BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78673_g1_i1 len=1732 path=[1:0-1731]

Length=1732
                                                                      Score     E

ref|XP_007037964.1|  Cytochrome P450 94A2                               636   0.0      
ref|XP_002279981.1|  PREDICTED: cytochrome P450 94B3-like               634   0.0      Vitis vinifera
ref|XP_006351474.1|  PREDICTED: cytochrome P450 94A1-like               632   0.0      
ref|XP_004236553.1|  PREDICTED: cytochrome P450 94B3-like               628   0.0      
ref|XP_004236333.1|  PREDICTED: cytochrome P450 94B3-like               626   0.0      
gb|ADO24345.1|  cytochrome P450 A                                       624   0.0      
ref|XP_004236332.1|  PREDICTED: cytochrome P450 94B3-like               624   0.0      
ref|XP_006351473.1|  PREDICTED: cytochrome P450 94A1-like               623   0.0      
ref|XP_006351475.1|  PREDICTED: cytochrome P450 94A1-like               623   0.0      
ref|XP_009604998.1|  PREDICTED: cytochrome P450 94B3-like               620   0.0      
ref|XP_009607568.1|  PREDICTED: cytochrome P450 94B3-like               620   0.0      
ref|XP_009601037.1|  PREDICTED: cytochrome P450 94B3-like               619   0.0      
ref|XP_006440103.1|  hypothetical protein CICLE_v10019793mg             616   0.0      
gb|KDO52651.1|  hypothetical protein CISIN_1g036030mg                   616   0.0      
ref|XP_006477025.1|  PREDICTED: cytochrome P450 94A1-like               616   0.0      
ref|XP_009766464.1|  PREDICTED: cytochrome P450 94B3-like               613   0.0      
ref|XP_011044159.1|  PREDICTED: cytochrome P450 94B3-like               612   0.0      
ref|XP_002318721.2|  hypothetical protein POPTR_0012s09880g             615   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011083758.1|  PREDICTED: cytochrome P450 94B3-like               605   0.0      
ref|XP_002511196.1|  cytochrome P450, putative                          601   0.0      Ricinus communis
ref|XP_008239459.1|  PREDICTED: cytochrome P450 94B3                    601   0.0      
ref|XP_010250749.1|  PREDICTED: cytochrome P450 94B3-like               600   0.0      
ref|XP_007210176.1|  hypothetical protein PRUPE_ppa017252mg             595   0.0      
emb|CDP15011.1|  unnamed protein product                                596   0.0      
ref|XP_009762653.1|  PREDICTED: cytochrome P450 94B3-like               592   0.0      
ref|XP_010045499.1|  PREDICTED: cytochrome P450 94B3-like               593   0.0      
gb|AJD25220.1|  cytochrome P450 CYP94B50                                591   0.0      
ref|XP_009359442.1|  PREDICTED: cytochrome P450 94B3-like               591   0.0      
ref|XP_010045498.1|  PREDICTED: cytochrome P450 94B3-like               591   0.0      
gb|KCW83161.1|  hypothetical protein EUGRSUZ_B00116                     589   0.0      
gb|KCW83159.1|  hypothetical protein EUGRSUZ_B00114                     588   0.0      
ref|XP_010045501.1|  PREDICTED: cytochrome P450 94B3-like               586   0.0      
ref|XP_010104028.1|  Cytochrome P450 94A1                               584   0.0      
ref|XP_011084785.1|  PREDICTED: cytochrome P450 94B3-like               582   0.0      
gb|KCW83162.1|  hypothetical protein EUGRSUZ_B00117                     582   0.0      
ref|XP_007134770.1|  hypothetical protein PHAVU_010G074400g             582   0.0      
ref|XP_003601427.1|  Cytochrome P450 94A1                               582   0.0      
gb|KCW83158.1|  hypothetical protein EUGRSUZ_B00113                     581   0.0      
ref|XP_010026539.1|  PREDICTED: cytochrome P450 94B3-like               581   0.0      
ref|XP_008464443.1|  PREDICTED: cytochrome P450 94B3                    580   0.0      
gb|EYU43048.1|  hypothetical protein MIMGU_mgv1a026913mg                578   0.0      
ref|XP_010026558.1|  PREDICTED: cytochrome P450 94B3-like               580   0.0      
ref|XP_009368544.1|  PREDICTED: cytochrome P450 94B3-like               579   0.0      
ref|XP_003516338.1|  PREDICTED: cytochrome P450 94A2-like               578   0.0      
ref|XP_010045497.1|  PREDICTED: cytochrome P450 94B3-like               577   0.0      
gb|KEH22037.1|  cytochrome P450 family protein                          575   0.0      
ref|XP_003522151.1|  PREDICTED: cytochrome P450 94A2-like               575   0.0      
ref|XP_008346695.1|  PREDICTED: cytochrome P450 94B3-like               575   0.0      
ref|XP_004502138.1|  PREDICTED: cytochrome P450 94A2-like               573   0.0      
gb|KFK34160.1|  hypothetical protein AALP_AA5G108200                    572   0.0      
ref|XP_002273811.3|  PREDICTED: cytochrome P450 94B3                    573   0.0      Vitis vinifera
gb|KGN63489.1|  hypothetical protein Csa_1G002090                       572   0.0      
ref|XP_008368443.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    570   0.0      
ref|XP_008341677.1|  PREDICTED: cytochrome P450 94B3-like               568   0.0      
ref|XP_010250748.1|  PREDICTED: cytochrome P450 94B3-like               567   0.0      
ref|XP_010112360.1|  Cytochrome P450 94A1                               567   0.0      
ref|XP_009371650.1|  PREDICTED: cytochrome P450 94B3-like               566   0.0      
ref|XP_002300103.1|  cytochrome P450 family protein                     566   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006470124.1|  PREDICTED: cytochrome P450 94A2-like               565   0.0      
ref|XP_009150186.1|  PREDICTED: cytochrome P450 94B3                    565   0.0      
ref|XP_006447077.1|  hypothetical protein CICLE_v10017920mg             564   0.0      
ref|XP_008341306.1|  PREDICTED: cytochrome P450 94B3-like               565   0.0      
ref|XP_002509524.1|  cytochrome P450, putative                          564   0.0      Ricinus communis
ref|XP_009784521.1|  PREDICTED: cytochrome P450 94B3-like               564   0.0      
ref|XP_009149812.1|  PREDICTED: cytochrome P450 94B3                    564   0.0      
ref|XP_007215034.1|  hypothetical protein PRUPE_ppa004311mg             564   0.0      
ref|XP_009620348.1|  PREDICTED: cytochrome P450 94B3                    562   0.0      
ref|XP_011003922.1|  PREDICTED: cytochrome P450 94B3                    563   0.0      
ref|XP_008231126.1|  PREDICTED: cytochrome P450 94B3                    561   0.0      
gb|KDP46287.1|  hypothetical protein JCGZ_10127                         558   0.0      
ref|XP_008788895.1|  PREDICTED: cytochrome P450 94B3-like               558   0.0      
ref|XP_004513634.1|  PREDICTED: cytochrome P450 94A1-like               558   0.0      
emb|CDY59153.1|  BnaC08g48490D                                          555   0.0      
ref|XP_010929779.1|  PREDICTED: cytochrome P450 94B3-like               553   0.0      
ref|XP_010550730.1|  PREDICTED: cytochrome P450 94B3                    549   0.0      
ref|XP_010677888.1|  PREDICTED: cytochrome P450 94B3                    549   0.0      
ref|XP_010029004.1|  PREDICTED: cytochrome P450 94B3-like               548   0.0      
ref|XP_010033411.1|  PREDICTED: cytochrome P450 94B3-like               548   0.0      
ref|XP_009394066.1|  PREDICTED: cytochrome P450 94B3-like               546   0.0      
ref|XP_003553253.2|  PREDICTED: cytochrome P450 94A1-like               546   0.0      
ref|XP_006338805.1|  PREDICTED: cytochrome P450 94A1-like               546   0.0      
ref|XP_010503490.1|  PREDICTED: cytochrome P450 94B3-like               545   0.0      
ref|XP_009407042.1|  PREDICTED: cytochrome P450 94B3-like               545   0.0      
ref|XP_006290939.1|  hypothetical protein CARUB_v10017052mg             544   0.0      
ref|NP_190421.1|  cytochrome P450, family 94, subfamily B, polype...    544   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426348.1|  PREDICTED: cytochrome P450 94B3                    544   0.0      
ref|XP_002877615.1|  CYP94B3                                            543   0.0      
ref|XP_010515172.1|  PREDICTED: cytochrome P450 94B3-like               543   0.0      
ref|XP_003548522.2|  PREDICTED: cytochrome P450 94A1-like               543   0.0      
gb|AAM60854.1|  cytochrome P450-like protein                            542   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBI21357.3|  unnamed protein product                                543   0.0      
ref|XP_007161734.1|  hypothetical protein PHAVU_001G094200g             541   0.0      
ref|XP_008450098.1|  PREDICTED: cytochrome P450 94B3 isoform X1         540   0.0      
ref|XP_009130252.1|  PREDICTED: cytochrome P450 94B1-like               540   0.0      
emb|CDY37921.1|  BnaA06g18960D                                          538   0.0      
ref|XP_010545953.1|  PREDICTED: cytochrome P450 94B3-like               539   0.0      
ref|NP_201150.1|  cytochrome P450, family 94, subfamily B, polype...    539   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303976.1|  PREDICTED: cytochrome P450 94A1-like               538   0.0      
ref|XP_004233587.1|  PREDICTED: cytochrome P450 94B3                    537   0.0      
dbj|BAC43161.1|  putative cytochrome P450                               537   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282257.1|  hypothetical protein CARUB_v10028534mg             535   0.0      
ref|XP_006394276.1|  hypothetical protein EUTSA_v10005707mg             533   0.0      
ref|XP_002866555.1|  hypothetical protein ARALYDRAFT_496532             532   0.0      
gb|KFK28056.1|  hypothetical protein AALP_AA8G465900                    531   1e-180   
ref|XP_009415113.1|  PREDICTED: cytochrome P450 94B3-like               531   5e-180   
ref|XP_010444242.1|  PREDICTED: cytochrome P450 94B1                    529   2e-179   
ref|XP_010460278.1|  PREDICTED: cytochrome P450 94B1-like               529   2e-179   
gb|KGN58177.1|  hypothetical protein Csa_3G585890                       528   4e-179   
ref|XP_010484081.1|  PREDICTED: cytochrome P450 94B1-like               524   1e-177   
ref|XP_009112079.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    524   2e-177   
ref|XP_003577576.1|  PREDICTED: cytochrome P450 94B3                    521   4e-176   
ref|XP_008450099.1|  PREDICTED: cytochrome P450 94B3 isoform X2         518   1e-175   
dbj|BAJ97414.1|  predicted protein                                      518   6e-175   
ref|NP_001067905.2|  Os11g0483000                                       519   1e-174   Oryza sativa Japonica Group [Japonica rice]
gb|EAY80935.1|  hypothetical protein OsI_36114                          518   1e-174   Oryza sativa Indica Group [Indian rice]
ref|NP_566155.1|  cytochrome P450, family 94, subfamily B, polype...    513   1e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404244.1|  hypothetical protein EUTSA_v10011125mg             511   8e-173   
ref|NP_001168221.1|  uncharacterized protein LOC100381980 precursor     512   1e-172   Zea mays [maize]
ref|XP_010552073.1|  PREDICTED: cytochrome P450 94B1                    511   1e-172   
gb|EPS66548.1|  hypothetical protein M569_08223                         508   2e-172   
ref|XP_008678135.1|  PREDICTED: cytochrome P450 94B3                    512   3e-172   
tpg|DAA38877.1|  TPA: putative cytochrome P450 superfamily protein      511   3e-172   
tpg|DAA38876.1|  TPA: putative cytochrome P450 superfamily protein      511   2e-171   
gb|KFK37646.1|  hypothetical protein AALP_AA3G010200                    506   3e-170   
emb|CDY70403.1|  BnaAnng33550D                                          499   3e-168   
ref|XP_006848391.1|  hypothetical protein AMTR_s00013p00215200          497   6e-167   
ref|XP_002882162.1|  CYP94B2                                            496   7e-167   
ref|XP_009124051.1|  PREDICTED: cytochrome P450 94B3                    496   1e-166   
ref|XP_004962539.1|  PREDICTED: cytochrome P450 94A2-like               496   2e-166   
emb|CDX77090.1|  BnaC04g38850D                                          495   2e-166   
ref|XP_006296783.1|  hypothetical protein CARUB_v10016004mg             484   3e-162   
emb|CDY71281.1|  BnaA06g38770D                                          483   4e-162   
gb|EAY82999.1|  hypothetical protein OsI_38222                          485   6e-162   Oryza sativa Indica Group [Indian rice]
gb|EYU45403.1|  hypothetical protein MIMGU_mgv1a006399mg                482   7e-162   
ref|NP_001066704.2|  Os12g0443000                                       484   2e-161   Oryza sativa Japonica Group [Japonica rice]
emb|CDX84409.1|  BnaC03g50910D                                          480   8e-161   
ref|XP_010436732.1|  PREDICTED: cytochrome P450 94B3-like               472   4e-157   
ref|XP_010485350.1|  PREDICTED: cytochrome P450 94B3-like               470   2e-156   
ref|XP_010496429.1|  PREDICTED: cytochrome P450 94B3-like               469   8e-156   
gb|EEE53156.1|  hypothetical protein OsJ_35982                          459   4e-152   Oryza sativa Japonica Group [Japonica rice]
emb|CDY16724.1|  BnaA09g06580D                                          457   4e-152   
gb|EEE52103.1|  hypothetical protein OsJ_33900                          457   5e-151   Oryza sativa Japonica Group [Japonica rice]
emb|CDY48144.1|  BnaCnng15860D                                          450   4e-149   
gb|EMS53696.1|  Cytochrome P450 94A1                                    448   4e-148   
gb|ADE75655.1|  unknown                                                 447   1e-146   
ref|XP_009610819.1|  PREDICTED: cytochrome P450 94A1-like               441   7e-145   
ref|XP_009763713.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    439   2e-144   
gb|AAL54884.1|AF092913_1  cytochrome P450-dependent fatty acid hy...    438   5e-144   Nicotiana tabacum [American tobacco]
ref|XP_007050381.1|  Cytochrome P450 94A1                               436   3e-143   
ref|XP_006838838.1|  hypothetical protein AMTR_s00002p00263780          434   8e-143   
ref|XP_010246279.1|  PREDICTED: cytochrome P450 94A2-like               433   6e-142   
ref|XP_006383694.1|  cytochrome P450 CYP94A1 family protein             432   1e-141   
ref|XP_010246280.1|  PREDICTED: cytochrome P450 94A2-like               432   1e-141   
ref|XP_006383696.1|  cytochrome P450 CYP94A1 family protein             429   2e-140   
ref|XP_009414555.1|  PREDICTED: cytochrome P450 94C1-like               429   3e-140   
ref|XP_008364314.1|  PREDICTED: cytochrome P450 94A1-like               428   5e-140   
gb|AAZ39645.1|  cytochrome P450 monooxygenase                           427   1e-139   Petunia x hybrida [garden petunia]
ref|XP_009354911.1|  PREDICTED: cytochrome P450 94A1-like               426   2e-139   
ref|XP_002300789.2|  cytochrome P450 CYP94A1 family protein             426   5e-139   Populus trichocarpa [western balsam poplar]
gb|AJD25218.1|  cytochrome P450 CYP94A48                                425   7e-139   
ref|XP_006366194.1|  PREDICTED: cytochrome P450 94A1-like               424   1e-138   
ref|XP_002282477.2|  PREDICTED: cytochrome P450 94A1-like               426   2e-138   Vitis vinifera
