009785850.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW35550.1| hypothetical protein L8106_13105 [Lyngbya sp. PCC 8106]
Length=205

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACA-GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L E++ +++K+A   C     TS EC AAWD VEEL A A+H + ++ D    E FC++N
Sbjct  135  LEERIQEAIKDARATCTEKGATSKECAAAWDIVEELQAEAAHQKAERLDQTAFEVFCEEN  194

Query  247  PESEECRTYDN  215
            P++ E R YDN
Sbjct  195  PDAAEARVYDN  205



>ref|WP_017297697.1| hypothetical protein [Nodosilinea nodulosa]
Length=75

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 1/72 (1%)
 Frame = -3

Query  427  SLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKD  251
            ++ E++   ++ A  AC     +S EC AAWD VEEL A ASH R K      LE +C  
Sbjct  4    NIKERIEKEIEGARAACDVSGGSSQECAAAWDAVEELQAEASHQRVKGTGKTSLEAYCDS  63

Query  250  NPESEECRTYDN  215
            NPE++ECR YDN
Sbjct  64   NPEADECRVYDN  75



>ref|WP_011143687.1| hypothetical protein [Gloeobacter violaceus]
 ref|NP_926644.1| hypothetical protein gsr3698 [Gloeobacter violaceus PCC 7421]
 dbj|BAC91639.1| gsr3698 [Gloeobacter violaceus PCC 7421]
Length=75

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  391  AEEACA--GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDNPESEECRTYD  218
            A+E C+  GD  S +C AAWD VEE+ AAASHA DK K  N L+ +C DNP++ ECR Y+
Sbjct  16   AKEICSINGDG-SAQCAAAWDAVEEVQAAASHAGDKDKKMNSLQSYCADNPDAAECRIYE  74

Query  217  N  215
            +
Sbjct  75   D  75



>ref|WP_036481640.1| hypothetical protein [Myxosarcina sp. GI1]
Length=74

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGE-CVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + E++    + A E C+ +  S E C  AWD VEEL A ASH R K    N LE++C+
Sbjct  2    SDIQERINQERQKAREVCSTEGDSSENCAVAWDTVEELQAEASHQRTKAPKKNSLEQYCE  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDAPECRVYED  74



>ref|WP_017293080.1| hypothetical protein [Geminocystis herdmanii]
Length=74

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ EK+ + +K A E C      S EC AAWD VEEL A ASH ++ +     LE++C 
Sbjct  2    SNIQEKIQEEIKEAREVCDINGKGSPECAAAWDAVEELQAEASHQKENEHPKTSLEQYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDAAECRLYED  74



>ref|XP_010061244.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Eucalyptus 
grandis]
Length=148

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -3

Query  433  DSSLSEKVADSVKNAEEACAGDPTSGECVAAWDEVEELSAAASHARDK-KKDSNPLEEFC  257
            +  L+E + + V+ A E C GD  S  C  AWDEVEE+S A +  R + +K  +PLE FC
Sbjct  75   EKRLAEMIEEKVREAREVCEGDARSDGCKVAWDEVEEVSQAKADLRLRLEKQQDPLESFC  134

Query  256  KDNPESEECRTY  221
            + NP+++ECR +
Sbjct  135  EQNPDTDECRVH  146



>emb|CAB56831.1| hypothetical protein [Cyanophora paradoxa]
Length=85

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 8/82 (10%)
 Frame = -3

Query  448  VCAAPDSSLSEKVADSVKNA----EEACAGDPTSGECVAAWDEVEELSAAASHARDKKKD  281
            V A+ D S+ E++  ++  A    EE  A   TS E   AWDEVEEL A  SH + + K 
Sbjct  8    VFASADLSIQERIQKAISQARAVAEEKGA---TSKEARVAWDEVEELEAELSHQKAQPK-  63

