BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7867_g1_i1 len=888 path=[520:0-887]

Length=888
                                                                      Score     E

ref|XP_009771308.1|  PREDICTED: ethylene-responsive transcription...    247   1e-76   
ref|XP_009613551.1|  PREDICTED: ethylene-responsive transcription...    243   3e-75   
ref|XP_006347933.1|  PREDICTED: ethylene-responsive transcription...    229   4e-70   
ref|XP_009613128.1|  PREDICTED: ethylene-responsive transcription...    227   6e-69   
ref|XP_004229764.1|  PREDICTED: ethylene-responsive transcription...    227   6e-69   
ref|XP_009791350.1|  PREDICTED: ethylene-responsive transcription...    216   8e-65   
ref|XP_011089857.1|  PREDICTED: ethylene-responsive transcription...    215   3e-64   
gb|ADJ67431.1|  ethylene response factor 2                              212   3e-63   
ref|XP_011032938.1|  PREDICTED: ethylene-responsive transcription...    213   3e-63   
gb|ABQ62972.1|  TINY-like protein                                       209   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006375232.1|  hypothetical protein POPTR_0014s05500g             209   3e-62   
ref|XP_006364331.1|  PREDICTED: ethylene-responsive transcription...    206   3e-61   
ref|XP_009628141.1|  PREDICTED: ethylene-responsive transcription...    206   5e-61   
ref|XP_011093328.1|  PREDICTED: ethylene-responsive transcription...    204   2e-60   
ref|XP_002880148.1|  hypothetical protein ARALYDRAFT_483623             204   5e-60   
ref|XP_006345609.1|  PREDICTED: ethylene-responsive transcription...    201   6e-60   
ref|NP_182021.1|  ethylene-responsive transcription factor ERF034       204   7e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09462.1|  unnamed protein product                                203   2e-59   
gb|AAM64613.1|  putative AP2 domain transcription factor                203   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AHB33875.1|  ERF transcription factor 04                             202   4e-59   
ref|XP_008232393.1|  PREDICTED: ethylene-responsive transcription...    199   3e-58   
ref|XP_006397675.1|  hypothetical protein EUTSA_v10001792mg             199   5e-58   
gb|KFK37291.1|  hypothetical protein AALP_AA4G238300                    198   1e-57   
ref|XP_004240059.1|  PREDICTED: ethylene-responsive transcription...    196   2e-57   
ref|XP_007140776.1|  hypothetical protein PHAVU_008G141000g             197   4e-57   
ref|XP_007218799.1|  hypothetical protein PRUPE_ppa009812mg             196   4e-57   
gb|EYU31917.1|  hypothetical protein MIMGU_mgv1a014733mg                193   5e-57   
ref|XP_010544587.1|  PREDICTED: ethylene-responsive transcription...    193   8e-56   
ref|XP_007052232.1|  Integrase-type DNA-binding superfamily prote...    194   9e-56   
ref|XP_007134514.1|  hypothetical protein PHAVU_010G054000g             192   1e-55   
emb|CDX74699.1|  BnaA05g04450D                                          192   2e-55   
ref|XP_010524419.1|  PREDICTED: ethylene-responsive transcription...    192   2e-55   
gb|KHN34489.1|  Ethylene-responsive transcription factor ERF034         191   4e-55   
emb|CDY18963.1|  BnaC04g03870D                                          191   4e-55   
ref|XP_008356544.1|  PREDICTED: ethylene-responsive transcription...    191   6e-55   
ref|XP_003521085.1|  PREDICTED: ethylene-responsive transcription...    191   7e-55   
ref|XP_003530164.1|  PREDICTED: ethylene-responsive transcription...    192   1e-54   
ref|XP_009143083.1|  PREDICTED: ethylene-responsive transcription...    190   1e-54   
ref|XP_003622605.1|  Ethylene-responsive transcription factor ERF034    187   6e-54   
ref|XP_003516798.1|  PREDICTED: ethylene-responsive transcription...    187   7e-54   
emb|CDX95624.1|  BnaC03g25050D                                          188   7e-54   
ref|XP_010508227.1|  PREDICTED: ethylene-responsive transcription...    187   1e-53   
gb|ACU24100.1|  unknown                                                 188   1e-53   Glycine max [soybeans]
ref|XP_002511623.1|  Transcriptional factor TINY, putative              187   2e-53   Ricinus communis
ref|XP_010661364.1|  PREDICTED: ethylene-responsive transcription...    184   9e-53   
ref|XP_009133691.1|  PREDICTED: ethylene-responsive transcription...    184   1e-52   
gb|KDP28842.1|  hypothetical protein JCGZ_14613                         182   4e-52   
ref|XP_008347085.1|  PREDICTED: ethylene-responsive transcription...    183   4e-52   
emb|CDX83411.1|  BnaA03g20950D                                          183   7e-52   
ref|XP_004510113.1|  PREDICTED: ethylene-responsive transcription...    179   2e-51   
ref|XP_002301249.2|  hypothetical protein POPTR_0002s14210g             181   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_007039780.1|  Integrase-type DNA-binding superfamily prote...    179   6e-51   
ref|XP_010518106.1|  PREDICTED: ethylene-responsive transcription...    180   6e-51   
ref|XP_007155687.1|  hypothetical protein PHAVU_003G222600g             178   9e-51   
ref|XP_009116730.1|  PREDICTED: ethylene-responsive transcription...    178   2e-50   
emb|CDY41162.1|  BnaA09g38530D                                          178   2e-50   
ref|XP_009142308.1|  PREDICTED: ethylene-responsive transcription...    177   8e-50   
gb|ABQ62974.1|  TINY-like protein                                       177   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_004301177.1|  PREDICTED: ethylene-responsive transcription...    175   2e-49   
emb|CDX71804.1|  BnaC08g30700D                                          176   2e-49   
ref|XP_010506433.1|  PREDICTED: ethylene-responsive transcription...    176   3e-49   
ref|XP_003626728.1|  Ethylene-responsive transcription factor TINY      173   6e-49   
gb|KFK35254.1|  hypothetical protein AALP_AA5G261400                    174   9e-49   
ref|XP_004307005.1|  PREDICTED: ethylene-responsive transcription...    173   2e-48   
ref|XP_004508937.1|  PREDICTED: ethylene-responsive transcription...    172   3e-48   
ref|XP_006368997.1|  hypothetical protein POPTR_0001s15550g             172   5e-48   
gb|ABQ62971.1|  TINY-like protein                                       171   5e-48   Populus trichocarpa [western balsam poplar]
emb|CDX98416.1|  BnaC06g17770D                                          171   6e-48   
ref|XP_010264388.1|  PREDICTED: ethylene-responsive transcription...    172   1e-47   
ref|XP_006291643.1|  hypothetical protein CARUB_v10017799mg             171   1e-47   
emb|CDX67829.1|  BnaA07g18690D                                          170   2e-47   
ref|XP_006294662.1|  hypothetical protein CARUB_v10023699mg             172   2e-47   
ref|XP_010469178.1|  PREDICTED: ethylene-responsive transcription...    171   2e-47   
ref|NP_001235341.1|  dehydration-responsive element binding prote...    169   3e-47   
ref|XP_009104264.1|  PREDICTED: ethylene-responsive transcription...    170   3e-47   
gb|KHN43745.1|  Ethylene-responsive transcription factor ERF034         167   5e-47   
ref|XP_002876560.1|  hypothetical protein ARALYDRAFT_486521             170   5e-47   
ref|NP_191608.1|  ethylene-responsive transcription factor ERF035       169   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056415.1|  PREDICTED: ethylene-responsive transcription...    170   8e-47   
ref|XP_004492188.1|  PREDICTED: ethylene-responsive transcription...    168   1e-46   
ref|XP_008803818.1|  PREDICTED: ethylene-responsive transcription...    170   2e-46   
ref|XP_010258834.1|  PREDICTED: ethylene-responsive transcription...    169   2e-46   
ref|XP_009400894.1|  PREDICTED: ethylene-responsive transcription...    167   2e-46   
ref|XP_009387933.1|  PREDICTED: ethylene-responsive transcription...    167   2e-46   
gb|AGB05623.1|  DREB4A family transcription factor 2                    166   3e-46   
ref|XP_003549925.1|  PREDICTED: ethylene-responsive transcription...    167   3e-46   
ref|XP_007010564.1|  Ethylene response factor 2                         167   5e-46   
ref|XP_007038336.1|  Ethylene response factor 2                         167   5e-46   
gb|AES90882.2|  ethylene response factor                                167   6e-46   
ref|XP_002303364.1|  hypothetical protein POPTR_0003s07700g             166   6e-46   Populus trichocarpa [western balsam poplar]
ref|XP_009401144.1|  PREDICTED: ethylene-responsive transcription...    166   8e-46   
gb|KDP39899.1|  hypothetical protein JCGZ_03430                         166   8e-46   
ref|XP_011048423.1|  PREDICTED: ethylene-responsive transcription...    165   1e-45   
ref|XP_010413552.1|  PREDICTED: ethylene-responsive transcription...    166   1e-45   
ref|XP_003608685.1|  Ethylene-responsive transcription factor TINY      166   2e-45   
ref|XP_011001450.1|  PREDICTED: ethylene-responsive transcription...    165   2e-45   
ref|XP_010512376.1|  PREDICTED: ethylene-responsive transcription...    166   2e-45   
ref|XP_010264429.1|  PREDICTED: ethylene-responsive transcription...    163   7e-45   
ref|XP_004147220.1|  PREDICTED: ethylene-responsive transcription...    162   1e-44   
ref|XP_004301176.1|  PREDICTED: ethylene-responsive transcription...    160   2e-44   
ref|XP_003611338.1|  Ethylene-responsive transcription factor TINY      160   2e-44   
ref|XP_011031921.1|  PREDICTED: ethylene-responsive transcription...    161   4e-44   
ref|XP_006402577.1|  hypothetical protein EUTSA_v10006200mg             162   4e-44   
ref|XP_004162335.1|  PREDICTED: ethylene-responsive transcription...    160   5e-44   
ref|XP_009400694.1|  PREDICTED: ethylene-responsive transcription...    160   9e-44   
ref|XP_011016474.1|  PREDICTED: ethylene-responsive transcription...    160   1e-43   
ref|XP_008448820.1|  PREDICTED: ethylene-responsive transcription...    159   2e-43   
ref|XP_008796155.1|  PREDICTED: ethylene-responsive transcription...    159   2e-43   
ref|XP_008437812.1|  PREDICTED: ethylene-responsive transcription...    159   4e-43   
ref|XP_003635248.1|  PREDICTED: ethylene-responsive transcription...    158   4e-43   
ref|XP_009391523.1|  PREDICTED: ethylene-responsive transcription...    159   4e-43   
ref|XP_010919644.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    159   6e-43   
gb|AAX23704.1|  HvCBF7                                                  157   8e-43   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006421614.1|  hypothetical protein CICLE_v10006536mg             157   1e-42   
emb|CBI16632.3|  unnamed protein product                                164   2e-42   
ref|XP_010677077.1|  PREDICTED: ethylene-responsive transcription...    157   2e-42   
gb|EPS64897.1|  hypothetical protein M569_09882                         155   5e-42   
ref|XP_010505090.1|  PREDICTED: ethylene-responsive transcription...    154   7e-42   
ref|XP_009133039.1|  PREDICTED: ethylene-responsive transcription...    153   3e-41   
gb|AGE97371.1|  ethylene response factor 16                             154   3e-41   
ref|XP_010516772.1|  PREDICTED: ethylene-responsive transcription...    152   5e-41   
ref|XP_009389773.1|  PREDICTED: ethylene-responsive transcription...    152   5e-41   
ref|XP_006490227.1|  PREDICTED: ethylene-responsive transcription...    153   5e-41   
emb|CDX79619.1|  BnaC03g19550D                                          152   7e-41   
ref|XP_002516502.1|  Transcriptional factor TINY, putative              153   1e-40   Ricinus communis
gb|KDO61381.1|  hypothetical protein CISIN_1g023148mg                   153   2e-40   
gb|KDO61382.1|  hypothetical protein CISIN_1g023148mg                   153   2e-40   
ref|XP_006477148.1|  PREDICTED: ethylene-responsive transcription...    153   2e-40   
ref|XP_008238439.1|  PREDICTED: ethylene-responsive transcription...    152   2e-40   
gb|KDO61383.1|  hypothetical protein CISIN_1g023148mg                   152   2e-40   
ref|XP_004512200.1|  PREDICTED: ethylene-responsive transcription...    151   3e-40   
ref|XP_006295043.1|  hypothetical protein CARUB_v10024111mg             150   3e-40   
gb|KDO49961.1|  hypothetical protein CISIN_1g0410151mg                  150   3e-40   
ref|XP_008678901.1|  PREDICTED: ethylene-responsive transcription...    150   3e-40   
ref|XP_009398119.1|  PREDICTED: ethylene-responsive transcription...    150   4e-40   
ref|XP_007012129.1|  Integrase-type DNA-binding superfamily protein     151   4e-40   
ref|XP_009397875.1|  PREDICTED: ethylene-responsive transcription...    151   4e-40   
ref|XP_002879568.1|  hypothetical protein ARALYDRAFT_482537             149   5e-40   
ref|XP_006440269.1|  hypothetical protein CICLE_v10024602mg             152   7e-40   
emb|CDY45018.1|  BnaA08g12010D                                          150   7e-40   
ref|XP_009384462.1|  PREDICTED: ethylene-responsive transcription...    150   7e-40   
ref|XP_010104873.1|  Dehydration-responsive element-binding prote...    151   9e-40   
ref|NP_001239694.1|  dehydration-responsive element-binding prote...    148   1e-39   
ref|XP_002873522.1|  hypothetical protein ARALYDRAFT_487996             150   1e-39   
ref|XP_006399666.1|  hypothetical protein EUTSA_v10015895mg             150   1e-39   
ref|XP_006837306.1|  hypothetical protein AMTR_s00111p00051610          152   1e-39   
ref|XP_010646855.1|  PREDICTED: ethylene-responsive transcription...    149   2e-39   
ref|XP_009367456.1|  PREDICTED: ethylene-responsive transcription...    149   2e-39   
ref|XP_004134290.1|  PREDICTED: ethylene-responsive transcription...    149   2e-39   
ref|XP_003635442.1|  PREDICTED: ethylene-responsive transcription...    149   2e-39   
gb|KDP34150.1|  hypothetical protein JCGZ_07721                         149   2e-39   
ref|NP_001065380.1|  Os10g0560700                                       150   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010933634.1|  PREDICTED: LOW QUALITY PROTEIN: ethylene-res...    149   2e-39   
emb|CBI23469.3|  unnamed protein product                                149   2e-39   
ref|XP_004252501.1|  PREDICTED: dehydration-responsive element-bi...    145   3e-39   
gb|ABK28523.1|  unknown                                                 147   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181113.1|  ethylene-responsive transcription factor ERF038       147   3e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AGE97368.1|  ethylene response factor 13                             150   3e-39   
emb|CDY32094.1|  BnaC04g44720D                                          147   3e-39   
ref|XP_006356143.1|  PREDICTED: ethylene-responsive transcription...    147   4e-39   
ref|XP_010509574.1|  PREDICTED: ethylene-responsive transcription...    147   4e-39   
emb|CBI29555.3|  unnamed protein product                                149   4e-39   
ref|XP_006445373.1|  hypothetical protein CICLE_v10021740mg             149   4e-39   
gb|EPS69652.1|  hypothetical protein M569_05115                         146   5e-39   
ref|XP_002454537.1|  hypothetical protein SORBIDRAFT_04g032940          148   5e-39   Sorghum bicolor [broomcorn]
ref|XP_010053505.1|  PREDICTED: ethylene-responsive transcription...    147   6e-39   
ref|XP_002283864.1|  PREDICTED: ethylene-responsive transcription...    148   6e-39   Vitis vinifera
ref|XP_010254012.1|  PREDICTED: ethylene-responsive transcription...    147   7e-39   
ref|XP_010526108.1|  PREDICTED: ethylene-responsive transcription...    148   7e-39   
ref|XP_004241746.1|  PREDICTED: dehydration-responsive element-bi...    146   7e-39   
gb|AGE97369.1|  ethylene response factor 14                             148   9e-39   
gb|ADE41137.1|  AP2 domain class transcription factor                   147   9e-39   
ref|XP_008646010.1|  PREDICTED: ethylene-responsive transcription...    148   1e-38   
ref|XP_010249578.1|  PREDICTED: dehydration-responsive element-bi...    147   1e-38   
ref|XP_009138144.1|  PREDICTED: ethylene-responsive transcription...    147   1e-38   
ref|XP_006343055.1|  PREDICTED: dehydration-responsive element-bi...    147   1e-38   
ref|XP_011072408.1|  PREDICTED: dehydration-responsive element-bi...    146   1e-38   
ref|XP_010440105.1|  PREDICTED: ethylene-responsive transcription...    144   2e-38   
ref|XP_011012511.1|  PREDICTED: ethylene-responsive transcription...    146   2e-38   
ref|XP_009136807.1|  PREDICTED: ethylene-responsive transcription...    144   2e-38   
dbj|BAJ87193.1|  predicted protein                                      147   2e-38   
emb|CDY13503.1|  BnaA03g52210D                                          145   2e-38   
ref|XP_004291182.1|  PREDICTED: dehydration-responsive element-bi...    147   2e-38   
ref|XP_008393869.1|  PREDICTED: dehydration-responsive element-bi...    146   2e-38   
ref|XP_002303301.1|  hypothetical protein POPTR_0003s04920g             146   2e-38   Populus trichocarpa [western balsam poplar]
gb|AAX28965.1|  TmCBF7                                                  147   2e-38   Triticum monococcum [einkorn wheat]
ref|XP_006465666.1|  PREDICTED: ethylene-responsive transcription...    146   2e-38   
ref|XP_009108829.1|  PREDICTED: ethylene-responsive transcription...    146   3e-38   
gb|KFK25419.1|  hypothetical protein AALP_AA8G112500                    146   3e-38   
ref|XP_006476039.1|  PREDICTED: dehydration-responsive element-bi...    145   3e-38   
ref|XP_008795185.1|  PREDICTED: dehydration-responsive element-bi...    146   3e-38   
ref|XP_006450687.1|  hypothetical protein CICLE_v10009370mg             145   3e-38   
ref|XP_006289586.1|  hypothetical protein CARUB_v10003136mg             145   3e-38   
ref|XP_011004731.1|  PREDICTED: dehydration-responsive element-bi...    146   4e-38   
ref|XP_002324799.1|  hypothetical protein POPTR_0018s00270g             146   4e-38   Populus trichocarpa [western balsam poplar]
ref|XP_010419734.1|  PREDICTED: dehydration-responsive element-bi...    145   4e-38   
ref|XP_010062516.1|  PREDICTED: ethylene-responsive transcription...    147   4e-38   
ref|XP_004953340.1|  PREDICTED: ethylene-responsive transcription...    147   4e-38   
emb|CDP08151.1|  unnamed protein product                                147   4e-38   
ref|NP_001241356.1|  dehydration-responsive element-binding prote...    144   4e-38   
ref|XP_006426907.1|  hypothetical protein CICLE_v10027587mg             145   5e-38   
gb|ACU23160.1|  unknown                                                 144   5e-38   Glycine max [soybeans]
ref|XP_008374052.1|  PREDICTED: ethylene-responsive transcription...    143   5e-38   
ref|XP_006282732.1|  hypothetical protein CARUB_v10005867mg             143   5e-38   
ref|NP_001047629.1|  Os02g0657000                                       145   5e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010089277.1|  Ethylene-responsive transcription factor           145   5e-38   
ref|XP_004953342.1|  PREDICTED: ethylene-responsive transcription...    145   6e-38   
ref|XP_008220077.1|  PREDICTED: dehydration-responsive element-bi...    145   6e-38   
gb|KDO56992.1|  hypothetical protein CISIN_1g038538mg                   145   6e-38   
ref|XP_007209502.1|  hypothetical protein PRUPE_ppa010340mg             145   6e-38   
gb|KHN04233.1|  Dehydration-responsive element-binding protein 3        144   7e-38   
dbj|BAK05071.1|  predicted protein                                      146   7e-38   
ref|XP_009141508.1|  PREDICTED: ethylene-responsive transcription...    144   7e-38   
gb|KFK22266.1|  hypothetical protein AALP_AAs66747U002200               143   7e-38   
ref|XP_007137220.1|  hypothetical protein PHAVU_009G109600g             144   7e-38   
ref|XP_003529759.1|  PREDICTED: dehydration-responsive element-bi...    144   7e-38   
ref|XP_010915419.1|  PREDICTED: dehydration-responsive element-bi...    145   8e-38   
ref|XP_010434773.1|  PREDICTED: ethylene-responsive transcription...    143   8e-38   
emb|CDX72373.1|  BnaC07g43950D                                          144   8e-38   
ref|XP_009380474.1|  PREDICTED: ethylene-responsive transcription...    144   1e-37   
gb|EYU20436.1|  hypothetical protein MIMGU_mgv1a024757mg                144   1e-37   
ref|XP_007225774.1|  hypothetical protein PRUPE_ppa009533mg             145   1e-37   
emb|CDY49324.1|  BnaC03g66900D                                          143   1e-37   
ref|XP_009125819.1|  PREDICTED: dehydration-responsive element-bi...    144   1e-37   
ref|XP_004235656.1|  PREDICTED: ethylene-responsive transcription...    144   1e-37   
ref|NP_197953.1|  ethylene-responsive transcription factor TINY         143   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359762.1|  PREDICTED: dehydration-responsive element-bi...    143   2e-37   
ref|XP_009121933.1|  PREDICTED: dehydration-responsive element-bi...    144   2e-37   
ref|XP_010049108.1|  PREDICTED: ethylene-responsive transcription...    144   2e-37   
emb|CDY27827.1|  BnaC09g28540D                                          144   2e-37   
emb|CDX85705.1|  BnaA02g01080D                                          144   2e-37   
gb|KFK36467.1|  hypothetical protein AALP_AA4G128400                    142   2e-37   
emb|CDX69746.1|  BnaA10g20950D                                          144   2e-37   
gb|AIZ97485.1|  CBF-like protein CBF7                                   145   2e-37   
ref|XP_009143633.1|  PREDICTED: ethylene-responsive transcription...    143   2e-37   
ref|XP_008378086.1|  PREDICTED: ethylene-responsive transcription...    144   2e-37   
ref|NP_196720.1|  dehydration-responsive element-binding protein 3      144   2e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAH67503.1|  OSIGBa0134H18.5                                        144   2e-37   Oryza sativa [red rice]
emb|CDY72553.1|  BnaAnng41450D                                          142   2e-37   
ref|NP_001047627.1|  Os02g0656600                                       145   2e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009596664.1|  PREDICTED: dehydration-responsive element-bi...    142   3e-37   
ref|XP_002515992.1|  Transcriptional factor TINY, putative              144   3e-37   Ricinus communis
emb|CDO97995.1|  unnamed protein product                                144   3e-37   
ref|XP_006653648.1|  PREDICTED: ethylene-responsive transcription...    142   3e-37   
ref|XP_004245167.1|  PREDICTED: dehydration-responsive element-bi...    143   3e-37   
gb|AAW28084.1|  transcription factor DREBIII-1                          142   3e-37   Brassica napus [oilseed rape]
ref|XP_006412430.1|  hypothetical protein EUTSA_v10026204mg             142   3e-37   
ref|XP_010910974.1|  PREDICTED: ethylene-responsive transcription...    143   3e-37   
ref|XP_010102390.1|  Dehydration-responsive element-binding prote...    143   3e-37   
ref|NP_193408.1|  ethylene-responsive transcription factor ERF039       141   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160302.1|  hypothetical protein PHAVU_002G310200g             143   3e-37   
ref|XP_006414307.1|  hypothetical protein EUTSA_v10026276mg             142   4e-37   
ref|XP_008646012.1|  PREDICTED: ethylene-responsive transcription...    142   4e-37   
emb|CDY72344.1|  BnaCnng77210D                                          141   4e-37   
ref|XP_008348502.1|  PREDICTED: ethylene-responsive transcription...    143   4e-37   
ref|XP_010925663.1|  PREDICTED: ethylene-responsive transcription...    143   5e-37   
gb|KCW79102.1|  hypothetical protein EUGRSUZ_C00546                     142   5e-37   
gb|KFK27825.1|  hypothetical protein AALP_AA8G434600                    142   5e-37   
ref|XP_008810659.1|  PREDICTED: ethylene-responsive transcription...    142   6e-37   
ref|XP_009151103.1|  PREDICTED: ethylene-responsive transcription...    142   6e-37   
gb|KHN15832.1|  Dehydration-responsive element-binding protein 3        142   6e-37   
emb|CAH67502.1|  OSIGBa0134H18.4                                        144   6e-37   Oryza sativa [red rice]
emb|CDX75287.1|  BnaA01g04150D                                          141   6e-37   
emb|CDY09667.1|  BnaC07g33940D                                          140   7e-37   
ref|XP_004510292.1|  PREDICTED: ethylene-responsive transcription...    142   7e-37   
emb|CDX84176.1|  BnaC04g09380D                                          141   7e-37   
emb|CDX97125.1|  BnaC09g45000D                                          142   7e-37   
emb|CDX68891.1|  BnaC01g05620D                                          140   7e-37   
emb|CAD41607.2|  OSJNBb0034G17.3                                        142   7e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007161494.1|  hypothetical protein PHAVU_001G073800g             142   8e-37   
ref|XP_009125436.1|  PREDICTED: ethylene-responsive transcription...    142   8e-37   
ref|XP_009404533.1|  PREDICTED: ethylene-responsive transcription...    142   8e-37   
ref|XP_009767580.1|  PREDICTED: dehydration-responsive element-bi...    141   8e-37   
gb|ABA54282.1|  transcription factor DREBIII-4                          141   8e-37   Brassica napus [oilseed rape]
gb|EPS67314.1|  hypothetical protein M569_07461                         139   9e-37   
ref|XP_010047241.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    142   9e-37   
ref|XP_003626994.1|  Ethylene-responsive transcription factor TINY      141   1e-36   
ref|XP_009408707.1|  PREDICTED: ethylene-responsive transcription...    142   1e-36   
ref|XP_006289163.1|  hypothetical protein CARUB_v10002601mg             141   1e-36   
gb|ACJ84469.1|  unknown                                                 140   1e-36   
gb|KDP33726.1|  hypothetical protein JCGZ_07297                         142   1e-36   
ref|XP_010421439.1|  PREDICTED: ethylene-responsive transcription...    141   1e-36   
ref|XP_010240211.1|  PREDICTED: ethylene-responsive transcription...    143   1e-36   
ref|XP_006451256.1|  hypothetical protein CICLE_v10009138mg             143   1e-36   
gb|KEH36063.1|  AP2 domain class transcription factor                   140   1e-36   
ref|XP_009602025.1|  PREDICTED: dehydration-responsive element-bi...    141   1e-36   
ref|XP_010277347.1|  PREDICTED: ethylene-responsive transcription...    140   1e-36   
ref|NP_001053487.1|  Os04g0550200                                       141   1e-36   
ref|XP_010454922.1|  PREDICTED: ethylene-responsive transcription...    141   1e-36   
emb|CAH67505.1|  OSIGBa0134H18.7                                        141   1e-36   
ref|XP_009782186.1|  PREDICTED: ethylene-responsive transcription...    143   2e-36   
ref|XP_004976435.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   
gb|ABA54281.1|  transcription factor DREBIII-3                          140   2e-36   
emb|CDX80539.1|  BnaC07g29050D                                          141   2e-36   
gb|ABA54280.1|  transcription factor DREBIII-2                          140   2e-36   
ref|XP_007013070.1|  Integrase-type DNA-binding superfamily protein     141   2e-36   
ref|NP_001274158.1|  uncharacterized protein LOC101781338               142   2e-36   
ref|XP_009353569.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   
ref|XP_002514246.1|  Transcriptional factor TINY, putative              142   2e-36   
ref|XP_007215988.1|  hypothetical protein PRUPE_ppa011735mg             140   2e-36   
ref|XP_010493837.1|  PREDICTED: ethylene-responsive transcription...    140   2e-36   
ref|XP_009799693.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   
ref|XP_010449723.1|  PREDICTED: ethylene-responsive transcription...    139   2e-36   
ref|XP_004501158.1|  PREDICTED: dehydration-responsive element-bi...    139   2e-36   
ref|XP_003597699.1|  Ethylene-responsive transcription factor TINY      140   2e-36   
ref|XP_006359467.1|  PREDICTED: dehydration-responsive element-bi...    140   2e-36   
ref|XP_009610624.1|  PREDICTED: ethylene-responsive transcription...    141   2e-36   
gb|AEM63548.1|  dehydration-responsive element-binding protein DREB1    140   3e-36   
ref|XP_006394830.1|  hypothetical protein EUTSA_v10004870mg             140   3e-36   
ref|XP_009413850.1|  PREDICTED: dehydration-responsive element-bi...    141   3e-36   
ref|XP_002464932.1|  hypothetical protein SORBIDRAFT_01g029065          142   3e-36   
gb|ACI95260.1|  dehydration-responsive element binding protein          139   3e-36   
ref|XP_002454539.1|  hypothetical protein SORBIDRAFT_04g032960          142   3e-36   
ref|XP_010688291.1|  PREDICTED: ethylene-responsive transcription...    142   3e-36   
ref|XP_009421285.1|  PREDICTED: ethylene-responsive transcription...    140   3e-36   
ref|XP_009785489.1|  PREDICTED: ethylene-responsive transcription...    141   3e-36   
ref|NP_001053486.1|  Os04g0549700                                       142   4e-36   
ref|XP_009588133.1|  PREDICTED: ethylene-responsive transcription...    140   4e-36   
ref|XP_009145506.1|  PREDICTED: ethylene-responsive transcription...    139   4e-36   
gb|KDP37273.1|  hypothetical protein JCGZ_06329                         140   4e-36   
ref|XP_006282817.1|  hypothetical protein CARUB_v10006567mg             140   4e-36   
ref|XP_009399816.1|  PREDICTED: ethylene-responsive transcription...    140   4e-36   
ref|XP_002298236.1|  hypothetical protein POPTR_0001s18800g             140   4e-36   
emb|CDY66961.1|  BnaC09g50850D                                          139   5e-36   
ref|XP_002869242.1|  hypothetical protein ARALYDRAFT_913157             140   5e-36   
ref|XP_006406852.1|  hypothetical protein EUTSA_v10022278mg             140   5e-36   
ref|XP_003531655.2|  PREDICTED: dehydration-responsive element-bi...    142   5e-36   
ref|XP_008369428.1|  PREDICTED: ethylene-responsive transcription...    140   5e-36   
ref|XP_008794173.1|  PREDICTED: dehydration-responsive element-bi...    140   5e-36   
ref|XP_011091185.1|  PREDICTED: ethylene-responsive transcription...    140   6e-36   
ref|XP_010437852.1|  PREDICTED: ethylene-responsive transcription...    139   6e-36   
ref|XP_007024262.1|  Integrase-type DNA-binding superfamily protein     140   6e-36   
ref|XP_002868104.1|  hypothetical protein ARALYDRAFT_493200             138   6e-36   
ref|XP_008242523.1|  PREDICTED: dehydration-responsive element-bi...    141   7e-36   
emb|CDP09993.1|  unnamed protein product                                139   7e-36   
gb|KHN34916.1|  Dehydration-responsive element-binding protein 3        139   7e-36   
ref|XP_006853624.1|  hypothetical protein AMTR_s00056p00064760          141   7e-36   
ref|XP_002280555.2|  PREDICTED: dehydration-responsive element-bi...    140   7e-36   
ref|XP_007202464.1|  hypothetical protein PRUPE_ppa010130mg             140   7e-36   
ref|XP_009344189.1|  PREDICTED: ethylene-responsive transcription...    140   8e-36   
gb|EAY95076.1|  hypothetical protein OsI_16892                          137   8e-36   
gb|KDO66509.1|  hypothetical protein CISIN_1g041119mg                   140   9e-36   
gb|KFK38980.1|  hypothetical protein AALP_AA3G184500                    139   1e-35   
ref|XP_009620060.1|  PREDICTED: ethylene-responsive transcription...    140   1e-35   
ref|XP_008462760.1|  PREDICTED: ethylene-responsive transcription...    139   1e-35   
ref|XP_003572772.1|  PREDICTED: ethylene-responsive transcription...    139   1e-35   
ref|NP_001105081.1|  DREB-like protein                                  140   1e-35   
ref|XP_006355509.1|  PREDICTED: ethylene-responsive transcription...    139   1e-35   
ref|XP_010668364.1|  PREDICTED: dehydration-responsive element-bi...    140   1e-35   
gb|ABR16697.1|  unknown                                                 139   1e-35   
gb|AAM80485.1|AF493799_1  DRE binding factor 2                          140   1e-35   
ref|XP_009368950.1|  PREDICTED: ethylene-responsive transcription...    139   1e-35   
ref|NP_001237808.1|  TINY                                               139   1e-35   
ref|XP_003517069.1|  PREDICTED: dehydration-responsive element-bi...    138   1e-35   
ref|XP_006653649.1|  PREDICTED: ethylene-responsive transcription...    139   1e-35   
ref|XP_006294983.1|  hypothetical protein CARUB_v10024051mg             138   2e-35   
ref|XP_003538748.1|  PREDICTED: dehydration-responsive element-bi...    137   2e-35   
ref|NP_001149992.1|  dehydration-responsive element-binding prote...    138   2e-35   
ref|XP_006410739.1|  hypothetical protein EUTSA_v10017258mg             137   2e-35   
gb|ADE41141.1|  AP2 domain class transcription factor                   139   2e-35   
ref|XP_008460188.1|  PREDICTED: ethylene-responsive transcription...    137   2e-35   
ref|XP_009111677.1|  PREDICTED: ethylene-responsive transcription...    138   2e-35   
gb|EPS69678.1|  hypothetical protein M569_05091                         134   2e-35   
ref|XP_004170993.1|  PREDICTED: ethylene-responsive transcription...    137   2e-35   
ref|XP_003530573.1|  PREDICTED: dehydration-responsive element-bi...    138   2e-35   
emb|CDY19794.1|  BnaA09g04470D                                          137   2e-35   
ref|NP_195006.1|  ethylene-responsive transcription factor ERF043       138   2e-35   
ref|XP_011004913.1|  PREDICTED: ethylene-responsive transcription...    138   2e-35   
gb|EMT23855.1|  Ethylene-responsive transcription factor ERF034         139   2e-35   
ref|XP_010047704.1|  PREDICTED: ethylene-responsive transcription...    139   2e-35   
emb|CDY42937.1|  BnaA01g18170D                                          136   2e-35   
ref|XP_007135647.1|  hypothetical protein PHAVU_010G146600g             137   2e-35   
ref|XP_009780384.1|  PREDICTED: dehydration-responsive element-bi...    138   3e-35   
ref|XP_004151284.1|  PREDICTED: ethylene-responsive transcription...    137   3e-35   
emb|CDY30151.1|  BnaC05g37110D                                          138   3e-35   
ref|XP_009617333.1|  PREDICTED: ethylene-responsive transcription...    138   3e-35   
gb|KEH27173.1|  AP2 domain class transcription factor                   137   3e-35   
ref|XP_009352529.1|  PREDICTED: ethylene-responsive transcription...    139   3e-35   
ref|XP_009377993.1|  PREDICTED: ethylene-responsive transcription...    138   3e-35   
ref|XP_008353703.1|  PREDICTED: ethylene-responsive transcription...    138   3e-35   
ref|XP_008362954.1|  PREDICTED: ethylene-responsive transcription...    139   3e-35   
ref|XP_010447343.1|  PREDICTED: ethylene-responsive transcription...    138   3e-35   
gb|KHM98729.1|  Dehydration-responsive element-binding protein 3        136   3e-35   
gb|KFK32565.1|  hypothetical protein AALP_AA6G259700                    137   3e-35   
gb|EAZ31548.1|  hypothetical protein OsJ_15691                          137   3e-35   
ref|XP_002324441.2|  hypothetical protein POPTR_0018s09270g             139   3e-35   
gb|ABO48369.1|  TINY-like protein 2                                     139   3e-35   
ref|XP_011048337.1|  PREDICTED: ethylene-responsive transcription...    139   4e-35   
ref|XP_010692104.1|  PREDICTED: ethylene-responsive transcription...    139   4e-35   
ref|XP_008787070.1|  PREDICTED: dehydration-responsive element-bi...    135   4e-35   
ref|XP_009146154.1|  PREDICTED: ethylene-responsive transcription...    137   4e-35   
ref|XP_002446898.1|  hypothetical protein SORBIDRAFT_06g024530          140   4e-35   
ref|XP_004140628.1|  PREDICTED: ethylene-responsive transcription...    137   4e-35   
ref|XP_004161329.1|  PREDICTED: dehydration-responsive element-bi...    138   4e-35   
ref|XP_003533400.1|  PREDICTED: ethylene-responsive transcription...    137   5e-35   
ref|XP_004148719.1|  PREDICTED: LOW QUALITY PROTEIN: dehydration-...    137   5e-35   
ref|XP_004302874.1|  PREDICTED: dehydration-responsive element-bi...    138   5e-35   
ref|XP_003546954.1|  PREDICTED: ethylene-responsive transcription...    137   5e-35   
ref|XP_008775170.1|  PREDICTED: ethylene-responsive transcription...    137   5e-35   
ref|XP_009350478.1|  PREDICTED: ethylene-responsive transcription...    137   5e-35   
ref|XP_011009351.1|  PREDICTED: ethylene-responsive transcription...    138   6e-35   
ref|XP_002534158.1|  DNA binding protein, putative                      137   6e-35   
gb|EYU30725.1|  hypothetical protein MIMGU_mgv1a011460mg                138   7e-35   
ref|XP_009776195.1|  PREDICTED: dehydration-responsive element-bi...    136   7e-35   
ref|NP_001147713.1|  dehydration-responsive element-binding prote...    139   7e-35   
ref|XP_004503470.1|  PREDICTED: dehydration-responsive element-bi...    137   7e-35   
ref|XP_010542218.1|  PREDICTED: ethylene-responsive transcription...    137   7e-35   
ref|XP_011093630.1|  PREDICTED: ethylene-responsive transcription...    137   8e-35   
ref|XP_004287458.1|  PREDICTED: dehydration-responsive element-bi...    137   8e-35   
ref|XP_010432660.1|  PREDICTED: ethylene-responsive transcription...    137   8e-35   
ref|XP_006381752.1|  hypothetical protein POPTR_0006s17670g             138   9e-35   
gb|AET05216.2|  ethylene response factor                                136   9e-35   
gb|ADE41132.1|  AP2 domain class transcription factor                   137   1e-34   
ref|XP_009596026.1|  PREDICTED: dehydration-responsive element-bi...    135   1e-34   
ref|XP_007152902.1|  hypothetical protein PHAVU_004G169800g             136   1e-34   
gb|ABQ62966.1|  TINY-like protein                                       138   1e-34   
ref|XP_008447541.1|  PREDICTED: ethylene-responsive transcription...    135   1e-34   
ref|XP_010542217.1|  PREDICTED: ethylene-responsive transcription...    136   1e-34   
gb|ACF74280.1|  DREB-like protein                                       135   2e-34   
ref|XP_010691437.1|  PREDICTED: ethylene-responsive transcription...    136   2e-34   
ref|XP_008228463.1|  PREDICTED: ethylene-responsive transcription...    136   2e-34   
ref|XP_008805848.1|  PREDICTED: dehydration-responsive element-bi...    133   2e-34   
ref|XP_004976433.1|  PREDICTED: ethylene-responsive transcription...    137   2e-34   
ref|XP_010472602.1|  PREDICTED: ethylene-responsive transcription...    135   3e-34   
ref|XP_010429589.1|  PREDICTED: ethylene-responsive transcription...    135   3e-34   
ref|XP_003542090.1|  PREDICTED: dehydration-responsive element-bi...    135   3e-34   
emb|CAW30732.1|  TINY transcription factor                              134   3e-34   
ref|XP_010417360.1|  PREDICTED: ethylene-responsive transcription...    135   3e-34   
gb|EEE57511.1|  hypothetical protein OsJ_07796                          132   3e-34   
ref|XP_011081645.1|  PREDICTED: ethylene-responsive transcription...    135   3e-34   
ref|XP_008458661.1|  PREDICTED: dehydration-responsive element-bi...    135   4e-34   
ref|NP_188249.3|  ethylene-responsive transcription factor ERF036       135   4e-34   
ref|XP_003630740.1|  Ethylene-responsive transcription factor TINY      136   4e-34   
ref|XP_009140700.1|  PREDICTED: ethylene-responsive transcription...    134   4e-34   
gb|EYU29281.1|  hypothetical protein MIMGU_mgv1a024895mg                135   5e-34   
ref|XP_010267583.1|  PREDICTED: ethylene-responsive transcription...    133   5e-34   
ref|XP_010915977.1|  PREDICTED: ethylene-responsive transcription...    134   6e-34   
ref|XP_010915978.1|  PREDICTED: ethylene-responsive transcription...    134   6e-34   
gb|EPS62061.1|  hypothetical protein M569_12735                         132   6e-34   
ref|XP_002882995.1|  hypothetical protein ARALYDRAFT_897935             134   6e-34   
ref|XP_009381193.1|  PREDICTED: dehydration-responsive element-bi...    134   7e-34   
ref|XP_004139438.1|  PREDICTED: dehydration-responsive element-bi...    135   7e-34   
dbj|BAB01268.1|  transcription factor TINY-like protein                 135   7e-34   
ref|XP_006298435.1|  hypothetical protein CARUB_v10014506mg             134   8e-34   
ref|XP_007157270.1|  hypothetical protein PHAVU_002G056800g             132   1e-33   
gb|EMT14137.1|  Ethylene-responsive transcription factor ERF034         131   1e-33   
ref|XP_008783177.1|  PREDICTED: ethylene-responsive transcription...    133   1e-33   
ref|XP_009408899.1|  PREDICTED: ethylene-responsive transcription...    134   1e-33   
ref|XP_010051579.1|  PREDICTED: ethylene-responsive transcription...    134   1e-33   
ref|XP_003551139.1|  PREDICTED: dehydration-responsive element-bi...    134   1e-33   
ref|XP_008445017.1|  PREDICTED: ethylene-responsive transcription...    133   1e-33   
ref|XP_006340419.1|  PREDICTED: ethylene-responsive transcription...    132   1e-33   
ref|XP_003570022.1|  PREDICTED: ethylene-responsive transcription...    134   1e-33   
ref|XP_010538410.1|  PREDICTED: ethylene-responsive transcription...    132   2e-33   
gb|AID55125.1|  ethylene responsive factor 20                           131   2e-33   
emb|CDY35334.1|  BnaA04g15130D                                          132   2e-33   
ref|XP_010504078.1|  PREDICTED: ethylene-responsive transcription...    133   2e-33   
gb|EYU27280.1|  hypothetical protein MIMGU_mgv1a026082mg                130   2e-33   
gb|KFK29897.1|  hypothetical protein AALP_AA7G192600                    132   2e-33   
ref|NP_001236885.1|  uncharacterized protein LOC100527241               132   2e-33   
ref|XP_007150657.1|  hypothetical protein PHAVU_005G170600g             132   2e-33   
emb|CDX77012.1|  BnaC04g38070D                                          132   2e-33   
ref|NP_565609.3|  ethylene-responsive transcription factor ERF042       132   2e-33   
ref|XP_009409377.1|  PREDICTED: ethylene-responsive transcription...    134   3e-33   
emb|CDP03277.1|  unnamed protein product                                135   3e-33   
ref|XP_004964110.1|  PREDICTED: ethylene-responsive transcription...    134   4e-33   
ref|XP_004136219.1|  PREDICTED: ethylene-responsive transcription...    132   4e-33   
ref|XP_009801170.1|  PREDICTED: dehydration-responsive element-bi...    131   4e-33   
ref|NP_001151300.1|  dehydration-responsive element-binding prote...    132   6e-33   
ref|XP_003581499.1|  PREDICTED: ethylene-responsive transcription...    131   6e-33   
ref|XP_004953341.1|  PREDICTED: dehydration-responsive element-bi...    132   6e-33   
ref|XP_002278906.1|  PREDICTED: dehydration-responsive element-bi...    132   6e-33   
ref|XP_011081306.1|  PREDICTED: ethylene-responsive transcription...    132   7e-33   
ref|XP_008646011.1|  PREDICTED: ethylene-responsive transcription...    132   7e-33   
ref|XP_010266557.1|  PREDICTED: ethylene-responsive transcription...    130   7e-33   
ref|XP_010487482.1|  PREDICTED: ethylene-responsive transcription...    131   8e-33   
ref|XP_004498466.1|  PREDICTED: dehydration-responsive element-bi...    132   8e-33   
ref|XP_011078266.1|  PREDICTED: ethylene-responsive transcription...    132   8e-33   
ref|XP_009388688.1|  PREDICTED: ethylene-responsive transcription...    132   9e-33   
ref|XP_008678900.1|  PREDICTED: ethylene-responsive transcription...    132   1e-32   
ref|XP_002454993.1|  hypothetical protein SORBIDRAFT_03g002630          131   1e-32   
gb|AFW72636.1|  putative AP2/EREBP transcription factor superfami...    132   1e-32   
dbj|BAJ86214.1|  predicted protein                                      130   2e-32   
gb|AFG61639.1|  hypothetical protein 0_14481_01                         128   2e-32   
ref|XP_004165656.1|  PREDICTED: ethylene-responsive transcription...    130   2e-32   
ref|XP_003588384.1|  AP2 domain-containing transcription factor         131   2e-32   
ref|XP_004150289.1|  PREDICTED: dehydration-responsive element-bi...    130   2e-32   
ref|XP_004172022.1|  PREDICTED: dehydration-responsive element-bi...    130   3e-32   
ref|XP_002976414.1|  hypothetical protein SELMODRAFT_104978             129   3e-32   
ref|XP_010660384.1|  PREDICTED: ethylene-responsive transcription...    130   3e-32   
ref|XP_006852608.1|  hypothetical protein AMTR_s00021p00223240          130   3e-32   
ref|XP_002987250.1|  hypothetical protein SELMODRAFT_125385             128   3e-32   
gb|AFG61640.1|  hypothetical protein 0_14481_01                         127   3e-32   
ref|XP_008466061.1|  PREDICTED: dehydration-responsive element-bi...    129   4e-32   
gb|EPS58378.1|  hypothetical protein M569_16436                         125   4e-32   
ref|XP_002878890.1|  transcription factor                               129   4e-32   
ref|XP_010095372.1|  Dehydration-responsive element-binding prote...    130   4e-32   
ref|NP_001042318.1|  Os01g0200600                                       129   4e-32   
gb|AGE97357.1|  ethylene response factor 2                              130   5e-32   
emb|CAN72553.1|  hypothetical protein VITISV_015791                     130   7e-32   