ref|XP_011026019.1|  PREDICTED: cytochrome P450 94A1-like               423   3e-138   
ref|XP_002282468.1|  PREDICTED: cytochrome P450 94A1                    423   3e-138   Vitis vinifera
ref|XP_010111213.1|  Cytochrome P450 94A1                               423   4e-138   
emb|CAN75729.1|  hypothetical protein VITISV_031409                     422   7e-138   Vitis vinifera
ref|XP_004242690.1|  PREDICTED: cytochrome P450 94A1-like               421   1e-137   
ref|XP_002278009.1|  PREDICTED: cytochrome P450 94A1                    421   2e-137   Vitis vinifera
ref|XP_002322606.2|  hypothetical protein POPTR_0016s03160g             421   2e-137   Populus trichocarpa [western balsam poplar]
ref|XP_011041380.1|  PREDICTED: cytochrome P450 94A1-like               421   2e-137   
ref|XP_008235727.1|  PREDICTED: cytochrome P450 94A1-like               421   2e-137   
gb|AAL54885.1|AF092914_1  cytochrome P450-dependent fatty acid hy...    421   4e-137   Vicia sativa [spring vetch]
ref|XP_004170788.1|  PREDICTED: cytochrome P450 94A2-like               420   5e-137   
ref|XP_010247228.1|  PREDICTED: cytochrome P450 94B3-like               421   7e-137   
ref|XP_007199792.1|  hypothetical protein PRUPE_ppa004444mg             420   8e-137   
ref|XP_010038019.1|  PREDICTED: cytochrome P450 94A1-like               420   9e-137   
emb|CDP03714.1|  unnamed protein product                                419   1e-136   
ref|XP_006373690.1|  cytochrome P450 family protein                     419   1e-136   
ref|XP_002264897.1|  PREDICTED: cytochrome P450 94C1                    419   2e-136   Vitis vinifera
ref|XP_011070085.1|  PREDICTED: cytochrome P450 94A1                    419   2e-136   
emb|CDP03713.1|  unnamed protein product                                418   4e-136   
ref|XP_011028759.1|  PREDICTED: cytochrome P450 94A1-like               418   6e-136   
ref|XP_009377719.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    417   7e-136   
ref|XP_008447772.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    417   8e-136   
gb|KDP21346.1|  hypothetical protein JCGZ_21817                         417   9e-136   
gb|EPS72518.1|  hypothetical protein M569_02237                         417   1e-135   
ref|XP_010247227.1|  PREDICTED: cytochrome P450 94B3                    416   1e-135   
ref|XP_008235725.1|  PREDICTED: cytochrome P450 94A1-like               416   2e-135   
ref|XP_002521002.1|  cytochrome P450, putative                          416   2e-135   Ricinus communis
ref|XP_004247227.1|  PREDICTED: cytochrome P450 94A1-like               415   4e-135   
ref|XP_011024239.1|  PREDICTED: cytochrome P450 94C1-like               415   5e-135   
ref|XP_010039240.1|  PREDICTED: cytochrome P450 94A1-like               415   6e-135   
emb|CDY56777.1|  BnaAnng14430D                                          414   7e-135   
ref|XP_010278943.1|  PREDICTED: cytochrome P450 94A2-like               415   7e-135   
ref|XP_004493756.1|  PREDICTED: cytochrome P450 94A1-like               415   8e-135   
ref|XP_003553484.1|  PREDICTED: cytochrome P450 94A1-like               415   8e-135   
dbj|BAO45862.1|  cytochrome P450 94A1                                   414   1e-134   
ref|XP_010679201.1|  PREDICTED: cytochrome P450 94A1-like               415   1e-134   
ref|XP_010271731.1|  PREDICTED: cytochrome P450 94C1-like               414   1e-134   
emb|CDP03715.1|  unnamed protein product                                414   1e-134   
ref|XP_009377720.1|  PREDICTED: cytochrome P450 94A1-like isoform X2    414   1e-134   
ref|XP_009367721.1|  PREDICTED: cytochrome P450 94A1-like               414   2e-134   
gb|KEH23874.1|  cytochrome P450 family 94 protein                       414   2e-134   
ref|XP_002521004.1|  cytochrome P450, putative                          413   3e-134   Ricinus communis
gb|AJD25219.1|  cytochrome P450 CYP94A49                                413   3e-134   
ref|XP_011080016.1|  PREDICTED: cytochrome P450 94A2-like               413   3e-134   
ref|XP_009620147.1|  PREDICTED: cytochrome P450 94A2-like               413   3e-134   
ref|XP_006351638.1|  PREDICTED: cytochrome P450 94A2-like               412   4e-134   
ref|XP_009377718.1|  PREDICTED: cytochrome P450 94A1-like               412   5e-134   
ref|XP_004249120.1|  PREDICTED: cytochrome P450 94A2 isoform X1         412   6e-134   
emb|CDX72120.1|  BnaC08g27540D                                          411   1e-133   
gb|AED99869.1|  cytochrome P450                                         411   1e-133   
ref|XP_007200096.1|  hypothetical protein PRUPE_ppa019319mg             410   3e-133   
ref|XP_007162510.1|  hypothetical protein PHAVU_001G157900g             410   3e-133   
gb|EPS62279.1|  hypothetical protein M569_12509                         410   4e-133   
ref|XP_010938845.1|  PREDICTED: cytochrome P450 94B3-like               410   4e-133   
gb|AJD25221.1|  cytochrome P450 CYP94C54                                409   5e-133   
emb|CDY32022.1|  BnaC06g16000D                                          409   5e-133   
ref|XP_010906405.1|  PREDICTED: cytochrome P450 94A1                    410   6e-133   
ref|XP_010679199.1|  PREDICTED: cytochrome P450 94A2-like               410   6e-133   
ref|XP_007200970.1|  hypothetical protein PRUPE_ppa004449mg             410   6e-133   
ref|XP_006364779.1|  PREDICTED: cytochrome P450 94A2-like               409   6e-133   
ref|XP_011088865.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    409   8e-133   
ref|XP_003606223.1|  Cytochrome P450 94A1                               409   2e-132   
ref|XP_011094380.1|  PREDICTED: cytochrome P450 94C1-like               408   2e-132   
ref|XP_009781600.1|  PREDICTED: cytochrome P450 94A2-like               409   2e-132   
gb|EPS65724.1|  hypothetical protein M569_09053                         407   2e-132   
ref|XP_009594945.1|  PREDICTED: cytochrome P450 94A2-like               408   2e-132   
ref|XP_007015870.1|  Cytochrome P450 94A1                               408   3e-132   
ref|XP_002988642.1|  medium chain fatty acid hydroxylase                407   3e-132   
gb|KFK35660.1|  cytochrome p450                                         407   4e-132   
ref|XP_011087220.1|  PREDICTED: cytochrome P450 94A2-like               407   4e-132   
ref|XP_008801229.1|  PREDICTED: cytochrome P450 94C1                    408   5e-132   
ref|XP_003520587.1|  PREDICTED: cytochrome P450 94A1-like               407   5e-132   
ref|XP_009790300.1|  PREDICTED: cytochrome P450 94A2                    407   5e-132   
gb|KHN12182.1|  Cytochrome P450 94A1                                    407   5e-132   
ref|XP_006577067.1|  PREDICTED: cytochrome P450 94A1-like               408   6e-132   
ref|XP_010247156.1|  PREDICTED: cytochrome P450 94B3-like               407   7e-132   
ref|XP_002979339.1|  medium chain fatty acid hydroxylase                405   7e-132   
ref|XP_004506151.1|  PREDICTED: cytochrome P450 94A1-like               407   8e-132   
ref|XP_004249121.2|  PREDICTED: cytochrome P450 94A2 isoform X2         406   9e-132   
ref|XP_010516270.1|  PREDICTED: cytochrome P450 94B3-like               406   9e-132   
gb|EPS70135.1|  hypothetical protein M569_04626                         406   1e-131   
ref|XP_010906406.1|  PREDICTED: cytochrome P450 94B3-like               406   1e-131   
ref|XP_003521105.1|  PREDICTED: cytochrome P450 94A1                    405   2e-131   
gb|AAL54886.1|AF092915_1  cytochrome P450-dependent fatty acid hy...    406   2e-131   Nicotiana tabacum [American tobacco]
gb|EAZ13864.1|  hypothetical protein OsJ_03787                          406   2e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002964775.1|  medium chain fatty acid hydroxylase                405   2e-131   
ref|XP_002893825.1|  CYP94D1                                            405   3e-131   
gb|EAY76183.1|  hypothetical protein OsI_04116                          405   3e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_008382925.1|  PREDICTED: cytochrome P450 94A1-like               407   3e-131   
ref|XP_011077931.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    405   3e-131   
ref|XP_004289914.1|  PREDICTED: cytochrome P450 94A1-like               405   4e-131   
emb|CDP06950.1|  unnamed protein product                                405   4e-131   
ref|NP_191222.1|  cytochrome P450, family 94, subfamily D, polype...    405   4e-131   Arabidopsis thaliana [mouse-ear cress]
gb|AAN05337.1|  Putative cytochrome P450                                405   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010055620.1|  PREDICTED: cytochrome P450 94A2-like               405   5e-131   
ref|XP_010525434.1|  PREDICTED: cytochrome P450 94B3                    405   5e-131   
dbj|BAB92256.1|  putative cytochrome P450-dependent fatty acid hy...    405   5e-131   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK08034.1|  predicted protein                                      405   5e-131   
ref|XP_007132406.1|  hypothetical protein PHAVU_011G092100g             404   5e-131   
ref|XP_008788557.1|  PREDICTED: cytochrome P450 94A1                    404   5e-131   
ref|XP_009615866.1|  PREDICTED: cytochrome P450 94A2-like               405   6e-131   
ref|XP_002876375.1|  CYP94D2                                            404   6e-131   
ref|XP_002277129.2|  PREDICTED: cytochrome P450 94C1                    404   7e-131   Vitis vinifera
ref|NP_001049423.1|  Os03g0223100                                       405   7e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009774133.1|  PREDICTED: cytochrome P450 94C1-like               404   7e-131   
ref|NP_001172609.1|  Os01g0803900                                       405   7e-131   
ref|XP_002961706.1|  hypothetical protein SELMODRAFT_76541              404   8e-131   
ref|XP_002979336.1|  hypothetical protein SELMODRAFT_110688             404   8e-131   
ref|XP_010055610.1|  PREDICTED: cytochrome P450 94A2                    404   8e-131   
ref|XP_010679200.1|  PREDICTED: cytochrome P450 94A1-like               405   9e-131   
ref|XP_002315447.2|  hypothetical protein POPTR_0010s24310g             404   1e-130   Populus trichocarpa [western balsam poplar]
gb|ABC59092.1|  cytochrome P450 monooxygenase CYP94A14                  404   1e-130   Medicago truncatula
sp|O81117.2|C94A1_VICSA  RecName: Full=Cytochrome P450 94A1; AltN...    404   2e-130   Vicia sativa [spring vetch]
ref|XP_009104013.1|  PREDICTED: cytochrome P450 94B3-like               403   2e-130   
ref|XP_009589328.1|  PREDICTED: cytochrome P450 94C1-like               403   2e-130   
ref|XP_009412188.1|  PREDICTED: cytochrome P450 94A1-like               404   2e-130   
ref|XP_006644864.1|  PREDICTED: cytochrome P450 94A1-like               403   3e-130   
ref|XP_006471356.1|  PREDICTED: cytochrome P450 94A1-like               403   3e-130   
ref|XP_007162512.1|  hypothetical protein PHAVU_001G158100g             403   3e-130   
ref|XP_006430501.1|  hypothetical protein CICLE_v10011533mg             403   3e-130   
gb|EAY76187.1|  hypothetical protein OsI_04120                          403   3e-130   
ref|XP_009393106.1|  PREDICTED: cytochrome P450 94A1-like               403   3e-130   
ref|XP_008652957.1|  PREDICTED: cytochrome P450 94B3-like               402   5e-130   
ref|XP_009588047.1|  PREDICTED: cytochrome P450 94C1-like               402   5e-130   
ref|XP_009766870.1|  PREDICTED: cytochrome P450 94C1-like               401   6e-130   
emb|CAN67559.1|  hypothetical protein VITISV_002257                     402   6e-130   
ref|XP_006592314.1|  PREDICTED: cytochrome P450 94A1-like               402   7e-130   
gb|ABK28430.1|  unknown                                                 401   7e-130   
ref|XP_006482030.1|  PREDICTED: cytochrome P450 94A1-like               402   7e-130   
ref|XP_006424280.1|  hypothetical protein CICLE_v10028253mg             401   9e-130   
gb|KDO51311.1|  hypothetical protein CISIN_1g040199mg                   401   9e-130   
ref|XP_006471355.1|  PREDICTED: cytochrome P450 94A1-like               401   1e-129   
gb|EAY76557.1|  hypothetical protein OsI_04502                          402   1e-129   
ref|NP_001172660.1|  Os01g0858350                                       402   1e-129   
emb|CDP15392.1|  unnamed protein product                                400   1e-129   
ref|XP_010039015.1|  PREDICTED: cytochrome P450 94A2-like               401   1e-129   
ref|XP_004299232.1|  PREDICTED: cytochrome P450 94A1-like               400   2e-129   
ref|XP_006402968.1|  hypothetical protein EUTSA_v10005910mg             400   2e-129   
emb|CDX67652.1|  BnaA07g16920D                                          400   2e-129   
ref|XP_007209920.1|  hypothetical protein PRUPE_ppa004467mg             400   2e-129   
ref|XP_011028760.1|  PREDICTED: cytochrome P450 94A2-like               400   2e-129   
gb|KDP42721.1|  hypothetical protein JCGZ_23661                         400   3e-129   
ref|XP_002529058.1|  cytochrome P450, putative                          400   3e-129   
ref|XP_007010240.1|  Cytochrome P450                                    400   3e-129   
ref|XP_009610631.1|  PREDICTED: cytochrome P450 94A2                    400   3e-129   
ref|XP_007145327.1|  hypothetical protein PHAVU_007G229700g             400   4e-129   
ref|XP_010089862.1|  Cytochrome P450 94A1                               399   4e-129   
ref|NP_174713.1|  cytochrome P450, family 94, subfamily D, polype...    399   4e-129   
ref|XP_006577700.1|  PREDICTED: cytochrome P450 94A1-like               402   4e-129   
ref|XP_008810187.1|  PREDICTED: cytochrome P450 94A1-like               400   5e-129   
emb|CDJ26544.1|  unnamed protein product                                400   5e-129   
ref|XP_010232583.1|  PREDICTED: cytochrome P450 94C1                    400   7e-129   
gb|KHN10717.1|  Cytochrome P450 94A1                                    396   7e-129   
dbj|BAJ91842.1|  predicted protein                                      400   8e-129   
emb|CDM80095.1|  unnamed protein product                                400   9e-129   
ref|XP_007162039.1|  hypothetical protein PHAVU_001G118600g             400   9e-129   
dbj|BAJ91452.1|  predicted protein                                      400   1e-128   
ref|XP_008443231.1|  PREDICTED: cytochrome P450 94A1-like               399   1e-128   
ref|XP_007162882.1|  hypothetical protein PHAVU_001G188500g             399   1e-128   
ref|XP_010097640.1|  Cytochrome P450 94A1                               399   1e-128   
ref|XP_003538134.1|  PREDICTED: cytochrome P450 94A2-like               399   1e-128   
ref|XP_006482029.1|  PREDICTED: cytochrome P450 94A1-like               398   1e-128   
ref|XP_008788555.1|  PREDICTED: cytochrome P450 94A2-like               398   1e-128   
ref|XP_003596778.1|  Cytochrome P450                                    398   1e-128   
dbj|BAK06748.1|  predicted protein                                      400   1e-128   
ref|XP_004495122.1|  PREDICTED: cytochrome P450 94A2-like               399   2e-128   