Query  280  SNPLEEFCKDNPESEECRTYDN  215
            ++PL+EFCK+NPE++ECR Y++
Sbjct  64   ADPLQEFCKENPETDECRLYED  85



>ref|WP_029636735.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=81

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S +  ++ + V+ A   C    T S EC AAWD VEEL A ASH R  KK  N LE++C 
Sbjct  10   SDIQAQINEEVEQARTVCDISGTNSAECAAAWDAVEELQAEASHQRQNKK-KNSLEQYCD  68

Query  253  DNPESEECRTYDN  215
            DNPE+ ECR  DN
Sbjct  69   DNPEAIECRIDDN  81



>ref|WP_023072932.1| protein regulation of calvin cycle via association dissociation 
of prk cp12 gapdh complex [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36245.1| protein regulation of calvin cycle via association dissociation 
of prk cp12 gapdh complex [Leptolyngbya sp. Heron Island 
J]
Length=74

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPTSGE-CVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + EK+++ +K A + C+ D  + E C AAWD VEEL A ASH R+  K     E +C 
Sbjct  2    SDIQEKISEEIKAARDVCSTDGGNSETCAAAWDAVEELQAEASHQREASKPKTNFETYCD  61

Query  253  DNPESEECRTYDN  215
            +NP+++ECR Y++
Sbjct  62   ENPDADECRIYED  74



>ref|WP_015200789.1| hypothetical protein [Calothrix parietina]
 ref|YP_007140151.1| hypothetical protein Cal6303_5293 [Calothrix sp. PCC 6303]
 gb|AFZ04179.1| protein of unknown function CP12 [Calothrix sp. PCC 6303]
Length=74

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            +++ +++ + V+ A   C    T S EC AAWD VEEL A ASH R  K+  N LE +C 
Sbjct  3    NNIQDQIQEEVQQARTVCDVSGTNSAECAAAWDAVEELQAEASHQRQAKQ-KNSLERYCD  61

Query  253  DNPESEECRTYDN  215
            DNPE++EC+ Y++
Sbjct  62   DNPEADECKIYED  74



>ref|WP_039754825.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF28430.1| hypothetical protein PI95_57615 [Hassallia byssoidea VB512170]
Length=81

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +++   V+ A   C      S EC AAWD VEEL A ASH R  KK  N LE++C 
Sbjct  10   SNIDDQIEQEVEQARTVCDISGNNSAECAAAWDAVEELRAEASHQRQNKK-KNSLEQYCD  68

Query  253  DNPESEECRTYDN  215
            DNPE+ ECR  DN
Sbjct  69   DNPEAIECRIDDN  81



>ref|WP_015145579.1| CP12 domain-containing protein [Pleurocapsa minor]
 ref|YP_007082838.1| CP12 domain-containing protein [Pleurocapsa sp. PCC 7327]
 gb|AFY79281.1| CP12 domain protein [Pleurocapsa sp. PCC 7327]
Length=74

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S +  ++   ++NA   C+ +  TS EC AAWD VEEL A A+H R K  +    +++C 
Sbjct  2    SDIKNQIEQEIENARTVCSTEGETSSECAAAWDAVEELQAEAAHQRQKHPEKTSFQQYCD  61

Query  253  DNPESEECRTYDN  215
            +NP++ ECR YD+
Sbjct  62   ENPDAAECRVYDD  74



>ref|WP_023068047.1| CBS domain protein [Lyngbya aestuarii]
 gb|ERT05749.1| CBS domain protein [Lyngbya aestuarii BL J]
Length=204

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACA-GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L E++ +++K+A   CA    TS EC AAWD VEEL A A+H + ++ +    E FC++N
Sbjct  134  LEERIQEAIKDARATCAEKGATSKECAAAWDIVEELQAEAAHQKAERIEKTAFEAFCEEN  193

Query  247  PESEECRTYDN  215
            P++ E R YDN
Sbjct  194  PDAAEARVYDN  204



>ref|WP_015120210.1| CP12 domain-containing protein [Rivularia sp. PCC 7116]
 ref|YP_007057195.1| CP12 domain-containing protein [Rivularia sp. PCC 7116]
 gb|AFY56648.1| CP12 domain protein [Rivularia sp. PCC 7116]
Length=73