>ref|XP_009771308.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nicotiana sylvestris]
Length=278

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 159/197 (81%), Gaps = 10/197 (5%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KK+RK +G EKHPT+RGVRKRNWGKWVSEIR+PRKKSRIWLGTYPTAEMAARAHDVAALA
Sbjct  89   KKKRKNQGDEKHPTFRGVRKRNWGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALA  148

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKG+SAYLNFPHLADQLPRPAS SPKDIQAAAA AA +TF + + V   + +E   S+ +
Sbjct  149  IKGNSAYLNFPHLADQLPRPASTSPKDIQAAAANAATSTFLEKNSVR--DEVE---SQIK  203

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTWQLVG  292
            L SS SS NL  E+ QE LNSPS     DDTFFDLPDL++D  +QND Y   +STWQL G
Sbjct  204  LHSSHSSMNLALENTQELLNSPS--IDHDDTFFDLPDLTIDQVDQNDRYQYPISTWQLAG  261

Query  291  VDPGGFRLEEPFLWECY  241
             D G FRLEEPFLWECY
Sbjct  262  ADSGIFRLEEPFLWECY  278



>ref|XP_009613551.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nicotiana tomentosiformis]
Length=284

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = -1

Query  804  EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSA  625
            +G EKHPT+RGVRKRNWGKWVSEIR+PRKKSRIWLGTYPTAEMAARAHDVAALAIKG+SA
Sbjct  100  QGDEKHPTFRGVRKRNWGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALAIKGNSA  159

Query  624  YLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqs  445
            YLNFPHLADQLPRPA+ SPKDIQAAAA AA +TF + + +      EAE S+ +L +S S
Sbjct  160  YLNFPHLADQLPRPATTSPKDIQAAAAKAAASTFLEENSLRD----EAESSQIKLHNSHS  215

Query  444  ssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTWQLVGVDPGGF  274
            S+NL SE+ QE LNSPS     DDTFFDLPDLS+D  +QND Y   +STWQL G D G F
Sbjct  216  STNLASENAQELLNSPS--MDHDDTFFDLPDLSIDQVDQNDRYQYPISTWQLAGADSGVF  273

Query  273  RLEEPFLWECY  241
            RLEEPFLWECY
Sbjct  274  RLEEPFLWECY  284



>ref|XP_006347933.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Solanum tuberosum]
Length=260

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 146/199 (73%), Gaps = 20/199 (10%)
 Frame = -1

Query  822  KKRRKVEG--GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            K RRK EG   EKHPTYRGVRKRNWGKWVSEIR+PRKKSRIWLGTYPTAEMAARAHDVAA
Sbjct  77   KIRRKNEGVVDEKHPTYRGVRKRNWGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAA  136

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSR  469
            LAIKG SAYLNFPHLADQLPRPAS SPKDIQAAA              +   +I  E  +
Sbjct  137  LAIKGDSAYLNFPHLADQLPRPASTSPKDIQAAA------------AKAAAANIFLE-EK  183

Query  468  AELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTWQL  298
            ++L    SS + T+ + QE LNSPS     DD FFDLPDL++D  +QND Y   +STWQL
Sbjct  184  SQLTELHSSHSSTNLASQELLNSPS--MDHDDPFFDLPDLTIDRVDQNDRYQYPISTWQL  241

Query  297  VGVDPGGFRLEEPFLWECY  241
             G D G FRL+EPFLWECY
Sbjct  242  AGADSGMFRLDEPFLWECY  260



>ref|XP_009613128.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nicotiana tomentosiformis]
Length=270

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 145/186 (78%), Gaps = 11/186 (6%)
 Frame = -1

Query  789  HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFP  610
            HPTYRGVRKR+WGKWVSEIREPRKKSRIWLGTYPTA+MAARAHDVAALAIKG SAYLNFP
Sbjct  90   HPTYRGVRKRSWGKWVSEIREPRKKSRIWLGTYPTAQMAARAHDVAALAIKGDSAYLNFP  149

Query  609  HLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnlt  430
            HLA QLPRPAS SPKDIQ AAA AA  TF D       E I AEPSR EL S  SS+NL 
Sbjct  150  HLAHQLPRPASASPKDIQTAAAFAAAITFPD-----ENEEIRAEPSRVELRSCHSSTNLL  204

Query  429  sesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTW-QLVGVDPGGFRLEE  262
            SE+ QE  NS S     DDTFFDLPDLS+D A+QND Y   +STW QLVG D   FRLEE
Sbjct  205  SENTQELPNSFSRED--DDTFFDLPDLSIDVADQNDRYCCTMSTWQQLVGDDTTVFRLEE  262

Query  261  PFLWEC  244
            PFLW+C
Sbjct  263  PFLWDC  268



>ref|XP_004229764.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Solanum lycopersicum]
Length=274

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 150/210 (71%), Gaps = 17/210 (8%)
 Frame = -1

Query  852  GQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            G E +     +++++    EKHPTYRGVRKRNWGKWVSEIR+PRKKSRIWLGTYPTAEMA
Sbjct  76   GNEEEDNTKIRRKKQCVVDEKHPTYRGVRKRNWGKWVSEIRQPRKKSRIWLGTYPTAEMA  135

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTF---DDNDEVS  502
            ARAHDVAALAIKG SAYLNFPHLADQLPRPAS SPKDIQAAAA AA  +    +++ E S
Sbjct  136  ARAHDVAALAIKGDSAYLNFPHLADQLPRPASASPKDIQAAAAKAAAASIFLEENSVESS  195

Query  501  HGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND  322
                + +  S   L          S+++QE LNSPS     DD FFDLPDL +D  +QND
Sbjct  196  QLTGLHSSHSSTNL---------ASDNVQELLNSPS--MDHDDPFFDLPDLIIDRLDQND  244

Query  321  HY---VSTWQLVGVDPGGFRLEEPFLWECY  241
             Y   VSTWQL G D G FRL+EPFLWECY
Sbjct  245  RYQYPVSTWQLAGADSGMFRLDEPFLWECY  274



>ref|XP_009791350.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Nicotiana 
sylvestris]
Length=274

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 142/187 (76%), Gaps = 11/187 (6%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPTYRGVRKR+WGKWVSEIREPRKKSRIWLGTYPTA+MAARAHDVAALAIKG SAYLNF
Sbjct  93   KHPTYRGVRKRSWGKWVSEIREPRKKSRIWLGTYPTAQMAARAHDVAALAIKGDSAYLNF  152

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            PH A  LP P S SPKDIQ AAA AA  TF + +     E I AE SR ELPS  SS+NL
Sbjct  153  PHFAHLLPCPTSTSPKDIQTAAAKAATITFPEEN-----EEIRAETSRVELPSCHSSTNL  207

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTWQL-VGVDPGGFRLE  265
              E+++E  NS S     DDTFFDLPDLS+D  +QND Y   +STWQ  VG D  GFRLE
Sbjct  208  FLENIKELPNSLSRED--DDTFFDLPDLSIDVVDQNDRYWCTMSTWQQPVGADITGFRLE  265

Query  264  EPFLWEC  244
            EPFLWEC
Sbjct  266  EPFLWEC  272



>ref|XP_011089857.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Sesamum 
indicum]
Length=286

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 154/211 (73%), Gaps = 11/211 (5%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRK----VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            + Q  K+G  +  R++        +KHPTYRGVRKRNWG+WV EIREPRKKSRIWLGTYP
Sbjct  79   KAQGEKSGNEDAARQRNGGSASANDKHPTYRGVRKRNWGRWVCEIREPRKKSRIWLGTYP  138

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE  508
            TAEMAARAHDVAALAIKG SAYLNFP LA  LPRP S +PKDIQAAAA AA  TF   +E
Sbjct  139  TAEMAARAHDVAALAIKGQSAYLNFPQLAQYLPRPTSTAPKDIQAAAAKAAAATFP--EE  196

Query  507  VSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSL---DG  337
             S     E + S ++LPSSQSS+NLT ++MQES NS S     DDTFFDLPDLSL   D 
Sbjct  197  TSQC-GAEPQLSESKLPSSQSSTNLTLDNMQESSNSASAAHHDDDTFFDLPDLSLSSTDH  255

Query  336  ANQNDHYVSTWQLVGVDPGGFRLEEPFLWEC  244
            +N   +Y S+WQL G D  GFRLE+PFLWEC
Sbjct  256  SNGYCYYASSWQLAGADV-GFRLEDPFLWEC  285



>gb|ADJ67431.1| ethylene response factor 2 [Actinidia deliciosa]
Length=264

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 150/205 (73%), Gaps = 16/205 (8%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            R +E K G  ++KR K  G EKHPTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEM
Sbjct  73   RVEETKNGNEHRKRHKSGGDEKHPTYRGVRIRNWGKWVSEIREPRKKSRIWLGTYPTAEM  132

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAA AIKG SAYLNFP LA +LPRPA+ SPKDIQAAAAMAA + F        G
Sbjct  133  AARAHDVAARAIKGKSAYLNFPELAHELPRPATTSPKDIQAAAAMAAASLFS-------G  185

Query  495  ESIEAEPSRAELPs--sqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND  322
            E+  AEPSRA LP   S ++ + +  + QES+NSPS +   DDTFFDLPDLS DG     
Sbjct  186  EATRAEPSRAGLPCSHSSTTLSSSENTTQESVNSPSNHD--DDTFFDLPDLS-DGCC---  239

Query  321  HYVSTWQLVGVDPGGFRLEEPFLWE  247
            +Y S+WQL   +   FRL++PF WE
Sbjct  240  YYASSWQLAASE-LSFRLDDPFSWE  263



>ref|XP_011032938.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Populus 
euphratica]
Length=299

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 147/209 (70%), Gaps = 13/209 (6%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGE---KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPT  685
            + QE ++G    KRRK  G +   KHPTYRGVR R+WGKWV EIREPRKKSRIWLGTYPT
Sbjct  97   KSQELQSGNEGNKRRKTTGNQTNGKHPTYRGVRMRSWGKWVCEIREPRKKSRIWLGTYPT  156

Query  684  AEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEV  505
            AEMAARAHDVA+LAIKG SAYLNFP L D+LPRP S SPKDIQAAAA AA  +F    E 
Sbjct  157  AEMAARAHDVASLAIKGGSAYLNFPELVDELPRPLSKSPKDIQAAAAKAAAASF---PET  213

Query  504  SHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN  325
             H ++ EA+ S AEL  S  S NL   + QES +SPS    VDD  FDLPDL +DG N +
Sbjct  214  RHCDA-EADLSHAELNVSNLSDNLAMYNTQESSSSPS--TDVDDKLFDLPDLFIDGVNHS  270

Query  324  D---HYVSTWQLVGVDPGGFRLEEPFLWE  247
            D   +Y   WQL   D  GFRLEEPFLWE
Sbjct  271  DGFCYYSPPWQLCSAD-TGFRLEEPFLWE  298



>gb|ABQ62972.1| TINY-like protein [Populus trichocarpa]
Length=269

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -1

Query  855  RGQEAKTGG-GNKKRRKV--EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPT  685
            + QE ++G  GNKKR+    E   KHPTYRGVR R+WGKWV EIREPRKKSRIWLGTYPT
Sbjct  63   KSQELQSGNEGNKKRKTTRNENNGKHPTYRGVRMRSWGKWVCEIREPRKKSRIWLGTYPT  122

Query  684  AEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEV  505
            AEMAARAHDVAALAIKG SAYLNFP L D+LPRP S SPKDIQAAAA AA  +F +    
Sbjct  123  AEMAARAHDVAALAIKGGSAYLNFPELVDELPRPLSKSPKDIQAAAAKAAAASFPETRHC  182

Query  504  SHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN  325
                  EA+ S AEL  S  S NL  +++QES +SPS    VDD  FDLPDL +DG N +
Sbjct  183  EAEAEAEADMSHAELNVSNLSDNLAMDNIQESSSSPS--TDVDDKLFDLPDLFIDGVNHS  240

Query  324  D---HYVSTWQLVGVDPGGFRLEEPFLWE  247
            D   +Y   WQL   D  GFRLEEPFLWE
Sbjct  241  DGFCYYSPPWQLCSAD-TGFRLEEPFLWE  268



>ref|XP_006375232.1| hypothetical protein POPTR_0014s05500g [Populus trichocarpa]
 gb|ABQ62973.1| TINY-like protein [Populus trichocarpa]
 gb|ERP53029.1| hypothetical protein POPTR_0014s05500g [Populus trichocarpa]
Length=269

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 147/209 (70%), Gaps = 9/209 (4%)
 Frame = -1

Query  855  RGQEAKTGG-GNKKRRKV--EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPT  685
            + QE ++G  GNKKR+    E   KHPTYRGVR R+WGKWV EIREPRKKSRIWLGTYPT
Sbjct  63   KSQELQSGNEGNKKRKTTRNENNGKHPTYRGVRMRSWGKWVCEIREPRKKSRIWLGTYPT  122

Query  684  AEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEV  505
            AEMAARAHDVAALAIKG SAYLNFP L D+LPRP S SPKDIQAAAA AA  +F +    
Sbjct  123  AEMAARAHDVAALAIKGGSAYLNFPELVDELPRPLSKSPKDIQAAAAKAAAASFPETRHC  182

Query  504  SHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN  325
                  EA+ S AEL  S  S NL  +++QES +SPS    VDD  FDLPDL +DG N +
Sbjct  183  EAEAEAEADMSHAELNVSNLSDNLAMDNIQESSSSPS--TDVDDKLFDLPDLFIDGVNHS  240

Query  324  D---HYVSTWQLVGVDPGGFRLEEPFLWE  247
            D   +Y   WQL   D  GFRLEEPFLWE
Sbjct  241  DGFCYYSPPWQLCSAD-TGFRLEEPFLWE  268



>ref|XP_006364331.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Solanum tuberosum]
Length=235

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 135/199 (68%), Gaps = 25/199 (13%)
 Frame = -1

Query  825  NKKRRKV---EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            NK+R+KV   +  +KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTY TAEMAARAHDV
Sbjct  55   NKRRKKVIQDDHDDKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYLTAEMAARAHDV  114

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AALAIKGHSAYLNFP+LADQLPRP SN PKDIQ AAA AA T+F  N   S    + +  
Sbjct  115  AALAIKGHSAYLNFPYLADQLPRPTSNYPKDIQIAAAKAAATSFSGNKAESSHIKLHSSS  174

Query  474  SRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTW  304
            S  E                  + SP      DDTFF+LPDLS++  +Q D Y   +STW
Sbjct  175  SSTE----------------TFITSP--LTDKDDTFFNLPDLSINKVDQIDSYCYPISTW  216

Query  303  QLVGVDPGGFRLEEPFLWE  247
             L G D  GF  EEPFLW+
Sbjct  217  HLPGTD-VGFWPEEPFLWQ  234



>ref|XP_009628141.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Nicotiana tomentosiformis]
Length=263

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 148/197 (75%), Gaps = 8/197 (4%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTY--RGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA  652
            N+KR+K EG +KHPTY  RGVRKRNWGKWVSEIREPRKKSRIWLGTY TAEMAARAHDVA
Sbjct  69   NRKRKKKEGDDKHPTYSYRGVRKRNWGKWVSEIREPRKKSRIWLGTYRTAEMAARAHDVA  128

Query  651  ALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPS  472
            ALAIKGHSAYLNFP+LA+QLPRPAS SPKDIQ AAA AA TTF + +  S  ES     S
Sbjct  129  ALAIKGHSAYLNFPYLANQLPRPASTSPKDIQIAAAKAAATTFPEEEMKSRAESSHEISS  188

Query  471  RAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYV---STWQ  301
              E  SS SS++L+SE+ QE + SPS     DDTFF+LPDLS +  +Q   Y    STW 
Sbjct  189  PMEPHSSCSSTDLSSENNQEFVKSPS--TDKDDTFFNLPDLSFNEVDQIGRYSDPNSTWL  246

Query  300  LVGVDPGGFRLEEPFLW  250
             VG D  GF LEEPFL+
Sbjct  247  QVGAD-VGFWLEEPFLF  262



>ref|XP_011093328.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Sesamum 
indicum]
Length=252

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 136/209 (65%), Gaps = 21/209 (10%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            + Q++      ++  K    EK  TYRGVR+R+WGKWV EIREPRKKSRIWLGTYPTAEM
Sbjct  61   KAQKSTKRAQAEEDDKGAAAEKQTTYRGVRRRSWGKWVCEIREPRKKSRIWLGTYPTAEM  120

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAALAIKG SAYLNFPHLA QLPRPAS +PKDIQAA+A AA  TF         
Sbjct  121  AARAHDVAALAIKGESAYLNFPHLAHQLPRPASTTPKDIQAASAKAAAYTFI--------  172

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY  316
             S EAEPS         SS        E  ++ +     DDTFFDLPDLSLD  + +  Y
Sbjct  173  -SAEAEPS-------SHSSTNLELENIEESSTSASMAHDDDTFFDLPDLSLDSTDHSSPY  224

Query  315  V----STWQLVGVDPGGFRLEEPFLWECY  241
                 S+WQL G D  GFRLE+PF WECY
Sbjct  225  CYNFASSWQLAGAD-VGFRLEDPFPWECY  252



>ref|XP_002880148.1| hypothetical protein ARALYDRAFT_483623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56407.1| hypothetical protein ARALYDRAFT_483623 [Arabidopsis lyrata subsp. 
lyrata]
Length=290

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 144/210 (69%), Gaps = 19/210 (9%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            GGG  KRRK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV
Sbjct  80   GGG--KRRKTSGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  137

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES---IE  484
            AALAIKG +AYLNFP L+ +LPRP +NSPKDIQAAA++AA    D  ++VS+ E     E
Sbjct  138  AALAIKGTTAYLNFPELSGELPRPVTNSPKDIQAAASLAAVNWQDPVNDVSNSEVAELAE  197

Query  483  AEPSRAELP-------ssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLD---GA  334
            AEPSRA +        S+ ++ +  S     +  S +     ++  FDLPDL  D     
Sbjct  198  AEPSRAVVAQLFSSDTSTATTQSQESSEASCASTSCTDKDSEEEKLFDLPDLFTDENEMM  257

Query  333  NQND---HYVSTWQLVGVDPGGFRLEEPFL  253
             +ND   +Y STWQL G D  GFRLEEPF 
Sbjct  258  IRNDAFCYYSSTWQLCGAD-AGFRLEEPFF  286



>ref|XP_006345609.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Solanum tuberosum]
Length=203

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 144/196 (73%), Gaps = 9/196 (5%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            +K+++ +   KHPTYRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTA+MAARAHDVAALA
Sbjct  13   QKKKRNDDDNKHPTYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAQMAARAHDVAALA  72

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKG SA+LNFPHL DQ PRPAS   KDIQAAAA AA   F    E    E    E  + E
Sbjct  73   IKGCSAHLNFPHLVDQYPRPASTCHKDIQAAAAKAAAIPF---PEEDEEEEDRVESDQVE  129

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTW-QLV  295
            L +  SS+NL  E+ +ESLNSPS     DDTFFDLPDLS+D  +Q + Y   +STW QL+
Sbjct  130  LRNCHSSTNLFLENTKESLNSPSRED--DDTFFDLPDLSIDMVDQTNSYWCTMSTWQQLI  187

Query  294  GVDPGGFRLEEPFLWE  247
            G D   +RL+EPFLWE
Sbjct  188  GADTTVYRLDEPFLWE  203



>ref|NP_182021.1| ethylene-responsive transcription factor ERF034 [Arabidopsis 
thaliana]
 sp|Q8LBQ7.2|ERF34_ARATH RecName: Full=Ethylene-responsive transcription factor ERF034 
[Arabidopsis thaliana]
 gb|AAM14835.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAP40391.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAP40485.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 dbj|BAF01461.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AEC10488.1| ethylene-responsive transcription factor ERF034 [Arabidopsis 
thaliana]
Length=295

 Score =   204 bits (519),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 141/207 (68%), Gaps = 19/207 (9%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI
Sbjct  87   KRRKTNGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  146

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH---GESIEAEPSR  469
            KG +AYLNFP LA +LPRP +NSPKDIQAAA++AA    D  ++VS+    E +EAEPSR
Sbjct  147  KGTTAYLNFPKLAGELPRPVTNSPKDIQAAASLAAVNWQDSVNDVSNSEVAEIVEAEPSR  206

Query  468  AELPssqsssnltsesmqeSLNSPSGYGGV---------DDTFFDLPDLSLD---GANQN  325
            A +    SS   T+ + Q    S +              ++  FDLPDL  D      +N
Sbjct  207  AVVAQLFSSDTSTTTTTQSQEYSEASCASTSACTDKDSEEEKLFDLPDLFTDENEMMIRN  266

Query  324  D---HYVSTWQLVGVDPGGFRLEEPFL  253
            D   +Y STWQL G D  GFRLEEPF 
Sbjct  267  DAFCYYSSTWQLCGAD-AGFRLEEPFF  292



>emb|CDP09462.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 152/218 (70%), Gaps = 19/218 (9%)
 Frame = -1

Query  849  QEAKTGGG-NKKRRKVEGG--EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            Q AK  G  N+ R+K + G  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE
Sbjct  83   QVAKINGNENQPRKKHKNGDDEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  142

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAALAIKGHSAYLNFP LA +LPRPA+ SPKDIQAAAA AA  TF   +    
Sbjct  143  MAARAHDVAALAIKGHSAYLNFPRLAHELPRPATTSPKDIQAAAAKAAAATFPGEN----  198

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
            G   EAEP +AEL +  SS++ +  +MQES NS S    +DDTFFDLPDLS D     DH
Sbjct  199  GGGAEAEPIQAELTNCHSSTDFSLHNMQESSNSASTDDDIDDTFFDLPDLSFDVTGATDH  258

Query  318  Y---------VSTWQLVGVDPGG---FRLEEPFLWECY  241
                       S W  + + P     FRLEEPFLWECY
Sbjct  259  LDGFNCFHGSSSWWPQLHLAPAAEPVFRLEEPFLWECY  296



>gb|AAM64613.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
Length=295

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 146/207 (71%), Gaps = 19/207 (9%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI
Sbjct  87   KRRKTNGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  146