dbj|BAJ89814.1|  predicted protein                                      399   2e-128   
ref|XP_009366644.1|  PREDICTED: cytochrome P450 94C1-like               398   2e-128   
ref|XP_004291623.1|  PREDICTED: cytochrome P450 94A1-like               398   2e-128   
ref|XP_009116365.1|  PREDICTED: cytochrome P450 94B3                    398   2e-128   
ref|XP_010907146.1|  PREDICTED: cytochrome P450 94C1-like               398   2e-128   
gb|KHN18751.1|  Cytochrome P450 94A1                                    401   2e-128   
gb|KEH42592.1|  cytochrome P450 family-dependent fatty acid hydro...    398   3e-128   
gb|KEH23872.1|  cytochrome P450 family 94 protein                       397   3e-128   
ref|XP_007010545.1|  Cytochrome P450, putative                          397   3e-128   
ref|XP_008244020.1|  PREDICTED: cytochrome P450 94A1-like               397   3e-128   
gb|KEH42061.1|  cytochrome P450 family 94 protein                       397   5e-128   
gb|AHF22085.1|  CYP94A43                                                397   5e-128   
ref|XP_002307954.2|  putative cytochrome P450 family protein            397   5e-128   
ref|XP_003564422.1|  PREDICTED: cytochrome P450 94B3                    397   6e-128   
gb|KDP21345.1|  hypothetical protein JCGZ_21816                         397   6e-128   
ref|XP_010232465.1|  PREDICTED: cytochrome P450 94B3-like               397   6e-128   
gb|AJD25223.1|  cytochrome P450 CYP94D47                                396   7e-128   
ref|XP_006644862.1|  PREDICTED: cytochrome P450 94A1-like               397   7e-128   
ref|XP_011040725.1|  PREDICTED: cytochrome P450 94A1                    396   8e-128   
ref|XP_010034212.1|  PREDICTED: cytochrome P450 94C1-like               397   8e-128   
ref|XP_010673087.1|  PREDICTED: cytochrome P450 94A2-like               397   8e-128   
ref|XP_010510742.1|  PREDICTED: cytochrome P450 94C1-like               396   9e-128   
dbj|BAK07606.1|  predicted protein                                      399   1e-127   
ref|XP_007027680.1|  Cytochrome P450 94A1                               397   1e-127   
ref|XP_006644863.1|  PREDICTED: cytochrome P450 94A1-like               397   1e-127   
ref|XP_010557399.1|  PREDICTED: cytochrome P450 94C1-like               395   1e-127   
ref|XP_009383319.1|  PREDICTED: cytochrome P450 94B3-like               396   1e-127   
ref|XP_004167155.1|  PREDICTED: cytochrome P450 94A1-like               396   1e-127   
ref|XP_004970286.1|  PREDICTED: cytochrome P450 94A1-like               396   2e-127   
ref|XP_009374745.1|  PREDICTED: cytochrome P450 94C1-like               395   2e-127   
ref|XP_004970645.1|  PREDICTED: cytochrome P450 94A1-like               396   2e-127   
ref|XP_006644861.1|  PREDICTED: cytochrome P450 94A1-like               395   3e-127   
emb|CDP06233.1|  unnamed protein product                                395   3e-127   
ref|XP_006645049.1|  PREDICTED: cytochrome P450 94A1-like               395   3e-127   
ref|XP_006341238.1|  PREDICTED: cytochrome P450 94A1-like               394   3e-127   
ref|XP_004136768.1|  PREDICTED: cytochrome P450 94A1-like               395   4e-127   
emb|CDX67653.1|  BnaA07g16930D                                          394   4e-127   
ref|XP_006430255.1|  hypothetical protein CICLE_v10013425mg             393   4e-127   
ref|XP_007203184.1|  hypothetical protein PRUPE_ppa025166mg             394   4e-127   
ref|XP_008391766.1|  PREDICTED: cytochrome P450 94C1-like               395   4e-127   
ref|XP_010100076.1|  Cytochrome P450 94A1                               417   5e-127   
tpg|DAA44138.1|  TPA: putative cytochrome P450 superfamily protein      395   5e-127   
ref|XP_003624855.1|  Cytochrome P450                                    394   6e-127   
ref|XP_006424281.1|  hypothetical protein CICLE_v10028254mg             394   6e-127   
ref|XP_009388367.1|  PREDICTED: cytochrome P450 94C1-like               394   7e-127   
gb|EYU36964.1|  hypothetical protein MIMGU_mgv1a023150mg                393   7e-127   
ref|XP_002533544.1|  cytochrome P450, putative                          394   8e-127   
gb|AFW85651.1|  putative cytochrome P450 superfamily protein            394   9e-127   
emb|CDY32023.1|  BnaC06g16010D                                          393   1e-126   
ref|XP_004487513.1|  PREDICTED: cytochrome P450 94A1-like               393   1e-126   
ref|XP_004301073.1|  PREDICTED: cytochrome P450 94A1-like               393   1e-126   
ref|XP_010111205.1|  Cytochrome P450 94A2                               393   1e-126   
ref|XP_010932013.1|  PREDICTED: cytochrome P450 94C1-like               393   1e-126   
ref|XP_010247229.1|  PREDICTED: cytochrome P450 94B3-like               393   1e-126   
dbj|BAJ90714.1|  predicted protein                                      394   1e-126   
ref|XP_010504571.1|  PREDICTED: cytochrome P450 94B3-like               393   1e-126   
gb|KHN10718.1|  Cytochrome P450 94A1                                    390   2e-126   
ref|XP_002319770.2|  hypothetical protein POPTR_0013s07310g             393   2e-126   
gb|ACG47870.1|  cytochrome P450 CYP94D27                                393   2e-126   
ref|XP_002979685.1|  medium chain fatty acid hydroxylase                392   3e-126   
ref|XP_002439815.1|  hypothetical protein SORBIDRAFT_09g020650          392   4e-126   
ref|XP_006341239.1|  PREDICTED: cytochrome P450 94A1-like               396   4e-126   
ref|XP_006347236.1|  PREDICTED: cytochrome P450 94A1-like               391   4e-126   
ref|XP_009411963.1|  PREDICTED: cytochrome P450 94C1-like               392   5e-126   
dbj|BAB92258.1|  putative cytochrome P450-dependent fatty acid hy...    392   5e-126   
ref|XP_010541286.1|  PREDICTED: cytochrome P450 94C1-like               391   5e-126   
ref|XP_003577084.2|  PREDICTED: cytochrome P450 94B3-like               392   5e-126   
ref|XP_002465625.1|  hypothetical protein SORBIDRAFT_01g042470          392   6e-126   
ref|XP_008461642.1|  PREDICTED: cytochrome P450 94C1                    392   6e-126   
ref|XP_009386731.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    392   6e-126   
ref|XP_004249445.1|  PREDICTED: cytochrome P450 94C1-like               391   7e-126   
ref|XP_011005435.1|  PREDICTED: cytochrome P450 94C1-like               392   8e-126   
ref|XP_002985393.1|  hypothetical protein SELMODRAFT_122098             391   8e-126   
gb|EMT25753.1|  Cytochrome P450 94A1                                    399   9e-126   
ref|NP_180337.1|  cytochrome P450, family 94, subfamily C, polype...    390   1e-125   
ref|XP_008790927.1|  PREDICTED: cytochrome P450 94C1-like               391   1e-125   
ref|XP_010244250.1|  PREDICTED: cytochrome P450 94C1                    390   2e-125   
ref|XP_009794142.1|  PREDICTED: cytochrome P450 94A2-like               391   2e-125   
ref|XP_006290956.1|  hypothetical protein CARUB_v10017072mg             389   3e-125   
ref|XP_002519477.1|  cytochrome P450, putative                          389   4e-125   
ref|XP_009338906.1|  PREDICTED: cytochrome P450 94C1-like               390   4e-125   
ref|XP_002468241.1|  hypothetical protein SORBIDRAFT_01g042310          390   4e-125   
ref|XP_008241266.1|  PREDICTED: cytochrome P450 94C1-like               389   4e-125   
gb|AFW78139.1|  putative cytochrome P450 superfamily protein            390   4e-125   
ref|XP_004985159.1|  PREDICTED: cytochrome P450 94A1-like               390   5e-125   
ref|XP_008790365.1|  PREDICTED: cytochrome P450 94A1-like               389   5e-125   
ref|XP_008376983.1|  PREDICTED: cytochrome P450 94C1-like               390   5e-125   
ref|XP_006361761.1|  PREDICTED: cytochrome P450 94A2-like               389   6e-125   
ref|XP_009800093.1|  PREDICTED: cytochrome P450 94C1-like               389   7e-125   
ref|XP_010473161.1|  PREDICTED: cytochrome P450 94C1                    388   8e-125   
ref|XP_003558468.1|  PREDICTED: cytochrome P450 94B3-like               389   9e-125   
ref|XP_009414947.1|  PREDICTED: cytochrome P450 94C1-like               388   1e-124   
ref|XP_002458797.1|  hypothetical protein SORBIDRAFT_03g040440          389   1e-124   
ref|XP_006430254.1|  hypothetical protein CICLE_v10013407mg             387   2e-124   
ref|XP_008784226.1|  PREDICTED: cytochrome P450 94C1-like               388   2e-124   
ref|XP_008371286.1|  PREDICTED: cytochrome P450 94C1-like               388   2e-124   
ref|XP_006481811.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    388   2e-124   
ref|XP_009104014.1|  PREDICTED: cytochrome P450 94B3-like               387   2e-124   
ref|XP_009103613.1|  PREDICTED: cytochrome P450 94C1                    387   2e-124   
ref|XP_006481880.1|  PREDICTED: cytochrome P450 94A1-like               387   2e-124   
ref|XP_010912256.1|  PREDICTED: cytochrome P450 94C1-like               387   2e-124   
gb|KCW87400.1|  hypothetical protein EUGRSUZ_B03878                     387   2e-124   
ref|XP_004139575.1|  PREDICTED: cytochrome P450 94A1-like               387   3e-124   
gb|KGN64915.1|  hypothetical protein Csa_1G154090                       388   3e-124   
ref|XP_009393377.1|  PREDICTED: cytochrome P450 94C1-like               388   3e-124   
ref|XP_008657035.1|  PREDICTED: cytochrome P450 94C1-like               389   3e-124   
ref|XP_010322431.1|  PREDICTED: cytochrome P450 94C1                    386   5e-124   
ref|XP_009348573.1|  PREDICTED: cytochrome P450 94C1-like               387   5e-124   
ref|XP_004250943.1|  PREDICTED: cytochrome P450 94A2-like               387   6e-124   
ref|XP_004305353.1|  PREDICTED: cytochrome P450 94A1-like               386   6e-124   
gb|KHN48177.1|  Cytochrome P450 94A1                                    386   6e-124   
ref|XP_006646412.1|  PREDICTED: cytochrome P450 94A1-like               387   7e-124   
dbj|BAJ87982.1|  predicted protein                                      387   7e-124   
dbj|BAJ88840.1|  predicted protein                                      387   8e-124   
ref|XP_004985158.1|  PREDICTED: cytochrome P450 94A2-like               387   1e-123   
ref|XP_011046266.1|  PREDICTED: cytochrome P450 94C1-like               385   1e-123   
ref|XP_010049665.1|  PREDICTED: cytochrome P450 94C1-like               385   2e-123   
ref|XP_003542412.1|  PREDICTED: cytochrome P450 94A2-like               385   2e-123   
ref|XP_003541451.1|  PREDICTED: cytochrome P450 94A1-like               386   2e-123   
ref|XP_010045242.1|  PREDICTED: cytochrome P450 94C1-like               385   2e-123   
ref|XP_006294094.1|  hypothetical protein CARUB_v10023087mg             385   2e-123   
ref|XP_010651498.1|  PREDICTED: cytochrome P450 94A1-like               386   2e-123   
ref|XP_009364325.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    389   2e-123   
ref|XP_007205046.1|  hypothetical protein PRUPE_ppa004592mg             385   2e-123   
emb|CDX71432.1|  BnaC04g16670D                                          384   3e-123   
ref|NP_001044554.1|  Os01g0804400                                       385   3e-123   
ref|XP_002439880.1|  hypothetical protein SORBIDRAFT_09g021890          385   4e-123   
ref|XP_004149216.1|  PREDICTED: cytochrome P450 94A1-like               384   4e-123   
ref|XP_006384629.1|  cytochrome P450 family protein                     384   4e-123   
ref|XP_009403729.1|  PREDICTED: cytochrome P450 94C1-like               384   5e-123   
emb|CDY04506.1|  BnaA07g13320D                                          384   5e-123   
sp|P98188.1|C94A2_VICSA  RecName: Full=Cytochrome P450 94A2; AltN...    384   6e-123   
ref|XP_008228870.1|  PREDICTED: cytochrome P450 94C1                    384   6e-123   
ref|XP_002880978.1|  CYP94C1                                            384   6e-123   
gb|KGN59117.1|  hypothetical protein Csa_3G775300                       384   7e-123   
ref|XP_008443586.1|  PREDICTED: cytochrome P450 94C1-like               383   7e-123   
ref|XP_010658738.1|  PREDICTED: cytochrome P450 94C1-like               384   7e-123   
ref|XP_006361448.1|  PREDICTED: cytochrome P450 94A1-like               384   8e-123   
ref|XP_009338687.1|  PREDICTED: cytochrome P450 94C1-like               386   9e-123   
ref|XP_004970288.1|  PREDICTED: cytochrome P450 94A1-like               384   2e-122   
ref|XP_002300790.2|  hypothetical protein POPTR_0002s04340g             379   2e-122   
ref|XP_010673086.1|  PREDICTED: cytochrome P450 94A1-like               383   2e-122   
ref|XP_010067149.1|  PREDICTED: cytochrome P450 94C1-like               382   2e-122   
ref|XP_004980146.1|  PREDICTED: cytochrome P450 94A1-like               382   3e-122   
gb|EAY98229.1|  hypothetical protein OsI_20140                          382   4e-122   
ref|XP_010111207.1|  Cytochrome P450 94A1                               387   7e-122   
emb|CBI30267.3|  unnamed protein product                                382   7e-122   
gb|EYU35153.1|  hypothetical protein MIMGU_mgv1a026773mg                381   1e-121   
ref|XP_002312905.2|  cytochrome P450 family protein                     380   1e-121   
ref|XP_010935094.1|  PREDICTED: cytochrome P450 94A1-like               379   3e-121   
ref|XP_011044868.1|  PREDICTED: cytochrome P450 94C1-like               379   5e-121   
ref|XP_009618179.1|  PREDICTED: cytochrome P450 94C1-like               379   5e-121   
gb|KHN40957.1|  Cytochrome P450 94A1                                    373   6e-121   
ref|XP_007144717.1|  hypothetical protein PHAVU_007G179000g             379   7e-121   
ref|NP_001055681.1|  Os05g0445100                                       379   1e-120   
ref|XP_009789882.1|  PREDICTED: cytochrome P450 94C1-like               377   1e-120   
ref|XP_008813428.1|  PREDICTED: cytochrome P450 94A1-like               379   1e-120   
emb|CAN66874.1|  hypothetical protein VITISV_021428                     383   1e-120   
ref|XP_004977485.1|  PREDICTED: cytochrome P450 94A1-like               378   2e-120   
ref|XP_010521668.1|  PREDICTED: cytochrome P450 94C1-like               377   2e-120   
dbj|BAJ94069.1|  predicted protein                                      378   2e-120   
ref|XP_008808400.1|  PREDICTED: cytochrome P450 94A1-like               377   2e-120   
emb|CBX25250.1|  hypothetical_protein                                   377   4e-120   
ref|XP_006409751.1|  hypothetical protein EUTSA_v10016556mg             376   5e-120   
ref|XP_009401100.1|  PREDICTED: cytochrome P450 94C1-like               375   9e-120   
gb|KCW84705.1|  hypothetical protein EUGRSUZ_B01524                     374   1e-119   
ref|XP_008393292.1|  PREDICTED: cytochrome P450 94A2-like               376   1e-119   
ref|XP_006654479.1|  PREDICTED: cytochrome P450 94A2-like               375   2e-119   
emb|CBX25324.1|  hypothetical_protein                                   375   2e-119   
ref|NP_001065766.1|  Os11g0151400                                       374   5e-119   
gb|EMT02614.1|  Cytochrome P450 94A1                                    374   5e-119   
ref|XP_003577893.2|  PREDICTED: cytochrome P450 94C1-like               374   8e-119   