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + +K+ + ++ A   C      S EC AAWD VEEL A ASH R + K  N LE++C 
Sbjct  2    SDIKDKIQEELQEARTVCDTSGSNSAECAAAWDAVEELQAEASHQR-QSKPKNSLEKYCD  60

Query  253  DNPESEECRTYDN  215
            +NPE++ECR YD+
Sbjct  61   ENPEADECRVYDD  73



>ref|WP_009629451.1| protein of unknown function CP12 [Pseudanabaena biceps]
 gb|ELS30493.1| protein of unknown function CP12 [Pseudanabaena biceps PCC 7429]
Length=73

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGDPT-SGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ EK+ + V+ A + C    T S EC  AWD VEEL A ASH + ++K  N LE +C 
Sbjct  2    SNIKEKILEEVQIARQICETSGTDSKECAVAWDGVEELQAEASHQK-QEKSKNSLEVYCD  60

Query  253  DNPESEECRTYDN  215
            DNPE+ ECR Y++
Sbjct  61   DNPEAAECRLYED  73



>ref|WP_012594266.1| MULTISPECIES: hypothetical protein [Cyanothece]
 ref|YP_002371147.1| hypothetical protein PCC8801_0914 [Cyanothece sp. PCC 8801]
 ref|YP_003136710.1| hypothetical protein Cyan8802_0941 [Cyanothece sp. PCC 8802]
 gb|ACK64991.1| protein of unknown function CP12 [Cyanothece sp. PCC 8801]
 gb|ACU99874.1| protein of unknown function CP12 [Cyanothece sp. PCC 8802]
Length=74

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ E +   ++NA E C+ +   SG+C AAWD VEEL A ASH R  +      +++C 
Sbjct  2    SNIEETIEKELQNAREVCSTEGANSGDCAAAWDAVEELQAEASHQRQNQPAKTDFQKYCD  61

Query  253  DNPESEECRTYDN  215
            DNP++ ECR Y++
Sbjct  62   DNPDAVECRMYED  74



>ref|WP_002781201.1| hypothetical protein [Microcystis aeruginosa]
 dbj|BAG48286.1| CP12 polypeptide [Microcystis aeruginosa NIES-843]
 emb|CCH96080.1| CP12 polypeptide [Microcystis aeruginosa PCC 9717]
 emb|CCI15198.1| CP12 polypeptide [Microcystis aeruginosa PCC 9806]
 emb|CCI30119.1| CP12 polypeptide [Microcystis aeruginosa PCC 9809]
 dbj|GAL91700.1| protein CP12, regulation of calvin cycle via association/dissociation 
of PRK/CP12/GAPDH complex [Microcystis aeruginosa NIES-44]
Length=74

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 1/73 (1%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S++ +K+ + ++NA   C+ +  TSGEC AAWD VEEL A A+H R         E +C 
Sbjct  2    SNIQDKIQEELENARAVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKTYFENYCD  61

Query  253  DNPESEECRTYDN  215
             NP++ ECR Y++
Sbjct  62   SNPDAAECRIYED  74



>ref|WP_014275448.1| hypothetical protein [Arthrospira platensis]
 ref|YP_005069080.1| hypothetical protein [Arthrospira platensis NIES-39]
 dbj|BAI90542.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=204

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L++++  +++ A   CA    TS EC AAWD VEEL A A+H R ++ +    E +C++N
Sbjct  134  LADRIEQAIEEARATCAAKGATSRECAAAWDIVEELQAEAAHQRSERIEKTAFEVYCEEN  193

Query  247  PESEECRTYDN  215
            PE+ E R YDN
Sbjct  194  PEAAEARVYDN  204



>ref|WP_019493833.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=72

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 6/74 (8%)
 Frame = -3

Query  427  SLSEKVADSVKNAEEACAGDPTSGE---CVAAWDEVEELSAAASHARDKKKDSNPLEEFC  257
            S+ E++   ++ A   C  D T GE   C AAWD VEEL A ASH R +K  S+ LE++C
Sbjct  2    SIQERIQQELEQARAVC--DATGGESSECAAAWDAVEELQAEASHQRQEKPKSS-LEQYC  58