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH---GESIEAEPSR  469
            KG +AYLNFP LA +LPRP +NSPKDIQAAA++AA    D  ++VS+    E +EAEPSR
Sbjct  147  KGTTAYLNFPKLAGELPRPVTNSPKDIQAAASLAAVNWQDSVNDVSNSEVAEIVEAEPSR  206

Query  468  ---AELPssqsssnltsesmqeSLNSPSGYGGVDD------TFFDLPDLSLD---GANQN  325
               A+L SS +S+  T++S + S  S +      D        FDLPDL  D      +N
Sbjct  207  TVVAQLFSSDTSTTTTTQSQEYSEASCASTSACTDKDSEEEKLFDLPDLFTDENEMMIRN  266

Query  324  D---HYVSTWQLVGVDPGGFRLEEPFL  253
            D   +Y STWQL G D  GFRLEEPF 
Sbjct  267  DAFCYYSSTWQLCGAD-AGFRLEEPFF  292



>gb|AHB33875.1| ERF transcription factor 04 [Coffea arabica]
Length=311

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 152/218 (70%), Gaps = 19/218 (9%)
 Frame = -1

Query  849  QEAKTGGG-NKKRRKVEGG--EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            Q AK  G  N+ R+K + G  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE
Sbjct  98   QVAKINGNENQPRKKHKNGDDEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  157

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAALAIKGHSAYLNFPHLA +LPRPA+ SPKDIQAAAA AA  TF   +    
Sbjct  158  MAARAHDVAALAIKGHSAYLNFPHLAHELPRPATTSPKDIQAAAAKAAAATFPGEN----  213

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
            G   EAEP +AEL +  SS++ +  +MQES NSPS    +DDTFFDLPDLS D     DH
Sbjct  214  GGGAEAEPIQAELTNCHSSTDFSLHNMQESSNSPSTDDDIDDTFFDLPDLSFDVTGATDH  273

Query  318  Y---------VSTWQLVGVDPGG---FRLEEPFLWECY  241
                       S W  +   P     FRLEEPFLWE Y
Sbjct  274  LDGFNCFHGSSSWWPQLHPAPAAEPVFRLEEPFLWEWY  311



>ref|XP_008232393.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Prunus 
mume]
Length=272

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 139/212 (66%), Gaps = 13/212 (6%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGE---KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            E +     KK+R+    +   KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEM
Sbjct  61   ENEQDNSKKKKRQRNSDQSDGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEM  120

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE---V  505
            AARAHDVAALAIKG SA+LNFP LA  LP+P S SPKDIQAAAA AA    D ++E   +
Sbjct  121  AARAHDVAALAIKGASAFLNFPELAQTLPQPDSKSPKDIQAAAAKAAAAAADASEEKQII  180

Query  504  SHGESIEAEP-SRAELPssqsssnltsesmqeSLNSPSGYGGV-DDTFFDLPDLSLDGAN  331
               E+ EAEP S+ +LP S +S+        +   S        DD  FDLPDL +DG N
Sbjct  181  CETEAEEAEPSSKVKLPMSSNSTLSMDNINAQESTSTCASTDYDDDKLFDLPDLFMDGTN  240

Query  330  QNDHYV----STWQLVGVDPGGFRLEEPFLWE  247
             +D +     STW L   D  GFRLE+PFLWE
Sbjct  241  GSDQFCYSTSSTWHLCAAD-TGFRLEDPFLWE  271



>ref|XP_006397675.1| hypothetical protein EUTSA_v10001792mg [Eutrema salsugineum]
 gb|ESQ39128.1| hypothetical protein EUTSA_v10001792mg [Eutrema salsugineum]
Length=298

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 138/213 (65%), Gaps = 26/213 (12%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRKV  G+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI
Sbjct  84   KRRKVNAGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  143

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH-------GESIEA  481
            KG +A+LNFP L+ +LPRP +NSPKDIQAAA  AA   + D+  VS         E  EA
Sbjct  144  KGATAFLNFPELSGELPRPVTNSPKDIQAAATSAA-VNWQDSATVSLRVNNSDGAELAEA  202

Query  480  EPSRAELPssqs--------ssnltsesmqeSLNSPSGYGGVD---DTFFDLPDLSLDGA  334
            EPSRA +  S S        +      S     ++ + +   D   +  FDLPDL  DG 
Sbjct  203  EPSRAVMAQSLSSSVVCSSDTMTQQESSETSCASTTTSFADKDSDEEKLFDLPDLFTDGN  262

Query  333  N---QND---HYVSTWQLVGVDPGGFRLEEPFL  253
                +ND   +Y STWQL G D  GFRLEEPF 
Sbjct  263  EMMIRNDAFCYYSSTWQLCGAD-AGFRLEEPFF  294



>gb|KFK37291.1| hypothetical protein AALP_AA4G238300 [Arabis alpina]
Length=291

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 140/211 (66%), Gaps = 24/211 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+RK+ GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAI
Sbjct  79   KKRKITGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAI  138

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES-------IEA  481
            KG +AYLNFP L+ +LPRP +NSPKDIQ AAA AA   + D+   SHGE+        EA
Sbjct  139  KGTTAYLNFPELSGELPRPVTNSPKDIQ-AAATAAAINWQDSSINSHGENNSEIAELAEA  197

Query  480  EPSRAELPssqsssnltsesmqeSLNSPSGYGGV--------DDTFFDLPDLSLDGAN--  331
            EPSRA +  S S    +  + QES  +               ++  FDLPDL  D  N  
Sbjct  198  EPSRAVMAQSNSGVFSSDATTQESSEASCASTTTLCMDKDNEEEKLFDLPDLFSDDGNGM  257

Query  330  --QND---HYVSTWQLVGVDPGGFRLEEPFL  253
              +ND   +Y S WQL G D  GFRLEEPF 
Sbjct  258  MIRNDAFCYYSSAWQLCGAD-AGFRLEEPFF  287



>ref|XP_004240059.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Solanum lycopersicum]
Length=253

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 138/187 (74%), Gaps = 9/187 (5%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            +KHPTYRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTA+MAARAHDVAALAIKG SA+LN
Sbjct  72   DKHPTYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAQMAARAHDVAALAIKGCSAHLN  131

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssn  436
            FPHL DQ P PAS   KDIQAAAA AA   F    E    E  + E  + EL +   S+N
Sbjct  132  FPHLVDQYPHPASTCHKDIQAAAAKAAAIPF---PEEDEEEEDQIESDQVELRNCHPSTN  188

Query  435  ltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY---VSTW-QLVGVDPGGFRL  268
            L  E+ +ESLNSPS     DDTFFDLPDLS+D  +Q + Y   +STW QL+G D   +RL
Sbjct  189  LFLENAKESLNSPSRED--DDTFFDLPDLSIDVVDQTNSYWCTMSTWQQLIGADTMVYRL  246

Query  267  EEPFLWE  247
            +EPFLWE
Sbjct  247  DEPFLWE  253



>ref|XP_007140776.1| hypothetical protein PHAVU_008G141000g [Phaseolus vulgaris]
 gb|ESW12770.1| hypothetical protein PHAVU_008G141000g [Phaseolus vulgaris]
Length=309

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 136/206 (66%), Gaps = 13/206 (6%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KKR++     KHP+YRGVR R WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA LA
Sbjct  105  KKRQRNGSDNKHPSYRGVRMRAWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVATLA  164

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDN-------DEVSHGE---  493
            IKGHSAYLNFP+LA  LPRP + SPKDIQAAAA AA T FDD+       DE +H E   
Sbjct  165  IKGHSAYLNFPNLAQDLPRPITTSPKDIQAAAAKAASTFFDDDKHCEAEKDEENHAEQAS  224

Query  492  --SIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
              ++  + + AE   ++ +S+ T        +S S     DDT FDLPDL  DG N    
Sbjct  225  SSTLRMDSTEAEQVQAKQASSFTLSMDNTQGSSTSHSTADDDTLFDLPDLFPDGNNGLFS  284

Query  318  YVSTWQLVGVDPGGFRLEEPFLWECY  241
              S+W+L  VD  GFR EE  LWE Y
Sbjct  285  NSSSWRLCAVD-SGFRHEEQLLWENY  309



>ref|XP_007218799.1| hypothetical protein PRUPE_ppa009812mg [Prunus persica]
 gb|EMJ19998.1| hypothetical protein PRUPE_ppa009812mg [Prunus persica]
Length=276

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/211 (56%), Positives = 139/211 (66%), Gaps = 12/211 (6%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGE---KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            E +     KK+R+    +   KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEM
Sbjct  66   ENEQDNSKKKKRQRSSDQSDGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEM  125

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE---V  505
            AARAHDVAALAIKG SA+LNFP LA  LP+P S SPKDIQAAAA AA+   D ++E   +
Sbjct  126  AARAHDVAALAIKGASAFLNFPELAQTLPQPDSKSPKDIQAAAAKAAKAAADASEEKQII  185

Query  504  SHGESIEAEP-SRAELPssqsssnltsesmqeSLNSPSGYGGV-DDTFFDLPDLSLDGAN  331
               E+ EAEP S+ +LP S +S+        +   S        DD  FDLPDL +DG N
Sbjct  186  CETEAEEAEPSSKVKLPMSSNSTLSMDNINAQESTSTCASTDYDDDKLFDLPDLFMDGTN  245

Query  330  QNDHYV---STWQLVGVDPGGFRLEEPFLWE  247
             +D +    STW L   D  GFRL +PFLWE
Sbjct  246  GSDQFCYSSSTWHLCAAD-TGFRLGDPFLWE  275



>gb|EYU31917.1| hypothetical protein MIMGU_mgv1a014733mg [Erythranthe guttata]
Length=180

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 135/184 (73%), Gaps = 13/184 (7%)
 Frame = -1

Query  780  YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPHLA  601
            YRGVRKRNWGKWV EIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG SAYLNFPHLA
Sbjct  2    YRGVRKRNWGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGQSAYLNFPHLA  61

Query  600  DQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnltses  421
            + LPRPAS +PKDIQAAAA AA       +E+S     +AEPS+++L SS SS+NL   S
Sbjct  62   EYLPRPASTAPKDIQAAAAEAAAAA-AFPEEISRSSDEQAEPSQSKLASSHSSTNLQETS  120

Query  420  mqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH------YVSTWQLVGVDPGGFRLEEP  259
                 NS S     DDTFFDLPDLSL G++ + +        S+WQL G D   FRLE+P
Sbjct  121  -----NSASTAHEADDTFFDLPDLSLGGSDHSGNGYSYYASSSSWQLAGAD-ACFRLEDP  174

Query  258  FLWE  247
            FLWE
Sbjct  175  FLWE  178



>ref|XP_010544587.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Tarenaya hassleriana]
Length=274

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 138/205 (67%), Gaps = 12/205 (6%)
 Frame = -1

Query  828  GNKKRRK--VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            G KKRRK    G +KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV
Sbjct  69   GAKKRRKNSENGSDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  128

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AALAIKG  A+LNFP L+ +LPRPAS SPKDIQAAA  AA  T+ D  +     S + EP
Sbjct  129  AALAIKGTGAFLNFPELSGELPRPASTSPKDIQAAAGKAAAATWHDLGQNGDEGSSKTEP  188

Query  474  SRAEL------PssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND---  322
            S   +       S  SS   T ES   S  S +   G +DT FDLPDL  DG  +ND   
Sbjct  189  SGGVMYAVQSSSSLVSSDTTTYESSLISSASSTDKEGDEDTLFDLPDLFTDGLTRNDAFC  248

Query  321  HYVSTWQLVGVDPGGFRLEEPFLWE  247
            +Y STWQL   +   FRLEEPFLW+
Sbjct  249  YYSSTWQLCAAE-SVFRLEEPFLWQ  272



>ref|XP_007052232.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOX96389.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=310

 Score =   194 bits (492),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 142/208 (68%), Gaps = 13/208 (6%)
 Frame = -1

Query  834  GGGNKKRRKV---EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  664
               NKKR +    + G KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARA
Sbjct  106  SASNKKRHRSCDDDDGSKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  165

Query  663  HDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTF----DDNDEVSHG  496
            HDVAALAIKG SAYLNFP LA  LPRPA  SPKDIQAAA+ AA +TF      N E    
Sbjct  166  HDVAALAIKGRSAYLNFPELAKDLPRPAGTSPKDIQAAASQAAASTFLKTRRCNIEAEAE  225

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND--  322
               E  PS+ ELP S  S    S+++QES +SPS       T FDLPDL +D  +++D  
Sbjct  226  AEAEVGPSQEELPVSHLSQTSASDNVQESSSSPSIDDDD--TLFDLPDLMIDATDRSDGF  283

Query  321  -HYVSTWQLVGVDPGGFRLEEPFLWECY  241
              Y STWQ+  VD  GFRLEEPF WE Y
Sbjct  284  CSYSSTWQICAVD-AGFRLEEPFSWEYY  310



>ref|XP_007134514.1| hypothetical protein PHAVU_010G054000g [Phaseolus vulgaris]
 gb|ESW06508.1| hypothetical protein PHAVU_010G054000g [Phaseolus vulgaris]
Length=283

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 135/206 (66%), Gaps = 16/206 (8%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E  + G  K++R+    + +PTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR
Sbjct  90   EKDSKGCKKRQRENPSNQNYPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  149

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE--  493
            AHDVAALAIKGHSAYLNFP LA +LPRPA+ SPKDIQAAAA AA T+F   + V H +  
Sbjct  150  AHDVAALAIKGHSAYLNFPELAQELPRPATTSPKDIQAAAAKAANTSF---ELVKHCQIE  206

Query  492  --SIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
                  EP++AE      +S+ T        +S S     DDT FDLPDL  D   Q   
Sbjct  207  DEEEGEEPNQAE-----HASSSTLSMDNTQESSSSHSTNDDDTLFDLPDLFPD---QLCS  258

Query  318  YVSTWQLVGVDPGGFRLEEPFLWECY  241
            Y S+W L  V   GFRLEE   WE Y
Sbjct  259  YSSSWHLCAVG-SGFRLEESLFWENY  283



>emb|CDX74699.1| BnaA05g04450D [Brassica napus]
Length=282

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 136/212 (64%), Gaps = 27/212 (13%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTA+MAARAHDVAALAI
Sbjct  71   KRRKTNGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAI  130

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD------DNDEVSHGESIEAE  478
            KG +AYLNFP LA +LPRP +NSPKDIQAAA  AA    D      DN +++  E  EAE
Sbjct  131  KGTTAYLNFPELAGELPRPVTNSPKDIQAAATAAAVNWQDSGGLHVDNSDIT--EKTEAE  188

Query  477  PSRA----ELPssqsssnltsesmqeSLNSPSGYGGVD-----DTFFDLPDLSLDGANQ-  328
            PS A     L  S   S+          +  S    VD     +  FDLPDL  +G N+ 
Sbjct  189  PSGAVMAQSLSDSAVFSSDIITQELSETSCASTTSFVDKDSDEEKLFDLPDL-FNGGNEI  247

Query  327  ----NDHY---VSTWQLVGVDPGGFRLEEPFL  253
                ND +    STWQL G D  GFRLEEPF 
Sbjct  248  GIIRNDAFWYDSSTWQLCGAD-AGFRLEEPFF  278



>ref|XP_010524419.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Tarenaya hassleriana]
Length=276

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 146/214 (68%), Gaps = 19/214 (9%)
 Frame = -1

Query  834  GGGNKKRRKVE---GGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  664
              G KKR K      G+KHPTYRGVR R+WGKWVSEIR+PRKKSRIWLGTY TAEMAARA
Sbjct  62   NNGAKKRHKNNDNGSGDKHPTYRGVRMRSWGKWVSEIRQPRKKSRIWLGTYRTAEMAARA  121

Query  663  HDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD-----DNDEVSH  499
            HDVAALAIKG +AYLNFP L+ +LPRPA+ SPKDIQAAAA AA T  D     D+  +  
Sbjct  122  HDVAALAIKGSTAYLNFPKLSGELPRPATTSPKDIQAAAAKAAATWHDLTPTADDRTMGS  181

Query  498  GESIEAEPSRAELPssqsss------nltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG  337
             +S E+E SRAE+ +++SSS       +T +S   S  S +     +DT FDLPDL  DG
Sbjct  182  DDSGESETSRAEISAARSSSSLVSSDMMTRDSSVTSSASSADKDSEEDTLFDLPDLFTDG  241

Query  336  ANQND----HYVSTWQLVGVDPGGFRLEEPFLWE  247
            + +ND     Y STWQL   D   FRLEEPFLW+
Sbjct  242  STRNDAFCYSYSSTWQLCAAD-SVFRLEEPFLWQ  274



>gb|KHN34489.1| Ethylene-responsive transcription factor ERF034 [Glycine soja]
Length=266

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 136/207 (66%), Gaps = 18/207 (9%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKH-PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            +  K   G KKR+     + H PTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEMA
Sbjct  70   ENGKDSKGCKKRQIDNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  129

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE  493
            ARAHDVAALAIKGHSAYLNFP LA +LPRP S SPKDIQAAAA AA T F   +EV H +
Sbjct  130  ARAHDVAALAIKGHSAYLNFPELAQELPRPVSTSPKDIQAAAAKAANTAF---EEVRHCQ  186

Query  492  SIEAEPSRAELPssqsssnltsesmqeSLNSP----SGYGGV-DDTFFDLPDLSLDGANQ  328
              E E  + +           + S   S+++P    S +  + DDT FDLPDL  DG N 
Sbjct  187  ITEEEAEQNQ--------AEQASSSTLSMDNPQEPSSSHSTIDDDTLFDLPDLFPDGNNG  238

Query  327  NDHYVSTWQLVGVDPGGFRLEEPFLWE  247
               + S+W L  VD  GFRLEE F +E
Sbjct  239  LCSFSSSWHLCAVD-SGFRLEESFFYE  264



>emb|CDY18963.1| BnaC04g03870D [Brassica napus]
Length=283

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 136/212 (64%), Gaps = 27/212 (13%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTA+MAARAHDVAALAI
Sbjct  72   KRRKSNGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAI  131

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDD------NDEVSHGESIEAE  478
            KG +AYLNFP LA +LPRP +NSPKDIQAAA  AA    D       N +++  E IEAE
Sbjct  132  KGTTAYLNFPELAGELPRPVTNSPKDIQAAATAAAVNWQDSGGLHVGNSDIT--EKIEAE  189

Query  477  PSRA----ELPssqsssnltsesmqeSLNSPSGYGGVD-----DTFFDLPDLSLDGANQ-  328
            PS A     L  S   S+          +  S    VD     +  FDLPDL  +G N+ 
Sbjct  190  PSGAVMAQSLSDSVVFSSDIITQELSETSCASTTSFVDKDSDEEKLFDLPDL-FNGGNEI  248

Query  327  ----NDHY---VSTWQLVGVDPGGFRLEEPFL  253
                ND +    STWQL G D  GFRLEEPF 
Sbjct  249  GIIRNDTFWYDSSTWQLCGAD-AGFRLEEPFF  279



>ref|XP_008356544.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Malus domestica]
Length=278

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 137/206 (67%), Gaps = 18/206 (9%)
 Frame = -1

Query  828  GNKKRRKVEGGE----KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            GNKK+R+    +    KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAH
Sbjct  78   GNKKKRQRTTSDHSDGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  137

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ---aaaamaAETTFDDNDEVSHGES  490
            DVA LAIKG SAYLNFP LA  LP+P S SPKDIQ   A AA AA +  +D   +   E+
Sbjct  138  DVATLAIKGVSAYLNFPELAQALPQPDSKSPKDIQAAAAKAAAAAASASEDKQLICEAET  197

Query  489  IEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDD-TFFDLPDLSLDGANQNDHYV  313
             EAEP   +LP S +S+   ++    +    SG    DD   FDLPDL +DG + +D++ 
Sbjct  198  KEAEP---KLPISTNSTLSNAQESSSTC--ASGSTDYDDEKLFDLPDLFMDGKDGSDNFC  252

Query  312  ----STWQLVGVDPGGFRLEEPFLWE  247
                STW L   D  GFRL +PFLWE
Sbjct  253  NYSSSTWHLCAAD-TGFRLGDPFLWE  277



>ref|XP_003521085.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Glycine max]
Length=287

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 133/194 (69%), Gaps = 7/194 (4%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K++R       HPTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA
Sbjct  101  KRQRDNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  160

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKGHSAYLNFP LA +LPRPAS SPKDIQAAA+ AA T F   + V H +  E +     
Sbjct  161  IKGHSAYLNFPELAQELPRPASTSPKDIQAAASKAANTAF---EVVKHCQITEEQEQEQN  217

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDP  283
                ++SS L+ ++ QE   S S     DDT FDLPDL  DG N    + S+W L  VD 
Sbjct  218  QAEQETSSTLSMDNTQEP--SSSHSTNDDDTLFDLPDLFPDGNNGLCSF-SSWHLCAVD-  273

Query  282  GGFRLEEPFLWECY  241
             GFRLEE F WE Y
Sbjct  274  SGFRLEESFFWENY  287



>ref|XP_003530164.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Glycine max]
Length=363

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 136/207 (66%), Gaps = 18/207 (9%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKH-PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            +  K   G KKR+     + H PTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEMA
Sbjct  167  ENGKDSKGCKKRQIDNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  226

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE  493
            ARAHDVAALAIKGHSAYLNFP LA +LPRP S SPKDIQAAAA AA T F   +EV H +
Sbjct  227  ARAHDVAALAIKGHSAYLNFPELAQELPRPVSTSPKDIQAAAAKAANTAF---EEVRHCQ  283

Query  492  SIEAEPSRAELPssqsssnltsesmqeSLNSP----SGYGGV-DDTFFDLPDLSLDGANQ  328
              E E  + +           + S   S+++P    S +  + DDT FDLPDL  DG N 
Sbjct  284  ITEEEAEQNQ--------AEQASSSTLSMDNPQEPSSSHSTIDDDTLFDLPDLFPDGNNG  335

Query  327  NDHYVSTWQLVGVDPGGFRLEEPFLWE  247
               + S+W L  VD  GFRLEE F +E
Sbjct  336  LCSFSSSWHLCAVD-SGFRLEESFFYE  361



>ref|XP_009143083.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Brassica 
rapa]
Length=282

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 132/210 (63%), Gaps = 23/210 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTA+MAARAHDVAALAI
Sbjct  71   KRRKTNGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAI  130

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDN----DEVSHGESIEAEPS  472
            KG +AYLNFP LA +LPRP +NSPKDIQAAA  AA    D      D     E  EAEPS
Sbjct  131  KGTTAYLNFPELAGELPRPVTNSPKDIQAAATAAAVNWQDSGGLHVDISDITEKTEAEPS  190

Query  471  RA----ELPssqsssnltsesmqeSLNSPSGYGGVD-----DTFFDLPDLSLDGANQ---  328
             A     L  S   S+          +  S    VD     +  FDLPDL  +G N+   
Sbjct  191  GAVMAQSLSDSVVFSSDIITQELSETSCASTTSFVDKDSDEEKLFDLPDL-FNGGNEIGI  249

Query  327  --NDHY---VSTWQLVGVDPGGFRLEEPFL  253
              ND +    STWQL G D  GFRLEEPF 
Sbjct  250  IRNDAFWYDSSTWQLCGAD-AGFRLEEPFF  278



>ref|XP_003622605.1| Ethylene-responsive transcription factor ERF034 [Medicago truncatula]
 gb|AES78823.1| AP2/ERF domain transcription factor [Medicago truncatula]
Length=235

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 129/201 (64%), Gaps = 10/201 (5%)
 Frame = -1

Query  831  GGNKKRRKVEGGE---KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
             GNKK +K E  E   KHPTYRGVR R WGKWVSEIREPRKKSRIWLGTYPTAEMAARAH
Sbjct  41   NGNKKSKKRERNENDTKHPTYRGVRMRAWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  100

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEA  481
            DVAALAIKGHSAYLNFP+LA  LPRP++ SPKDIQ AAA AA   F++       E  + 
Sbjct  101  DVAALAIKGHSAYLNFPNLAQNLPRPSTTSPKDIQVAAAKAAAIVFEE-----IKEDQDQ  155

Query  480  EPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQ  301
            +  +    +  S  N+   +      + +    +DDT FDLPDL  DG N    Y S+W 
Sbjct  156  DQDQVSFSTLSSIDNVQESNSSSPSTTATTNDDIDDTLFDLPDLFPDGKNGILSYYSSWH  215

Query  300  LVGVDPGGFRLEEPF-LWECY  241
            L  VD  G RLEE    WE Y
Sbjct  216  LCAVD-SGLRLEEQLSSWEYY  235



>ref|XP_003516798.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Glycine max]
 gb|KHN23919.1| Ethylene-responsive transcription factor ERF034 [Glycine soja]
Length=263

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 136/209 (65%), Gaps = 14/209 (7%)
 Frame = -1

Query  828  GNKKRRKVEGGEK--HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
             +KKR++ +  E   HP+YRGVR R WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV
Sbjct  56   NSKKRQRSDDNENKHHPSYRGVRMRAWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  115

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE-  478
            AALA+KGHSA+LNFP+LA  LPRP + SPKDIQAAAA AA TTF D++ V+H ++ +AE 
Sbjct  116  AALAVKGHSAFLNFPNLAQDLPRPTTTSPKDIQAAAAKAATTTFFDDEIVNHCQAEKAEQ  175

Query  477  --------PSRAELPssqsssnltsesmqeSLNSPSGYGGVDD--TFFDLPDLSLDGANQ  328
                    PS   +  + + +         S    S      D  T FDLPDL  DG + 
Sbjct  176  NHGEQQASPSTLCMMDNSTEAEQIQAEQASSTQESSSSHSTADEETLFDLPDLFPDGNSG  235

Query  327  NDHYVSTWQLVGVDPGGFRLEEPFLWECY  241
               Y S W L  VD  GFRLEE FLWE +
Sbjct  236  LFSYSSCWHLCAVD-SGFRLEEQFLWENF  263



>emb|CDX95624.1| BnaC03g25050D [Brassica napus]
Length=276

 Score =   188 bits (477),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 135/209 (65%), Gaps = 23/209 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK+ GG+KHP YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA+LAI
Sbjct  67   KRRKISGGDKHPNYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAI  126

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD--------DNDEVSHGESIE  484
            KG +A+LNFP L+ +LPRP + SPKDIQAAA  AA    D        +N +V   E  E
Sbjct  127  KGTTAHLNFPELSGELPRPVTRSPKDIQAAATAAAVNWQDSGANSLRMNNSDV--AELAE  184

Query  483  AEPSRAELPssqsssnltse------smqeSLNSPSGYGGVD---DTFFDLPDLSLDGAN  331
             EPSR  +  S S S + S         + S  S + +   D   +  FDLPDL  D   
Sbjct  185  TEPSRGVMAQSLSGSVVFSSDINTRDLSETSCASTTSFADKDKEEEKLFDLPDLVTDEII  244

Query  330  QND---HYVSTWQLVGVDPGGFRLEEPFL  253
            +ND    Y STWQL G D  GFRLEEPF 
Sbjct  245  RNDAFSFYSSTWQLCGAD-HGFRLEEPFF  272



>ref|XP_010508227.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Camelina sativa]
Length=285

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 140/214 (65%), Gaps = 22/214 (10%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            +TGG   K+RK+ GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAH
Sbjct  73   QTGG---KKRKINGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  129

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDD-NDEVSHGESIE  484
            DVAALAIKG +AYLNFP L+ +LPRP +NSPKDIQAAA++AA    D  ND     E  E
Sbjct  130  DVAALAIKGTTAYLNFPELSGELPRPVTNSPKDIQAAASLAAVNWQDPVNDVEEVAELAE  189

Query  483  AEPSRA-----------ELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG  337
            AEPSRA              ++  S   +  S   + +S +     ++  FDLPDL  D 
Sbjct  190  AEPSRAATVVSSDTSTTTTTTTTHSQESSEASCASTTSSCTDKYNDEEKLFDLPDLFTDE  249

Query  336  ------ANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                   +   +Y STWQL G D  GFRLEEPF 
Sbjct  250  NEMMIRKDAFCYYSSTWQLCGAD-AGFRLEEPFF  282



>gb|ACU24100.1| unknown [Glycine max]
Length=287

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 132/194 (68%), Gaps = 7/194 (4%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K++R       HPTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA
Sbjct  101  KRQRDNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  160

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKGHSAYLNFP LA +LPRPAS SPKDIQAAA+ AA T F   + V H +  E +     
Sbjct  161  IKGHSAYLNFPELAQELPRPASTSPKDIQAAASKAANTAF---EVVKHCQITEEQEQEQN  217

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDP  283
                ++SS L+ ++ QE   S S     DDT FDLPDL  DG N    + S+W    VD 
Sbjct  218  QAEQETSSTLSMDNTQEP--SSSHSTNDDDTLFDLPDLFPDGNNGLCSF-SSWHWCAVD-  273

Query  282  GGFRLEEPFLWECY  241
             GFRLEE F WE Y
Sbjct  274  SGFRLEESFFWENY  287



>ref|XP_002511623.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF50292.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=276

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 139/212 (66%), Gaps = 15/212 (7%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGE-----KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPT  685
            QE ++G  N+  RK +  +     KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPT
Sbjct  65   QELESGNNNESSRKKQKSDNNENAKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPT  124

Query  684  AEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEV  505
            AEMAARAHDVAALAIKG+SAYLNFP LA  LPRPA+ +PKDIQ AAA AA      N   
Sbjct  125  AEMAARAHDVAALAIKGNSAYLNFPELALGLPRPATKAPKDIQVAAAKAATAV---NFLE  181

Query  504  SHGESIEAEPSRAE--LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGAN  331
                 +EA  S+AE        ++  ++ S   +    +     DDT FDLPDL ++G +
Sbjct  182  KTQSDVEAGMSQAEGSSSLVIDNTRESTSSPSTATTIATTSNDSDDTLFDLPDLFVEGID  241

Query  330  --QND--HYVSTWQLVGVDPGGFRLEEPFLWE  247
              +ND  HY  +WQL   D  GFRLEEP+LWE
Sbjct  242  RHKNDFLHYSPSWQLCAAD-TGFRLEEPYLWE  272



>ref|XP_010661364.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Vitis vinifera]
Length=255

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 132/209 (63%), Gaps = 27/209 (13%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEG-GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            Q  K G  ++KR+K E  G++HPTYRGVR RNWGKWVSEIREP+KKSRIWLGTYPTAEMA
Sbjct  66   QGMKNGNESRKRQKTENDGKQHPTYRGVRMRNWGKWVSEIREPKKKSRIWLGTYPTAEMA  125

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE  493
            ARAHDVAALAIKG S +LNFP LA  LPRPAS SPKDIQAAAA AA TTF   DE     
Sbjct  126  ARAHDVAALAIKGSSPHLNFPELAHALPRPASTSPKDIQAAAAEAANTTFSQPDET----  181

Query  492  SIEAE-PSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLD-----GAN  331
             +EAE P  +E                   +S S     DD FFDLPD+ +D     G  
Sbjct  182  EVEAEHPVSSE---------------NTLESSNSTSVDNDDAFFDLPDIVMDVMDLTGDR  226

Query  330  QNDHYVSTWQLVGVDPGGFR-LEEPFLWE  247
               +Y   WQ  G     FR +EEPFLWE
Sbjct  227  FCYYYYPLWQPAGGADNIFRPVEEPFLWE  255



>ref|XP_009133691.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Brassica rapa]
Length=277

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 138/210 (66%), Gaps = 24/210 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK+ GG+KHP YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA+LAI
Sbjct  67   KRRKISGGDKHPNYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAI  126

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD--------DNDEVSHGESIE  484
            KG +A+LNFP L+ +LPRP ++SPKDIQAAA  AA    D        +N +V   E  E
Sbjct  127  KGTTAHLNFPELSGELPRPVTSSPKDIQAAATAAAVNWQDSGANSLRMNNSDV--AELAE  184

Query  483  AEPSRAELPssqsssnltse------smqeSLNSPSGYGGVD---DTFFDLPDL-SLDGA  334
             EPSR  +  + S S + S         + S +S + +   D   D  FDLPDL S +  
Sbjct  185  TEPSRVVMAQALSGSVVYSSDVNTRDLSEISCSSTTSFADKDKEEDKLFDLPDLFSDEMI  244

Query  333  NQND---HYVSTWQLVGVDPGGFRLEEPFL  253
             +ND   +Y S WQL G D  GFRLEEPF 
Sbjct  245  IRNDAFCYYSSAWQLCGAD-HGFRLEEPFF  273



>gb|KDP28842.1| hypothetical protein JCGZ_14613 [Jatropha curcas]
Length=247

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/218 (47%), Positives = 132/218 (61%), Gaps = 33/218 (15%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVE-----------GGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIW  703
            QE + G  +KK++K+               KHP YRGVR R+WGKWVSEIREPRKKSRIW
Sbjct  48   QELENGNESKKKQKMSTSSADHNETNRNNNKHPKYRGVRMRSWGKWVSEIREPRKKSRIW  107

Query  702  LGTYPTAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTF  523
            LGTYPTAEMAARAHDVAALAIKG+SAYLNFP L  +LPRP + SPKDIQ           
Sbjct  108  LGTYPTAEMAARAHDVAALAIKGNSAYLNFPELVHELPRPVTKSPKDIQ-----------  156

Query  522  DDNDEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSL  343
                  +  ++  +E ++ +L +       ++ +   ++++ S     DDT FDLPDL +
Sbjct  157  -----AAAAKAALSETTQFQLQAEAHQLISSNTNTTSAMDN-SNTQESDDTLFDLPDLFI  210

Query  342  DG----ANQNDHYVSTWQLVGVDPGGFRLEEPFLWECY  241
            DG    +N    Y  +W L   D  GFR+EEP++WE Y
Sbjct  211  DGVDLKSNGFCQYSPSWHLCTAD-TGFRVEEPYIWEYY  247



>ref|XP_008347085.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Malus domestica]
Length=271

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 133/203 (66%), Gaps = 10/203 (5%)
 Frame = -1

Query  828  GNKKRRKVEGGE----KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            GNKK+R+    +    KHPT+ GVR R+WGKWVSEIREPRKKSRIWLGTY TAEMAARAH
Sbjct  69   GNKKKRQRTTSDHSNGKHPTFCGVRMRSWGKWVSEIREPRKKSRIWLGTYQTAEMAARAH  128

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEA  481
            DVAALAIKG SAYLNFP LA  LP+P S SPKDIQAAAA AA      +         EA
Sbjct  129  DVAALAIKGASAYLNFPELAQALPQPDSKSPKDIQAAAAKAASEAAAASASEEKQLICEA  188