>ref|XP_007037964.1| Cytochrome P450 94A2 [Theobroma cacao]
 gb|EOY22465.1| Cytochrome P450 94A2 [Theobroma cacao]
Length=508

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/482 (66%), Positives = 370/482 (77%), Gaps = 9/482 (2%)
 Frame = -1

Query  1597  FHTEHHKK-LIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRT  1421
              H+ + KK +  + P SYP +GCL+SFYKNR  LLDWYT LL+ SP++TIVV RLGA RT
Sbjct  26    LHSFYAKKSVFAHGPSSYPFLGCLISFYKNRRRLLDWYTDLLSESPSQTIVVRRLGARRT  85

Query  1420  VVTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTAR  1241
             VVTA+  NVEYMLK NF NFPKG+P  +ILGD LG GIFNVDG+LWS QRKLASHEF+ +
Sbjct  86    VVTANPANVEYMLKTNFNNFPKGKPFTEILGDLLGCGIFNVDGELWSTQRKLASHEFSTK  145

Query  1240  SLRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclss  1061
             SLRE V+KTL+EEV+ RL PLL+ A  +  VLDLQDVLRRFAFDTICK+       C   
Sbjct  146   SLREFVVKTLQEEVENRLLPLLQEAMESEKVLDLQDVLRRFAFDTICKV-SLGHDPCCLD  204

Query  1060  sdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEII  881
                    LV AFD ASEISA RGMAP+F VWK KRA N+GSEKKL+E IK+V D V EII
Sbjct  205   LSKPVPPLVKAFDIASEISAMRGMAPMFVVWKIKRALNIGSEKKLKEAIKLVQDCVLEII  264

Query  880   RVRKQE-KANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLL  704
             R +K+  +A         D LSRLL AGH +EVVRDMVISF++AGRDTTSSA++W FWLL
Sbjct  265   RNKKRALEAETKCCDDAEDLLSRLLSAGHDEEVVRDMVISFIMAGRDTTSSAMSWLFWLL  324

Query  703   SKHPNIETTVIKQVLS--SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAAND  530
             SKH N +  ++K+V S   + +K LNF+ L+EMN +KACLCESMRLYPPVAWDSKHA ND
Sbjct  325   SKHQNAQNMIVKEVESMLCNGEKELNFEVLKEMNCVKACLCESMRLYPPVAWDSKHALND  384

Query  529   DVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD----EQGKLKMISPFKF  362
             DVLPDGT + +G+RVT+ PY MGRME LWG D  EFKPDRWF     E G LK +SPFKF
Sbjct  385   DVLPDGTFVEKGDRVTYFPYGMGRMEELWGKDRFEFKPDRWFQESDAENGLLKSVSPFKF  444

Query  361   PVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVH  182
             PVFQAGPRVCLGKEMAFIQMK+VVASILRRFEIRPVC+ QPVFVPLLT +MA GL V V 
Sbjct  445   PVFQAGPRVCLGKEMAFIQMKYVVASILRRFEIRPVCQEQPVFVPLLTAHMAGGLNVLVR  504

Query  181   MR  176
              R
Sbjct  505   RR  506



>ref|XP_002279981.1| PREDICTED: cytochrome P450 94B3-like [Vitis vinifera]
Length=512

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/484 (64%), Positives = 372/484 (77%), Gaps = 7/484 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
             F     KK   + PPSYP IGCL+SFY+NR  LL+WYT LL+ SP++TIVVHRLGA RTV
Sbjct  30    FEHAFKKKACRFGPPSYPFIGCLVSFYQNRRRLLEWYTDLLSESPSQTIVVHRLGARRTV  89