Query  256  KDNPESEECRTYDN  215
             DNPE+ ECR Y+ 
Sbjct  59   DDNPEAAECRVYEE  72



>ref|WP_015137816.1| CP12 domain-containing protein [Nostoc sp. PCC 7524]
 ref|YP_007074960.1| CP12 domain-containing protein [Nostoc sp. PCC 7524]
 gb|AFY47363.1| CP12 domain protein [Nostoc sp. PCC 7524]
Length=78

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            ++L  ++   V+ A   C      S EC AAWD VEEL A ASH R + K  N LE++C 
Sbjct  7    NNLQNQIEAEVEQARAVCDLSGSNSAECAAAWDAVEELQAEASHQR-QNKPKNSLEQYCD  65

Query  253  DNPESEECRTYD  218
            DNPE+ ECR YD
Sbjct  66   DNPEAAECRVYD  77



>ref|WP_017717331.1| CP12 polypeptide [Oscillatoria sp. PCC 10802]
Length=204

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACA-GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L +++  +V+ A   CA   PTS EC AAWD VEEL A ASH R +K      EE+C +N
Sbjct  134  LDQRIQKAVEEARATCAEKGPTSKECAAAWDIVEELQAEASHQRGQKLVKTAFEEYCDEN  193

Query  247  PESEECRTYD  218
            P++ E R Y+
Sbjct  194  PDAAEARIYE  203



>ref|WP_015184117.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007123387.1| hypothetical protein Mic7113_4282 [Microcoleus sp. PCC 7113]
 gb|AFZ19981.1| CBS domain-containing protein [Microcoleus sp. PCC 7113]
Length=204

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACAGD-PTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
             ++K+ ++++NA   C      S EC AAWD VEE+ A A+H R KK D    +E+C++ 
Sbjct  134  FADKIQEAIENARTICTQKGAASPECAAAWDAVEEMQAEAAHQRAKKVDKTAFDEYCEEY  193

Query  247  PESEECRTYDN  215
            PE+ E R YDN
Sbjct  194  PEALEARIYDN  204



>ref|WP_037220753.1| hypothetical protein [Richelia intracellularis]
 emb|CDN13693.1| Protein CP12, regulation of Calvin cycle via association/dissociation 
of PRK/CP12/GAPDH complex [Richelia intracellularis]
Length=73

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 2/73 (3%)
 Frame = -3

Query  430  SSLSEKVADSVKNAEEAC-AGDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCK  254
            S + EK+ + ++ A   C      S EC AAWD VEEL A ASH + + K  N LE++C 
Sbjct  2    SDIQEKIQEELEQARAVCDTSGNNSAECAAAWDAVEELQAEASHQK-QAKPKNSLEQYCD  60

Query  253  DNPESEECRTYDN  215
            +NPE+ ECR YD+
Sbjct  61   ENPEAAECRVYDD  73



>ref|WP_006621675.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ97086.1| protein of unknown function CP12 [Arthrospira maxima CS-328]
 emb|CCE20451.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 gb|EKD10546.1| hypothetical protein SPLC1_S082210 [Arthrospira platensis C1]
 emb|CDM92988.1| conserved protein of unknown function [Arthrospira sp. PCC 8005]
Length=205

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -3

Query  424  LSEKVADSVKNAEEACA-GDPTSGECVAAWDEVEELSAAASHARDKKKDSNPLEEFCKDN  248
            L++++  ++++A   CA    TS EC AAWD VEEL A A+H R ++ +    E +C++N
Sbjct  135  LADRIEQAIEDARATCAEKGATSRECAAAWDIVEELQAEAAHQRSERIEKTAFEVYCEEN  194

Query  247  PESEECRTYDN  215
            PE+ E R YDN
Sbjct  195  PEAVEARVYDN  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1639611019956