Query  480  EPSRAELPssqsssnltsesmqeSLNSPSGYGGVD-DTFFDLPDLSLDGANQNDHY----  316
            E + AE+    S+++  S + + S    S     D +  FDLPDL +DG + +D++    
Sbjct  189  ETNEAEVKLPMSANSTLSNAQESSSTCASASTNYDEEQLFDLPDLVIDGKDGSDNFRYYS  248

Query  315  VSTWQLVGVDPGGFRLEEPFLWE  247
             STW L   D  GFRLEEPFLWE
Sbjct  249  SSTWHLCAADT-GFRLEEPFLWE  270



>emb|CDX83411.1| BnaA03g20950D [Brassica napus]
Length=277

 Score =   183 bits (464),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 138/210 (66%), Gaps = 24/210 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KRRK+ GG+KHP YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA+LAI
Sbjct  67   KRRKISGGDKHPNYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVASLAI  126

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD--------DNDEVSHGESIE  484
            KG +A+LNFP L+ +LPRP ++SPKDIQAAA  AA    D        +N +V   E  E
Sbjct  127  KGTTAHLNFPELSGELPRPVTSSPKDIQAAATAAAVNWQDSGANSLRMNNSDV--AELAE  184

Query  483  AEPSRAELPssqsssnltse------smqeSLNSPSGYGGVD---DTFFDLPDL-SLDGA  334
             EPSR  +  + S S + S         + S +S + +   D   +  FDLPDL S +  
Sbjct  185  TEPSRVVMAQALSGSVVYSSDINTRDLSEISCSSTTSFADKDKEEEKLFDLPDLFSDEMI  244

Query  333  NQND---HYVSTWQLVGVDPGGFRLEEPFL  253
             +ND   +Y S WQL G D  GFRLEEPF 
Sbjct  245  IRNDAFCYYSSAWQLCGAD-HGFRLEEPFF  273



>ref|XP_004510113.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=210

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 115/197 (58%), Gaps = 44/197 (22%)
 Frame = -1

Query  822  KKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            KKR++ E  E  KHPTYRGVR RNWGKWV EIREPRKKSRIWLGTYPTAEMAARAHDVAA
Sbjct  54   KKRQRSESDENMKHPTYRGVRMRNWGKWVCEIREPRKKSRIWLGTYPTAEMAARAHDVAA  113

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSR  469
            LAIKG+SAYLNFP LA QLP+P S SPKDIQ AAA AA  T  D+ +             
Sbjct  114  LAIKGNSAYLNFPQLAKQLPKPISTSPKDIQFAAAKAANNTSFDSQQHD-----------  162

Query  468  AELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGV  289
                                          D T FDLPDL  DG N      S+W L  V
Sbjct  163  ------------------------------DSTLFDLPDLFPDGNNGLSSSYSSWNLCAV  192

Query  288  DPGGFRL-EEPFLWECY  241
            D G  RL +EP  WE Y
Sbjct  193  DTGLIRLDQEPSFWENY  209



>ref|XP_002301249.2| hypothetical protein POPTR_0002s14210g [Populus trichocarpa]
 gb|EEE80522.2| hypothetical protein POPTR_0002s14210g [Populus trichocarpa]
Length=272

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 139/210 (66%), Gaps = 15/210 (7%)
 Frame = -1

Query  855  RGQEAKTGG--GNKKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            + QE ++ G  G K+R+  E  +  KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYP
Sbjct  70   KAQELQSSGNEGGKRRKTAENEKNGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYP  129

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE  508
            TAEMAARAHDVAALAIKG SAYLNFP  A +LP P S SPKDIQAAAA AA  +F +   
Sbjct  130  TAEMAARAHDVAALAIKGGSAYLNFPEFAHELPPPLSKSPKDIQAAAAKAAAASFTETRY  189

Query  507  VSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQ  328
                   EAE + + L  S +  N    S   S +S       DDT FDLPDL +DG + 
Sbjct  190  CEGEGGGEAELNVSNLSDSLAMDNTQESSSSPSTDS-------DDTLFDLPDLFIDGVHH  242

Query  327  ND---HYVSTWQLVGVDPGGFRLEEPFLWE  247
            +D   +Y S+WQL   D  GFRL EPFLWE
Sbjct  243  SDGFCYYSSSWQLCAAD-TGFRLGEPFLWE  271



>ref|XP_007039780.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
 gb|EOY24281.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma 
cacao]
Length=237

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 134/208 (64%), Gaps = 19/208 (9%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGE---KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            K    N+ +RKV+  E   KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+PTAEMAA
Sbjct  37   KVKNANESKRKVKNDEVEGKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTAEMAA  96

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES  490
            RAHDVAAL IKG SAYLNFP +A +LPRP S SPKDIQAAAA AA   +  + EV     
Sbjct  97   RAHDVAALTIKGKSAYLNFPEIAHELPRPVSASPKDIQAAAAKAATLNYPKSHEV-----  151

Query  489  IEAEPSRAE--LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY  316
             EAE S+ +   P S +S+  + ++     +S S     DD F DLPDL LD  +Q D +
Sbjct  152  -EAELSQVDQMFPRSPASTVTSHDTQD---SSSSPLINNDDAFIDLPDLLLDMNHQIDEF  207

Query  315  --VSTWQLVGVD---PGGFRLEEPFLWE  247
                +WQL   D     GF  EEP LWE
Sbjct  208  WGSLSWQLPATDDPVENGFGYEEPCLWE  235



>ref|XP_010518106.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Camelina sativa]
Length=283

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 128/193 (66%), Gaps = 13/193 (7%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            +KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG +AYLN
Sbjct  89   DKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLN  148

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDD-NDEVSHGESIEAEPSRAELPssqsss  439
            FP L+ +LPRP +NSPKDIQAAA++AA    D  ND     E  EAEPSRA    S  +S
Sbjct  149  FPELSGELPRPVTNSPKDIQAAASLAAVNWQDPVNDVEEVAELAEAEPSRAATVISSDTS  208

Query  438  nltsesmqeSLNSPSGYGGVD-----DTFFDLPDLSLDGAN---QND---HYVSTWQLVG  292
              T        +  S     D     +  FDLPDL  D      +N+   +Y STWQL G
Sbjct  209  TTTQSQESLEASCASTTSCTDKDNDEEKLFDLPDLFTDENEMMIRNETFCYYSSTWQLCG  268

Query  291  VDPGGFRLEEPFL  253
             D  GFRLEEPF 
Sbjct  269  AD-AGFRLEEPFF  280



>ref|XP_007155687.1| hypothetical protein PHAVU_003G222600g [Phaseolus vulgaris]
 gb|ESW27681.1| hypothetical protein PHAVU_003G222600g [Phaseolus vulgaris]
Length=230

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 130/206 (63%), Gaps = 23/206 (11%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            Q + T     KR  +      HPTYRGVR R WGKWVSEIREPRKKSRIWLGT+PT +MA
Sbjct  45   QPSNTKDKKNKRTNINTNHGNHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPDMA  104

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE  493
            ARAHDVAAL IKG SA+LNFP LA +LPRPA+NSPKDIQ AAA AA   F+         
Sbjct  105  ARAHDVAALTIKGSSAFLNFPELAAELPRPATNSPKDIQVAAAKAAALDFN-------HR  157

Query  492  SIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND--H  319
            S EAE   +EL         +      + +S S   G DDTF DLPDLS D ++  D  H
Sbjct  158  SHEAE---SEL---------SRGGSISNSSSNSSLKGEDDTFMDLPDLSPDLSHGADEFH  205

Query  318  YVSTWQLVGVDPGGFRLEEPFLWECY  241
            Y S W + G +  GFRLEEPFLWE Y
Sbjct  206  YSSAWLVTGPE-LGFRLEEPFLWESY  230



>ref|XP_009116730.1| PREDICTED: ethylene-responsive transcription factor ERF035 [Brassica 
rapa]
Length=248

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 139/208 (67%), Gaps = 12/208 (6%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            Q+ + GG  +K    +G E    YRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAEMAA
Sbjct  42   QDNEAGGKRRKSNGRDGNENPTPYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAEMAA  101

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES  490
            RAHDVAALAIKG+S YLNFP L+  LPRP S SPKDIQAAAA AAETT+   + V H + 
Sbjct  102  RAHDVAALAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAAAKAAETTW--QEPVIHEKL  159

Query  489  IEAEPSRAELPssqsssnltsesmqeSLNSPSGYG--GVDDTFFDLPDLSLDG-ANQNDH  319
            +E E S +EL ++  SS  +S       +  S       ++T FDLPDL  +G  NQND 
Sbjct  160  VE-ELSHSELSTADQSSTSSSFIFSSDTSETSSTDKESNEETVFDLPDLFTEGLLNQNDA  218

Query  318  Y-----VSTWQLVGVDPGGFRLEEPFLW  250
            +      STWQL G D   FRLEEPF W
Sbjct  219  FRYYDSTSTWQLFG-DDVVFRLEEPFTW  245



>emb|CDY41162.1| BnaA09g38530D [Brassica napus]
Length=248

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 139/208 (67%), Gaps = 12/208 (6%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            Q+ + GG  +K    +G E    YRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAEMAA
Sbjct  42   QDNEAGGKRRKSNGRDGNENPTPYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAEMAA  101

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES  490
            RAHDVAALAIKG+S YLNFP L+  LPRP S SPKDIQAAAA AAETT+   + V H + 
Sbjct  102  RAHDVAALAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAAAKAAETTW--KEPVIHEKL  159

Query  489  IEAEPSRAELPssqsssnltsesmqeSLNSPSGYG--GVDDTFFDLPDLSLDG-ANQNDH  319
            +E E S +EL ++  SS  +S       +  S       ++T FDLPDL  +G  NQND 
Sbjct  160  VE-ELSHSELSTADQSSTSSSFIFSSDTSETSSTDKESNEETVFDLPDLFTEGLLNQNDA  218

Query  318  Y-----VSTWQLVGVDPGGFRLEEPFLW  250
            +      STWQL G D   FRLEEPF W
Sbjct  219  FRYYDSTSTWQLFG-DDVVFRLEEPFTW  245



>ref|XP_009142308.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Brassica rapa]
Length=277

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 127/185 (69%), Gaps = 11/185 (6%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+RK  GG+KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTA+MAARAHDVAALAI
Sbjct  79   KQRKTSGGDKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTADMAARAHDVAALAI  138

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAEL  460
            KG +AYLNFP L+ +LPRP +NSPKDIQ AAA AA   + D+D V+  E  EAEPSR  +
Sbjct  139  KGTTAYLNFPELSGELPRPVTNSPKDIQ-AAATAAAVNWQDSD-VAALE--EAEPSREVM  194

Query  459  PssqsssnltsesmqeSLNSPSGYG---GVDDTFFDLPDLSLDGANQND----HYVSTWQ  301
              S S S + S  +     S +        ++  FDLPDL  D     D    +Y STWQ
Sbjct  195  AQSLSGSVVFSSDITTREMSETSCADKESDEEKLFDLPDLFNDEMMIRDDAFCYYSSTWQ  254

Query  300  LVGVD  286
            L G D
Sbjct  255  LCGAD  259



>gb|ABQ62974.1| TINY-like protein [Populus trichocarpa]
Length=272

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 138/210 (66%), Gaps = 15/210 (7%)
 Frame = -1

Query  855  RGQEAKTGG--GNKKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            + QE ++ G  G K+R+  E  +  KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYP
Sbjct  70   KAQELQSSGNEGGKRRKTTENEKNGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYP  129

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE  508
            TAEMAARAHDVAALAIKG SAYLNFP  A +LP P S SPKDIQAAAA AA  +F +   
Sbjct  130  TAEMAARAHDVAALAIKGGSAYLNFPEFAHELPPPLSKSPKDIQAAAAKAAAASFTETRY  189

Query  507  VSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQ  328
                   EAE + + L  S +  N    S   S +S       DDT FDLPDL +DG + 
Sbjct  190  CEGEGGGEAELNVSNLSDSLAMDNTQESSSSPSTDS-------DDTLFDLPDLFIDGVHH  242

Query  327  ND---HYVSTWQLVGVDPGGFRLEEPFLWE  247
            +D   +Y S+WQL   D  GFRL EPFL E
Sbjct  243  SDGFCYYSSSWQLCAAD-TGFRLGEPFLLE  271



>ref|XP_004301177.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=225

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 130/211 (62%), Gaps = 27/211 (13%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            R  E  +G G K     EG ++HP YRGVR+R WGKWVSEIREPRKKSRIWLGT+ T EM
Sbjct  34   RVIENGSGKGAKSDGSEEGSQQHPMYRGVRRRQWGKWVSEIREPRKKSRIWLGTFETPEM  93

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDD--NDEVS  502
            AARAHDVAAL IKG SAYLNFP LA +LPRPAS+SPKDIQAAAA AA  ++ +  N   +
Sbjct  94   AARAHDVAALTIKGSSAYLNFPELAQELPRPASSSPKDIQAAAAKAAALSYPNCRNSHET  153

Query  501  HGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLD-GANQN  325
            H E  EA P R                   S  SP      DDTF+DLPDL +D G    
Sbjct  154  H-EPEEARPCR-----------------DSSSTSPLSDEHNDDTFYDLPDLLIDVGQYHG  195

Query  324  DH-----YVSTWQLVGVDPGGFRLEEPFLWE  247
            DH       +TWQL  +D    R+EE FLW+
Sbjct  196  DHEYYFPVAATWQLDPMD-TILRMEESFLWD  225



>emb|CDX71804.1| BnaC08g30700D [Brassica napus]
Length=248

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 144/211 (68%), Gaps = 18/211 (9%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKH--PT-YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            Q+ + GG   KRRK  G +++  PT YRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAE
Sbjct  42   QDNEAGG---KRRKSNGRDRNENPTPYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAE  98

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAALAIKG+S YLNFP L+  LPRP S SPKDIQAAAA AAETT+   + V H
Sbjct  99   MAARAHDVAALAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAAAKAAETTW--QEPVIH  156

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYG--GVDDTFFDLPDLSLDG-ANQ  328
             + +E E S  EL ++  SS  +S       +  S       ++T FDLPDL  +G  NQ
Sbjct  157  EKLVE-ELSHYELSTADQSSTSSSFVFSSDTSETSSTDKESNEETVFDLPDLFTEGLLNQ  215

Query  327  NDHY-----VSTWQLVGVDPGGFRLEEPFLW  250
            ND +     +STWQL G D   FRLEEPF W
Sbjct  216  NDAFRYYDSMSTWQLFG-DDVVFRLEEPFTW  245



>ref|XP_010506433.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Camelina sativa]
Length=289

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 135/196 (69%), Gaps = 16/196 (8%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            +KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG +AYLN
Sbjct  92   DKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLN  151

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDD-NDEVSHGESIEAEPSRA-----ELPs  454
            FP L+ +LPRP +NSPKDIQAAA++AA    D  ND     E  EAEPSRA        S
Sbjct  152  FPELSGELPRPLTNSPKDIQAAASLAAVNWQDPVNDVEEVAELAEAEPSRAATVISSDTS  211

Query  453  sqsssnltsesmqeSLNSPSGYGGVD---DTFFDLPDLSLD---GANQND---HYVSTWQ  301
            + +++  + ES + S  S + +   D   +  FDLPDL  D      +ND   +Y STWQ
Sbjct  212  TTTTTTQSQESSEASCASTTSFTDKDNDEEKLFDLPDLFTDENEMMIRNDAFCYYSSTWQ  271

Query  300  LVGVDPGGFRLEEPFL  253
            L G D  GFRLEEPF 
Sbjct  272  LCGAD-AGFRLEEPFF  286



>ref|XP_003626728.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
 gb|AET01204.1| ethylene response factor [Medicago truncatula]
Length=207

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 122/202 (60%), Gaps = 35/202 (17%)
 Frame = -1

Query  825  NKKRRK---VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            +KKR++   VE    HPTYRGVRKRNWGK+V EIREP+KKSRIWLGTYPTAEMAARAHDV
Sbjct  34   SKKRQRSTEVENNSTHPTYRGVRKRNWGKFVCEIREPKKKSRIWLGTYPTAEMAARAHDV  93

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AALAIKGHSAYLNFP L  QLP+P S S KDIQAAAA AA T F             AEP
Sbjct  94   AALAIKGHSAYLNFPELVQQLPKPISTSTKDIQAAAAKAANTVF------------VAEP  141

Query  474  SRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN----DHYVST  307
             + E                 S +S +     D T FDLPDL  D  N          S+
Sbjct  142  IQEE---------------HFSSSSSTFTNNDDATLFDLPDLFPDDGNNGLCSYSSKNSS  186

Query  306  WQLVGVDPGGFRLEEPFLWECY  241
            W L  VD  GFRLEEP  WE Y
Sbjct  187  WYLCAVD-SGFRLEEPSFWEKY  207



>gb|KFK35254.1| hypothetical protein AALP_AA5G261400 [Arabis alpina]
Length=253

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 127/203 (63%), Gaps = 21/203 (10%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            ++R+    E   +YRGVRKR+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI
Sbjct  56   EKRRGHDNENPTSYRGVRKRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  115

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDD-------NDEVSHGESIEA  481
            KG+S +LNFP L+   PRP S SPKDIQ AAA AA  T+ +        DE+SH E   A
Sbjct  116  KGNSGFLNFPELSGLFPRPVSCSPKDIQIAAAKAAAATWQEPIISEKVADELSHSELSTA  175

Query  480  EPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG-ANQNDHY----  316
              S A      SS    + S  +  N        ++T FDLPDL  DG  +QND +    
Sbjct  176  HESSASCSFMFSSDTSETSSTDKESN--------EETVFDLPDLFTDGLMSQNDAFRYYN  227

Query  315  -VSTWQLVGVDPGGFRLEEPFLW  250
               TWQL G +   FRLEEPF W
Sbjct  228  NTFTWQLYGEEDLVFRLEEPFTW  250



>ref|XP_004307005.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=274

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 139/219 (63%), Gaps = 18/219 (8%)
 Frame = -1

Query  852  GQEAKTGGGN----KKRRKVEG----GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLG  697
            GQE   G  N    KKR++       G KHPT+RGVR R+WGKWVSEIREPRKKSRIWLG
Sbjct  56   GQEDNNGSNNEPNTKKRQRSSNDHGDGGKHPTFRGVRMRSWGKWVSEIREPRKKSRIWLG  115

Query  696  TYPTAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaA---ETT  526
            TYPTAEMAARAHDVAA AIKG SAYLNFP LA  LP+PAS SPKDIQAAAA AA   E  
Sbjct  116  TYPTAEMAARAHDVAARAIKGASAYLNFPELAQTLPQPASASPKDIQAAAAKAASALEEM  175

Query  525  FDDNDEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLS  346
                 EV   E    +PS+ E  ++ +++  TS S   + +S S     DD  FDLPDL 
Sbjct  176  KKCGAEVEEEEEQATQPSKDEETTTTTANTSTSTSNSTACSSSSSSVDYDDKLFDLPDLF  235

Query  345  LDGANQNDHYV------STWQLVGVDPGGFRLEEPFLWE  247
            +DG N +  +       S+W L   D  GFRLEEPF WE
Sbjct  236  MDGTNGSYQFCFSSSSSSSWHLCAADT-GFRLEEPFSWE  273



>ref|XP_004508937.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=231

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 119/184 (65%), Gaps = 23/184 (13%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+PT +MAARAHDVAALAIKG SAYLNF
Sbjct  67   KHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALAIKGSSAYLNF  126

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA  LPRPAS SPKDIQAAAA AA T ++        E+ EAEPS+A           
Sbjct  127  PELAAMLPRPASTSPKDIQAAAAKAAATFYNHPTRQLQLEA-EAEPSQAS----------  175

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVD--PGGFRLEEP  259
                   S N  S   G DD F +LPDLSLD ++      S W + G       FRLE+ 
Sbjct  176  ----SSSSHNERSSLNGEDDMFLNLPDLSLDYSS------SAWLVTGAQHIDSAFRLEDS  225

Query  258  FLWE  247
            FLW+
Sbjct  226  FLWD  229



>ref|XP_006368997.1| hypothetical protein POPTR_0001s15550g [Populus trichocarpa]
 gb|ERP65566.1| hypothetical protein POPTR_0001s15550g [Populus trichocarpa]
Length=252

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 139/205 (68%), Gaps = 10/205 (5%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            R Q+ K    + K+ K  G   +HP+YRGVR R WGKWVSEIR+P+KKSRIWLGT+PT E
Sbjct  47   RNQDPKNNNESNKKAKSGGNAGRHPSYRGVRMRQWGKWVSEIRQPKKKSRIWLGTFPTPE  106

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAAL IKGHSA+LNFP LA + PRPAS+SPKDIQAAAA+AA  +   + +   
Sbjct  107  MAARAHDVAALTIKGHSAHLNFPELAHEFPRPASSSPKDIQAAAALAATLSCKTSPK---  163

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
            G   EAE     LP S  S+  ++E+ + SL+SP    G DDTF DLPD+  D    ++ 
Sbjct  164  GRETEAE-DELMLPHSPDSTLASNETQEYSLSSPLRDDG-DDTFIDLPDILQDQYQFDEF  221

Query  318  -YVSTWQLVG---VDPGGFRLEEPF  256
             Y+S+WQLVG    D G +  EEPF
Sbjct  222  CYLSSWQLVGPETSDIGFWHQEEPF  246



>gb|ABQ62971.1| TINY-like protein [Populus trichocarpa]
Length=221

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 139/205 (68%), Gaps = 10/205 (5%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            R Q+ K    + K+ K  G   +HP+YRGVR R WGKWVSEIR+P+KKSRIWLGT+PT E
Sbjct  16   RNQDPKNNNESNKKAKSGGNAGRHPSYRGVRMRQWGKWVSEIRQPKKKSRIWLGTFPTPE  75

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAAL IKGHSA+LNFP +A + PRPAS+SPKDIQAAAA+AA  +   + +   
Sbjct  76   MAARAHDVAALTIKGHSAHLNFPEIAHEFPRPASSSPKDIQAAAALAATLSCKTSQK---  132

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
            G   EAE     LP S  S+  ++E+ + SL+SP    G DDTF DLPD+  D    ++ 
Sbjct  133  GRETEAE-DELMLPHSPDSTLASNETQEYSLSSPLRDDG-DDTFIDLPDILQDQYQFDEF  190

Query  318  -YVSTWQLVG---VDPGGFRLEEPF  256
             Y+S+WQLVG    D G +  EEPF
Sbjct  191  CYLSSWQLVGPETSDIGFWHHEEPF  215



>emb|CDX98416.1| BnaC06g17770D [Brassica napus]
Length=243

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 134/192 (70%), Gaps = 10/192 (5%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
             GG +++R    G K+PTYRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAEMAARAHDV
Sbjct  49   AGGKRRKRNGGNGNKNPTYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDV  108

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AALAIKG+S YLNFP L+  LPRP S SPKDIQAAAA AAE  +    E    E +  E 
Sbjct  109  AALAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAAAKAAEVMW---QEPVIDEKLANER  165

Query  474  SRAELPssqsssnltsesmqeSLNSPSG-YGGVDDTFFDLPDLSLDG-ANQNDHY-----  316
            S +EL ++QSS++ +     ++++S S      ++T FDLPDL ++G  N +D +     
Sbjct  166  SHSELSTAQSSTSSSFVFSSDTIDSLSTDKESNEETVFDLPDLFMEGFLNHDDSFGYYES  225

Query  315  VSTWQLVGVDPG  280
             +TWQL G D G
Sbjct  226  TTTWQLYGEDVG  237



>ref|XP_010264388.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Nelumbo 
nucifera]
Length=282

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 135/214 (63%), Gaps = 17/214 (8%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGE---KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            QE K    ++KR+K        KHPTYRGVR RNWGKWVSEIREPRKKSRIWLGT+PT E
Sbjct  71   QEVKDENESRKRQKASSNVNDGKHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPE  130

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAAL IKG+SAYLNFP LA +LPRPAS+SPKDIQAAAA AA  TFD     + 
Sbjct  131  MAARAHDVAALTIKGNSAYLNFPELAHELPRPASSSPKDIQAAAAKAAAATFDKQ---AT  187

Query  498  GESIEAEP----SRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGAN  331
            G  +E E     S+   P S  S   T+ S      S S     ++T FDLPDL LD   
Sbjct  188  GREVETEAQSKRSKPGFPISDYSPIHTTTSDDTPEFSISPSTD-EETLFDLPDLFLDHTI  246

Query  330  QNDHYVSTWQLVGVDPG---GFRLEEP-FLWECY  241
              + +   + L  + PG   G R++EP  LWE +
Sbjct  247  SPNRF--DFSLSLLSPGADLGLRMDEPLLLWEYH  278



>ref|XP_006291643.1| hypothetical protein CARUB_v10017799mg [Capsella rubella]
 gb|EOA24541.1| hypothetical protein CARUB_v10017799mg [Capsella rubella]
Length=279

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 135/224 (60%), Gaps = 25/224 (11%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPT--YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            Q+    GG  KRRK     K+PT  YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEM
Sbjct  56   QDNNDAGG--KRRKSNDDHKNPTTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEM  113

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaama------AETTFDDN  514
            AARAHDVA+LAIKG+S YLNFP L+  LPRP S+SPKDIQAAA  A       E   D+ 
Sbjct  114  AARAHDVASLAIKGNSGYLNFPELSGLLPRPVSSSPKDIQAAATKAAETTTWQELATDEK  173

Query  513  ------DEVSHGESIEAEPSRAELPssqsssnltsesmqeSL---NSPSGYGGVDDTFFD  361
                  DE+SH   +    +     ++   S+ +S  +  S       +     ++T FD
Sbjct  174  LAEPEADELSHSSELLMSTTTTTTTAAADQSSTSSSFVFSSDTSETCSTDKESSEETLFD  233

Query  360  LPDLSLDG-ANQNDHYV-----STWQLVGVDPGGFRLEEPFLWE  247
            LPDL  DG  N ND +      STWQL G D G  R EEPF+W+
Sbjct  234  LPDLFTDGLMNGNDAFCLCNGTSTWQLYGEDVGFLRFEEPFIWQ  277



>emb|CDX67829.1| BnaA07g18690D [Brassica napus]
Length=243

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 136/199 (68%), Gaps = 15/199 (8%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            Q+ + GG   KRRK  GG   K+PTYRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAEM
Sbjct  45   QDTEAGG---KRRKSNGGNGNKNPTYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAEM  101

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAALAIKG+S  LNFP L+  LPRP S SPKDIQAAAA AAE  +    E    
Sbjct  102  AARAHDVAALAIKGNSGCLNFPELSTLLPRPVSCSPKDIQAAAAKAAEVMW---QEPVID  158

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSG-YGGVDDTFFDLPDLSLDG-ANQND  322
            E +  E S +EL ++QSS++ +     ++L++ S      ++T FDLPDL  +G  N ND
Sbjct  159  EKLANERSYSELSTAQSSTSSSFVFSSDTLDTLSTDKESNEETMFDLPDLFTEGFMNHND  218

Query  321  HY-----VSTWQLVGVDPG  280
             +      +TWQL G D G
Sbjct  219  SFRYYESTTTWQLYGEDVG  237



>ref|XP_006294662.1| hypothetical protein CARUB_v10023699mg [Capsella rubella]
 gb|EOA27560.1| hypothetical protein CARUB_v10023699mg [Capsella rubella]
Length=306

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 133/200 (67%), Gaps = 20/200 (10%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            +KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG +AYLN
Sbjct  104  DKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGTTAYLN  163

Query  615  FPHLADQLPRPASNSPKDIQaaaamaA----ETTFDDNDEVSHGESIEAEPSRAELPssq  448
            FP L+ +LPRP +NSPKDIQAAA++AA    +   D +D     E  EAEPS A +  S 
Sbjct  164  FPELSGELPRPVTNSPKDIQAAASLAAVNWQDPVNDADDSEEAAELAEAEPSPAAVVFSS  223

Query  447  sssnltsesmqeSLNSPSGYGGV---------DDTFFDLPDLSLD---GANQND---HYV  313
             +S  T+ + Q   +S +              ++  FDLPDL  D      +ND   +Y 
Sbjct  224  DTSTTTTTTTQSQESSEASCASTSCSTDKDNEEEKLFDLPDLFADENEMMIRNDAFCYYS  283

Query  312  STWQLVGVDPGGFRLEEPFL  253
            STWQL G D  GFRLEEPF 
Sbjct  284  STWQLCGAD-AGFRLEEPFF  302



>ref|XP_010469178.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Camelina sativa]
Length=271

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 134/219 (61%), Gaps = 24/219 (11%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPT-YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
             GG +++  V    K+PT YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD
Sbjct  52   AGGKRRKSNVSDDNKNPTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  111

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaam-------aAETTFDD------  517
            VA+LAIKG+S YLNFP L+  LPRP S SPKDIQAAA           E   DD      
Sbjct  112  VASLAIKGNSGYLNFPELSHLLPRPVSCSPKDIQAAATKAAEATTWQLEPAIDDGKLPEP  171

Query  516  --NDEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSL  343
              +DE+SH E + +  +      S +SS+    S     +S       ++T FDLPDL  
Sbjct  172  EADDELSHSELL-STITTTTADQSSTSSSFVFSSDTSETSSTDKESNEEETVFDLPDLFT  230

Query  342  DG-ANQNDHYVS-----TWQLVGVDPGGFRL-EEPFLWE  247
            DG  N+ND +       TWQL G +  GFR  EEPF+W+
Sbjct  231  DGLMNRNDAFCLCNGTFTWQLCGEEDVGFRFEEEPFIWQ  269



>ref|NP_001235341.1| dehydration-responsive element binding protein 6 [Glycine max]
 gb|ABQ42205.1| dehydration-responsive element binding protein 6 [Glycine max]
Length=230

 Score =   169 bits (429),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 129/188 (69%), Gaps = 16/188 (9%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+PT +MAARAHDVAAL IKG SAYLNF
Sbjct  55   KHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLNF  114

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LAD+LPRPAS SPKDIQAAAA AA   F      SH    E+E SRA        S+ 
Sbjct  115  PELADELPRPASTSPKDIQAAAAKAAALDFGHR---SH--DAESELSRA-------VSSS  162

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND--HYVSTWQLVGVD--PGGFRLE  265
                   S ++ S   GVDDTF DLPDLSLD ++  D  HY S W + G +    GFRLE
Sbjct  163  ILTQASSSSSNSSSLKGVDDTFLDLPDLSLDLSHGADEFHYSSAWLVAGAEHIELGFRLE  222

Query  264  EPFLWECY  241
            +PFLWE Y
Sbjct  223  DPFLWESY  230



>ref|XP_009104264.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Brassica rapa]
Length=243

 Score =   170 bits (430),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 132/190 (69%), Gaps = 12/190 (6%)
 Frame = -1

Query  822  KKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            +KRRK  GG   K+PTYRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAEMAARAHDVAA
Sbjct  51   RKRRKSNGGNGNKNPTYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAA  110

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSR  469
            LAIKG+S  LNFP L+  LPRP S SPKDIQAAAA AAE  +    E    E +  E S 
Sbjct  111  LAIKGNSGCLNFPELSTLLPRPVSCSPKDIQAAAAKAAEVMW---QEPVIDEKLANERSY  167

Query  468  AELPssqsssnltsesmqeSLNSPSG-YGGVDDTFFDLPDLSLDG-ANQNDHY-----VS  310
            +EL ++QSS++ +     ++L++ S      ++T FDLPDL  +G  N ND +      +
Sbjct  168  SELSTAQSSTSSSFVFSSDTLDTLSTDKESNEETMFDLPDLFTEGFMNHNDSFRYYESTT  227

Query  309  TWQLVGVDPG  280
            TWQL G D G
Sbjct  228  TWQLYGEDVG  237



>gb|KHN43745.1| Ethylene-responsive transcription factor ERF034 [Glycine soja]
Length=168

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 121/174 (70%), Gaps = 7/174 (4%)
 Frame = -1

Query  762  RNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRP  583
            RNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFP LA +LPRP
Sbjct  2    RNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPELAQELPRP  61

Query  582  ASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnltsesmqeSLN  403
            AS SPKDIQAAA+ AA T F   + V H +  E +         ++SS L+ ++ QE   
Sbjct  62   ASTSPKDIQAAASKAANTAF---EVVKHCQITEEQEQEQNQAEQETSSTLSMDNTQEP--  116

Query  402  SPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFLWECY  241
            S S     DDT FDLPDL  DG N    + S+W L  VD  GFRLEE F WE Y
Sbjct  117  SSSHSTNDDDTLFDLPDLFPDGNNGLCSF-SSWHLCAVD-SGFRLEESFFWENY  168



>ref|XP_002876560.1| hypothetical protein ARALYDRAFT_486521 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52819.1| hypothetical protein ARALYDRAFT_486521 [Arabidopsis lyrata subsp. 
lyrata]
Length=264

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 130/220 (59%), Gaps = 28/220 (13%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPT-YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            Q+   GG  +K   V    K+PT YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMA
Sbjct  52   QDNGVGGKRRKISNVSDDNKNPTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMA  111

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTF----------  523
            ARAHDVAALAIKG+S YLNFP L+  LPRP S SPKDIQAAA  AAE T           
Sbjct  112  ARAHDVAALAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAATKAAEATTWQKPIINEKL  171

Query  522  --DDNDEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDL  349
               + DE+SH E +    S        SS    + S  +  N        ++  FDLPDL
Sbjct  172  AEPEGDELSHSELLSTAQSSTSSCFVFSSDTSETSSTDKESN--------EEKVFDLPDL  223

Query  348  SLDG-ANQNDHYVS-----TWQLVGVDPGGFRLEEPFLWE  247
              DG  NQND +       TWQL G D  G R EEPF W+
Sbjct  224  FTDGLMNQNDAFCLCNGTFTWQLYGEDV-GLRFEEPFNWQ  262



>ref|NP_191608.1| ethylene-responsive transcription factor ERF035 [Arabidopsis 
thaliana]
 sp|Q9M210.1|ERF35_ARATH RecName: Full=Ethylene-responsive transcription factor ERF035 
[Arabidopsis thaliana]
 emb|CAB81835.1| transcription factor-like protein [Arabidopsis thaliana]
 gb|AAT44915.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABK59687.1| At3g60490 [Arabidopsis thaliana]
 gb|AEE80067.1| ethylene-responsive transcription factor ERF035 [Arabidopsis 
thaliana]
Length=256

 Score =   169 bits (429),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 129/211 (61%), Gaps = 23/211 (11%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPT-YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
             GG +++  V    K+PT YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD
Sbjct  52   SGGKRRKSNVSDDNKNPTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  111