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+A NVEY+LK NF NFPKG+P  +ILGD LG GIFNVDGDLWS+QRKLASHEF+ +S
Sbjct  90    VTANAANVEYVLKTNFSNFPKGKPFTEILGDLLGFGIFNVDGDLWSSQRKLASHEFSTKS  149

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRE VM+ LEEEV+GRL PLLE+A   + VLDLQDVLRRFAF+T+CK+       C    
Sbjct  150   LREFVMRILEEEVEGRLLPLLESAMEKNEVLDLQDVLRRFAFETVCKV-SLGVDPCCLDL  208

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   LV AFD+ASEI A RGMAPV+AVWK KRAFNVGSE+KL+E +++VH  V EII+
Sbjct  209   SRPVPPLVRAFDRASEICAMRGMAPVYAVWKMKRAFNVGSERKLKESVQLVHSSVREIIQ  268

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +K++   + A G G D L+ LL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLS+
Sbjct  269   NKKRKLEEDRAEGDGGDLLTSLLSAGHGEEVVRDMVISFIMAGRDTTSAAMTWLFWLLSQ  328

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             HP IE+ ++  V  S  +  L+F+ L+EMN++KACLCESMRLYPPV WDSKHAA DD LP
Sbjct  329   HPPIESAIVAHV-DSLYRNPLDFETLKEMNFVKACLCESMRLYPPVVWDSKHAAADDTLP  387

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-----QGKLKMISPFKFPVF  353
             DGT +  G+RVT+ PY MGRME+LWG D  EF+PDRW +E      G LK +SP+KFPVF
Sbjct  388   DGTALREGDRVTYFPYGMGRMEHLWGKDRFEFRPDRWLEEPEADGGGPLKAVSPYKFPVF  447

Query  352   QAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             QAGPRVCLGKEMAFIQMK+VVASILRRFEIRP   ++PVFVPLLT +MA G  V V  R 
Sbjct  448   QAGPRVCLGKEMAFIQMKYVVASILRRFEIRPAGSNRPVFVPLLTAHMAGGFKVVVRKRS  507

Query  172   GYNN  161
             G N 
Sbjct  508   GGNE  511



>ref|XP_006351474.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=492

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/478 (64%), Positives = 374/478 (78%), Gaps = 7/478 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
              H +  K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT+
Sbjct  20    LHLKFRKFSPMYGPSSYPILGCLISFYKNRHQLLDWYTQLLSESPTQTILVQRFGAPRTI  79

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             +TA+ +NVEYMLK NF+N+PKG+P   ILGDFLGRGIFNVDG+LWSAQRKLASHEF+  S
Sbjct  80    ITANPDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNS  139

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRELV+K LEE V+ RL PLL  AA++  VLDLQDVLRRFAFDTICK+            
Sbjct  140   LRELVVKALEEVVENRLIPLLIQAAKSGKVLDLQDVLRRFAFDTICKV-SLGTDPHCLDD  198

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
              S    LV++FD AS   A RGMAPV+A+WK KRA N+GSEKKL+E++K VH  ++EII 
Sbjct  199   LSHVPVLVESFDTASLACAMRGMAPVYAIWKSKRALNLGSEKKLKENVKRVHCCIDEIIV  258

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +KQ+    I +G   D LSRLL AGH++EVVRDMVISFL+AGRDTTSSALTW FWL++ 
Sbjct  259   EKKQK----IVSGNHMDLLSRLLLAGHENEVVRDMVISFLIAGRDTTSSALTWLFWLITN  314

Query  697   HPNIETTVIKQVLS--SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDV  524
             H +I+  +IK++ S  + D K L FD L+EM Y+ ACL ESMRLYPPVAWDSKHAA DD+
Sbjct  315   HHDIKDKMIKEITSINNGDHKALEFDELKEMKYLAACLNESMRLYPPVAWDSKHAAKDDI  374

Query  523   LPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAG  344
             LPDGT + +GNRVT+  Y MGRME +WG D LEFKP+RW DE G+LK++SP+K+PVFQAG
Sbjct  375   LPDGTRVQKGNRVTYFQYGMGRMEEIWGKDRLEFKPERWMDENGELKIVSPYKYPVFQAG  434

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             PRVCLGKEMAF QMK+V+AS+LRRFEI+PV   +PVF+PLLT +M  G  VR+H R+G
Sbjct  435   PRVCLGKEMAFTQMKYVLASVLRRFEIKPVKVEKPVFMPLLTAHMVGGFNVRIHHRDG  492



>ref|XP_004236553.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=492

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/473 (65%), Positives = 366/473 (77%), Gaps = 4/473 (1%)
 Frame = -1

Query  1585  HHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTAS  1406
             H K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT++TA+
Sbjct  21    HLKFTPIYAPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITAN  80

Query  1405  AENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLREL  1226
              +NVEYMLK NF+N+PKG+P   ILGDFLGRGIFNVDG+LWSAQRKLASHEF+  SLRE 
Sbjct  81    PDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLREF  140

Query  1225  VMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssa  1046
             V+KTLEE V+ RL PLL   A +  VLDLQDVLRRFAFDTICK+             S  
Sbjct  141   VVKTLEEVVENRLIPLLIQVANSGKVLDLQDVLRRFAFDTICKV-SLGTDPHCLDDLSHV  199

Query  1045  eSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ  866
               LVD+FD AS   A RGMAPV+A+WK KRA N GSEKKLRE++K VH  ++EII  +KQ
Sbjct  200   PVLVDSFDTASLACAMRGMAPVYAIWKSKRALNFGSEKKLRENVKRVHCCIDEIIEEKKQ  259

Query  865   EKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNI  686
             + A     G   D LSRLL AGH +EVVRDMVISFL+AGRDTTSSALTW FWL + H ++
Sbjct  260   KIATE-NGGNQMDLLSRLLLAGHDNEVVRDMVISFLIAGRDTTSSALTWLFWLTTNHRDV  318

Query  685   ETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             +  +IK++ S  +  K L FD L+EM Y+ ACL ESMRLYPPVAWDSKHAA DD+LPDGT
Sbjct  319   KDEMIKEITSIYNGDKALEFDELKEMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGT  378

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCL  329
              + +GNRVT+ PY MGRME +WG D LEFKPDRW DE G LKM+SP+K+PVFQAGPRVCL
Sbjct  379   RVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPDRWIDENGALKMVSPYKYPVFQAGPRVCL  438

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCE-SQPVFVPLLTGYMAKGLYVRVHMRE  173
             GKEMAF QMK+V+AS+LRRFEI+PV    +PVF+PLLT +MA G  VR++ R+
Sbjct  439   GKEMAFTQMKYVLASVLRRFEIKPVVNVEKPVFLPLLTAHMAGGFNVRIYHRD  491



>ref|XP_004236333.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=494

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/471 (64%), Positives = 368/471 (78%), Gaps = 3/471 (1%)
 Frame = -1

Query  1585  HHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTAS  1406
             H K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT++TA+
Sbjct  21    HLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITAN  80

Query  1405  AENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLREL  1226
              +NVEYMLK NF+N+PKG+P   ILGDFLGRGIFNVDG+LWSAQRKLASHEF+  SLRE 
Sbjct  81    PDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLREF  140

Query  1225  VMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssa  1046
             V+KTLEE V+ RL PLL   A +  VLDLQDVLRRFAFDTICK+             S  
Sbjct  141   VVKTLEEVVENRLIPLLIQTANSGKVLDLQDVLRRFAFDTICKV-SLGTDPHCLDDLSHV  199

Query  1045  eSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ  866
               LVD+FD AS   A RGMAPV+A+WK KRA N+GSEKKL+E++K VH  +++II  +KQ
Sbjct  200   PVLVDSFDTASLACAMRGMAPVYAIWKSKRALNLGSEKKLKENVKRVHCCIDKIIEEKKQ  259

Query  865   EKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNI  686
             + A     G   D LSRLL AGH++EVVRDMVISFL+AGRDTTSSALTW FWL + H ++
Sbjct  260   KIATE-NGGNHMDLLSRLLLAGHENEVVRDMVISFLMAGRDTTSSALTWLFWLTTNHRDV  318

Query  685   ETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             +  +IK++ S ++  K L FD L+EM YI ACL ESMRLYPPVAWDSKHAA DD+LPDGT
Sbjct  319   KDEMIKEITSINNGDKALEFDELKEMKYITACLNESMRLYPPVAWDSKHAAKDDILPDGT  378

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCL  329
              + +GNRVT+ PY MGRME +WG D LEFKP+RW +E G+LK++SP+K+PVFQAGPRVCL
Sbjct  379   RVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPERWMEENGELKIVSPYKYPVFQAGPRVCL  438

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF QMK+V+AS+LRRFEI+PV   +PVF+PLLT +M  G  VR+H R
Sbjct  439   GKEMAFTQMKYVLASVLRRFEIKPVKLEKPVFLPLLTAHMVGGFNVRIHHR  489



>gb|ADO24345.1| cytochrome P450 A [Capsicum annuum]
Length=497

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/476 (63%), Positives = 365/476 (77%), Gaps = 2/476 (0%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
              H +  K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT+
Sbjct  22    LHLQFRKFTPIYGPSSYPIVGCLISFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTI  81

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             +TA+  NVE+MLK NF N+PKG+P  +ILGDFLGRGIFNVDG+ WSAQRKLASHEF+ +S
Sbjct  82    ITANPNNVEHMLKTNFTNYPKGQPFTEILGDFLGRGIFNVDGEQWSAQRKLASHEFSTKS  141

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRE V+KTLEE VD RL PLL  AA++  VLDLQDVLRRFAFDTICK+            
Sbjct  142   LREFVVKTLEEVVDTRLIPLLNHAAKSGKVLDLQDVLRRFAFDTICKV-SLGTDPHCLDD  200

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
              S   SLVD+FD AS+  A RGMAPV+A+WK KRA N+ SEKKL+E++K VH  + +II 
Sbjct  201   LSDVPSLVDSFDTASQAGAMRGMAPVYAIWKGKRALNLRSEKKLKENVKRVHCCINDIIE  260

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +KQ    N       D LSRLL AGH+DEVVRDMVISFL+AGRDTTSSALTW FWL + 
Sbjct  261   KKKQTINENGKNSKNMDLLSRLLIAGHEDEVVRDMVISFLMAGRDTTSSALTWLFWLTTN  320

Query  697   HPNIETTVIKQVLSSD-DQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
             HP+++  +I ++ S +   K L FD  +EM Y++ACL ESMRLYPPVAWDSKHAA DD+L
Sbjct  321   HPDVKNEMINEITSINIGDKALEFDESKEMKYLQACLNESMRLYPPVAWDSKHAATDDIL  380

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGP  341
             PDGT + +GNRVT+  Y MGRME +WG D LEFKPDRW DE G LK +S +KFPVFQAGP
Sbjct  381   PDGTRVQKGNRVTYFQYGMGRMEEIWGKDRLEFKPDRWIDENGLLKSVSAYKFPVFQAGP  440

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             RVCLGKEMAF+QMK+V+AS+LRRFEI+PV   +PVF+PLLT +MA G  VR+  R+
Sbjct  441   RVCLGKEMAFMQMKYVLASVLRRFEIKPVKVEKPVFMPLLTAHMAGGFNVRICHRD  496



>ref|XP_004236332.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=491

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/471 (64%), Positives = 366/471 (78%), Gaps = 3/471 (1%)
 Frame = -1

Query  1585  HHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTAS  1406
             H K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT++TA+
Sbjct  21    HLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITAN  80

Query  1405  AENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLREL  1226
              +NVEYMLK NF+N+PKG+P   ILGDFLGRGIFNVDG+LW+AQRKLASHEF+  SLRE 
Sbjct  81    PDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWNAQRKLASHEFSTNSLREF  140

Query  1225  VMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssa  1046
             V+KTLEE V+ RL PLL  AA +  VLDLQDVLRRFAFDTICK+             S  
Sbjct  141   VVKTLEEVVENRLVPLLIQAANSGKVLDLQDVLRRFAFDTICKV-SLGTDPHCLDDLSHV  199

Query  1045  eSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ  866
               LVD+FD AS   A RGMAPV+A+WK KRA N+GSEKKL+E++K VH  ++EII  +KQ
Sbjct  200   PVLVDSFDTASRACAMRGMAPVYAIWKSKRALNLGSEKKLKENVKRVHCCIDEIIEEKKQ  259

Query  865   EKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNI  686
             + A     G   D LSRLL AGH +EVVRDMVISFL+AGRDTTSSALTW FWL + H ++
Sbjct  260   KIATE-NGGDQMDLLSRLLLAGHDNEVVRDMVISFLMAGRDTTSSALTWLFWLTTNHRDV  318

Query  685   ETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             +  +IK++ S ++  K L FD L+EM ++ ACL ESMRLYPPVAWDSKHAA DD+LPDGT
Sbjct  319   KDEMIKEITSINNGDKALEFDELKEMKHLAACLNESMRLYPPVAWDSKHAAKDDILPDGT  378