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET------TFDDN--DEVS  502
            VAALAIKG+S +LNFP L+  LPRP S SPKDIQAAA  AAE         D    DE+S
Sbjct  112  VAALAIKGNSGFLNFPELSGLLPRPVSCSPKDIQAAATKAAEATTWHKPVIDKKLADELS  171

Query  501  HGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG-ANQN  325
            H E +    S        SS    + S  +  N        ++T FDLPDL  DG  N N
Sbjct  172  HSELLSTAQSSTSSSFVFSSDTSETSSTDKESN--------EETVFDLPDLFTDGLMNPN  223

Query  324  DHYVS-----TWQLVGVDPGGFRLEEPFLWE  247
            D +       TWQL G +  GFR EEPF W+
Sbjct  224  DAFCLCNGTFTWQLYGEEDVGFRFEEPFNWQ  254



>ref|XP_010056415.1| PREDICTED: ethylene-responsive transcription factor ERF034 [Eucalyptus 
grandis]
 gb|KCW73138.1| hypothetical protein EUGRSUZ_E01593 [Eucalyptus grandis]
Length=289

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 127/196 (65%), Gaps = 10/196 (5%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KR K  G  +HPTYRGVR RNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI
Sbjct  101  KRHKAGGSGEHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  160

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD-DNDEVSHGESIEAEPSRAE  463
            KG SA LNFP LA +LPRPAS SPKDIQ AAA AA +     ++  +  +   A P R  
Sbjct  161  KGSSAVLNFPELAPELPRPASTSPKDIQEAAAKAAASFAPLPSERGAEDDGTGANPRRDT  220

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVS-TWQLVGVD  286
               S S +N + ES   S N        +D  FDLPDL +D  N      S +WQ+   D
Sbjct  221  SERSLSDTNSSQESTNCSSND------NEDALFDLPDLCVDQPNGFGFCPSLSWQVCAAD  274

Query  285  PGGFRLEEPFL-WECY  241
              G RLEEP+L W+ +
Sbjct  275  -SGSRLEEPYLAWDYF  289



>ref|XP_004492188.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=233

 Score =   168 bits (425),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 123/205 (60%), Gaps = 23/205 (11%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            +KKR + +   KHPTYRGVR R WGK+VSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL
Sbjct  42   SKKRERKQNDTKHPTYRGVRMRAWGKYVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  101

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRA  466
            AIKGHSAYLNFP+LA  LPRP++ SPKDIQAAAA AA T F    E+   ++ E + S +
Sbjct  102  AIKGHSAYLNFPNLAQNLPRPSTTSPKDIQAAAAKAAATIF---VEIKDQQNQEDQDSSS  158

Query  465  ELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN----------DHY  316
             L       +          NSPS    V     D  D        +           + 
Sbjct  159  TLSLENVRESS---------NSPSSTTTVTTATTDDDDDDTLFDLPDLLLDDKNGLFSYS  209

Query  315  VSTWQLVGVDPGGFRLEEPFLWECY  241
             S+WQL  VD  G RLEE  LWE Y
Sbjct  210  SSSWQLCAVD-SGLRLEEQLLWEFY  233



>ref|XP_008803818.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Phoenix dactylifera]
Length=319

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 128/205 (62%), Gaps = 19/205 (9%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            R  EA +GG  KKR K +G  KHPTYRGVR RNWGKWVSEIREPRKKSRIWLGT+PTAEM
Sbjct  128  RDAEASSGGEAKKRSK-DG--KHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTAEM  184

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAAL IKG SAYLNFP LA +LPRPA++SPKDIQAAAA+AA  TF D    S G
Sbjct  185  AARAHDVAALTIKGQSAYLNFPELACKLPRPATSSPKDIQAAAALAAAATFGDCSPGSCG  244

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY  316
             S+E+   R E+ ++  S              P+     +D         L        Y
Sbjct  245  -SVESAACRDEITTTSDSPP------------PATPSSGNDDALFDLPDLLLDLRDGFCY  291

Query  315  VSTWQLVGVDPG---GFRLEEPFLW  250
             STW     +     GFRLEEPFLW
Sbjct  292  SSTWLPPAPEEDSTIGFRLEEPFLW  316



>ref|XP_010258834.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nelumbo nucifera]
Length=275

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 126/191 (66%), Gaps = 11/191 (6%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPTYRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL +KG SAYLNF
Sbjct  86   KHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALTVKGKSAYLNF  145

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDN-DEVSHGESIEAEPSRAELPssqsssn  436
            P  A +LPRPAS+SPKDIQAAAA AA  TF ++    SH    E EPS  E  S   + +
Sbjct  146  PERAHELPRPASSSPKDIQAAAAKAAAATFGEHPSRSSHEADAEGEPSEPEPESLPITHS  205

Query  435  ltsesmqeSLNSPSGYGGVDD---TFFDLPDLSLD-GANQNDHYVSTWQLVGVDPG----  280
             +  +        S     D+    FFDLPDL LD  +NQ D +     L+   PG    
Sbjct  206  PSLTTTSADTQEFSVSPSTDEEDSLFFDLPDLFLDLSSNQIDRFGFCSPLLS--PGEADF  263

Query  279  GFRLEEPFLWE  247
            GF++EEPFLWE
Sbjct  264  GFQMEEPFLWE  274



>ref|XP_009400894.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=244

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 118/197 (60%), Gaps = 27/197 (14%)
 Frame = -1

Query  813  RKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG  634
            RK     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAAL IKG
Sbjct  67   RKRSKDGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKG  126

Query  633  HSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET------TFDDNDEVSHGESIEAEPS  472
             SA+LNFP L  QLPRPAS SPKDIQAAA +AA T      T   + E S  +   AEP 
Sbjct  127  QSAHLNFPELTAQLPRPASASPKDIQAAAMLAAVTFCATGLTPCTSSECSGAD--HAEPP  184

Query  471  RAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVG  292
             +  P+                 S +     DD  FDLPDL LD      +  S+  L  
Sbjct  185  ISRSPA-----------------STTSSSDNDDALFDLPDLCLDLREGFCYSSSSSWLPC  227

Query  291  VDPG--GFRLEEPFLWE  247
             D     FR++EPFLW+
Sbjct  228  ADEDYVEFRVDEPFLWK  244



>ref|XP_009387933.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=228

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 125/193 (65%), Gaps = 17/193 (9%)
 Frame = -1

Query  816  RRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIK  637
            +R  EG  KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAA+ IK
Sbjct  50   KRSKEG--KHPGYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAAMTIK  107

Query  636  GHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELP  457
            G SA LNFP LAD+LPRPAS +P+ IQAAAA+AA TTF    E +   S E+   +AE+P
Sbjct  108  GQSACLNFPELADELPRPASAAPEHIQAAAALAAATTFGGRGETTRA-SEESGRRQAEMP  166

Query  456  ssqsssnltsesmqeSLNSPSGYGGV-DDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPG  280
             S+S              +P+      DD  FDLPDL LD +     + S       D  
Sbjct  167  MSRSP-------------APAALSSDGDDKLFDLPDLPLDVSEGFRSHPSWAPSTVEDCI  213

Query  279  GFRLEEPFLWECY  241
             FR+EEP +WE Y
Sbjct  214  QFRVEEPLVWEYY  226



>gb|AGB05623.1| DREB4A family transcription factor 2 [Euphorbia esula]
Length=211

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 118/190 (62%), Gaps = 25/190 (13%)
 Frame = -1

Query  801  GGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAY  622
             G +HPTYRGVR R WGKWVSEIR+PRKKSRIWLGTYP  EMAARAHDVA   IKG+SA+
Sbjct  40   AGSRHPTYRGVRMRQWGKWVSEIRQPRKKSRIWLGTYPDPEMAARAHDVAEFKIKGNSAH  99

Query  621  LNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqss  442
            LNFP L D+LPRP ++SPKDIQ AAA+AA + F   +  +  E I   P   E       
Sbjct  100  LNFPDLIDKLPRPRTSSPKDIQEAAAVAAASNFKKLESTAEEEEI-VLPQSPE-------  151

Query  441  snltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGV--DP----G  280
                      SL+SPS     DDTF DLPDL LD  +    +   WQ+ GV  DP     
Sbjct  152  -----NQESLSLSSPSR----DDTFIDLPDLLLDITHNFGDFC--WQMAGVHDDPSSETA  200

Query  279  GFRLEEPFLW  250
            GFR EE FLW
Sbjct  201  GFRHEEIFLW  210



>ref|XP_003549925.1| PREDICTED: ethylene-responsive transcription factor ERF035 [Glycine 
max]
Length=232

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 132/193 (68%), Gaps = 19/193 (10%)
 Frame = -1

Query  807  VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHS  628
            +EG  KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+PT +MAARAHDVAAL IKG S
Sbjct  55   IEG--KHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSS  112

Query  627  AYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssq  448
            AYLNFP LA +LPRPAS SPKDIQAAAA A+   F         +S EAE   ++  SS 
Sbjct  113  AYLNFPELAAKLPRPASTSPKDIQAAAAKASALDFGH-------QSHEAESELSQAVSSS  165

Query  447  sssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND--HYVSTWQLVGVD--PG  280
              +  +S S   SL       GVDDTF DLPDLSLD ++  D  HY S W + G +    
Sbjct  166  IQTQSSSSSSNSSLK------GVDDTFLDLPDLSLDLSHGADEFHYSSAWLVAGAEHIEL  219

Query  279  GFRLEEPFLWECY  241
            GFRLEEPFLWE Y
Sbjct  220  GFRLEEPFLWESY  232



>ref|XP_007010564.1| Ethylene response factor 2 [Theobroma cacao]
 gb|EOY19374.1| Ethylene response factor 2 [Theobroma cacao]
Length=278

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 123/184 (67%), Gaps = 8/184 (4%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            +HPTYRGVR R+WGKWVSEIREPRKKSRIWLGT+PTA+MAARAHDVA++ IKG SAYLNF
Sbjct  100  RHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTADMAARAHDVASMVIKGDSAYLNF  159

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P  A +LPRPAS+S +DIQ AA  AA    D ++ +     ++ EPS+ E+P  QS S  
Sbjct  160  PESAHELPRPASSSRRDIQEAANKAAYAMVDQHNAMIE---VKTEPSQDEMPVPQSPSTT  216

Query  432  tsesmqeSLNSPSGYG-GVDDTFFDLPDLSLDGANQNDH-YVSTWQLVGVDPGGFRLEEP  259
            T     +   SPS      D  +FDLPDLSL+  + +   Y S WQ  G+D   F+ EE 
Sbjct  217  TMSCETQ--GSPSSQSVDSDSMWFDLPDLSLEANSSHRFGYTSWWQQAGID-TEFQFEET  273

Query  258  FLWE  247
              W+
Sbjct  274  MGWD  277



>ref|XP_007038336.1| Ethylene response factor 2 [Theobroma cacao]
 gb|EOY22837.1| Ethylene response factor 2 [Theobroma cacao]
Length=287

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            +HPTYRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVA++AIKG+SAYLNF
Sbjct  109  RHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVASMAIKGNSAYLNF  168

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P  A +LPRPAS++ +DIQ AA  AA    D ++ +   +++   PS+ E+P+ QS S+ 
Sbjct  169  PESAHELPRPASSARRDIQEAANKAAYAMVDQHNAMIEVKTV---PSQDEMPAPQSPSST  225

Query  432  tsesmqeSLNSPSGYG-GVDDTFFDLPDLSLDGANQNDH-YVSTWQLVGVDPGGFRLEEP  259
            T     +   SPS      D  +FDLPDLSL+  + +   Y S WQ  G+D   F+ EE 
Sbjct  226  TMSCETQ--GSPSSQSVDSDSMWFDLPDLSLEANSSHRFGYTSWWQQAGIDI-EFKFEET  282

Query  258  FLWE  247
              W+
Sbjct  283  MGWD  286



>gb|AES90882.2| ethylene response factor [Medicago truncatula]
Length=257

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 127/194 (65%), Gaps = 13/194 (7%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            + +PTYRGVR R WGKWVSEIREPRKKSRIWLGT+PT +MAARAHDVAAL IKG SAYLN
Sbjct  69   KNNPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLN  128

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssn  436
            FP LA  LPR AS SPKDIQ AAA AA T ++           EAEPS+A      SSS+
Sbjct  129  FPELAAVLPRAASASPKDIQVAAAKAAATVYNHAITDQIELEAEAEPSQA-----VSSSS  183

Query  435  ltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND---HYVSTWQLVG----VDPGG  277
             +S S   S N  S   G DD F +LPDL+LD  +  D   +Y S+  LV     +D   
Sbjct  184  SSSSSSSSSHNEGSSLKGEDDMFLNLPDLTLDLRHSGDDGFYYSSSAWLVNGAQHID-SS  242

Query  276  FRLEEPFLWECY*V  235
            FRLE+P LW+ Y V
Sbjct  243  FRLEDPILWDSYQV  256



>ref|XP_002303364.1| hypothetical protein POPTR_0003s07700g [Populus trichocarpa]
 gb|ABQ62970.1| TINY-like protein [Populus trichocarpa]
 gb|EEE78343.1| hypothetical protein POPTR_0003s07700g [Populus trichocarpa]
Length=225

 Score =   166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 138/208 (66%), Gaps = 10/208 (5%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            R Q+      +K+ ++     +HP+YRGVR R WGKWVSEIR+P+KKSRIWLGT+ T EM
Sbjct  15   RNQDPNNYESDKQAKRRGNAGRHPSYRGVRMRQWGKWVSEIRQPKKKSRIWLGTFSTPEM  74

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAAL IKGHSA+LNFP LA + PRPAS+SPKDIQAAAA+AA  +   + +   G
Sbjct  75   AARAHDVAALTIKGHSAHLNFPELAHEFPRPASSSPKDIQAAAALAATLSCKTSQK---G  131

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH-  319
               EAE +   LP S  S+  ++E+ + SLNSP      DDTF DLPD+    ++Q D  
Sbjct  132  RETEAE-AELMLPRSLDSTLASNETQEYSLNSPLR-DDDDDTFIDLPDILQGISHQFDEF  189

Query  318  -YVSTWQLVGV---DPGGFRLEEPFLWE  247
             Y+S WQ VG    D G +  EEP LWE
Sbjct  190  CYLSPWQPVGTETSDVGFWHHEEPSLWE  217



>ref|XP_009401144.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Musa 
acuminata subsp. malaccensis]
Length=255

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 117/188 (62%), Gaps = 28/188 (15%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG SA+LNF
Sbjct  88   KHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGQSAHLNF  147

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA +LPRPA+ +PKD+QAAAA+AA  TF      S   +    P +AE P        
Sbjct  148  PELAAELPRPATAAPKDVQAAAALAAAATFCGPCTTSQCSA----PDQAEQPDPT-----  198

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGG------FR  271
                       PSG    DD  FDLPDL L G  +   Y S+       P        FR
Sbjct  199  ---------TPPSGD---DDALFDLPDLFL-GLREGFCYSSSSSSSAWLPSTEEDGVEFR  245

Query  270  LEEPFLWE  247
            +EEPFLWE
Sbjct  246  IEEPFLWE  253



>gb|KDP39899.1| hypothetical protein JCGZ_03430 [Jatropha curcas]
Length=238

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 128/202 (63%), Gaps = 27/202 (13%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            N K+ K E  + +P YRGVR R WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA 
Sbjct  53   NNKKAKAENAKIYPNYRGVRMRQWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAS  112

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVS----HGESIEAE  478
             IKGHSA+LNFP LA +LPRPAS+SPKDIQAAAA+AA   + +++EV+      +  E E
Sbjct  113  TIKGHSAHLNFPELAHKLPRPASSSPKDIQAAAALAAALNYQNDNEVADLIISSQLGEPE  172

Query  477  PSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH--YVSTW  304
            P   ++  +                S       DDTF DLPDL  D ++Q +   Y+S+W
Sbjct  173  PQWPDITEA----------------SHDTQESEDDTFIDLPDLLQDISHQFNEFCYLSSW  216

Query  303  -QLVGV----DPGGFRLEEPFL  253
             Q +GV    D G +  +E F 
Sbjct  217  QQQLGVAENLDTGLWYHQESFF  238



>ref|XP_011048423.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Populus euphratica]
Length=227

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 139/209 (67%), Gaps = 10/209 (5%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            R Q+ +    + K+ K  G   +HP+YRGVR R+WGKWVSEIR+P+KKSRIWLGT+ T E
Sbjct  15   RNQDPENNYESDKQAKSRGNAGRHPSYRGVRMRHWGKWVSEIRQPKKKSRIWLGTFSTPE  74

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAAL IKGHSA+LNFP LA + PRPAS+SPKDIQAAAA+AA  +     +   
Sbjct  75   MAARAHDVAALTIKGHSAHLNFPELAHEFPRPASSSPKDIQAAAALAATLSCKTGQK---  131

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
            G   EAE +   LP S  S+  ++E+ + SL+SP      DDTF DLPD+  D ++Q D 
Sbjct  132  GRETEAE-AELMLPCSLDSTLASNETQEYSLSSPLRDDDDDDTFIDLPDILQDISHQFDE  190

Query  318  --YVSTWQLVGV---DPGGFRLEEPFLWE  247
              Y+S WQ VG    D G +  E+  LWE
Sbjct  191  FCYLSPWQPVGTETSDVGFWHQEDLSLWE  219



>ref|XP_010413552.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Camelina sativa]
Length=267

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 110/216 (51%), Positives = 131/216 (61%), Gaps = 22/216 (10%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPT-YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
             GG +++  V    K+PT YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD
Sbjct  52   AGGKRRKSNVSDDNKNPTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  111

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaama------AETTFDDN------  514
            VA+LAIKG+S YLNFP L+  LPRP S SPKDIQAAA  A       E   DD       
Sbjct  112  VASLAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAATKAAETTTWQEPAIDDEKLPEPE  171

Query  513  -DEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG  337
             DE+SH E +    +        S+S+    S   S  S +     ++T FDLPDL  DG
Sbjct  172  ADELSHSELLSTITTTT--ADQSSTSSSFVFSSDTSETSSTDKESNEETVFDLPDLFTDG  229

Query  336  -ANQNDHYV-----STWQLVGVDPGGFRLEEPFLWE  247
              ++ND +       TWQL G D G    EEPF+W+
Sbjct  230  LMDRNDAFCLCNGTFTWQLYGDDVGLRFEEEPFIWQ  265



>ref|XP_003608685.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
Length=290

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 126/192 (66%), Gaps = 13/192 (7%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            + +PTYRGVR R WGKWVSEIREPRKKSRIWLGT+PT +MAARAHDVAAL IKG SAYLN
Sbjct  69   KNNPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPDMAARAHDVAALTIKGSSAYLN  128

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssn  436
            FP LA  LPR AS SPKDIQ AAA AA T ++           EAEPS+A      SSS+
Sbjct  129  FPELAAVLPRAASASPKDIQVAAAKAAATVYNHAITDQIELEAEAEPSQA-----VSSSS  183

Query  435  ltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND---HYVSTWQLVG----VDPGG  277
             +S S   S N  S   G DD F +LPDL+LD  +  D   +Y S+  LV     +D   
Sbjct  184  SSSSSSSSSHNEGSSLKGEDDMFLNLPDLTLDLRHSGDDGFYYSSSAWLVNGAQHID-SS  242

Query  276  FRLEEPFLWECY  241
            FRLE+P LW+ Y
Sbjct  243  FRLEDPILWDSY  254



>ref|XP_011001450.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Populus euphratica]
Length=253

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 135/205 (66%), Gaps = 11/205 (5%)
 Frame = -1

Query  855  RGQEAKTGG-GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            R Q+ K    GN+K +      +HP+YRGVR R WGKWVSEIR+P+KKSRIWLGT+PT E
Sbjct  47   RNQDPKNSNEGNRKAKSGGNAGRHPSYRGVRMRQWGKWVSEIRQPKKKSRIWLGTFPTPE  106

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAAL IKG SA+LNFP LA + PRPAS+SPKDIQAAAA+AA  +   + +   
Sbjct  107  MAARAHDVAALTIKGSSAHLNFPELAHEFPRPASSSPKDIQAAAALAAALSCKTSQK---  163

Query  498  GESIEAEPSRAELPss--qsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN  325
            G   EAE     LP S   + +  ++E+ + SL+SP    G DDTF DLPD+  D     
Sbjct  164  GRETEAE-DELMLPHSPDSTLAVASNETQEYSLSSPLRDDG-DDTFIDLPDILQDHQFDE  221

Query  324  DHYVSTWQLVGV---DPGGFRLEEP  259
              Y+S+WQLVG    D G +  EEP
Sbjct  222  FCYLSSWQLVGAETSDIGFWHHEEP  246



>ref|XP_010512376.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Camelina sativa]
Length=269

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 132/221 (60%), Gaps = 21/221 (10%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            Q+   GG  +K    +  +   +YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAA
Sbjct  48   QDNDAGGKRRKSNVSDDNKNQTSYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAA  107

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaama------AETTFDDN--  514
            RAHDVA+LAIKG+S YLNFP L+  LPRP S SPKDIQAAA  A       E   DD   
Sbjct  108  RAHDVASLAIKGNSGYLNFPELSGLLPRPVSCSPKDIQAAATKAAETTTWQEPAIDDEKL  167

Query  513  -----DEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDL  349
                 DE+SH   + +  +      S +SS+    S     +S       ++T FDLPDL
Sbjct  168  PEPEADELSHSYELLSTITTTTADQSSTSSSFVFSSDTSETSSTDKESN-EETVFDLPDL  226

Query  348  SLDG-ANQNDHYVS-----TWQLVGVDPGGFRL-EEPFLWE  247
              DG  N+ND +       TWQL G +  GFR  EEPF+W+
Sbjct  227  FTDGLMNRNDAFCLCNDTFTWQLYGEEDVGFRFEEEPFIWQ  267



>ref|XP_010264429.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Nelumbo nucifera]
Length=225

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 131/206 (64%), Gaps = 10/206 (5%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            +E K     ++++K    + KHP+YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMA
Sbjct  18   KEVKNANETRRQQKTSSNDGKHPSYRGVRIRNWGKWVSEIREPRKKSRIWLGTFPTPEMA  77

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE  493
            ARAHDVAALAIKG++A+LNFP LA +LPRPAS S KDIQAAAA AA  TFD        E
Sbjct  78   ARAHDVAALAIKGNAAFLNFPELAHELPRPASLSHKDIQAAAAKAAAATFDKQPASCEVE  137

Query  492  S-IEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY  316
            +  + E S ++ P S S S   +      + S       +D  FDLPDL +D     + +
Sbjct  138  TEDQGERSGSKFPISDSPSLNFTSDDDAGVRSTD-----EDALFDLPDLVIDQTTTPNMF  192

Query  315  VSTWQLV--GVDPGGFRLEEPF-LWE  247
              +  L+    +  G +++EPF LWE
Sbjct  193  DFSSSLMSPAANNFGLQMDEPFLLWE  218



>ref|XP_004147220.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cucumis sativus]
 gb|KGN55849.1| hypothetical protein Csa_3G019400 [Cucumis sativus]
Length=214

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 113/178 (63%), Gaps = 20/178 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+ K+   +KHPTYRGVR R WGKWVSEIREP+KKSRIWLGT+ T+EMAARAHDVAA  I
Sbjct  31   KKVKIGNDDKHPTYRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTSEMAARAHDVAAKTI  90

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAEL  460
            KGHSAYLNFP LA +LPRPAS+SPKDI+AAAA AA      NDE + G   E   +    
Sbjct  91   KGHSAYLNFPELAHRLPRPASSSPKDIRAAAAKAALF----NDEQNPGAKSEMNLNCC--  144

Query  459  PssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVD  286
                            ++   SG G +DDTFFDLPDL +D  N         Q V +D
Sbjct  145  -------------GSSAVAVKSG-GEIDDTFFDLPDLFIDDPNHQIDTFCFSQFVPID  188



>ref|XP_004301176.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Fragaria vesca subsp. vesca]
Length=187

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 120/197 (61%), Gaps = 15/197 (8%)
 Frame = -1

Query  837  TGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
            T  G +K  + EG E+ PTYRGVR+R WGKWVSEIREPRKKSRIWLGT+ TAEMAARAHD
Sbjct  6    TQNGERKSSE-EGSEQKPTYRGVRRREWGKWVSEIREPRKKSRIWLGTFATAEMAARAHD  64

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE  478
            VAAL IKG SA+LNFP LA +LPR AS+SPKDIQAAAA AA  ++          S  + 
Sbjct  65   VAALTIKGRSAHLNFPELAQELPRAASSSPKDIQAAAAKAAALSYPSCSSTVSSSSSSSS  124

Query  477  PSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQL  298
               A+             +     +SPS     DDTFFDLPDL LD  +        + +
Sbjct  125  SHEAQ----------EHYAEPAQDSSPSETIN-DDTFFDLPDLLLDVGHYRSDDAYCFSI  173

Query  297  VGVDPGGFRLEEPFLWE  247
            V        LEEPFLW+
Sbjct  174  VDT---SISLEEPFLWD  187



>ref|XP_003611338.1| Ethylene-responsive transcription factor TINY [Medicago truncatula]
 gb|AES94296.1| ethylene response factor [Medicago truncatula]
Length=181

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 123/198 (62%), Gaps = 36/198 (18%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            NK +   + G KHP YRGVR R+WGKWVSEIREP+KKSRIWLGTYPT EMAARAHDVAA 
Sbjct  14   NKTKNNGDNG-KHPLYRGVRMRSWGKWVSEIREPKKKSRIWLGTYPTPEMAARAHDVAAQ  72

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRA  466
            AIKG SAYLNFP LA QLPRP +NSPKDIQAAAA             + G   EA+    
Sbjct  73   AIKGSSAYLNFPELAQQLPRPTTNSPKDIQAAAAK----------AATMGSLHEAQDQDH  122

Query  465  ELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG--ANQNDHYVS-TWQLV  295
            ++              QE+LN        DDTF+DLPDL LD   ++   HY S +W + 
Sbjct  123  DI--------------QETLND------EDDTFYDLPDLLLDSNKSSSEFHYSSMSWLVA  162

Query  294  GVD-PG-GFRLEEPFLWE  247
            G + P   F L+EPF WE
Sbjct  163  GAEYPNPSFGLDEPFPWE  180



>ref|XP_011031921.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Populus 
euphratica]
Length=226

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 139/209 (67%), Gaps = 11/209 (5%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            R Q+ +    + K+ K  G   +HP+YRGVR R+WGKWVSEIR+P+KKSRIWLGT+ T E
Sbjct  15   RNQDPENNYESDKQAKSRGNAGRHPSYRGVRMRHWGKWVSEIRQPKKKSRIWLGTFSTPE  74

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSH  499
            MAARAHDVAAL IKGHSA+LNFP LA + PRPAS+SPKDIQAAAA+AA  +     +   
Sbjct  75   MAARAHDVAALTIKGHSAHLNFPELAHEFPRPASSSPKDIQAAAALAATLSCKTGQK---  131

Query  498  GESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH  319
            G   EAE +   LP S  S+  ++E+ + SL+SP      DDTF DLPD+  D ++Q D 
Sbjct  132  GRETEAE-AELMLPCSLDSTLASNETQEYSLSSPLR-DDDDDTFIDLPDILQDISHQFDE  189

Query  318  --YVSTWQLVGV---DPGGFRLEEPFLWE  247
              Y+S WQ VG    D G +  E+  LWE
Sbjct  190  FCYLSPWQPVGTETSDVGFWHQEDLSLWE  218



>ref|XP_006402577.1| hypothetical protein EUTSA_v10006200mg [Eutrema salsugineum]
 gb|ESQ44030.1| hypothetical protein EUTSA_v10006200mg [Eutrema salsugineum]
Length=248

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 132/210 (63%), Gaps = 29/210 (14%)
 Frame = -1

Query  819  KRRKVEGGEKHPT-YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KRRK    +   T YRGVRKR+WGKWVSEIREP+KKSRIWLGTYPTAEMAARAHDVAALA
Sbjct  45   KRRKRSNDKCQTTPYRGVRKRSWGKWVSEIREPKKKSRIWLGTYPTAEMAARAHDVAALA  104

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDD-------------NDEVS  502
            I+G+S YLNFP L+  LPRP S+SPKDIQ AAA AAE T+ +              DE+S
Sbjct  105  IRGNSGYLNFPELSGLLPRPVSSSPKDIQIAAAKAAEATWREPVHDHEKAKRLMGTDELS  164

Query  501  HGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDG-ANQN  325
            H E   A+ S +      S ++ TS +  +  N        ++T FDLPDL  DG  NQN
Sbjct  165  HSELSTAQSSASSSVVFSSDTSETSSTHDKESN--------EETVFDLPDLFTDGLMNQN  216

Query  324  DHY-----VSTWQLVGVDPGGFRLEEPFLW  250
            D +      STW L   D   FRLEEPF W
Sbjct  217  DAFRYYDDTSTWHLYENDV-WFRLEEPFTW  245



>ref|XP_004162335.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cucumis sativus]
Length=214

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 112/178 (63%), Gaps = 20/178 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+ K+   +KHPTYRGVR R WGKWVSEIREP+KKSRIWLGT+ T EMAARAHDVAA  I
Sbjct  31   KKVKIGNDDKHPTYRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTPEMAARAHDVAAKTI  90

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAEL  460
            KGHSAYLNFP LA +LPRPAS+SPKDI+AAAA AA      NDE + G   E   +    
Sbjct  91   KGHSAYLNFPELAHRLPRPASSSPKDIRAAAAKAALF----NDEQNPGAKSEMNLNCC--  144

Query  459  PssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVD  286
                            ++   SG G +DDTFFDLPDL +D  N         Q V +D
Sbjct  145  -------------GSSAVAVKSG-GEIDDTFFDLPDLFIDDPNHQIDTFCFSQFVPID  188



>ref|XP_009400694.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Musa acuminata subsp. malaccensis]
Length=246

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 108/185 (58%), Gaps = 35/185 (19%)
 Frame = -1

Query  789  HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFP  610
            HP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAAL IKG SA+LNFP
Sbjct  93   HPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALTIKGQSAHLNFP  152

Query  609  HLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnlt  430
             LA  LPRPA+ +PKDIQAAAA+AA         VSH                       
Sbjct  153  ELAAVLPRPATAAPKDIQAAAALAAACPGQAEQPVSHS----------------------  190

Query  429  sesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGV----DPGGFRLEE  262
                   L +PS  G  +D  FDLPDL LD  +   H              D   FR+EE
Sbjct  191  -------LTTPSSDG--EDALFDLPDLFLDLRDAFCHSSPPPSSWLPSTEEDGIVFRVEE  241

Query  261  PFLWE  247
            PFLWE
Sbjct  242  PFLWE  246



>ref|XP_011016474.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Populus euphratica]
Length=245

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 120/181 (66%), Gaps = 11/181 (6%)
 Frame = -1

Query  855  RGQEAKTGG--GNKKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            + QE ++ G  G K+R+  E  +  KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYP
Sbjct  59   KAQELQSSGNEGGKRRKTAENEKNGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYP  118

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE  508
            TAEMAARAHDVAALAIKG SAYLNFP  A +LP P S SPKDIQAAAA AA  +F++   
Sbjct  119  TAEMAARAHDVAALAIKGGSAYLNFPEFAHELPPPLSKSPKDIQAAAAKAAAASFNETRY  178

Query  507  VSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQ  328
                   EAE + + L  S +  N    S   S  S       DDT FDLPDL +DG + 
Sbjct  179  CEGEGGGEAELNVSNLSDSLAMDNTQESSSTPSTES-------DDTLFDLPDLFIDGVHH  231

Query  327  N  325
            +
Sbjct  232  S  232



>ref|XP_008448820.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Cucumis 
melo]
Length=214

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 119/189 (63%), Gaps = 22/189 (12%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            + K     K  +KV+ G   KHPTYRGVR R WGKWVSEIREP+KKSRIWLGT+ T EMA
Sbjct  20   DIKNCIKEKTSKKVKLGSDGKHPTYRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTPEMA  79

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGE  493
            ARAHDVAA  IKGHSAYLNFP LA +LPRPAS+SPKDI+AAAA AA      NDE + G 
Sbjct  80   ARAHDVAAKTIKGHSAYLNFPELAHRLPRPASSSPKDIRAAAAKAALF----NDEQNPG-  134

Query  492  SIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYV  313
                  +++EL          +     ++   SG G +DDTFFDLPDL +D  N      
Sbjct  135  ------AKSEL--------NLNCCGSSAVAVKSG-GEIDDTFFDLPDLFIDDPNHQIDTF  179

Query  312  STWQLVGVD  286
               Q V +D
Sbjct  180  CFSQFVPID  188



>ref|XP_008796155.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Phoenix dactylifera]
Length=237

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 130/204 (64%), Gaps = 27/204 (13%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            RG EA +GG  KKR K +G  KHPTYRGVR RNWGKWVSEIREPRKKSRIWLGT+ TAEM
Sbjct  59   RGAEAGSGGEAKKRSK-DG--KHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFATAEM  115

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAALAIKG SA+LNFP LA +LPRPA+ SPKDIQAAAA+AA   F D       
Sbjct  116  AARAHDVAALAIKGQSAHLNFPELAGRLPRPATASPKDIQAAAALAAAAAFADCGPCRDA  175

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY  316
                A P+ +  P+                 +PS          DLPDL LD  ++  +Y
Sbjct  176  ----AVPAASRSPA-----------------TPSSDHDDALF--DLPDLLLDLRDEFCYY  212

Query  315  VSTWQLVG-VDPGGFRLEEPFLWE  247
             STW      D  GFRLEEPFLWE
Sbjct  213  SSTWLPPAEEDANGFRLEEPFLWE  236



>ref|XP_008437812.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
isoform X1 [Cucumis melo]
 ref|XP_008437813.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
isoform X2 [Cucumis melo]
Length=231

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 125/198 (63%), Gaps = 9/198 (5%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
             K+R  ++    HP +RGVRKRNWGKWVSEIREPRKK+RIWLGTYPT EMAARAHD AAL
Sbjct  38   TKQRTTIQRNRDHPMFRGVRKRNWGKWVSEIREPRKKTRIWLGTYPTPEMAARAHDAAAL  97

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRA  466
            AIKGHSA+LNFP LA  LPRP S S KDIQAAAA AA  TF        G     E SR 
Sbjct  98   AIKGHSAFLNFPELAQFLPRPLSRSHKDIQAAAAQAAAATFSSGINAESGGEEAVEESRE  157

Query  465  ELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYV---STWQLV  295
             L       +   E  ++S NSPS   G D+T FDLPDL +  ++  D +V   S WQ  
Sbjct  158  PL----FPGSDGGERTEDSTNSPSTIAG-DETLFDLPDLVIGSSDSKDGFVYHSSLWQFC  212

Query  294  -GVDPGGFRLEEPFLWEC  244
               D  GFRLEEP  WE 
Sbjct  213  AAADHNGFRLEEPSFWEL  230



>ref|XP_003635248.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Vitis vinifera]
Length=225

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 131/212 (62%), Gaps = 20/212 (9%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGE-----KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPT  685
            QEAK+   +  R+KV+G       KHPTYRGVR+RNWGKWVSEIREPRKKSRIWLG++ T
Sbjct  22   QEAKSE--DDHRKKVKGCSNDDRFKHPTYRGVRRRNWGKWVSEIREPRKKSRIWLGSFAT  79

Query  684  AEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEV  505
             EMAARAHDVAALAIKGHSA+LNFP LA Q PRP + SP+DI+AAAA AA  T     E 
Sbjct  80   PEMAARAHDVAALAIKGHSAHLNFPELAHQFPRPETKSPEDIRAAAAKAAMFTHPRRRE-  138

Query  504  SHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLS---LDGA  334
               E+ +AE      PSS S+++           SP+     D TFFDLPDL    +   
Sbjct  139  ---EADQAEVVGCHSPSSTSNTSCDDTKEPPP--SPTVTTADDGTFFDLPDLFPNLITDH  193

Query  333  NQNDHYVST--WQLVGVDP--GGFRLEEPFLW  250
               D +  +  W L  V+     F LEEP LW
Sbjct  194  QMTDIFCQSIMWPLPEVESVDMDFYLEEPLLW  225



>ref|XP_009391523.1| PREDICTED: ethylene-responsive transcription factor ERF038 [Musa 
acuminata subsp. malaccensis]
Length=252

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 126/201 (63%), Gaps = 21/201 (10%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            ++A+  GG +  +    G++H +YRGVR R+WG+WVSEIREP+KKSRIWLGT+PTAEMAA
Sbjct  69   RKARKAGGEETEKPGNDGKQHASYRGVRMRSWGRWVSEIREPKKKSRIWLGTFPTAEMAA  128

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES  490
            RAHDVAALAIKG SAYLNFP LA +LPRPA+  PKDIQAAA++AA T FDD+       +
Sbjct  129  RAHDVAALAIKGQSAYLNFPELASRLPRPATAKPKDIQAAASLAAATAFDDH-------T  181

Query  489  IEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVS  310
                P++ ELP S S +             PS   G      DL     +G      Y S
Sbjct  182  PSPCPTQTELPLSHSPAPT---------TPPSDDHGALFDLPDLLLDLREGFC----YSS  228

Query  309  TWQLVGVDPG-GFRLEEPFLW  250
            +W     D G  FR+EEPFLW
Sbjct  229  SWAPSTADDGVEFRVEEPFLW  249



>ref|XP_010919644.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF038 [Elaeis guineensis]
Length=267

 Score =   159 bits (402),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            R  EA +GG  KKR K +G  KHPTYRGVR RNWGKWVSEIREP+KKSRIWLGT+PTAEM
Sbjct  79   REAEASSGGEAKKRSK-DG--KHPTYRGVRMRNWGKWVSEIREPKKKSRIWLGTFPTAEM  135

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAAL IKG SAYLNFP LA +LPRPA+ +PKDIQAAAA+AA  TF D    S G
Sbjct  136  AARAHDVAALTIKGESAYLNFPELARKLPRPATTAPKDIQAAAALAAAATFGDLSPGSSG  195



>gb|AAX23704.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
 gb|AAX23705.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
 gb|AAX23706.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
 gb|AAX28954.1| HvCBF7 [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 122/211 (58%), Gaps = 34/211 (16%)
 Frame = -1

Query  843  AKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  664
            A T    KKR + +G  +HPTYRGVR R+WGKWVSEIREPRKKSRIWLGT+ TAEMAARA
Sbjct  30   ATTASSKKKRARNDG--RHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFATAEMAARA  87

Query  663  HDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIE  484
            HDVAALAIKG +A+LNFP LA +LPRPA+ +PKD+QAAAA+AA   F  +   +     +
Sbjct  88   HDVAALAIKGRAAHLNFPDLAHELPRPATAAPKDVQAAAALAASADFPASATATANAGAK  147

Query  483  ----AEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLD----GANQ  328
                 EP+ A                    ++ +     +D  FDLPDL  D      + 
Sbjct  148  NPDGPEPNAA--------------------SASTPPDTAEDALFDLPDLLFDLRHGPPSC  187

Query  327  NDHYVSTW----QLVGVDPGGFRLEEPFLWE  247
                 STW       G   G FRLEEP  WE
Sbjct  188  QVSCASTWDDDVAFAGPGAGVFRLEEPLQWE  218



>ref|XP_006421614.1| hypothetical protein CICLE_v10006536mg [Citrus clementina]
 gb|ESR34854.1| hypothetical protein CICLE_v10006536mg [Citrus clementina]
Length=230

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 117/185 (63%), Gaps = 15/185 (8%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            K+PTYRGVR R+WGKWVSEIR+PRKKSRIWLG++PTAEMAARAHDVAALAIKGHSA+LNF
Sbjct  57   KYPTYRGVRMRSWGKWVSEIRQPRKKSRIWLGSFPTAEMAARAHDVAALAIKGHSAHLNF  116

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LAD+LPRPAS +PKDIQAAAA AA     D+            P R E  +   S+  
Sbjct  117  PELADELPRPASAAPKDIQAAAAKAAAAAIFDS------------PRRIEANNDTQSTCH  164

Query  432  tsesmqeSLNSPSGYGGVDDTFFD-LPDLSLDGANQNDHYV--STWQLVGVDPGGFRLEE  262
                     +  S     D  +FD LPDLSL+G +  + +   S WQ       GF+ EE
Sbjct  165  DENKNSADHHDHSSSDDRDSAWFDHLPDLSLEGDDGKNRFCDSSWWQQAEFGHMGFQFEE  224

Query  261  PFLWE  247
               W+
Sbjct  225  ILCWD  229



>emb|CBI16632.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEG-GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
            Q  K G  ++KR+K E  G++HPTYRGVR RNWGKWVSEIREP+KKSRIWLGTYPTAEMA
Sbjct  531  QGMKNGNESRKRQKTENDGKQHPTYRGVRMRNWGKWVSEIREPKKKSRIWLGTYPTAEMA  590

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE  508
            ARAHDVAALAIKG S +LNFP LA  LPRPAS SPKDIQAAAA AA TTF   DE
Sbjct  591  ARAHDVAALAIKGSSPHLNFPELAHALPRPASTSPKDIQAAAAEAANTTFSQPDE  645



>ref|XP_010677077.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Beta 
vulgaris subsp. vulgaris]
Length=241

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 117/172 (68%), Gaps = 9/172 (5%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E     G KK+ K +   KHPTYRGVR RNWGKWVSEIREPRKKSRIWLGT+ TA+MAAR
Sbjct  43   EKTCNEGRKKKCKDDFEGKHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFATADMAAR  102

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESI  487
            AHDVAALAIKGH+AYLNFP LA QLP+PAS +PKDIQAAA  AA         +     +
Sbjct  103  AHDVAALAIKGHNAYLNFPDLAHQLPKPASTTPKDIQAAAIKAA---------MDFPGLL  153

Query  486  EAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGAN  331
            +++PS +    S +++  +S S  ++ +S S     D  FF+LPDL LD  N
Sbjct  154  QSQPSHSHQADSPATTATSSSSNYDTSSSASSSNFDDTIFFNLPDLFLDLEN  205



>gb|EPS64897.1| hypothetical protein M569_09882 [Genlisea aurea]
Length=225

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = -1

Query  843  AKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  664
            A   G N+K+R  + G KHP YRGVR R+WGKWVSEIR+PRKKSRIWLGTYPTAEMAARA
Sbjct  9    AGAAGENRKKRAKDCGTKHPVYRGVRMRSWGKWVSEIRQPRKKSRIWLGTYPTAEMAARA  68

Query  663  HDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            HDVAAL+IKG+SA LNFP L+D LPRP S SP+DIQ
Sbjct  69   HDVAALSIKGNSAVLNFPQLSDSLPRPLSLSPRDIQ  104



>ref|XP_010505090.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Camelina sativa]
Length=196

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 117/199 (59%), Gaps = 34/199 (17%)
 Frame = -1

Query  822  KKRRKVEGGEK-----HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
            KK+R V+  EK     HPT+RGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAHD
Sbjct  27   KKKRSVKDDEKVVVSKHPTFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAHD  86

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE  478
            VAALAIKG SA+LNFP LA QLPRPAS  PKDIQAAAA AA     D +  +   S    
Sbjct  87   VAALAIKGGSAHLNFPELAYQLPRPASADPKDIQAAAAAAAAAVAIDMEVETSSPS--PS  144

Query  477  PSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQL  298
            P+  E                   +SP      DD F DLPDL LD   + D +   W+ 
Sbjct  145  PTVTE------------------TSSPGMTAISDDAFSDLPDLLLDVNRKIDGF---WES  183

Query  297  VGVDPGGFRLEEPFLWECY  241
               D      EEPFL + Y
Sbjct  184  FPDD------EEPFLSQSY  196



>ref|XP_009133039.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Brassica rapa]
 emb|CDX84602.1| BnaA03g16280D [Brassica napus]
Length=203

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 109/184 (59%), Gaps = 32/184 (17%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KH ++RGVR R WGKWVSEIREP+KKSRIWLGT+PTAEMAARAHDVAALAIKG SA+LNF
Sbjct  52   KHQSFRGVRMRQWGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAALAIKGDSAHLNF  111

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA  LPRPAS  PKDIQAAAA AA +   D D  +   S  A                
Sbjct  112  PELAYHLPRPASAHPKDIQAAAAEAAASVVIDMDIETSSPSTGA----------------  155

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                    L+ P+     DD F DLPDL LD  ++ND +   W+        F  EEPF 
Sbjct  156  ------TELSPPAVASTADDAFSDLPDLFLDVNHKNDGF---WE-------SFPYEEPFF  199

Query  252  WECY  241
               Y
Sbjct  200  SGSY  203



>gb|AGE97371.1| ethylene response factor 16 [Tamarix hispida]
Length=253

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 137/215 (64%), Gaps = 26/215 (12%)
 Frame = -1

Query  849  QEAKTGGGN-------KKRRKVEGGE--KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLG  697
            QE KT   N       +K  K  G    + PTYRGVRKR+WGKWVSEIREP+KKSRIWL 
Sbjct  51   QEEKTINPNNNDDATSRKNIKATGSAEGRRPTYRGVRKRSWGKWVSEIREPKKKSRIWLP  110

Query  696  TYP-TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNS--PKDIQaaaamaAETT  526
            T+P TAEMAARAHDVAALAIKGHSAYLNFP L  QLPRPAS+S  PKDIQAAAA AA   
Sbjct  111  TFPPTAEMAARAHDVAALAIKGHSAYLNFPELEAQLPRPASSSPQPKDIQAAAAKAAALE  170

Query  525  FDDNDEVSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLS  346
                 E +H    EA+P     P++ ++S+      + S +S S     DDTF+DLPD  
Sbjct  171  --AKPEPNH---FEADPLS---PAAPTTSSSCDTQQESSASSSSDVSDYDDTFYDLPDFI  222

Query  345  LDGANQNDHYVSTWQLVGVDP--GGFRLEEPFLWE  247
            +D     ++ ++ WQLVGV+P   G +L  P  WE
Sbjct  223  ID----IEYDITRWQLVGVEPVDAGDQLIGPCFWE  253



>ref|XP_010516772.1| PREDICTED: ethylene-responsive transcription factor ERF038 [Camelina 
sativa]
Length=196

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 119/207 (57%), Gaps = 34/207 (16%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEK-----HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTA  682
            E +     KK+R V+  EK     HPT+RGVR R WGKWVSEIREP+KKSRIWLGT+ TA
Sbjct  19   ERRVKNYPKKKRSVKDDEKVVVSKHPTFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTA  78

Query  681  EMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVS  502
            EMAARAHDVAALAIKG SA+LNFP LA  LPRPAS  PKDIQAAAA AA     D +  +
Sbjct  79   EMAARAHDVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQAAAAAAAAAVAIDMEVET  138

Query  501  HGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND  322
               S    P+  E                   +SP      DD F DLPDL LD  ++ D
Sbjct  139  SSPS--PSPTVTE------------------TSSPGTTAISDDAFSDLPDLLLDVNHKID  178

Query  321  HYVSTWQLVGVDPGGFRLEEPFLWECY  241
             +   W+    D      EEPFL + Y
Sbjct  179  GF---WESFPDD------EEPFLSQSY  196



>ref|XP_009389773.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=213

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 125/202 (62%), Gaps = 28/202 (14%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            +EA+  GG +K+ +  GG KH +YRGVR R WGKWVSEIREP+K SRIWLGT+PTAEMAA
Sbjct  39   REAEAIGGKEKKEQGSGG-KHSSYRGVRMRAWGKWVSEIREPKKNSRIWLGTFPTAEMAA  97

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES  490
            RAHDVAALAIKG SAYLNFP LA QLPRPAS++PKDIQAAAA+AA T   D+   S  E+
Sbjct  98   RAHDVAALAIKGRSAYLNFPELASQLPRPASSTPKDIQAAAALAAATAAGDHS--SKTET  155

Query  489  IEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVS  310
            + +  S A  P                  +PS     DD         L    ++  Y +
Sbjct  156  LSSH-SPAATP------------------TPS-----DDGALFDLPDLLLDLREDFCYFA  191

Query  309  TWQL-VGVDPGGFRLEEPFLWE  247
            +W+  +  D    + EEPFLWE
Sbjct  192  SWEASIAEDGFELKFEEPFLWE  213



>ref|XP_006490227.1| PREDICTED: ethylene-responsive transcription factor ERF035-like 
[Citrus sinensis]
Length=245

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 115/194 (59%), Gaps = 18/194 (9%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            K+PTYRGVR R+WGKWVSEIR+PRKKSRIWLG++PTAEMAARAHDVAALAIKGH A+LNF
Sbjct  57   KYPTYRGVRMRSWGKWVSEIRQPRKKSRIWLGSFPTAEMAARAHDVAALAIKGHLAHLNF  116

Query  612  PHLADQLPRPASNSPKDIQ-aaaamaAETTFD---------DNDEVSHGESIEAEPSRAE  463
            P LAD+LPRPAS +PKDIQ AAA  AA   FD         D     H E+  +      
Sbjct  117  PELADELPRPASAAPKDIQAAAAKAAAAAIFDSPSRIEANNDTQSTCHDENKNSADHHDH  176

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYV--STWQLVGV  289
              S  S S         SL   S +      F  LPDLSL+G    + +   S WQ    
Sbjct  177  SSSDDSDSAWFDHLPDLSLEGDSAW------FDHLPDLSLEGDGDKNRFCDSSWWQQAEF  230

Query  288  DPGGFRLEEPFLWE  247
               GF+ EE   W+
Sbjct  231  GHMGFQFEETLCWD  244



>emb|CDX79619.1| BnaC03g19550D [Brassica napus]
Length=203

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 108/184 (59%), Gaps = 32/184 (17%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KH ++RGVR R WGKWVSEIREP+KKSRIWLGT+PTAEMAARAHDVAALAIKG SA+LNF
Sbjct  52   KHQSFRGVRMRQWGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAALAIKGDSAHLNF  111

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA  LPRPAS  PKDIQAAAA AA +   D    +   S  A                
Sbjct  112  PELAYHLPRPASADPKDIQAAAAEAAASVVIDMGIETSSPSTGA----------------  155

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                    L+ P+     DD F DLPDL LD  ++ND +   W+        F  EEPF 
Sbjct  156  ------TELSPPAVASTADDAFSDLPDLLLDVNHKNDGF---WE-------SFPYEEPFF  199

Query  252  WECY  241
               Y
Sbjct  200  SGSY  203



>ref|XP_002516502.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF45843.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=270

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            NKK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL
Sbjct  38   NKKIKRIRDTNKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAL  97

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFD  520
            +IKG+SA LNFP LAD LPRPAS +P+D+Q AAA AA+  TFD
Sbjct  98   SIKGNSAILNFPELADSLPRPASLAPRDVQIAAAKAAQMDTFD  140



>gb|KDO61381.1| hypothetical protein CISIN_1g023148mg [Citrus sinensis]
Length=286

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -1

Query  849  QEAKTGGGN----KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTA  682
            ++ KT   N     K RKV    KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ T 
Sbjct  49   EKTKTASDNDHHESKTRKV-SDLKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFATP  107

Query  681  EMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            EMAARAHDVAALAIKGHSAYLNFP LA +LPRPA++SPKDIQ
Sbjct  108  EMAARAHDVAALAIKGHSAYLNFPELAHELPRPATSSPKDIQ  149



>gb|KDO61382.1| hypothetical protein CISIN_1g023148mg [Citrus sinensis]
Length=285

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -1

Query  849  QEAKTGGGN----KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTA  682
            ++ KT   N     K RKV    KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ T 
Sbjct  49   EKTKTASDNDHHESKTRKV-SDLKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFATP  107

Query  681  EMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            EMAARAHDVAALAIKGHSAYLNFP LA +LPRPA++SPKDIQ
Sbjct  108  EMAARAHDVAALAIKGHSAYLNFPELAHELPRPATSSPKDIQ  149



>ref|XP_006477148.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Citrus sinensis]
Length=287

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -1

Query  849  QEAKTGGGN----KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTA  682
            ++ KT   N     K RKV    KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ T 
Sbjct  49   EKTKTASDNDHHESKTRKV-SDLKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFATP  107

Query  681  EMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            EMAARAHDVAALAIKGHSAYLNFP LA +LPRPA++SPKDIQ
Sbjct  108  EMAARAHDVAALAIKGHSAYLNFPELAHELPRPATSSPKDIQ  149



>ref|XP_008238439.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Prunus 
mume]
Length=253

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 122/201 (61%), Gaps = 25/201 (12%)
 Frame = -1

Query  825  NKKRRKV--EGGEKH--PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
            ++K+ K+    G +H  P YRGVR R WGKWVSEIREPRKKSRIWLGT+PT EMAARAHD
Sbjct  66   SQKKAKINDSNGRQHHDPVYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHD  125

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE  478
            VAAL IKG SA LNFP LA +LPRPAS S KDIQAAAA AA   +  +   S   S EA+
Sbjct  126  VAALTIKGRSAVLNFPELAQELPRPASASAKDIQAAAAKAAALNYPISCSSSSSSSREAD  185

Query  477  PSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH---YVST  307
               AE  +  S         Q+S  SPS     DDTFFDLPDL LD  +  DH   +   
Sbjct  186  ---AETEAELSQHRQAVHDTQDSSTSPSTNN--DDTFFDLPDLLLDFGHHRDHGFCFSVP  240

Query  306  WQLVGVDPGGFRLEEP--FLW  250
            W           LEEP  FLW
Sbjct  241  W-----------LEEPNNFLW  250



>gb|KDO61383.1| hypothetical protein CISIN_1g023148mg [Citrus sinensis]
Length=248

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -1

Query  849  QEAKTGGGN----KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTA  682
            ++ KT   N     K RKV    KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ T 
Sbjct  49   EKTKTASDNDHHESKTRKV-SDLKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFATP  107

Query  681  EMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            EMAARAHDVAALAIKGHSAYLNFP LA +LPRPA++SPKDIQ
Sbjct  108  EMAARAHDVAALAIKGHSAYLNFPELAHELPRPATSSPKDIQ  149



>ref|XP_004512200.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cicer arietinum]
Length=225

 Score =   151 bits (381),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 110/193 (57%), Gaps = 29/193 (15%)
 Frame = -1

Query  798  GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYL  619
            G  HP YRGVR R WGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAA AIKG SAYL
Sbjct  55   GNIHPLYRGVRMRQWGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAAQAIKGSSAYL  114

Query  618  NFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsss  439
            NFP LAD LPRPA+ SPKDIQ  AA A   T     E  +    +A  ++          
Sbjct  115  NFPELADHLPRPATTSPKDIQ--AAAAKAATMGYLHETQNYYQAQAHDNKK---------  163

Query  438  nltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY--VST---WQLVGVD--PG  280
                        S S     DDTFFDLPDL +D  N +  +   ST   W + G +    
Sbjct  164  -----------TSNSCLRDEDDTFFDLPDLLVDLNNSSREFNNASTSMPWVVAGAEHPDS  212

Query  279  GFRLEEPFLWECY  241
            GF L E F  E Y
Sbjct  213  GFGLNETFPGEPY  225



>ref|XP_006295043.1| hypothetical protein CARUB_v10024111mg [Capsella rubella]
 gb|EOA27941.1| hypothetical protein CARUB_v10024111mg [Capsella rubella]
Length=194

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 114/184 (62%), Gaps = 32/184 (17%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPT+RGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAHDVAALAIKG SA+LNF
Sbjct  43   KHPTFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNF  102

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA  LPRPAS  PKDIQAAAA AA      ND       +E E S +  P+   +   
Sbjct  103  PELAYHLPRPASADPKDIQAAAAAAAAI----ND-------MEVETSPSPSPTVTDT---  148

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                     +SP+     DD F DLPDL LD  ++ D +   W+    +      EEPFL
Sbjct  149  ---------SSPTMTAISDDAFSDLPDLLLDVNHKIDGF---WESFPDE------EEPFL  190

Query  252  WECY  241
             + Y
Sbjct  191  SQSY  194



>gb|KDO49961.1| hypothetical protein CISIN_1g0410151mg, partial [Citrus sinensis]
Length=198

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            K+PTYRGVR R+WGKWVSEIR+PRKKSRIWLG++PTAEMAARAHDVAALAIKGHSA+LNF
Sbjct  57   KYPTYRGVRMRSWGKWVSEIRQPRKKSRIWLGSFPTAEMAARAHDVAALAIKGHSAHLNF  116

Query  612  PHLADQLPRPASNSPKDIQ  556
            P LAD+LPRPAS +PKDIQ
Sbjct  117  PELADELPRPASAAPKDIQ  135



>ref|XP_008678901.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Zea mays]
 gb|AFW63265.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05753.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=228

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KKRR+   G+ HPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ TAEMAARAHDVAALA
Sbjct  46   KKRRRTTDGQHHPTYRGVRMRAWGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALA  105

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG +A+LNFP LAD+LPRPA+ +PKD+Q
Sbjct  106  IKGRAAHLNFPELADELPRPATAAPKDVQ  134



>ref|XP_009398119.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=237

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 121/200 (61%), Gaps = 20/200 (10%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G+K  +K     K P+YRGVR RNWGKWVSEIREP+KKSRIWLGT+PTAEMAARAHDVAA
Sbjct  54   GDKGAKKRSSDGKQPSYRGVRMRNWGKWVSEIREPKKKSRIWLGTFPTAEMAARAHDVAA  113

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSR  469
            L IKG SA+LNFP LA +LPRPA+ +PKD+QAAAA+AA  T   +     G S E+ PS+
Sbjct  114  LTIKGPSAHLNFPELASKLPRPATAAPKDVQAAAALAAAATLGGHSPGLCG-SPESAPSQ  172

Query  468  AE---LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQL  298
             E   +P S                +P+     DD         L    +   + S+W  
Sbjct  173  NEPSPIPHSP---------------APTSPRSDDDGALFDLPDLLLDLREGFGHSSSWNA  217

Query  297  VGVDPG-GFRLEEPFLWECY  241
               + G  FR+EEPFLWE Y
Sbjct  218  SSAEAGIEFRVEEPFLWEYY  237



>ref|XP_007012129.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
 gb|EOY29748.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao]
Length=261

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E  +   NKK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  48   ETTSSDSNKKIKRMRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  107

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG+SA LNFP LA+ LPRP S +P+D+Q
Sbjct  108  AHDVAALSIKGNSAILNFPELANSLPRPVSLAPRDVQ  144



>ref|XP_009397875.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 120/194 (62%), Gaps = 18/194 (9%)
 Frame = -1

Query  813  RKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG  634
            RK     KHP Y GVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAA+AIKG
Sbjct  72   RKRSKDGKHPVYHGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAAMAIKG  131

Query  633  HSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE-PSRAELP  457
             SA+LNFP LA +LPRPA+ SPKDIQAAAA+AA  TF    +++   S E   P +AE P
Sbjct  132  QSAHLNFPELAAELPRPATASPKDIQAAAALAAAATFCARGDLTPCTSSECSGPGQAEPP  191

Query  456  ssqsssnltsesmqeSLNSPSG-YGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPG  280
            +S               +SP+G          DL      G   +    S+W     D G
Sbjct  192  AS---------------SSPTGDIDDALFDLPDLLLDLRQGFRYSSSSSSSWLPSNDDDG  236

Query  279  -GFRLEEPFLWECY  241
              FR+EEPFLWE Y
Sbjct  237  VEFRIEEPFLWEYY  250



>ref|XP_002879568.1| hypothetical protein ARALYDRAFT_482537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55827.1| hypothetical protein ARALYDRAFT_482537 [Arabidopsis lyrata subsp. 
lyrata]
Length=189

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 115/209 (55%), Gaps = 38/209 (18%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEK----HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            + +E +     KK+R  +  EK    HPT+RGVR R WGKWVSEIREP+KKSRIWLGT+ 
Sbjct  15   QAKERRVKNNPKKKRAKDDDEKVVSKHPTFRGVRMRQWGKWVSEIREPKKKSRIWLGTFS  74

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDE  508
            TAEMAARAHDVAALAIKG SA+LNFP LA  LPRPAS  PKDIQAAAA AA     +   
Sbjct  75   TAEMAARAHDVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQAAAAAAAAAMDVETSS  134

Query  507  VSHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQ  328
             S   ++                           +SP+     DD F DLPDL L   N 
Sbjct  135  PSPSPTV------------------------TETSSPAMTALSDDAFSDLPDLLL---NV  167

Query  327  NDHYVSTWQLVGVDPGGFRLEEPFLWECY  241
            N +    W         F  EEPFL + Y
Sbjct  168  NHNIDGFWD-------SFPYEEPFLSQSY  189



>ref|XP_006440269.1| hypothetical protein CICLE_v10024602mg [Citrus clementina]
 gb|ESR53509.1| hypothetical protein CICLE_v10024602mg [Citrus clementina]
Length=293

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 82/102 (80%), Gaps = 5/102 (5%)
 Frame = -1

Query  849  QEAKTGGGN----KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTA  682
            ++ KT   N     K RKV    KHPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ T 
Sbjct  49   EKTKTASDNDHHESKTRKV-SDLKHPTYRGVRMRQWGKWVSEIREPRKKSRIWLGTFATP  107

Query  681  EMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            EMAARAHDVAALAIKGHSAYLNFP LA +LPRPA++SPKDIQ
Sbjct  108  EMAARAHDVAALAIKGHSAYLNFPELAHELPRPATSSPKDIQ  149



>emb|CDY45018.1| BnaA08g12010D [Brassica napus]
Length=222

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 117/188 (62%), Gaps = 9/188 (5%)
 Frame = -1

Query  831  GGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA  652
            G +KK++    G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RAHDVA
Sbjct  7    GSDKKKK----GNKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVA  62

Query  651  ALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPS  472
            AL+IKG SA LNFP L+D LPRPAS SP+D++AAA  AA   FD        E+ E E S
Sbjct  63   ALSIKGTSAILNFPELSDVLPRPASLSPRDVRAAATKAALMEFDTTAFCHESETSETEAS  122

Query  471  RAELPssqsssnltsesmqeSLNSPSGYGGVDDTF---FDLPDL--SLDGANQNDHYVST  307
                 S  + +  TSE+   S+ S      V D      +LP L  SL+ +N+   + S 
Sbjct  123  DKRSESEGNETAETSETASFSVTSIDEESSVSDNLEKIVELPSLGTSLNESNEFVFFDSL  182

Query  306  WQLVGVDP  283
              LV + P
Sbjct  183  EDLVYMPP  190



>ref|XP_009384462.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Musa acuminata subsp. malaccensis]
Length=257

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 118/198 (60%), Gaps = 22/198 (11%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            GGG  + RK   G KHP YRGVR R WGKWVSEIR+PRKK+RIWLGT+PTAEMAARAHDV
Sbjct  79   GGGVDEARKGSKGGKHPAYRGVRMRAWGKWVSEIRQPRKKTRIWLGTFPTAEMAARAHDV  138

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AAL+IKG SA LNFP LA +LPRPAS +P+DIQAAAA+AA   F D        S E+  
Sbjct  139  AALSIKGQSACLNFPELAAELPRPASAAPEDIQAAAALAASIMFGD-PRPGTCTSAESGL  197

Query  474  SRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQND--HYVSTWQ  301
             + ELP S                SP       D+   L DL     +  +   Y S W+
Sbjct  198  RQTELPVS---------------RSPPPLTPSSDSDDALFDLPDLLLDVGEGFCYSSPWE  242

Query  300  LVGVDPGGFRLEEPFLWE  247
                +   FRLEEP LWE
Sbjct  243  ----NCMEFRLEEPLLWE  256



>ref|XP_010104873.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
 gb|AHJ25983.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXC02109.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
Length=271

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -1

Query  834  GGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            GG    + K + G KHPT+RGVR R WGKWVSEIREPRKKSRIWLGT+PT EMAARAHDV
Sbjct  62   GGSESDKCKAKNGSKHPTFRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDV  121

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AAL IKG SA+LNFP LA +LPRPA++S KDIQ
Sbjct  122  AALTIKGRSAFLNFPELAPELPRPATSSAKDIQ  154



>ref|NP_001239694.1| dehydration-responsive element-binding protein 3-like [Glycine 
max]
 gb|ACJ37436.1| AP2 domain-containing transcription factor 2 [Glycine max]
Length=188

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (85%), Gaps = 3/93 (3%)
 Frame = -1

Query  825  NKKRRKVEGG---EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
             KK +++ GG    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDV
Sbjct  11   TKKIKRIRGGGDSSKHPLYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDV  70

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AAL+IKG +A LNFPHLA+ LPRPAS +P+D+Q
Sbjct  71   AALSIKGPAAILNFPHLANSLPRPASLAPRDVQ  103



>ref|XP_002873522.1| hypothetical protein ARALYDRAFT_487996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49781.1| hypothetical protein ARALYDRAFT_487996 [Arabidopsis lyrata subsp. 
lyrata]
Length=236

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            NKK ++V    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL
Sbjct  37   NKKTKRVIDSGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAL  96

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            +IKG SA LNFP LAD  PRP S SP+DIQ
Sbjct  97   SIKGTSAILNFPELADSFPRPVSLSPRDIQ  126



>ref|XP_006399666.1| hypothetical protein EUTSA_v10015895mg [Eutrema salsugineum]
 gb|ESQ41119.1| hypothetical protein EUTSA_v10015895mg [Eutrema salsugineum]
Length=243

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -1

Query  852  GQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
              E+KT    KK ++     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMA
Sbjct  34   SHESKTEQNEKKTKRARDSGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMA  93

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            ARAHDVAAL+IKG SA LNFP LA+  PRP S SP+DIQ
Sbjct  94   ARAHDVAALSIKGSSAILNFPELAESFPRPVSLSPRDIQ  132



>ref|XP_006837306.1| hypothetical protein AMTR_s00111p00051610 [Amborella trichopoda]
 gb|ERN00160.1| hypothetical protein AMTR_s00111p00051610 [Amborella trichopoda]
Length=362

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K RR    G KHP YRGVR RNWG+WVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL 
Sbjct  70   KSRRTNADGGKHPVYRGVRMRNWGRWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALT  129

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG SA+LNFP LA +LPRPAS SP+DIQ
Sbjct  130  IKGRSAFLNFPELAAELPRPASASPRDIQ  158



>ref|XP_010646855.1| PREDICTED: ethylene-responsive transcription factor ERF038 [Vitis 
vinifera]
Length=228

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = -1

Query  849  QEAKTGGGNKKRRK------VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            +E K G  ++KR K      V+ G + PTYRGVR RNWGKWVSEIREPRKKSRIWLGT+P
Sbjct  36   KEGKNGDKSRKRGKSGTTSSVKDGRR-PTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFP  94

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            TAEMAARAHDVAAL IKGHSAYLNFP LA +LPRPA+ SPKDI+
Sbjct  95   TAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPATASPKDIR  138



>ref|XP_009367456.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Pyrus x bretschneideri]
Length=245

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K  ++V    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  52   KDAKRVRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  111

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFD  520
            IKG+SA LNFP L+D LPRP SN+P+D+QAAA+ AAE   FD
Sbjct  112  IKGNSAILNFPELSDLLPRPVSNAPRDVQAAASKAAEMHQFD  153



>ref|XP_004134290.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Cucumis sativus]
 gb|KGN56366.1| hypothetical protein Csa_3G118010 [Cucumis sativus]
Length=230

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 122/198 (62%), Gaps = 9/198 (5%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
             K+   ++    HP +RGVRKRNWGKWVSEIREPRKK+RIWLGTYPT EMAARAHD AAL
Sbjct  37   TKQTTTIQQNRHHPMFRGVRKRNWGKWVSEIREPRKKTRIWLGTYPTPEMAARAHDAAAL  96

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRA  466
            AIKG SA+LNFP LA  LPRP S S KDIQAAAA AA  TF        G     E SR 
Sbjct  97   AIKGRSAFLNFPELAQFLPRPLSRSHKDIQAAAAQAAAATFSAGINAESGGEEAVEESRE  156

Query  465  ELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYV---STWQLV  295
             L       +   E  ++S NS S   G D+T FDLPDL +  ++  D +V   S WQ  
Sbjct  157  AL----FPGSDGGERTEDSTNSTSTVAG-DETLFDLPDLVMGSSDLKDGFVYHSSLWQFC  211

Query  294  -GVDPGGFRLEEPFLWEC  244
               D  G+RLEEP  WE 
Sbjct  212  AAADHNGYRLEEPSFWEL  229



>ref|XP_003635442.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Vitis 
vinifera]
Length=231

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = -1

Query  849  QEAKTGGGNKKRRK------VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            +E K G  ++KR K      V+ G + PTYRGVR RNWGKWVSEIREPRKKSRIWLGT+P
Sbjct  39   KEGKNGDKSRKRGKSGSTNSVKDGRR-PTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFP  97