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCL  329
              + +GNRVT+ PY MGRME +WG D LEFKPDRW DE G LK +SP+++PVFQAGPRVCL
Sbjct  379   RVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPDRWIDENGGLKSVSPYEYPVFQAGPRVCL  438

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF QMK+V+AS+LRRFEI+PV   +PVF+PLLT +M  G  VR++ R
Sbjct  439   GKEMAFTQMKYVLASVLRRFEIKPVNVEKPVFLPLLTAHMVGGFNVRIYGR  489



>ref|XP_006351473.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=489

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/471 (63%), Positives = 366/471 (78%), Gaps = 5/471 (1%)
 Frame = -1

Query  1585  HHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTAS  1406
             H K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT++TA+
Sbjct  21    HLKFTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSDSPTQTILVQRFGAPRTIITAN  80

Query  1405  AENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLREL  1226
              +NVEYMLK NF+N+PKG+P   ILGDFLGRGIFNVDG+LW+AQRKLASHEF+  SLRE 
Sbjct  81    PDNVEYMLKTNFINYPKGKPFTDILGDFLGRGIFNVDGELWNAQRKLASHEFSTNSLREF  140

Query  1225  VMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssa  1046
             V+KTLEE V+ RL PLL  AA++   LDLQDVLRRF+FDTICK+             S  
Sbjct  141   VVKTLEEVVENRLIPLLIQAAKSGKALDLQDVLRRFSFDTICKV-SLGTDPHCLDDLSHV  199

Query  1045  eSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ  866
               LVD+FD AS   A RGMAPV+A+WK KRA N+GSEK+L+E++K VH  ++EII+ +K+
Sbjct  200   PVLVDSFDTASRACAMRGMAPVYAIWKSKRALNLGSEKQLKENVKRVHCCIDEIIQEKKE  259

Query  865   EKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNI  686
             +    I    G D LSRLL AGH+DEV+RDMVISFL+AGRDTTSSALTW FWL + HPNI
Sbjct  260   KI---IINENGGDLLSRLLIAGHEDEVLRDMVISFLMAGRDTTSSALTWLFWLTTNHPNI  316

Query  685   ETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             +  +I ++ S ++  K L FD L+EM Y+ ACL ESMRLYPPVAWDSKHAA DD+LPDGT
Sbjct  317   KNEMIDEITSINNGDKALEFDELKEMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGT  376

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCL  329
              + +GNRVT+ PY MGRME +WG D LEFKPDRW DE G  K + P+K+PVFQAGPR+CL
Sbjct  377   RVQKGNRVTYFPYGMGRMEEIWGKDRLEFKPDRWIDENGGSKSVCPYKYPVFQAGPRMCL  436

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF QMK+V+AS+LRRFEI+PV   +PVF+PLLT +M  G  VR++ R
Sbjct  437   GKEMAFTQMKYVLASVLRRFEIKPVNVEKPVFLPLLTAHMVGGFNVRIYER  487



>ref|XP_006351475.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=495

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/479 (63%), Positives = 375/479 (78%), Gaps = 11/479 (2%)
 Frame = -1

Query  1585  HHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTAS  1406
             H K   +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT++TA+
Sbjct  21    HLKCTPIYGPSSYPILGCLISFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITAN  80

Query  1405  AENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLREL  1226
              +NVEYMLK NF+N+PKG+P   ILGDFLG GIFNVDG+LWSAQRKLASHEF+  SLRE 
Sbjct  81    PDNVEYMLKTNFINYPKGKPFTDILGDFLGGGIFNVDGELWSAQRKLASHEFSTNSLREF  140

Query  1225  VMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssa  1046
             V+KTLEE V+ RL PLL  AA++  VL+LQDVLRRFAFDTICK+             S  
Sbjct  141   VVKTLEEVVETRLVPLLIQAAKSGKVLNLQDVLRRFAFDTICKV-SLGTDPHCLDDLSHV  199

Query  1045  eSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ  866
               LVD+FD AS+  A RGMAPV+A+WK KRA N+GSEKKL+E++K VH  ++EII   ++
Sbjct  200   PVLVDSFDTASQACAMRGMAPVYAIWKSKRALNLGSEKKLKENVKRVHCCIDEII---EE  256

Query  865   EKANNIAAGAG-----SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLS  701
             +K  NIA   G     +D LSRLL AG+++EVVRDMVISFL+AGRDTTSSALTW FWL +
Sbjct  257   KKLKNIATENGDHMKNTDLLSRLLIAGYENEVVRDMVISFLMAGRDTTSSALTWLFWLTT  316

Query  700   KHPNIETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDV  524
              H +++  +IK++ S ++  K+L+FD L+EM Y+ ACL ESMRLYPPV WDSKHAA DD+
Sbjct  317   NHRDVKDEMIKEITSINNGDKSLDFDELKEMKYLAACLNESMRLYPPVVWDSKHAAKDDI  376

Query  523   LPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAG  344
             LPDGT + +GNRVT+  Y MGRME +WG D LEFKPDRW DE G LK++SP+K+PVFQAG
Sbjct  377   LPDGTRVQKGNRVTYFQYGMGRMEEIWGKDRLEFKPDRWIDENGALKIVSPYKYPVFQAG  436

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCE-SQPVFVPLLTGYMAKGLYVRVHMREG  170
             PRVCLGKEMAF QMK+V+AS+LRRFEI+PV    +PVFVPLLT +MA G  VR++ R+G
Sbjct  437   PRVCLGKEMAFTQMKYVLASVLRRFEIKPVVNVEKPVFVPLLTAHMAGGFNVRIYHRDG  495



>ref|XP_009604998.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana tomentosiformis]
Length=500

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/465 (64%), Positives = 364/465 (78%), Gaps = 3/465 (1%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             +Y P SYPI+GCL+SFYKN + LLDWYT+LL+ SPT+TI+V R GAPRT++TA+A NVE+
Sbjct  35    IYGPSSYPILGCLISFYKNSHRLLDWYTELLSESPTQTILVQRFGAPRTIITANANNVEH  94

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF+N+PKG+P  +ILGDFLG GIFNVDG+ W+ QRKLASHEF+ +SLRE V+KTLE
Sbjct  95    ILKTNFINYPKGQPFTEILGDFLGMGIFNVDGERWNTQRKLASHEFSTKSLREFVVKTLE  154

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             E V+ RL PLL+ AA+++ VLDLQDVLRRFAFDTICK+             S    LV+A
Sbjct  155   EVVETRLIPLLDQAAKSTKVLDLQDVLRRFAFDTICKV-SLGTDPHCLDDLSHVPILVEA  213

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD AS+  A RGMAP++AVWK KRA N+GSEKKL+E++K VH  + EII  +KQ K N  
Sbjct  214   FDNASQACAMRGMAPIYAVWKSKRALNLGSEKKLKENVKRVHCCISEIIEKKKQ-KINEN  272

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRLL AGH+DEVVRDMVISFL+AGRDTTSSALTW FWL +KH +++  +I 
Sbjct  273   GDHKNMDLLSRLLIAGHEDEVVRDMVISFLIAGRDTTSSALTWLFWLTTKHHDVKNEMIS  332

Query  667   QVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++ S ++  K L FD L+EM Y++ACL ESMRLYPPVAWDSKHAA DD+LPDGT + +GN
Sbjct  333   EITSINNGDKALEFDDLKEMKYLQACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGN  392

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
             RVT+  Y MGRME +WG D LEFKPDRW DE G  K + P+KFPVFQAGPRVCLGKEMAF
Sbjct  393   RVTYFQYGMGRMEEIWGKDRLEFKPDRWLDENGVSKSVCPYKFPVFQAGPRVCLGKEMAF  452

Query  310   IQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
              QMK+V+AS+LRRFEI+PV   +PVFVPLLT +MA G  VR++ R
Sbjct  453   TQMKYVLASVLRRFEIKPVNVDKPVFVPLLTAHMAGGFNVRIYHR  497



>ref|XP_009607568.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana tomentosiformis]
Length=502

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/465 (64%), Positives = 363/465 (78%), Gaps = 3/465 (1%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             +Y P SYPI+GCL+SFYKNR  LLDWYT LLA SPT+TI+V R GAPRT++TA+A NVE+
Sbjct  35    IYGPSSYPILGCLISFYKNRQRLLDWYTGLLAESPTQTILVQRFGAPRTIITANANNVEH  94

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF+N+PKG+P  +ILGDFLG GIFNVDG+ W+ QRKLASHEF+ +SLRE V+KTLE
Sbjct  95    ILKTNFINYPKGQPFTEILGDFLGMGIFNVDGERWNTQRKLASHEFSTKSLREFVVKTLE  154

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             E V+ RL PLL+ AA+++ V+DLQDVLRRFAFDTICK+             S    LV+A
Sbjct  155   EVVETRLIPLLDQAAKSTKVVDLQDVLRRFAFDTICKV-SLGTDPHCLDDLSHVPVLVEA  213

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD AS+  A RGMAP++AVWK KRA N+GSEKKL+E++K VH  + EII  +KQ K N  
Sbjct  214   FDNASQACAMRGMAPIYAVWKSKRALNLGSEKKLKENVKRVHCCINEIIEKKKQ-KINEN  272

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRLL AGH+DEVVRDMVISFL+AGRDTTSSALTW FWL +KH  +++ +I 
Sbjct  273   EDHKNMDLLSRLLIAGHEDEVVRDMVISFLMAGRDTTSSALTWLFWLTTKHHKVKSEMIN  332

Query  667   QVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++ S ++  K L FD L+EM Y++ACL ESMRLYPPVAWDSKHAA DD+LPDGT I +GN
Sbjct  333   EITSINNGDKALEFDDLKEMKYLQACLNESMRLYPPVAWDSKHAAKDDILPDGTRIQKGN  392

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
             RVT+  Y MGRME +WG D LEFKPDRW DE G  K + P+KFPVFQAGPRVCLGKEMAF
Sbjct  393   RVTYFQYGMGRMEEIWGKDRLEFKPDRWLDENGVSKSVCPYKFPVFQAGPRVCLGKEMAF  452

Query  310   IQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
              QMK+V+AS+LRRFEI+PV   +PVFVPLLT +MA G  VR++ R
Sbjct  453   TQMKYVLASVLRRFEIKPVNVDKPVFVPLLTAHMAGGFNVRIYHR  497



>ref|XP_009601037.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana tomentosiformis]
Length=496

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/474 (63%), Positives = 366/474 (77%), Gaps = 5/474 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
              H +  +   +Y P SYPI+GCL+SFYKNR+ LLDWYT LL+ SPT+TI+V R GAPRT+
Sbjct  25    LHLKSRRSTPIYGPSSYPILGCLISFYKNRHQLLDWYTDLLSESPTQTILVQRFGAPRTI  84

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+A+NVE++LK NF N+PKG+P  +ILGDFLG GIFNVDG++W+ QRKLASHEF+ +S
Sbjct  85    VTANADNVEHILKTNFTNYPKGKPFTEILGDFLGVGIFNVDGEMWNTQRKLASHEFSTKS  144

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRE V+KTLEEEV+ RL PLLE AA +  VLDLQDVLRRFAFDTICK+            
Sbjct  145   LREFVVKTLEEEVETRLIPLLETAAESGRVLDLQDVLRRFAFDTICKV-SLGIDLHFLDV  203

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   LV+AFD AS+  A RGMAPV+AVWK KRAF +GSE KL+E++  +HD + EII 
Sbjct  204   SQPVPPLVEAFDNASQACAMRGMAPVYAVWKFKRAFKLGSESKLKENVTQIHDSINEIII  263

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +KQ    N      SD LSRLL  G +DEVVRDMVISFL+AGRDTTSSALTW FWLL+K
Sbjct  264   TKKQNIHEN-GGERNSDLLSRLLLVGLEDEVVRDMVISFLMAGRDTTSSALTWLFWLLTK  322

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             H N E  ++ +++S    K +N+D L+EM Y  ACLCESMRLYPPVAWDSKHA  DD+LP
Sbjct  323   HRNTEIEILDEIMSI---KAMNYDELKEMKYTHACLCESMRLYPPVAWDSKHAVKDDILP  379

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPR  338
             +GT +Y+GNRVT+  Y MGRME LWG D LEFKP+RW D+ G+LK +SP+KFPVFQAGPR
Sbjct  380   NGTRVYKGNRVTYFQYGMGRMEELWGKDRLEFKPERWIDQNGELKTVSPYKFPVFQAGPR  439

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             VCLGKEMAFIQMK+V+A++L+RFEI+PV   +P+FVPLLT YMA GL VR+  R
Sbjct  440   VCLGKEMAFIQMKYVLAAVLKRFEIKPVNVDKPIFVPLLTAYMAGGLNVRICNR  493



>ref|XP_006440103.1| hypothetical protein CICLE_v10019793mg [Citrus clementina]
 gb|ESR53343.1| hypothetical protein CICLE_v10019793mg [Citrus clementina]
Length=506