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            TAEMAARAHDVAAL IKGHSAYLNFP LA +LPRPA+ SPKDI+
Sbjct  98   TAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPATASPKDIR  141



>gb|KDP34150.1| hypothetical protein JCGZ_07721 [Jatropha curcas]
Length=255

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
             KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL
Sbjct  37   TKKIKRIRDSNKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAL  96

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            +IKG+SA LNFP LA+ LPRPAS +P+D+Q
Sbjct  97   SIKGNSAILNFPELANSLPRPASLAPRDVQ  126



>ref|NP_001065380.1| Os10g0560700 [Oryza sativa Japonica Group]
 gb|AAL79793.1|AC079874_16 putative DNA binding protein [Oryza sativa Japonica Group]
 gb|AAP55010.1| AP2 domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27217.1| Os10g0560700 [Oryza sativa Japonica Group]
Length=289

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 127/209 (61%), Gaps = 11/209 (5%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            K+    KKR++   G KHP YRGVR R WGKWVSEIREPRKKSRIWLGT+PTA+MAARAH
Sbjct  77   KSSAATKKRKRSSDG-KHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPTADMAARAH  135

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAE-TTFDDNDEVSHGESIE  484
            DVAALAIKG +A+LNFP LA  LPR AS SPKD+QAAAA+AA  TT   +   S   + +
Sbjct  136  DVAALAIKGRAAHLNFPDLAGVLPRAASASPKDVQAAAALAAAFTTSPSSSPSSSLSADD  195

Query  483  AEPSRA-----ELPssqsssnltsesmqeSLNSPSGYGGVDD-TFFDLPDLSLDGANQND  322
              P        E P++ + ++    S    + + +     D+   FDLPDL  D  +   
Sbjct  196  VAPCVVHADADEQPAAAAKNDDDDGSTTAPVAAAAAAAAADEQQLFDLPDLLFDIQDGPF  255

Query  321  HYVSTWQ-LVGVDP--GGFRLEEPFLWEC  244
             + + W  L  VD      RLEEP LW+ 
Sbjct  256  GFPAMWAPLADVDEVNAELRLEEPLLWDL  284



>ref|XP_010933634.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription 
factor ERF038-like [Elaeis guineensis]
Length=261

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = -1

Query  855  RGQEAK-TGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            RG EA  T  G  K+R  +G  KHPTYRGVR RNWGKWVSEIREPRKKSRIWLGT+ TAE
Sbjct  69   RGAEAAGTTTGEAKKRSKDG--KHPTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFATAE  126

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            MAARAHDVAAL IKG SA+LNFP LA +LPRPA+ SPKDIQ
Sbjct  127  MAARAHDVAALTIKGQSAHLNFPELACKLPRPATASPKDIQ  167



>emb|CBI23469.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = -1

Query  849  QEAKTGGGNKKRRK------VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            +E K G  ++KR K      V+ G + PTYRGVR RNWGKWVSEIREPRKKSRIWLGT+P
Sbjct  47   KEGKNGDKSRKRGKSGTTSSVKDGRR-PTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFP  105

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            TAEMAARAHDVAAL IKGHSAYLNFP LA +LPRPA+ SPKDI+
Sbjct  106  TAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPATASPKDIR  149



>ref|XP_004252501.1| PREDICTED: dehydration-responsive element-binding protein 3 [Solanum 
lycopersicum]
Length=143

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = -1

Query  795  EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLN  616
            E +P YRGVR R+WGKWVSEIR+PRKKSRIWLGTYPT EMAARAHDVAAL+IKG+SA LN
Sbjct  25   ETYPVYRGVRMRSWGKWVSEIRQPRKKSRIWLGTYPTPEMAARAHDVAALSIKGNSAILN  84

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE  478
            FP L + LPRPAS SP+D+Q AAA   E     +  + H ES+E E
Sbjct  85   FPQLVESLPRPASISPRDVQ-AAAAMDELNSSVSSTLRHSESMETE  129



>gb|ABK28523.1| unknown [Arabidopsis thaliana]
Length=195

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 107/184 (58%), Gaps = 30/184 (16%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHP +RGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAHDVAALAIKG SA+LNF
Sbjct  41   KHPNFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNF  100

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA  LPRPAS  PKDIQAAAA AA     D D  +   S    P+  E          
Sbjct  101  PELAYHLPRPASADPKDIQAAAAAAAAAVAIDMDVETSSPS--PSPTVTE----------  148

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                     +SP+     DD F DLPDL L   N N +    W         F  EEPFL
Sbjct  149  --------TSSPAMIALSDDAFSDLPDLLL---NVNHNIDGFWD-------SFPYEEPFL  190

Query  252  WECY  241
             + Y
Sbjct  191  SQSY  194



>ref|NP_181113.1| ethylene-responsive transcription factor ERF038 [Arabidopsis 
thaliana]
 sp|Q9ZQP3.1|ERF38_ARATH RecName: Full=Ethylene-responsive transcription factor ERF038 
[Arabidopsis thaliana]
 gb|AAD15445.1| putative AP2 domain transcription factor [Arabidopsis thaliana]
 gb|AAT44912.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABE65886.1| AP2 domain-containing transcription factor [Arabidopsis thaliana]
 gb|ABF83644.1| At2g35700 [Arabidopsis thaliana]
 gb|AEC09146.1| ethylene-responsive transcription factor ERF038 [Arabidopsis 
thaliana]
Length=194

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 107/184 (58%), Gaps = 30/184 (16%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHP +RGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAHDVAALAIKG SA+LNF
Sbjct  41   KHPNFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNF  100

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA  LPRPAS  PKDIQAAAA AA     D D  +   S    P+  E          
Sbjct  101  PELAYHLPRPASADPKDIQAAAAAAAAAVAIDMDVETSSPS--PSPTVTE----------  148

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                     +SP+     DD F DLPDL L   N N +    W         F  EEPFL
Sbjct  149  --------TSSPAMIALSDDAFSDLPDLLL---NVNHNIDGFWD-------SFPYEEPFL  190

Query  252  WECY  241
             + Y
Sbjct  191  SQSY  194



>gb|AGE97368.1| ethylene response factor 13 [Tamarix hispida]
Length=303

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 123/199 (62%), Gaps = 22/199 (11%)
 Frame = -1

Query  780  YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPHLA  601
            YRGVR+R+WGKWVSEIREPRK SRIWLGT+ TAEMAARAHDVAALAIKG+SAYLNFP L 
Sbjct  106  YRGVRRRSWGKWVSEIREPRKTSRIWLGTFATAEMAARAHDVAALAIKGNSAYLNFPELK  165

Query  600  DQLPRPASNSPKDIQaaaamaA-------ETTFDDNDEVSHG----ESIEAEPSRAEL--  460
             QLPRPAS+SPKDIQAAAA AA        T   ++ E   G    E I  E +  +L  
Sbjct  166  AQLPRPASSSPKDIQAAAAKAAADLESPPRTDITNDHEGYKGGDGHEPISQEGADHDLDS  225

Query  459  PssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH----YVSTWQLVG  292
            P++ +SS+       ES  S S     DDTF++LPDL LD      H     ++ WQ+VG
Sbjct  226  PATAASSSCDDTQQAESFASSSD-DCCDDTFYNLPDLFLDLGQHVIHEFRYNMARWQVVG  284

Query  291  ----VDPGGFRLEEPFLWE  247
                 D     L  P  WE
Sbjct  285  AETEADDENQLLGGPCFWE  303



>emb|CDY32094.1| BnaC04g44720D [Brassica napus]
Length=193

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 115/208 (55%), Gaps = 48/208 (23%)
 Frame = -1

Query  843  AKTGGGN---KKRRKVEGGEK----HPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPT  685
            A+T   N   KKR K +  EK    HP++RGVR R WGKWVSEIREPRKKSRIWLGT+ T
Sbjct  27   ARTVNSNNPKKKRVKKDNDEKAVSKHPSFRGVRMRQWGKWVSEIREPRKKSRIWLGTFAT  86

Query  684  AEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEV  505
            AE AARAHDVAALAIKG SA+LNFP LA   PRPAS +PKDIQAAAA AA    D     
Sbjct  87   AEKAARAHDVAALAIKGRSAHLNFPELAYHFPRPASANPKDIQAAAAAAAAVAVD-----  141

Query  504  SHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQN  325
                 IE E S                     L SP+     DD F DLPDL LD  ++ 
Sbjct  142  -----IEVEKS---------------------LPSPAMTAITDDAFSDLPDLLLDVNHKL  175

Query  324  DHYVSTWQLVGVDPGGFRLEEPFLWECY  241
            D +   W  +         EEPF    Y
Sbjct  176  DGF---WDCLP-------YEEPFFTGSY  193



>ref|XP_006356143.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Solanum tuberosum]
Length=189

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            + R  VE G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL+
Sbjct  4    RIRESVEKGNKHPIYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALS  63

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IK   + LNFPHL D LPRP S SP+D+Q
Sbjct  64   IKKDPSILNFPHLIDSLPRPISLSPRDVQ  92



>ref|XP_010509574.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Camelina sativa]
Length=199

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 116/200 (58%), Gaps = 34/200 (17%)
 Frame = -1

Query  822  KKRRKVEGGE------KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            KK+R V+  +      KHPT+RGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAH
Sbjct  28   KKKRSVKDDDEKVVVSKHPTFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAH  87

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEA  481
            DVAALAIKG SA+LNFP LA  LPRPAS  PKDIQAAAA AA     D  EV    S   
Sbjct  88   DVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQAAAAAAAAAVAIDM-EVETTSSPSP  146

Query  480  EPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQ  301
             P+  E                   +SP      DD F DLPDL LD   + D +   W+
Sbjct  147  SPTVTE------------------TSSPGMTAISDDAFSDLPDLLLDVNRKIDGF---WE  185

Query  300  LVGVDPGGFRLEEPFLWECY  241
                D      EEPFL + Y
Sbjct  186  SFPDD------EEPFLSQSY  199



>emb|CBI29555.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 85/104 (82%), Gaps = 7/104 (7%)
 Frame = -1

Query  849  QEAKTGGGNKKRRK------VEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYP  688
            +E K G  ++KR K      V+ G + PTYRGVR RNWGKWVSEIREPRKKSRIWLGT+P
Sbjct  64   KEGKNGDKSRKRGKSGSTNSVKDGRR-PTYRGVRMRNWGKWVSEIREPRKKSRIWLGTFP  122

Query  687  TAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            TAEMAARAHDVAAL IKGHSAYLNFP LA +LPRPA+ SPKDI+
Sbjct  123  TAEMAARAHDVAALTIKGHSAYLNFPELAQELPRPATASPKDIR  166



>ref|XP_006445373.1| hypothetical protein CICLE_v10021740mg [Citrus clementina]
 ref|XP_006464460.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Citrus sinensis]
 gb|ESR58613.1| hypothetical protein CICLE_v10021740mg [Citrus clementina]
 gb|KDO85585.1| hypothetical protein CISIN_1g024791mg [Citrus sinensis]
Length=262

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 126/208 (61%), Gaps = 18/208 (9%)
 Frame = -1

Query  822  KKRRKVEGGEKHPT-------YRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  664
            ++++K + G KH T       YRGVR R+WGKWVSEIREPRKKSRIWLGTYP  EMAARA
Sbjct  55   REKKKAQNG-KHRTCSSTGCCYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPIPEMAARA  113

Query  663  HDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDND-------EV  505
            HDVAALAIKG SA+LNFP LA QLP P S SPKDIQAAAA AA     + D        V
Sbjct  114  HDVAALAIKGRSAFLNFPLLAHQLPSPLSKSPKDIQAAAAEAAAAFQAEPDPLQLPHVRV  173

Query  504  SHGESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDD--TFFDLPDLSLDGAN  331
                S     +      S  S+N+ ++ +  S N        DD   FFDLPDL ++G++
Sbjct  174  LSSSSNSNTTTGTTSLLSSDSTNVNTQELTSSPNDSLHLHHRDDDDAFFDLPDLFINGSD  233

Query  330  QNDHYVSTWQLVGVDPGGFRLEEPFLWE  247
                   ++    VD  GFRLEEPFLWE
Sbjct  234  HLGGGFCSYLSTSVD-TGFRLEEPFLWE  260



>gb|EPS69652.1| hypothetical protein M569_05115, partial [Genlisea aurea]
Length=175

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+R  + G KHP YRGVR R+WGKWVSEIR+PRKKSRIWLGTYPTAEMAARAHDVAAL+I
Sbjct  4    KKRSKDCGTKHPIYRGVRMRSWGKWVSEIRQPRKKSRIWLGTYPTAEMAARAHDVAALSI  63

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            KG+SA LNFP L   LPRPAS SP+D+Q
Sbjct  64   KGNSAVLNFPQLTHSLPRPASLSPRDVQ  91



>ref|XP_002454537.1| hypothetical protein SORBIDRAFT_04g032940 [Sorghum bicolor]
 gb|EES07513.1| hypothetical protein SORBIDRAFT_04g032940 [Sorghum bicolor]
Length=234

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 118/205 (58%), Gaps = 26/205 (13%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KKRR+ + G  HPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ TAEMAARAHDVAALA
Sbjct  42   KKRRRTKDGH-HPTYRGVRMRAWGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALA  100

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKG +A+LNFP LA +LPRPA+ +PKD+QAAAA+AA   F      + G   +  P  + 
Sbjct  101  IKGRAAHLNFPELAGELPRPATAAPKDVQAAAALAAAADFPATPANAAGADDDCGPDASA  160

Query  462  LPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDP  283
              +S   S   S     +L++P                  D      H  S+ QL+   P
Sbjct  161  --ASDDVSASASPPPATTLDNPDDALFD----------LPDLLLDLRHGASSCQLLSCAP  208

Query  282  -------------GGFRLEEPFLWE  247
                         G FRLEEP LWE
Sbjct  209  SWYDDVCFSGAAAGAFRLEEPLLWE  233



>ref|XP_010053505.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Eucalyptus 
grandis]
 gb|KCW77814.1| hypothetical protein EUGRSUZ_D02102 [Eucalyptus grandis]
Length=225

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 119/184 (65%), Gaps = 18/184 (10%)
 Frame = -1

Query  786  PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPH  607
            P YRGVR+R WG+WVSEIREPRKKSRIWLGT+ TAEMAARAHDVAAL IKG SA+LNFP 
Sbjct  54   PNYRGVRRRQWGRWVSEIREPRKKSRIWLGTFQTAEMAARAHDVAALTIKGRSAHLNFPE  113

Query  606  LADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnlts  427
            LA+ LPRPAS S KDIQAAAA+AA  +F          + EA PSR   P++ + S  T 
Sbjct  114  LAELLPRPASKSAKDIQAAAALAAAISF---PRGDGAAAGEAGPSRPHSPNATAESFDTQ  170

Query  426  esmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVST--WQLVGVDPGGFRL---EE  262
            ES    L++       DDTF DLPDL +   N+ +    +  WQ    D  G R    ++
Sbjct  171  ESASSPLDNE------DDTFIDLPDLLVGFGNRMEELCMSFAWQ----DEDGTRFSHGDD  220

Query  261  PFLW  250
            PFLW
Sbjct  221  PFLW  224



>ref|XP_002283864.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Vitis vinifera]
Length=241

 Score =   148 bits (373),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -1

Query  855  RGQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            R   +K    +KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EM
Sbjct  32   RPNSSKPEPESKKMKRIRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEM  91

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AARAHDVAAL+IKG+SA LNFP LA  LPRP S +P+D+Q
Sbjct  92   AARAHDVAALSIKGNSAILNFPQLAASLPRPVSLAPRDVQ  131



>ref|XP_010254012.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Nelumbo nucifera]
Length=242

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KK +KV    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  43   KKTKKVRDCSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  102

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG+SA LNFP L   LPRPAS SP+D+Q
Sbjct  103  IKGNSAILNFPELVGSLPRPASLSPRDVQ  131



>ref|XP_010526108.1| PREDICTED: ethylene-responsive transcription factor ERF043 [Tarenaya 
hassleriana]
Length=262

 Score =   148 bits (374),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G K++R +    KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAA
Sbjct  28   GEKRKRVIGSPVKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAA  87

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            ++IKG SA LNFP L+   PRP S SPKDIQ
Sbjct  88   MSIKGSSAILNFPELSGSFPRPVSLSPKDIQ  118



>ref|XP_004241746.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum lycopersicum]
Length=192

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  816  RRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIK  637
            R   E G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL+IK
Sbjct  6    RESDEKGNKHPIYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALSIK  65

Query  636  GHSAYLNFPHLADQLPRPASNSPKDIQ  556
              S+ LNFPHL D LPRP S SP+D+Q
Sbjct  66   KDSSILNFPHLIDSLPRPISLSPRDVQ  92



>gb|AGE97369.1| ethylene response factor 14 [Tamarix hispida]
Length=277

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 126/191 (66%), Gaps = 14/191 (7%)
 Frame = -1

Query  822  KKRRKVEGG--EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            KK+R +     + H TYRGVRKR+WGKWVSEIREP+KKSRIWLG+YPTAEMAARAHDVAA
Sbjct  64   KKQRSMTTAATDHHSTYRGVRKRSWGKWVSEIREPKKKSRIWLGSYPTAEMAARAHDVAA  123

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSR  469
            LAIKG SA+LNFP LADQLPRP S+S  DIQ AAA AAE    D  + S  + +  +P  
Sbjct  124  LAIKGRSAFLNFPQLADQLPRPNSSSATDIQIAAAKAAEAA--DFLDHSADDYLPCDPVC  181

Query  468  A----ELPssqsssnltsesmqeSLNSPSGYGGVDD-TFFDLPDLSLDGANQNDHYVSTW  304
                 ELP   +S   TS + Q+S+NS +     D+ + FDLPDL + G ++ D  +   
Sbjct  182  TDRSNELP---TSCYSTSLNTQDSVNSRNAKIDEDEASLFDLPDLVIQGEDRRD--LGGI  236

Query  303  QLVGVDPGGFR  271
             +  + P  +R
Sbjct  237  AVCSITPSLYR  247



>gb|ADE41137.1| AP2 domain class transcription factor [Malus domestica]
Length=245

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K  ++V    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  52   KNAKRVRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  111

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFD  520
            IKG+SA LNFP  +D LPRP SN+P+D+QAAA+ AAE   FD
Sbjct  112  IKGNSAILNFPEFSDLLPRPVSNAPRDVQAAASKAAEMHQFD  153



>ref|XP_008646010.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Zea mays]
 gb|AFW72635.1| putative AP2/EREBP transcription factor superfamily protein [Zea 
mays]
 gb|AIB05310.1| AP2-EREBP transcription factor, partial [Zea mays]
Length=277

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 122/195 (63%), Gaps = 14/195 (7%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G ++R++   G +HPT+RGVR R WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAA
Sbjct  79   GGRRRKRGSAGTRHPTFRGVRMRVWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAA  138

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSR  469
            LAIKG  A+LNFPHLA  LPRPAS SP DIQAAAA AA    D + EV   ES  A    
Sbjct  139  LAIKGRGAHLNFPHLAHDLPRPASTSPADIQAAAAKAAAAAADADVEVEQCESSHA----  194

Query  468  AELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQ--NDHYVSTWQLV  295
             E PSS ++S+    +   +              FDLPDL +D ++   +  + +    V
Sbjct  195  VETPSSSAASSEEVAAASNAEEM--------SVLFDLPDLLMDLSDGLWSPIWAAAPAAV  246

Query  294  GVDPGGFRLEEPFLW  250
                GG  L EP LW
Sbjct  247  EEYDGGDSLSEPLLW  261



>ref|XP_010249578.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nelumbo nucifera]
Length=237

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
             KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL
Sbjct  42   QKKIKRMRDCSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAL  101

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            +IKG+SA LNFP LA  LPRPAS SP+D+Q
Sbjct  102  SIKGNSAILNFPELAGSLPRPASLSPRDVQ  131



>ref|XP_009138144.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Brassica rapa]
Length=235

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 3/91 (3%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G+ K +K   G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RAHDVAA
Sbjct  7    GSDKEKK---GSKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAA  63

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            L+IKG SA LNFP L+D LPRPAS SP+D++
Sbjct  64   LSIKGSSAILNFPELSDSLPRPASLSPRDVR  94



>ref|XP_006343055.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum tuberosum]
Length=248

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 1/91 (1%)
 Frame = -1

Query  825  NKKRRKVEGGE-KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
             KK++ +   E +H  YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA
Sbjct  52   TKKQKAITNSESRHQIYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  111

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            ++IKG SA LNFPHL D LPRP SNSP+D+Q
Sbjct  112  VSIKGKSAILNFPHLIDSLPRPLSNSPRDVQ  142



>ref|XP_011072408.1| PREDICTED: dehydration-responsive element-binding protein 3 [Sesamum 
indicum]
Length=215

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+R  + G KHP YRGVR R+WGKWVSEIR PRKKSRIWLGTYPTAEMAARAHDVAAL+I
Sbjct  30   KKRARDSGNKHPVYRGVRMRSWGKWVSEIRHPRKKSRIWLGTYPTAEMAARAHDVAALSI  89

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            KG SA LNFP L + LPRPAS SP+D+Q
Sbjct  90   KGDSAILNFPQLTESLPRPASLSPRDVQ  117



>ref|XP_010440105.1| PREDICTED: ethylene-responsive transcription factor ERF039 [Camelina 
sativa]
Length=179

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/95 (74%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            +TG  +K + + +G  KHPT+RGVR R WGKWVSEIREPRKKSRIWLGT+ T EMAARAH
Sbjct  20   RTGKSSKTKNEQKGVSKHPTFRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTPEMAARAH  79

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            DVAALAIKG SA+LNFP LA  LPRPAS  PKDIQ
Sbjct  80   DVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQ  114



>ref|XP_011012511.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Populus euphratica]
Length=237

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  816  RRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIK  637
            R KV    KHP YRGVR+R WGKWVSEIR+PRKKSRIWLGT+PT EMAARAHDVAAL IK
Sbjct  46   RSKVRDSSKHPVYRGVRRRAWGKWVSEIRQPRKKSRIWLGTFPTPEMAARAHDVAALCIK  105

Query  636  GHSAYLNFPHLADQLPRPASNSPKDIQ  556
            G SA LNFP LAD LPRP S  P+DIQ
Sbjct  106  GDSAILNFPELADSLPRPVSVMPRDIQ  132



>ref|XP_009136807.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Brassica rapa]
 emb|CDX90497.1| BnaA03g42840D [Brassica napus]
Length=177

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 108/200 (54%), Gaps = 42/200 (21%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            KT   +K R   +G  KHP +RGVR R WGKWVSEIREP+KKSRIWLGT+ T EMAARAH
Sbjct  20   KTINSSKTRDDQKGVSKHPNFRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTPEMAARAH  79

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEA  481
            DVAALAIKG SA+LNFP LA  LPRPAS+ PKDIQ                 +   ++E 
Sbjct  80   DVAALAIKGGSAHLNFPELACHLPRPASSDPKDIQ---------------AAATAAAVEW  124

Query  480  EPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQ  301
            +P  +                    ++ +     DD F DLPDL LD    NDH V  + 
Sbjct  125  KPPESP------------------SSTATSSSVADDAFSDLPDLLLD---VNDHKVDGFW  163

Query  300  LVGVDPGGFRLEEPFLWECY  241
                    F  EEPF  E Y
Sbjct  164  ------DSFPYEEPFFMENY  177



>dbj|BAJ87193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  798  GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYL  619
            G KHP+YRGVR+R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG SA+L
Sbjct  92   GFKHPSYRGVRRRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRSAHL  151

Query  618  NFPHLADQLPRPASNSPKDIQ  556
            NFP LA +LPRP S SP DIQ
Sbjct  152  NFPDLAHELPRPDSTSPADIQ  172



>emb|CDY13503.1| BnaA03g52210D [Brassica napus]
Length=223

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 3/91 (3%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G+ K +K   G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RAHDVAA
Sbjct  7    GSDKEKK---GSKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVAA  63

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            L+IKG SA LNFP L+D LPRPAS SP+D++
Sbjct  64   LSIKGSSAILNFPELSDSLPRPASLSPRDVR  94



>ref|XP_004291182.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Fragaria vesca subsp. vesca]
Length=254

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            + K     K +R      KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  44   QPKNNNDKKSKRARVDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  103

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG+SA LNFP L D LPRPAS +P+D+Q
Sbjct  104  AHDVAALSIKGNSAILNFPELIDSLPRPASLAPRDVQ  140



>ref|XP_008393869.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Malus domestica]
Length=245

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K  ++V    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  52   KNAKRVRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  111

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFD  520
            IKG+SA LNFP  +D LPRP SN+P+D+QAAA+ AAE   FD
Sbjct  112  IKGNSAILNFPEXSDLLPRPVSNAPRDVQAAASKAAEMHQFD  153



>ref|XP_002303301.1| hypothetical protein POPTR_0003s04920g [Populus trichocarpa]
 gb|EEE78280.1| hypothetical protein POPTR_0003s04920g [Populus trichocarpa]
Length=231

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -1

Query  816  RRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIK  637
            R KV    KHP YRGVR+R WGKWVSEIR+PRKKSRIWLGT+PT EMAARAHDVAAL IK
Sbjct  39   RSKVRDCSKHPVYRGVRRRAWGKWVSEIRQPRKKSRIWLGTFPTPEMAARAHDVAALCIK  98

Query  636  GHSAYLNFPHLADQLPRPASNSPKDIQ  556
            G SA LNFP LAD LPRP S  P+DIQ
Sbjct  99   GDSAILNFPELADSLPRPVSVMPRDIQ  125



>gb|AAX28965.1| TmCBF7 [Triticum monococcum]
Length=275

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  798  GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYL  619
            G KHP+YRGVR+R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG SA+L
Sbjct  94   GFKHPSYRGVRRRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRSAHL  153

Query  618  NFPHLADQLPRPASNSPKDIQ  556
            NFP LA +LPRP S SP DIQ
Sbjct  154  NFPELAHELPRPDSTSPADIQ  174



>ref|XP_006465666.1| PREDICTED: ethylene-responsive transcription factor ERF036-like 
[Citrus sinensis]
 ref|XP_006495405.1| PREDICTED: ethylene-responsive transcription factor ERF036-like 
[Citrus sinensis]
Length=243

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 103/163 (63%), Gaps = 16/163 (10%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K++R+ E G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+ T EMAARAHDVAAL+
Sbjct  51   KRKRESESGTKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFRTPEMAARAHDVAALS  110

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKG SA LNFP L + LPRP S  P+DIQ AA  AA    D +   S  + + A+P + E
Sbjct  111  IKGDSAVLNFPELVEVLPRPVSLLPRDIQTAATKAASMIIDPSS--STCDEVSAQPQQDE  168

Query  462  ---------LPssqsssnltsesmqeSLNSPSGYGGVDDTFFD  361
                     LP+ + S +  S      LN P     +DD  FD
Sbjct  169  QAELGEIVQLPNIEGSFDFDSAESHNELNIP-----IDDDLFD  206



>ref|XP_009108829.1| PREDICTED: ethylene-responsive transcription factor ERF043-like 
[Brassica rapa]
Length=232

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 77/92 (84%), Gaps = 4/92 (4%)
 Frame = -1

Query  831  GGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA  652
            G +KK++    G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RAHDVA
Sbjct  7    GSDKKKK----GNKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVA  62

Query  651  ALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AL+IKG SA LNFP L+D LPRPAS SP+D++
Sbjct  63   ALSIKGTSAILNFPELSDVLPRPASLSPRDVR  94



>gb|KFK25419.1| hypothetical protein AALP_AA8G112500 [Arabis alpina]
Length=236

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            KT    K  ++V    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAH
Sbjct  33   KTEENLKTTKRVRDSGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAH  92

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            DVAAL+IKG SA LNFP LAD  PRP S +P+DIQ
Sbjct  93   DVAALSIKGTSAILNFPELADSFPRPVSLNPRDIQ  127



>ref|XP_006476039.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Citrus sinensis]
 gb|KDO79821.1| hypothetical protein CISIN_1g027107mg [Citrus sinensis]
Length=228

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K +R  +   KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  30   KIKRMRDQSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  89

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG+SA LNFP LAD LPRP S +P+D+Q
Sbjct  90   IKGNSAILNFPELADSLPRPNSLAPRDVQ  118



>ref|XP_008795185.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Phoenix dactylifera]
Length=248

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E+K  GG K+ R    G +HP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  52   ESKKDGGGKRARD---GSRHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  108

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG SA LNFP LA  LPRPA+ SP+D+Q
Sbjct  109  AHDVAALSIKGASAILNFPELAGALPRPATLSPRDVQ  145



>ref|XP_006450687.1| hypothetical protein CICLE_v10009370mg [Citrus clementina]
 gb|ESR63927.1| hypothetical protein CICLE_v10009370mg [Citrus clementina]
Length=232

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K +R  +   KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  30   KIKRMRDQSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  89

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG+SA LNFP LAD LPRP S +P+D+Q
Sbjct  90   IKGNSAILNFPELADSLPRPNSLAPRDVQ  118



>ref|XP_006289586.1| hypothetical protein CARUB_v10003136mg [Capsella rubella]
 gb|EOA22484.1| hypothetical protein CARUB_v10003136mg [Capsella rubella]
Length=228

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KK ++     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+
Sbjct  32   KKTKRARDSGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALS  91

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG SA LNFP LAD  PRP S SP+DIQ
Sbjct  92   IKGTSAILNFPELADSFPRPVSLSPRDIQ  120



>ref|XP_011004731.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Populus euphratica]
Length=250

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            +KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL
Sbjct  46   SKKIKRIRDSNKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAL  105

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            +IKG+ A LNFP LA+ LPRPAS +P+D+Q
Sbjct  106  SIKGNPAILNFPELANYLPRPASLAPRDVQ  135



>ref|XP_002324799.1| hypothetical protein POPTR_0018s00270g [Populus trichocarpa]
 gb|ABQ62969.1| TINY-like protein [Populus trichocarpa]
 gb|EEF03364.1| hypothetical protein POPTR_0018s00270g [Populus trichocarpa]
Length=250

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            +KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL
Sbjct  46   SKKIKRIRDSNKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAAL  105

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            +IKG+ A LNFP LA+ LPRPAS +P+D+Q
Sbjct  106  SIKGNPAILNFPELANYLPRPASLAPRDVQ  135



>ref|XP_010419734.1| PREDICTED: dehydration-responsive element-binding protein 3 [Camelina 
sativa]
Length=241

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
             ++K     KK ++     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAA
Sbjct  33   HKSKAEQSEKKTKRERDSGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAA  92

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            RAHDVAAL+IKG SA LNFP LAD  PRP S SP+DIQ
Sbjct  93   RAHDVAALSIKGTSAILNFPELADSFPRPVSLSPRDIQ  130



>ref|XP_010062516.1| PREDICTED: ethylene-responsive transcription factor ERF036 [Eucalyptus 
grandis]
 gb|KCW69660.1| hypothetical protein EUGRSUZ_F03062 [Eucalyptus grandis]
Length=276

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  798  GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYL  619
            G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAAL+IKG SA L
Sbjct  71   GSKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALSIKGKSAVL  130

Query  618  NFPHLADQLPRPASNSPKDIQ  556
            NFPHLA  LPRPAS +P+DIQ
Sbjct  131  NFPHLAKLLPRPASLAPRDIQ  151



>ref|XP_004953340.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Setaria italica]
Length=274

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -1

Query  801  GGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAY  622
             G +HPT+RGVR R WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG +A+
Sbjct  82   AGTRHPTFRGVRMRVWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRAAH  141

Query  621  LNFPHLADQLPRPASNSPKDIQ  556
            LNFPHLA +LPRPAS SP DIQ
Sbjct  142  LNFPHLAHELPRPASASPADIQ  163



>emb|CDP08151.1| unnamed protein product [Coffea canephora]
Length=281

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            +KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+P+ EMAARAHDVAAL
Sbjct  57   SKKIKRIRDSSKHPLYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAAL  116

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            +IKG SA LNFP LA  LPRPAS SP+D+Q
Sbjct  117  SIKGTSAILNFPELAGSLPRPASLSPRDVQ  146



>ref|NP_001241356.1| dehydration-responsive element-binding protein 3-like [Glycine 
max]
 gb|ACJ37435.1| AP2 domain-containing transcription factor 1 [Glycine max]
Length=194

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  804  EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSA  625
            +   KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+IKG +A
Sbjct  27   DSSNKHPLYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSAA  86

Query  624  YLNFPHLADQLPRPASNSPKDIQ  556
             LNFPH A+ LPRPAS +P+D+Q
Sbjct  87   ILNFPHFANSLPRPASLAPRDVQ  109



>ref|XP_006426907.1| hypothetical protein CICLE_v10027587mg [Citrus clementina]
 gb|ESR40147.1| hypothetical protein CICLE_v10027587mg [Citrus clementina]
Length=243

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K++R+ E G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+ T EMAARAHDVAAL+
Sbjct  51   KRKRESESGTKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFRTPEMAARAHDVAALS  110

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKG SA LNFP L + LPRP S  P+DIQ AA  AA    D +   S  + + A+P + E
Sbjct  111  IKGDSAVLNFPELVEVLPRPVSLLPRDIQTAATKAASMIIDPSSSTS--DEVSAQPQQDE  168



>gb|ACU23160.1| unknown [Glycine max]
Length=194

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -1

Query  804  EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSA  625
            +   KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL+IKG +A
Sbjct  27   DSSNKHPLYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALSIKGSAA  86

Query  624  YLNFPHLADQLPRPASNSPKDIQ  556
             LNFPH A+ LPRPAS +P+D+Q
Sbjct  87   ILNFPHFANSLPRPASLAPRDVQ  109



>ref|XP_008374052.1| PREDICTED: ethylene-responsive transcription factor ERF034-like, 
partial [Malus domestica]
Length=168

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 4/91 (4%)
 Frame = -1

Query  828  GNKKRRKVEGGE----KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            GNKK+R+    +    KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAH
Sbjct  78   GNKKKRQRTTSDHSDGKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  137

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSP  568
            DVA LAIKG SAYLNFP LA  LP+P S SP
Sbjct  138  DVATLAIKGVSAYLNFPELAQALPQPDSKSP  168



>ref|XP_006282732.1| hypothetical protein CARUB_v10005867mg [Capsella rubella]
 gb|EOA15630.1| hypothetical protein CARUB_v10005867mg [Capsella rubella]
Length=176

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            +TG  +K + + +G  KHP++RGVR R WGKWVSEIREPRKKSRIWLGT+ T EMAARAH
Sbjct  17   RTGKSSKTKNEQKGVSKHPSFRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTPEMAARAH  76