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/485 (62%), Positives = 365/485 (75%), Gaps = 22/485 (5%)
 Frame = -1

Query  1594  HTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVV  1415
             H +HH       PPSYP IGCL+SFY+NR+ LL+WYT LL+ SPT+TI+V RLGA RT+V
Sbjct  27    HRDHH-------PPSYPFIGCLVSFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIV  79

Query  1414  TASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSL  1235
             TA+  NVEYMLK+NF NFPKG P  +ILGD LG GIFNVDG+LWS QRKLASHEF+A+SL
Sbjct  80    TANPANVEYMLKSNFTNFPKGRPFTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSL  139

Query  1234  RELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssd  1055
             RE  +KTL++EVD RL P+LE AA +  VLD QD+LRRFAFD +CK+             
Sbjct  140   REFTVKTLQQEVDDRLIPMLEEAAESRRVLDFQDILRRFAFDVVCKV-SLGTDPFCLDHS  198

Query  1054  ssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRV  875
                  LV AFD ASEISA RGMAPVF VWK KR  N+GSEKKL+E + +VH+ V EIIR 
Sbjct  199   QPLPPLVKAFDAASEISAMRGMAPVFLVWKIKRLLNMGSEKKLKESVNLVHESVMEIIRN  258

Query  874   RKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
             +K+   N++    G D LSRLL AGH ++V RDM ISF++AGRDTTS+A+TW FWLLS++
Sbjct  259   KKEN--NSVNGDEGGDLLSRLLSAGHGEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQN  316

Query  694   PNIETTVIKQVLSSDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAAN  533
               +E  ++ +V    D+      + L+F+ L+EMN++KACLCESMRLYPPVAWDSKHAA 
Sbjct  317   EAVERAIVDEVKLVTDKNNIGRARALDFETLKEMNFLKACLCESMRLYPPVAWDSKHAAA  376

Query  532   DDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISP  371
              DVLPDGTP+ +G+RVT+ PY MGRME LWG D LEFKPDRW D+ G+      LK +SP
Sbjct  377   YDVLPDGTPVRKGDRVTYMPYGMGRMETLWGKDRLEFKPDRWLDDLGEEWENRVLKPVSP  436

Query  370   FKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYV  191
             +KFPVFQAGPRVCLGKEMAFIQMK+VV S+LRRFEI+PV  +QPVFVPLLTG+M  GL V
Sbjct  437   YKFPVFQAGPRVCLGKEMAFIQMKYVVGSVLRRFEIKPVSGNQPVFVPLLTGHMIGGLKV  496

Query  190   RVHMR  176
              V  R
Sbjct  497   LVRKR  501



>gb|KDO52651.1| hypothetical protein CISIN_1g036030mg [Citrus sinensis]
Length=503

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/475 (63%), Positives = 364/475 (77%), Gaps = 15/475 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPSYP IGCL+SFY+NR+ LL+WYT LL+ SPT+TI+V RLGA RT+VTA+  NVEYM
Sbjct  29    HQPPSYPFIGCLVSFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYM  88

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK+NF NFPKG P  +ILGD LG GIFNVDG+LWS QRKLASHEF+A+SLRE  +KTL++
Sbjct  89    LKSNFTNFPKGRPFTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQ  148

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EVD RL P+LE AA +  VLD QD+LRRFAFD +CK+                  LV AF
Sbjct  149   EVDDRLIPMLEEAAESRRVLDFQDILRRFAFDVVCKV-SLGTDPFCLDHSQPLPPLVKAF  207

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D ASEISA RGMAPVF VWK KR  N+GSEKKL+E + +VH+ V EIIR +K+   N++ 
Sbjct  208   DAASEISAMRGMAPVFLVWKIKRLLNIGSEKKLKESVNLVHESVMEIIRNKKEN--NSVN  265

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---  674
                G D LSRLL AGH ++V RDM ISF++AGRDTTS+A+TW FWLLS++  +E  +   
Sbjct  266   GDEGGDLLSRLLSAGHGEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVEREIVDE  325

Query  673   IKQVLSSDD---QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             +KQV+  ++    + L+F+ L+EMN++KACLCESMRLYPPVAWDSKHAA  DVLPDGTP+
Sbjct  326   VKQVIDKNNIGRARALDFEALKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPV  385

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGP  341
              +G+RVT+ PY MGRME LWG D LEFKPDRW D+ G+      LK +SP+KFPVFQAGP
Sbjct  386   RKGDRVTYMPYGMGRMETLWGKDRLEFKPDRWLDDLGEEWENRVLKPVSPYKFPVFQAGP  445

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             RVCLGKEMAFIQMK+VV S+LRRFEI+PV  +QPVFVPLLTG+M  GL V V  R
Sbjct  446   RVCLGKEMAFIQMKYVVGSVLRRFEIKPVSGNQPVFVPLLTGHMIGGLKVLVRKR  500



>ref|XP_006477025.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/475 (63%), Positives = 364/475 (77%), Gaps = 15/475 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPSYP IGCL+SFY+NR+ LL+WYT LL+ SPT+TI+V RLGA RT+VTA+  NVEYM
Sbjct  30    HQPPSYPFIGCLVSFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYM  89

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK+NF NFPKG P  +ILGD LG GIFNVDG+LWS QRKLASHEF+A+SLRE  +KTL++
Sbjct  90    LKSNFTNFPKGRPFTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQ  149

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EVD RL P+LE AA +  VLD QD+LRRFAFD +CK+                  LV AF
Sbjct  150   EVDDRLIPMLEEAAESRRVLDFQDILRRFAFDVVCKV-SLGTDPFCLDLSRPLPPLVKAF  208

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D ASEISA RGMAPVF VWK KR  N+GSEKKL+E + +VH+ V EIIR +K+   N++ 
Sbjct  209   DAASEISAMRGMAPVFLVWKIKRLLNIGSEKKLKESVNLVHESVMEIIRNKKEN--NSVN  266

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---  674
                G D LSRLL AGH ++V RDM ISF++AGRDTTS+A+TW FWLLS++  +E  +   
Sbjct  267   GDEGGDLLSRLLSAGHGEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVEREIVDE  326

Query  673   IKQVLSSDD---QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             +KQV+  ++    + L+F+ L+EMN++KACLCESMRLYPPVAWDSKHAA  DVLPDGTP+
Sbjct  327   VKQVIDKNNIGRARALDFEALKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPV  386

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGP  341
              +G+RVT+ PY MGRME LWG D LEFKPDRW D+ G+      LK +SP+KFPVFQAGP
Sbjct  387   RKGDRVTYMPYGMGRMETLWGKDRLEFKPDRWLDDVGEEWENRVLKPVSPYKFPVFQAGP  446

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             RVCLGKEMAFIQMK+VV S+LRRFEI+PV  +QPVFVPLLTG+M  GL V V  R
Sbjct  447   RVCLGKEMAFIQMKYVVGSVLRRFEIKPVSGNQPVFVPLLTGHMIGGLKVLVRKR  501



>ref|XP_009766464.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana sylvestris]
Length=500

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/465 (64%), Positives = 372/465 (80%), Gaps = 3/465 (1%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             +Y P SYPI+GCL+SFYKNR+ LLDWYT+LL+ SPT+TI+V R GAPRT++TA+A NVE+
Sbjct  35    IYGPSSYPILGCLISFYKNRHRLLDWYTELLSESPTQTILVQRFGAPRTIITANATNVEH  94

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF N+PKG+P  +ILGDFLG GIFNVDG+ W+ QRKLASHEF+ +SLRE V+KTLE
Sbjct  95    ILKTNFTNYPKGQPFTEILGDFLGMGIFNVDGERWNTQRKLASHEFSTKSLREFVVKTLE  154

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             E V+ RL PLL+ AA+++ ++DLQDVLR FAFDTICK+SLG+DP CL         LV+A
Sbjct  155   EVVETRLIPLLDQAAKSNKIVDLQDVLRCFAFDTICKVSLGTDPHCLDDLSHVPI-LVEA  213

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD AS+  A RGMAP++AVWK KRA N+GSEKKL+E++K VH  + EII  +KQ+ + N 
Sbjct  214   FDNASQACAMRGMAPIYAVWKTKRALNLGSEKKLKENVKRVHCCINEIIEKKKQKISEN-  272

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRLL AGH+DEVVRDMVISFL+AGRDTTSSALTW FWL +KH +++  +I 
Sbjct  273   GDHKNMDLLSRLLIAGHEDEVVRDMVISFLMAGRDTTSSALTWLFWLTTKHHDVKNEMIN  332

Query  667   QVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++ S ++  K L FD L+EM Y++ACL ESMRLYPPVAWDSKHAA DD+LPDGT + +GN
Sbjct  333   EITSINNGDKALEFDDLKEMKYLQACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGN  392

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
             RVT+  Y MGRME +WG D LEFKP+RW DE+G  K + P+KFPVFQAGPRVCLGKEMAF
Sbjct  393   RVTYFQYGMGRMEEIWGKDRLEFKPERWLDEKGVSKSVCPYKFPVFQAGPRVCLGKEMAF  452

Query  310   IQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
              QMK+V+AS+LRRFEI+PV   +PVFVPLLT +MA G  VR++ R
Sbjct  453   TQMKYVLASVLRRFEIKPVNVDKPVFVPLLTAHMAGGFNVRIYHR  497



>ref|XP_011044159.1| PREDICTED: cytochrome P450 94B3-like [Populus euphratica]
Length=509

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/480 (62%), Positives = 359/480 (75%), Gaps = 6/480 (1%)
 Frame = -1

Query  1594  HTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVV  1415
             +    K    + PPSYPIIGCL+SFYKNR CLLDWYT LL+ SPT+TIVV RLGA R +V
Sbjct  27    YASRTKPPTTHGPPSYPIIGCLISFYKNRRCLLDWYTNLLSVSPTQTIVVQRLGARRIIV  86

Query  1414  TASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSL  1235
             TA+ ENVEY+LK NF+NFPKG+P  +ILGD LG GIFN DG+LWS QRKLASHEF+ +SL
Sbjct  87    TANPENVEYVLKTNFINFPKGKPFTEILGDLLGCGIFNADGELWSTQRKLASHEFSTKSL  146

Query  1234  RELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssd  1055
             RE V+ TL+EEV  RL PLLE A    SVLDLQD+LRRF+FD +C++             
Sbjct  147   REFVVMTLQEEVQNRLIPLLEEAVEAKSVLDLQDLLRRFSFDIVCRV-SLGTDPSSLDLS  205

Query  1054  ssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRV  875
                  LV AFD ASEISA RGMAPV+AVWK K+ FN+G+EKKL+E IK+VHD V EI+  
Sbjct  206   RPMPPLVKAFDAASEISAMRGMAPVYAVWKAKKLFNLGAEKKLKEAIKLVHDSVSEIVTT  265

Query  874   RKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
             +K+   N+      SD LSRLL AGH +EVVRDMV+SF++AGRDTTS+A+TW FWLLSKH
Sbjct  266   KKRVLENDREGKLESDLLSRLLLAGHGEEVVRDMVVSFIMAGRDTTSAAMTWLFWLLSKH  325

Query  694   PNIETTVIKQV--LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
              N E  ++K+V  L  D  K ++++ L+ MN++KA LCESMRLYPPV WDSKHA  DDVL
Sbjct  326   RNSEEMIVKEVKSLLDDGGKAIDYEVLKGMNFLKASLCESMRLYPPVPWDSKHAIIDDVL  385

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK---LKMISPFKFPVFQ  350
             PDGT + +G+RVT+ PY MGRME LWG D  EF+PDRWF E G    LK +SP+ FPVFQ
Sbjct  386   PDGTSVRKGDRVTYFPYGMGRMEKLWGKDRFEFRPDRWFQEIGNDQTLKSVSPYTFPVFQ  445

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             AGPRVCLGKEMA IQMK+V+A++LRRFEI PV +++PVF PLLT +M  GL V V  R G
Sbjct  446   AGPRVCLGKEMAMIQMKYVMAAVLRRFEIIPVFDNEPVFAPLLTAHMVGGLKVMVRRRNG  505



>ref|XP_002318721.2| hypothetical protein POPTR_0012s09880g [Populus trichocarpa]
 gb|EEE96941.2| hypothetical protein POPTR_0012s09880g [Populus trichocarpa]
Length=631

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/481 (62%), Positives = 363/481 (75%), Gaps = 6/481 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
             F+    K    + PPSYPIIGCL+SFYKNR CLLDWYT LL+ SPT+TIVV RLGA R +
Sbjct  26    FYASQTKPPTTHGPPSYPIIGCLISFYKNRRCLLDWYTNLLSVSPTQTIVVKRLGARRII  85

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+ ENVEY+LK NF+NFPKG+   +ILGD LG GIFN DG+LWS QRKLASHEF+ +S
Sbjct  86    VTANPENVEYVLKTNFINFPKGKSFTEILGDLLGCGIFNADGELWSTQRKLASHEFSTKS  145