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            DVAALAIKG SA+LNFP LA  LPRPAS  PKDIQ
Sbjct  77   DVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQ  111



>ref|NP_001047629.1| Os02g0657000 [Oryza sativa Japonica Group]
 emb|CAC39080.1| putative AP2 domain containing protein [Oryza sativa]
 gb|AAP83321.1| putative AP2 domain-containing protein [Oryza sativa Japonica 
Group]
 gb|AAQ24204.1| AP2 domain-containing protein Rap211 [Oryza sativa]
 dbj|BAD25756.1| putative DRE binding factor 2 [Oryza sativa Japonica Group]
 dbj|BAD25685.1| putative DRE binding factor 2 [Oryza sativa Japonica Group]
 dbj|BAF09543.1| Os02g0657000 [Oryza sativa Japonica Group]
 dbj|BAG98540.1| unnamed protein product [Oryza sativa Japonica Group]
Length=225

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 2/92 (2%)
 Frame = -1

Query  831  GGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA  652
            GG KKR + +G   HPTYRGVR R+WGKWVSEIREPRKKSRIWLGT+ TAEMAARAHDVA
Sbjct  35   GGKKKRPRKDG--HHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVA  92

Query  651  ALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            ALAIKG +A+LNFP LA +LPRPA+ +PKD+Q
Sbjct  93   ALAIKGRAAHLNFPDLAHELPRPATAAPKDVQ  124



>ref|XP_010089277.1| Ethylene-responsive transcription factor [Morus notabilis]
 gb|EXB37602.1| Ethylene-responsive transcription factor [Morus notabilis]
Length=256

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 109/167 (65%), Gaps = 16/167 (10%)
 Frame = -1

Query  729  EPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaa  550
            EPRKKSRIWLGT PTAEMAARAHDVAALAIKG SAYLNFP LA  LPRP S +PKDIQAA
Sbjct  99   EPRKKSRIWLGTSPTAEMAARAHDVAALAIKGASAYLNFPELARDLPRPLSTAPKDIQAA  158

Query  549  aamaAETTFDDNDEVSHGE--SIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVD  376
            AA+AA  +FD      H +    EAEPSRA+           + + QES +SP      +
Sbjct  159  AALAAAASFDATKSPPHHDPAEAEAEPSRAD---------HLTPTDQESASSPCLSENYE  209

Query  375  DTFFDLPDLSLDGANQND----HYVSTWQLVGVDPGGFRLEEPFLWE  247
            DT FDLPDL + G + ++    +Y  +W L   D  G RLEEPFLWE
Sbjct  210  DTLFDLPDLFIGGTDGSNIGFCYYSPSWHLCAAD-TGLRLEEPFLWE  255



>ref|XP_004953342.1| PREDICTED: ethylene-responsive transcription factor ERF034-like 
[Setaria italica]
Length=233

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 78/89 (88%), Gaps = 1/89 (1%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            KKRR+ + G  HPTYRGVR R WGKWVSEIREPRKKSRIWLGT+ TAEMAARAHDVAALA
Sbjct  39   KKRRRTKDGH-HPTYRGVRMRAWGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALA  97

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG +A+LNFP LA +LPRPA+ +PKD+Q
Sbjct  98   IKGRAAHLNFPELASELPRPATAAPKDVQ  126



>ref|XP_008220077.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Prunus mume]
Length=258

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G K  ++     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAA
Sbjct  53   GKKNTKRGRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAA  112

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFDDN  514
            L+IKG+SA LNFP L+D LPRP S +P+D+QAAA+ AA+   FD N
Sbjct  113  LSIKGNSAILNFPELSDSLPRPVSLAPRDVQAAASKAAQMHQFDAN  158



>gb|KDO56992.1| hypothetical protein CISIN_1g038538mg [Citrus sinensis]
Length=243

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 2/120 (2%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K++R+ E G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+ T EMAARAHDVAAL+
Sbjct  51   KRKRESESGTKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFRTPEMAARAHDVAALS  110

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAE  463
            IKG SA LNFP L + LPRP S  P+DIQ AA  AA    D +   S  + + A+P + E
Sbjct  111  IKGDSAVLNFPELVEVLPRPVSLLPRDIQTAATKAASMIIDPSS--STCDEVSAQPQQDE  168



>ref|XP_007209502.1| hypothetical protein PRUPE_ppa010340mg [Prunus persica]
 gb|EMJ10701.1| hypothetical protein PRUPE_ppa010340mg [Prunus persica]
Length=253

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 119/201 (59%), Gaps = 25/201 (12%)
 Frame = -1

Query  825  NKKRRKVEGG----EKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
            ++K+ K+ G       HP YRGVR R WGKWVSEIREPRKKSRIWLGT+PT EMAARAHD
Sbjct  66   SQKKAKINGSNGTQHHHPVYRGVRMRQWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHD  125

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAE  478
            VAAL IKG SA LNFP LA +LPRPAS S KDIQAAAA AA   +  +   S   S  + 
Sbjct  126  VAALTIKGRSAVLNFPELAQELPRPASASAKDIQAAAAKAAALNYPISCSSS---SSSSR  182

Query  477  PSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDH---YVST  307
             + AE  +  S         Q+S  SPS     DD FFDLPDL LD  +  DH   +   
Sbjct  183  EAEAETEAELSQHRQAVHDTQDSSTSPSTNN--DDMFFDLPDLLLDFGHHRDHGFCFSVP  240

Query  306  WQLVGVDPGGFRLEEP--FLW  250
            W           LEEP  FLW
Sbjct  241  W-----------LEEPNNFLW  250



>gb|KHN04233.1| Dehydration-responsive element-binding protein 3 [Glycine soja]
Length=207

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
              K+ ++     KHP Y GVRKRNWGKWVSEIREPRKKSRIWLGT+ T EMAARAHDVAA
Sbjct  19   AQKQSKRPRDCSKHPVYHGVRKRNWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAA  78

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETT-FDDNDEVSHGESIEA  481
            L IKG SA LNFP +AD LPRP + SP+DIQ AA  AA    FD   + S  E+ E+
Sbjct  79   LTIKGQSAILNFPEIADLLPRPVTCSPRDIQTAATAAASMVKFDPVTQSSDSETPES  135



>dbj|BAK05071.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=276

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 121/192 (63%), Gaps = 12/192 (6%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKG-HSAYLN  616
            KHP YRGVR R WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG  SA+LN
Sbjct  87   KHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGARSAHLN  146

Query  615  FPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssn  436
            FP LAD LPR AS +PKD+QAAAA+AA  T   +  +S  +S E E    E     + ++
Sbjct  147  FPELADVLPRAASPAPKDVQAAAALAAAFT-SSSPPLSTDQSEEEEGLIQEEIVKNNEAS  205

Query  435  ltsesmqeSLNSPSGYGGVDDT------FFDLPDLSLDGANQNDHYVSTWQ-LVGVDP--  283
              + +  ES  +P+  G  +         FDLPDL +D       + + W  L  V+   
Sbjct  206  AGATAQTESAGTPTSGGAAEQADEEELQLFDLPDLLMD-IEDGFGFSTMWAPLPDVEEVN  264

Query  282  GGFRLEEPFLWE  247
               RLEEP LWE
Sbjct  265  ADLRLEEPLLWE  276



>ref|XP_009141508.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Brassica rapa]
Length=194

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 109/198 (55%), Gaps = 45/198 (23%)
 Frame = -1

Query  822  KKRRKVEGGEKH----PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            KKR K +  EK     PT+RGVR R WGKWVSEIREPRKKSRIWLGT+ TAE AARAHDV
Sbjct  38   KKRVKKDNDEKAVSKPPTFRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTAEKAARAHDV  97

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AALAIKG SA+LNFP LA   PRPAS +PKDIQAAAA AA    D          IE E 
Sbjct  98   AALAIKGRSAHLNFPELAYHFPRPASANPKDIQAAAAAAAAVAVD----------IEVET  147

Query  474  SRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLV  295
            S                     L SP+     DD F DLPDL LD  ++ D +   W   
Sbjct  148  S---------------------LPSPAMTAIADDAFSDLPDLLLDVNHKLDGF---WD--  181

Query  294  GVDPGGFRLEEPFLWECY  241
                     EEPF    Y
Sbjct  182  -----SLPYEEPFFTGSY  194



>gb|KFK22266.1| hypothetical protein AALP_AAs66747U002200 [Arabis alpina]
Length=182

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 110/202 (54%), Gaps = 40/202 (20%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E  T  G+K  + ++G  KHP YRGVR R WGKWVSEIREPRKKSRIWLGT+ T EMAAR
Sbjct  21   ERTTVKGSKNVQNLKGVSKHPNYRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTPEMAAR  80

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESI  487
            AHDVAALAIKG SA+LNFP LA  LPRPAS  PKDIQAAA             V   E  
Sbjct  81   AHDVAALAIKGGSAHLNFPDLAYHLPRPASADPKDIQAAAT---------AAAVDWKEPP  131

Query  486  EAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVST  307
            E+  S                         +     DD F DLPDL LD    NDH+   
Sbjct  132  ESPSSTV-----------------------TSSPVADDAFTDLPDLLLD---VNDHH---  162

Query  306  WQLVGVDPGGFRLEEPFLWECY  241
             +L G     F  EEPF  E Y
Sbjct  163  -KLDGFW-DSFPYEEPFFSENY  182



>ref|XP_007137220.1| hypothetical protein PHAVU_009G109600g [Phaseolus vulgaris]
 gb|ESW09214.1| hypothetical protein PHAVU_009G109600g [Phaseolus vulgaris]
Length=194

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  852  GQEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMA  673
              E +     KK +++    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMA
Sbjct  10   SSETEASPETKKIKRIRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMA  69

Query  672  ARAHDVAALAIKGHSAYLNFPHLADQLPRPAS  577
            ARAHDVAAL+IKG +A LNFPHLA+ LPRPAS
Sbjct  70   ARAHDVAALSIKGSAAILNFPHLANSLPRPAS  101



>ref|XP_003529759.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Glycine max]
Length=207

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
              K+ ++     KHP Y GVRKRNWGKWVSEIREPRKKSRIWLGT+ T EMAARAHDVAA
Sbjct  19   AQKQSKRPRDCSKHPVYHGVRKRNWGKWVSEIREPRKKSRIWLGTFSTPEMAARAHDVAA  78

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETT-FDDNDEVSHGESIEA  481
            L IKG SA LNFP +AD LPRP + SP+DIQ AA  AA    FD   + S  E+ E+
Sbjct  79   LTIKGQSAILNFPEIADLLPRPVTCSPRDIQTAATAAASMVKFDPVTQSSDSETPES  135



>ref|XP_010915419.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Elaeis guineensis]
Length=250

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E+  GGG K+ R      +HP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  54   ESNKGGGGKRVRD---SSRHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  110

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG SA LNFP LA  LPRPA+ SP+D+Q
Sbjct  111  AHDVAALSIKGASAILNFPELAGSLPRPATLSPRDVQ  147



>ref|XP_010434773.1| PREDICTED: ethylene-responsive transcription factor ERF039-like 
[Camelina sativa]
Length=179

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            +TG  +K + + +G  KHP++RGVR R WGKWVSEIREPRKKSRIWLGT+ T EMAARAH
Sbjct  20   RTGKSSKSKNEQKGVSKHPSFRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTPEMAARAH  79

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            DVAALAIKG SA+LNFP LA  LPRPAS  PKDIQ
Sbjct  80   DVAALAIKGGSAHLNFPELAYHLPRPASVDPKDIQ  114



>emb|CDX72373.1| BnaC07g43950D [Brassica napus]
Length=228

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 3/114 (3%)
 Frame = -1

Query  831  GGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA  652
            G +K+++K   G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RAHDVA
Sbjct  7    GPDKEKKK---GSKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVA  63

Query  651  ALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGES  490
            AL+IKG SA LNFP L++ LPRPAS SP+D++AAA  AA   F ++    H  S
Sbjct  64   ALSIKGTSAILNFPELSNSLPRPASLSPRDVRAAATKAALMDFGNSAAFCHVRS  117



>ref|XP_009380474.1| PREDICTED: ethylene-responsive transcription factor TINY [Musa 
acuminata subsp. malaccensis]
 ref|XP_009380475.1| PREDICTED: ethylene-responsive transcription factor TINY [Musa 
acuminata subsp. malaccensis]
Length=238

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 79/97 (81%), Gaps = 2/97 (2%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            E  +GGG+ KR + +   KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+ T EMAAR
Sbjct  53   EESSGGGSAKRLRDQS--KHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFTTPEMAAR  110

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG +A LNFP LA  LPRPA+ SP+D+Q
Sbjct  111  AHDVAALSIKGAAAVLNFPELAGSLPRPATLSPRDVQ  147



>gb|EYU20436.1| hypothetical protein MIMGU_mgv1a024757mg, partial [Erythranthe 
guttata]
Length=226

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 76/97 (78%), Gaps = 7/97 (7%)
 Frame = -1

Query  825  NKKRRKVE-------GGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            NKK ++V           KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  42   NKKIKRVREAAASSNSSTKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  101

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAA++IKG SA LNFP LA  LPRPAS SP+DIQ
Sbjct  102  AHDVAAVSIKGASAILNFPELASALPRPASLSPRDIQ  138



>ref|XP_007225774.1| hypothetical protein PRUPE_ppa009533mg [Prunus persica]
 gb|EMJ26973.1| hypothetical protein PRUPE_ppa009533mg [Prunus persica]
Length=288

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
            G K  ++     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAA
Sbjct  53   GKKNTKRGRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAA  112

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFDDN  514
            L+IKG+SA LNFP L+D LPRP S +P+D+QAAA+ AA+   FD N
Sbjct  113  LSIKGNSAILNFPELSDSLPRPVSLAPRDVQAAASKAAQMHQFDAN  158



>emb|CDY49324.1| BnaC03g66900D [Brassica napus]
Length=207

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 4/90 (4%)
 Frame = -1

Query  831  GGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVA  652
            G +KK++    G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RAHDVA
Sbjct  7    GSDKKKK----GNKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRAHDVA  62

Query  651  ALAIKGHSAYLNFPHLADQLPRPASNSPKD  562
            AL+IKG SA LNFP L+D LPRPAS SP+D
Sbjct  63   ALSIKGTSAILNFPELSDVLPRPASLSPRD  92



>ref|XP_009125819.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Brassica rapa]
Length=234

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            +A+    +KK ++V+   +HP Y GVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  41   KAEQTDNSKKTKRVKDSGRHPVYHGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  100

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG SA LNFP L +  PRP S SP+DIQ
Sbjct  101  AHDVAALSIKGSSAILNFPELVESFPRPVSLSPRDIQ  137



>ref|XP_004235656.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Solanum lycopersicum]
Length=249

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            +H  YRGVR R+WGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA++IKG+SA LNF
Sbjct  68   RHQIYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAVSIKGNSAILNF  127

Query  612  PHLADQLPRPASNSPKDIQ  556
            PHL D LPRP S SP+DIQ
Sbjct  128  PHLIDSLPRPLSKSPRDIQ  146



>ref|NP_197953.1| ethylene-responsive transcription factor TINY [Arabidopsis thaliana]
 sp|Q39127.1|TINY_ARATH RecName: Full=Ethylene-responsive transcription factor TINY [Arabidopsis 
thaliana]
 emb|CAA64359.1| TINY [Arabidopsis thaliana]
 gb|AAC29139.1| TINY [Arabidopsis thaliana]
 gb|AAT44922.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|ABD94079.1| At5g25810 [Arabidopsis thaliana]
 gb|AED93490.1| ethylene-responsive transcription factor TINY [Arabidopsis thaliana]
Length=218

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            +K++ V+   KHP YRGVRKRNWGKWVSEIREPRKKSRIWLGT+P+ EMAARAHDVAAL+
Sbjct  22   EKKKPVKDSGKHPVYRGVRKRNWGKWVSEIREPRKKSRIWLGTFPSPEMAARAHDVAALS  81

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IKG SA LNFP LA   PRP+S SP+DIQ
Sbjct  82   IKGASAILNFPDLAGSFPRPSSLSPRDIQ  110



>ref|XP_006359762.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum tuberosum]
Length=207

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -1

Query  825  NKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAAL  646
            NK  ++     KHP +RGVR RNWGKWVSEIREPRKKSRIWLGT+P  EMAARAHDVAAL
Sbjct  16   NKSIKRNRDSSKHPVFRGVRMRNWGKWVSEIREPRKKSRIWLGTFPNPEMAARAHDVAAL  75

Query  645  AIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAET-TFDDNDEVS  502
            +IKG+SA LNFP LA  LPRPA+ SP+DIQAAAA AA    FD+N+ ++
Sbjct  76   SIKGNSAILNFPELAGLLPRPATLSPRDIQAAAAKAAAMDKFDNNNGIT  124



>ref|XP_009121933.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Brassica rapa]
Length=240

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = -1

Query  852  GQEAKTGGGNKKRRKVEGGEKH--PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
              +A+    +KK ++V+   KH  P YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT E
Sbjct  36   SSKAEQNENSKKAKRVKDSGKHAYPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPE  95

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            MAARAHDVAAL+IKG SA LNFP LAD  PRP S +P+DIQ
Sbjct  96   MAARAHDVAALSIKGASAILNFPELADSFPRPVSLNPRDIQ  136



>ref|XP_010049108.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Eucalyptus grandis]
 gb|KCW81571.1| hypothetical protein EUGRSUZ_C02928 [Eucalyptus grandis]
Length=258

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAAL IKG SA+LNF
Sbjct  54   KHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAALHIKGSSAFLNF  113

Query  612  PHLADQLPRPASNSPKDIQ  556
            PHLA  LPRP+S SP+D+Q
Sbjct  114  PHLAASLPRPSSLSPRDVQ  132



>emb|CDY27827.1| BnaC09g28540D [Brassica napus]
 emb|CDX91203.1| BnaC02g03940D [Brassica napus]
Length=231

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
             +KK ++V+   +HP Y GVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAARAHDVAA
Sbjct  44   NSKKTKRVKDSGRHPVYHGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHDVAA  103

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            L+IKG+SA LNFP L +  PRP S SP+DIQ
Sbjct  104  LSIKGNSAILNFPELVESFPRPVSLSPRDIQ  134



>emb|CDX85705.1| BnaA02g01080D [Brassica napus]
Length=234

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            +A+    +KK ++V+   +HP Y GVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  41   KAEQTDNSKKTKRVKDSGRHPVYHGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  100

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG SA LNFP L +  PRP S SP+DIQ
Sbjct  101  AHDVAALSIKGSSAILNFPELVESFPRPVSLSPRDIQ  137



>gb|KFK36467.1| hypothetical protein AALP_AA4G128400 [Arabis alpina]
Length=190

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 113/205 (55%), Gaps = 40/205 (20%)
 Frame = -1

Query  837  TGGGNKKRRKVEGGE------KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEM  676
            T   +KK+R  +  E      KHPT+RGVR R WGKWVSEIREP+KKSRIWLGT+PT EM
Sbjct  20   TNTNSKKKRAKDDDEERVMVPKHPTFRGVRMRQWGKWVSEIREPKKKSRIWLGTFPTPEM  79

Query  675  AARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHG  496
            AARAHDVAALAIKG SA+LNFP LA  LPRPAS  PKDIQAAAA AA        EV   
Sbjct  80   AARAHDVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQAAAAAAAVADM----EVETS  135

Query  495  ESIEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHY  316
                     +                   +N+ +     DD F DLPDL LD  + ND +
Sbjct  136  SPSSTSTEISS----------------PVMNAIA-----DDAFSDLPDLLLDVNHTNDGF  174

Query  315  VSTWQLVGVDPGGFRLEEPFLWECY  241
               W     D      EEPF  + Y
Sbjct  175  ---WDSFPND------EEPFFSQSY  190



>emb|CDX69746.1| BnaA10g20950D [Brassica napus]
Length=240

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = -1

Query  852  GQEAKTGGGNKKRRKVEGGEKH--PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
              +A+    +KK ++V+   KH  P YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT E
Sbjct  36   SSKAEQNENSKKAKRVKDSGKHAYPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPE  95

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            MAARAHDVAAL+IKG SA LNFP LAD  PRP S +P+DIQ
Sbjct  96   MAARAHDVAALSIKGASAILNFPELADSFPRPVSLNPRDIQ  136



>gb|AIZ97485.1| CBF-like protein CBF7 [Deschampsia antarctica]
Length=270

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -1

Query  804  EGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSA  625
            + G KHP+YRGVR+R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG  A
Sbjct  94   KSGFKHPSYRGVRRRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRKA  153

Query  624  YLNFPHLADQLPRPASNSPKDIQ  556
            +LNFP LAD+LPR  S SP DIQ
Sbjct  154  HLNFPELADELPRADSTSPADIQ  176



>ref|XP_009143633.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Brassica rapa]
Length=204

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 107/184 (58%), Gaps = 32/184 (17%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPTYRGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAHDVAALAIKG SA+LNF
Sbjct  53   KHPTYRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNF  112

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA QLPRPAS  PKDIQAAAA AA     D         +E E S             
Sbjct  113  PELACQLPRPASADPKDIQAAAAAAAAAVAVD---------MEVETSTPS----------  153

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                +    +SP+     DD F DLPDL LD  +  D +   W         F  EEPF 
Sbjct  154  ---PVSSEPSSPATTALADDAFSDLPDLLLDVNHNIDGF---WD-------SFPYEEPFF  200

Query  252  WECY  241
               Y
Sbjct  201  SGTY  204



>ref|XP_008378086.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Malus domestica]
 gb|ADE41142.1| AP2 domain class transcription factor [Malus domestica]
Length=252

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = -1

Query  849  QEAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAA  670
            QE      N  +R V    KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAA
Sbjct  44   QETDLPTKNNAKR-VRDSSKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAA  102

Query  669  RAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            RAHDVAAL+IKG+SA LNFP L++ LPRP S +P+D+Q
Sbjct  103  RAHDVAALSIKGNSAILNFPELSNSLPRPVSLAPRDVQ  140



>ref|NP_196720.1| dehydration-responsive element-binding protein 3 [Arabidopsis 
thaliana]
 sp|Q9LYD3.1|DREB3_ARATH RecName: Full=Dehydration-responsive element-binding protein 
3; AltName: Full=Protein TINY 2 [Arabidopsis thaliana]
 emb|CAB87719.1| transcription factor like protein [Arabidopsis thaliana]
 gb|AAT44918.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAX38232.1| DREB3 [Arabidopsis thaliana]
 gb|AED91698.1| dehydration-responsive element-binding protein 3 [Arabidopsis 
thaliana]
Length=236

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  846  EAKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAAR  667
            ++K     KK ++     KHP YRGVR RNWGKWVSEIREPRKKSRIWLGT+PT EMAAR
Sbjct  29   KSKAEQSEKKTKRGRDSGKHPVYRGVRMRNWGKWVSEIREPRKKSRIWLGTFPTPEMAAR  88

Query  666  AHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            AHDVAAL+IKG +A LNFP LAD  PRP S SP+DIQ
Sbjct  89   AHDVAALSIKGTAAILNFPELADSFPRPVSLSPRDIQ  125



>emb|CAH67503.1| OSIGBa0134H18.5 [Oryza sativa Indica Group]
Length=247

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 106/170 (62%), Gaps = 19/170 (11%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            K+R      KHPTYRGVR R+WGKWVSEIREPRKKSRIWLGT+ TAEMAARAHDVAALAI
Sbjct  51   KKRPRSDHLKHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFDTAEMAARAHDVAALAI  110

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAE----------TTFDDNDEVSHGES  490
            KG +A+LNFP LA  LPR AS SPKD+QAAAA+AA           T   D D  +  E 
Sbjct  111  KGRTAHLNFPDLAHLLPRAASASPKDVQAAAALAAATASPAPALSPTPCHDVDAAADDEP  170

Query  489  IEAEPSRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLD  340
              AEP +A  P     +    +          G  G+D T+F +PD  L+
Sbjct  171  EPAEPEQATAPVCIVENGTLQQ---------DGGTGLDYTYFTMPDALLE  211



>emb|CDY72553.1| BnaAnng41450D [Brassica napus]
Length=194

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 109/198 (55%), Gaps = 45/198 (23%)
 Frame = -1

Query  822  KKRRKVEGGEKH----PTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDV  655
            KKR K +  EK     P++RGVR R WGKWVSEIREPRKKSRIWLGT+ TAE AARAHDV
Sbjct  38   KKRVKKDNDEKAVSKPPSFRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTAEKAARAHDV  97

Query  654  AALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEP  475
            AALAIKG SA+LNFP LA   PRPAS +PKDIQAAAA AA    D          IE E 
Sbjct  98   AALAIKGRSAHLNFPELAYHFPRPASANPKDIQAAAAAAAAVAVD----------IEVET  147

Query  474  SRAELPssqsssnltsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLV  295
            S                     L SP+     DD F DLPDL LD  ++ D +   W   
Sbjct  148  S---------------------LPSPAMTAIADDAFSDLPDLLLDVNHKLDGF---WD--  181

Query  294  GVDPGGFRLEEPFLWECY  241
                     EEPF    Y
Sbjct  182  -----SLPYEEPFFTGSY  194



>ref|NP_001047627.1| Os02g0656600 [Oryza sativa Japonica Group]
 emb|CAC39072.1| putative AP2 domain transcription factor [Oryza sativa]
 gb|AAQ23982.1| transcription factor Rap212 [Oryza sativa]
 dbj|BAD25682.1| putative DRE binding factor 2 [Oryza sativa Japonica Group]
 dbj|BAF09541.1| Os02g0656600 [Oryza sativa Japonica Group]
 gb|EEE57510.1| hypothetical protein OsJ_07793 [Oryza sativa Japonica Group]
Length=287

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -1

Query  816  RRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIK  637
            R++ + G +HP+YRGVR+R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIK
Sbjct  88   RKRGDAG-RHPSYRGVRRRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIK  146

Query  636  GHSAYLNFPHLADQLPRPASNSPKDIQ  556
            G +A+LNFP LA  LPRPAS SP DIQ
Sbjct  147  GRAAHLNFPSLAHTLPRPASTSPSDIQ  173



>ref|XP_009596664.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Nicotiana tomentosiformis]
Length=196

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = -1

Query  822  KKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALA  643
            K R+    G ++P YRGVR R+WGKWVSEIREPRKKSRIWLGTYPT EMAARAHDVAAL+
Sbjct  5    KTRQSANTGNRYPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTYPTPEMAARAHDVAALS  64

Query  642  IKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            IK +S+ LNFPHL + LPRP S SP+D+Q
Sbjct  65   IKKNSSILNFPHLVNSLPRPVSLSPRDVQ  93



>ref|XP_002515992.1| Transcriptional factor TINY, putative [Ricinus communis]
 gb|EEF46412.1| Transcriptional factor TINY, putative [Ricinus communis]
Length=241

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%), Gaps = 3/101 (3%)
 Frame = -1

Query  849  QEAKTGGGNKKR---RKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAE  679
            + +K+ G   KR   ++     KHP YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAE
Sbjct  23   KHSKSEGPVDKRSCLKRARDCSKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAE  82

Query  678  MAARAHDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            MAARAHDVAA++IKG+SA LNFP L D LPRP S  P+DIQ
Sbjct  83   MAARAHDVAAMSIKGNSAILNFPQLIDSLPRPVSLMPRDIQ  123



>emb|CDO97995.1| unnamed protein product [Coffea canephora]
Length=251

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -1

Query  819  KRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAI  640
            KR++   G KHP YRGVR R+WGKWVSEIREPRKKSRIWLGTY TAEMAARAHDVAAL+I
Sbjct  51   KRQRDNSGNKHPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTYSTAEMAARAHDVAALSI  110

Query  639  KGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            KG+SA LNFP L + LPRP S +P+D+Q
Sbjct  111  KGNSAILNFPQLVESLPRPVSLAPRDVQ  138



>ref|XP_006653648.1| PREDICTED: ethylene-responsive transcription factor ERF038-like 
[Oryza brachyantha]
Length=209

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  798  GEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYL  619
            G KHP+YRGVR+R+WGKWVSEIREPRKKSRIWLGT+PTAEMAARAHDVAALAIKG +A+L
Sbjct  40   GFKHPSYRGVRRRSWGKWVSEIREPRKKSRIWLGTFPTAEMAARAHDVAALAIKGRNAHL  99

Query  618  NFPHLADQLPRPASNSPKDIQ  556
            NFP  A +LPRPAS SP DIQ
Sbjct  100  NFPDSAHELPRPASTSPADIQ  120



>ref|XP_004245167.1| PREDICTED: dehydration-responsive element-binding protein 3-like 
[Solanum lycopersicum]
Length=218

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  828  GNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAA  649
             NK  ++     KHP +RGVR RNWGKWVSEIREPRKKSRIWLGT+P  EMAARAHDVAA
Sbjct  16   SNKSIKRNRDSSKHPVFRGVRMRNWGKWVSEIREPRKKSRIWLGTFPNPEMAARAHDVAA  75

Query  648  LAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            L+IKG+SA LNFP LA  LPRPA+ SP+DIQ
Sbjct  76   LSIKGNSAILNFPELAGLLPRPATLSPRDIQ  106



>gb|AAW28084.1| transcription factor DREBIII-1 [Brassica napus]
 emb|CDY71448.1| BnaAnng37500D [Brassica napus]
Length=204

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 107/184 (58%), Gaps = 32/184 (17%)
 Frame = -1

Query  792  KHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIKGHSAYLNF  613
            KHPTYRGVR R WGKWVSEIREP+KKSRIWLGT+ TAEMAARAHDVAALAIKG SA+LNF
Sbjct  53   KHPTYRGVRMRQWGKWVSEIREPKKKSRIWLGTFSTAEMAARAHDVAALAIKGGSAHLNF  112

Query  612  PHLADQLPRPASNSPKDIQaaaamaAETTFDDNDEVSHGESIEAEPSRAELPssqsssnl  433
            P LA QLPRPAS  PKDIQAAAA AA     D         +E E S             
Sbjct  113  PELAYQLPRPASADPKDIQAAAAAAAAAVAVD---------MEVETSTPS----------  153

Query  432  tsesmqeSLNSPSGYGGVDDTFFDLPDLSLDGANQNDHYVSTWQLVGVDPGGFRLEEPFL  253
                +    +SP+     DD F DLPDL LD  +  D +   W         F  EEPF 
Sbjct  154  ---PVSSEPSSPATTALADDAFSDLPDLLLDVNHNIDGF---WD-------SFPYEEPFF  200

Query  252  WECY  241
               Y
Sbjct  201  SGTY  204



>ref|XP_006412430.1| hypothetical protein EUTSA_v10026204mg [Eutrema salsugineum]
 gb|ESQ53883.1| hypothetical protein EUTSA_v10026204mg [Eutrema salsugineum]
Length=217

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = -1

Query  843  AKTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARA  664
             ++  G+ K +K   G K P YRGVR R+WGKWVSEIREPRKKSRIWLGT+PTAEMA RA
Sbjct  2    VESSLGSDKEKK---GSKQPVYRGVRMRSWGKWVSEIREPRKKSRIWLGTFPTAEMAMRA  58

Query  663  HDVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQaaaamaAETTFD  520
            HDVAAL+IKG SA LNFP L++ LPRPAS SP+D++AAA  AA   FD
Sbjct  59   HDVAALSIKGTSAILNFPELSEFLPRPASLSPRDVRAAATKAAFMEFD  106



>ref|XP_010910974.1| PREDICTED: ethylene-responsive transcription factor TINY-like 
[Elaeis guineensis]
Length=226

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 77/94 (82%), Gaps = 2/94 (2%)
 Frame = -1

Query  837  TGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHD  658
            TGGG +KR +   G KHP YRGVR R WGKWVSEIREPRKKSRIWLGT+PT EMAARAHD
Sbjct  33   TGGGGEKRAR--DGTKHPVYRGVRMRAWGKWVSEIREPRKKSRIWLGTFPTPEMAARAHD  90

Query  657  VAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            VAAL++KG +A LNFP LA   PRPA+ SP+D+Q
Sbjct  91   VAALSVKGAAAVLNFPDLAASFPRPATLSPRDVQ  124



>ref|XP_010102390.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
 gb|AHJ25980.1| dehydration responsive element binding transcription factor [Morus 
notabilis]
 gb|EXB93375.1| Dehydration-responsive element-binding protein 3 [Morus notabilis]
Length=249

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -1

Query  816  RRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAHDVAALAIK  637
            +R      KHP YRGVR RNWGKWVSEIREP+KKSRIWLGT+PT EMAARAHDVAAL+IK
Sbjct  55   KRMRSDSSKHPVYRGVRMRNWGKWVSEIREPKKKSRIWLGTFPTPEMAARAHDVAALSIK  114

Query  636  GHSAYLNFPHLADQLPRPASNSPKDIQ  556
            G SA LNFPHLA  LPRPAS +P+D+Q
Sbjct  115  GSSAILNFPHLAGSLPRPASLAPRDVQ  141



>ref|NP_193408.1| ethylene-responsive transcription factor ERF039 [Arabidopsis 
thaliana]
 sp|Q9SUK8.1|ERF39_ARATH RecName: Full=Ethylene-responsive transcription factor ERF039 
[Arabidopsis thaliana]
 emb|CAB46040.1| apetala2 domain TINY like protein [Arabidopsis thaliana]
 emb|CAB78717.1| apetala2 domain TINY like protein [Arabidopsis thaliana]
 gb|AAS46629.1| At4g16750 [Arabidopsis thaliana]
 gb|AAT44941.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana]
 gb|AAW80865.1| At4g16750 [Arabidopsis thaliana]
 gb|AEE83797.1| ethylene-responsive transcription factor ERF039 [Arabidopsis 
thaliana]
Length=179

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -1

Query  840  KTGGGNKKRRKVEGGEKHPTYRGVRKRNWGKWVSEIREPRKKSRIWLGTYPTAEMAARAH  661
            KTG  +K + + +G  K P +RGVR R WGKWVSEIREPRKKSRIWLGT+ T EMAARAH
Sbjct  20   KTGKSSKTKNEQKGVSKQPNFRGVRMRQWGKWVSEIREPRKKSRIWLGTFSTPEMAARAH  79

Query  660  DVAALAIKGHSAYLNFPHLADQLPRPASNSPKDIQ  556
            DVAALAIKG SA+LNFP LA  LPRPAS  PKDIQ
Sbjct  80   DVAALAIKGGSAHLNFPELAYHLPRPASADPKDIQ  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1802351708432