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRE V+ TL+EEV+ RL PLLE A    SVLDLQD+LRRF+FD +C++            
Sbjct  146   LREFVVMTLQEEVENRLIPLLEEAVEAKSVLDLQDLLRRFSFDIVCRV-SLGTDPSCLDL  204

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   LV AFD ASEISA RGMAPV+AVWK K+ FN+G+EKKL+E IK+VHD V EI++
Sbjct  205   SRPIPPLVKAFDAASEISAMRGMAPVYAVWKAKKLFNLGAEKKLKEAIKLVHDSVSEIVK  264

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +K+   N+      SD LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLSK
Sbjct  265   TKKRVLENDREGKLESDLLSRLLLAGHGEEVVRDMVISFIMAGRDTTSAAMTWLFWLLSK  324

Query  697   HPNIETTVIKQV--LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDV  524
             H N E  ++K+V  L  D +K ++++ L+ MN++KA LCESMRLYPPV WDSKHA  DDV
Sbjct  325   HRNSEKMIVKEVKSLLDDREKAIDYEVLKGMNFLKASLCESMRLYPPVPWDSKHAIIDDV  384

Query  523   LPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK---LKMISPFKFPVF  353
             LPDGT + +G+RVT+ PY MGRME LWG D  EF+PDRWF E G    LK +SP+ FPVF
Sbjct  385   LPDGTSVRKGDRVTYFPYGMGRMEKLWGKDRFEFRPDRWFQEIGNDQTLKSVSPYTFPVF  444

Query  352   QAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             QAGPRVCLGKEMA IQMK+V+AS+LRRFEI+PV +++PVF PLLT +M  GL V V  R 
Sbjct  445   QAGPRVCLGKEMAMIQMKYVMASVLRRFEIKPVFDNEPVFAPLLTAHMVGGLKVMVKRRN  504

Query  172   G  170
             G
Sbjct  505   G  505



>ref|XP_011083758.1| PREDICTED: cytochrome P450 94B3-like [Sesamum indicum]
Length=545

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 364/475 (77%), Gaps = 6/475 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
             F  + H K+  +   S P IGCL++FYKNR  LLDWYT+LL+ S T+TIVVHRLGAPRT+
Sbjct  73    FFNKLHLKIRKFALYSCPSIGCLIAFYKNRRRLLDWYTELLSQSETQTIVVHRLGAPRTI  132

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+ +NVEY+LK NF NFPKG+P  ++LGDFLG GIFNVDG+ WS QRKLASHEF+A+S
Sbjct  133   VTANPDNVEYILKTNFANFPKGKPFTELLGDFLGLGIFNVDGEKWSIQRKLASHEFSAKS  192

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRE V+K LE+EV+ RL P+L+ AA N  ++D+Q+VLRRFAFDTICK+SLG DP CL  +
Sbjct  193   LREFVVKVLEDEVESRLIPILDDAAENDRIIDMQEVLRRFAFDTICKVSLGMDPLCLDLA  252

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   L  AFD AS ISA RG APVFAVWK KR  NVG EK+L+E +K+VH  V+E+IR
Sbjct  253   RPPPP-LASAFDAASAISAMRGTAPVFAVWKLKRTLNVGLEKELKEAVKLVHGCVDEMIR  311

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +K     N    +G D LSR L++G  DE+VRDMVISFL+AGRDTTS+A+TW FWLL+ 
Sbjct  312   SKKGTMGGN----SGGDLLSRFLESGLDDEMVRDMVISFLMAGRDTTSAAVTWLFWLLTG  367

Query  697   HPNIETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
             H  IE  V+ ++ S  +  + L FD L+ +N+IKACLC+ MRLYPPV WDSKHA  DDVL
Sbjct  368   HRGIEKQVVDEITSMKNGGEQLGFDDLKGLNFIKACLCDDMRLYPPVVWDSKHAVKDDVL  427

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGP  341
             PDGTP+YRGNRVT+  Y MGRME +WG D LEF+P+RW DE G +KM+SP+KF VFQAGP
Sbjct  428   PDGTPVYRGNRVTYFQYGMGRMEEVWGKDRLEFRPERWLDESGMVKMVSPYKFAVFQAGP  487

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             RVCLGKEMAFIQMK+VVAS+LRRFE+ PV    PVFVPLLT YM  G  VRV  R
Sbjct  488   RVCLGKEMAFIQMKYVVASVLRRFELHPVRSEPPVFVPLLTAYMGGGFNVRVQRR  542



>ref|XP_002511196.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51798.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/480 (63%), Positives = 360/480 (75%), Gaps = 17/480 (4%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             K L  + PPSYPIIGCLLSFYKNR+ LLDWYT LL+ SPT+TI V RLG  R VVTA+  
Sbjct  2     KLLSSHGPPSYPIIGCLLSFYKNRFRLLDWYTDLLSVSPTQTIEVQRLGGRRIVVTANPA  61

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVE+MLK+NF NFPKG+P  +ILGD LG GIFN DG+LWS QRKLASHEF+ +SLRE V+
Sbjct  62    NVEHMLKSNFSNFPKGKPFTEILGDLLGCGIFNADGELWSTQRKLASHEFSTKSLREFVV  121

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
             KTL+E V+ RL PLLE AA   SVLDLQDVLRRFAFD +C +                  
Sbjct  122   KTLQEVVENRLIPLLEDAADRESVLDLQDVLRRFAFDIVC-LVSLGTDPFCLDFSRPIPP  180

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEK  860
             LV AFD ASEISA RG APV+AVWK KR  N+G+EKKL+E +K+VH  V EI++ +K+  
Sbjct  181   LVKAFDTASEISAMRGTAPVYAVWKTKRMLNLGTEKKLKEAVKMVHSSVLEIVKNKKKVL  240

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
              N+     GSD LSRLL  GH +EV+RDMVISF++AGRDTTS+A+TW FWLLSK+ N E 
Sbjct  241   END----QGSDLLSRLLSGGHDEEVIRDMVISFIMAGRDTTSAAMTWLFWLLSKNKNSEE  296

Query  679   TVIKQV--LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
              ++K+V  L +  +K ++F+ L+EMN++KA LCESMRLYPPVAWDSKHA +DD+LPDGT 
Sbjct  297   MIVKEVTTLLNRGEKAIDFELLKEMNFLKASLCESMRLYPPVAWDSKHALSDDILPDGTF  356

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE----------QGKLKMISPFKFPV  356
             + +G+RVT+ PY MGRME LWG D  EFKPDRWF++             +K +SP+KFPV
Sbjct  357   VGKGDRVTYFPYGMGRMEKLWGKDCFEFKPDRWFNKPVGFGFESTGDRVMKSVSPYKFPV  416

Query  355   FQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             FQAGPRVCLGKEMAFIQMK+V ASILRRFEIRPV E QPV VPLLT +MA GL V V  R
Sbjct  417   FQAGPRVCLGKEMAFIQMKYVAASILRRFEIRPVREDQPVLVPLLTAHMAGGLKVTVKRR  476



>ref|XP_008239459.1| PREDICTED: cytochrome P450 94B3 [Prunus mume]
Length=510

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/488 (62%), Positives = 370/488 (76%), Gaps = 19/488 (4%)
 Frame = -1

Query  1603  RVFHTEHHKKLIV--YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGA  1430
             R  HT+  K  ++  + PPSYPIIGCL+SFYKN++ LLDWYT LL++SP++TIVV R+GA
Sbjct  23    RKSHTKLPKSPLINSHGPPSYPIIGCLISFYKNQHNLLDWYTSLLSNSPSQTIVVRRIGA  82

Query  1429  PRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEF  1250
              RT+VTA+  NVE++LK NF NFPKG+P+ + LGD LG GIFNVDGDLWS QRKLASHEF
Sbjct  83    RRTIVTANPSNVEHVLKTNFTNFPKGKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEF  142

Query  1249  TARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgc  1070
             + +SLRE V+KTLEEEV+ RL PLLE AA + SVLDLQ++LRRFAFDT+CK+        
Sbjct  143   STKSLREFVVKTLEEEVEHRLIPLLEEAAESKSVLDLQEILRRFAFDTVCKV-SLGSDPF  201

Query  1069  lsssdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVE  890
                       LV+AFD AS ISARR  AP++ +WK KRA N+GSEKKL+E +K+VH  V 
Sbjct  202   CLDLTRPVPPLVEAFDCASGISARRATAPLYLMWKVKRALNIGSEKKLKEAVKLVHGSVH  261

Query  889   EIIRVRKQ--EKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWF  716
             EII+ +K+  EK     +    D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW 
Sbjct  262   EIIQNKKKILEKDEGCES---HDMLSRLLLAGHGEEVVRDMVISFILAGRDTTSAAMTWL  318

Query  715   FWLLSKHPNIETTVIKQVLSSDDQKT----LNFDHLREMNYIKACLCESMRLYPPVAWDS  548
             FWLLSKHP+I   ++ +V +   Q T    L F+ L++M +++ACLCESMRLYPPV WDS
Sbjct  319   FWLLSKHPSINHQIVNEVENVLGQNTSTEKLGFEDLQKMRFLRACLCESMRLYPPVPWDS  378

Query  547   KHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF------DEQGKL  386
             KHA  D VLPDGT + +G+RVT+ PY MGRME LWG DW EF PDRWF      D+ G L
Sbjct  379   KHAEVDTVLPDGTWVGKGDRVTYFPYGMGRMEELWGKDWFEFNPDRWFDIEHGCDDGGVL  438

Query  385   KMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCE-SQPVFVPLLTGYM  209
             K ISP+KFPVFQAGPRVCLGKEMAFIQMK+V+AS+LRRFEI+PV E  QP+FVPLLT +M
Sbjct  439   KSISPYKFPVFQAGPRVCLGKEMAFIQMKYVMASVLRRFEIKPVYEKEQPIFVPLLTAHM  498

Query  208   AKGLYVRV  185
             A GL V V
Sbjct  499   AGGLKVLV  506



>ref|XP_010250749.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=488

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/474 (62%), Positives = 363/474 (77%), Gaps = 11/474 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP IGCL+SFYKNR+ LLDWYT+LLA SP KTIVV RLGA RTV+TA+ +NVEYM
Sbjct  5     HGPASYPFIGCLISFYKNRFRLLDWYTELLAQSPAKTIVVQRLGARRTVITANPDNVEYM  64

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L+ NF NFPKG+P  +ILGD LG GIFNVDG+LW  QRKL SHEFT +SLRE V+KTL E
Sbjct  65    LRTNFSNFPKGKPFTEILGDLLGYGIFNVDGELWRTQRKLVSHEFTTKSLREFVVKTLVE  124

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+ RL PLLE+A+ N+ V+D+Q++LRRFAFDT+CK+           +  +   L  AF
Sbjct  125   EVEERLLPLLESASANNKVVDMQELLRRFAFDTVCKV-SLGMDPGCLDASLTISPLARAF  183

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D ASEISARR  APVFAVWK KR   +GSE +L++ I+ VH  VEEIIR +K++ +   +
Sbjct  184   DVASEISARRAAAPVFAVWKIKRLLRMGSEWQLKQAIEDVHRSVEEIIRDKKKKISAGES  243

Query  844   AGA--GSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
              G     D LSRL+ AGH D+V RDMVISF++AGRDTTS+A+TW FW LS+HPN E  V+
Sbjct  244   RGEHDNGDLLSRLISAGHDDDVTRDMVISFIMAGRDTTSAAMTWLFWSLSRHPNTEKEVV  303

Query  670   KQV---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
             K+V   L +D+ K+L+++ L+++  +KACLCESMRLYPPVAWDSKH+   D LPDGT + 
Sbjct  304   KEVVTALGNDEPKSLDYEALKDLPLLKACLCESMRLYPPVAWDSKHSVRADTLPDGTKVG  363

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVC  332
              G+RVT+ PY MGRME+LWG D LEFKPDRWF     E G LK +SP+KFPVFQAGPRVC
Sbjct  364   VGDRVTYFPYGMGRMESLWGKDRLEFKPDRWFLEPDKEGGALKEVSPYKFPVFQAGPRVC  423

Query  331   LGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMRE  173
             LGKEMAFIQMK+VVASILRRFE+RPV  E +PVFVPLLT +MA G  V V +R+
Sbjct  424   LGKEMAFIQMKYVVASILRRFELRPVASERKPVFVPLLTAHMAGGFNVNVVVRQ  477



>ref|XP_007210176.1| hypothetical protein PRUPE_ppa017252mg, partial [Prunus persica]
 gb|EMJ11375.1| hypothetical protein PRUPE_ppa017252mg, partial [Prunus persica]
Length=505

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/484 (62%), Positives = 365/484 (75%), Gaps = 15/484 (3%)
 Frame = -1

Query  1603  RVFHTEHHKKLIV--YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGA  1430
             R  HT+  K  ++  + PPSYPIIGCL+SFYKN++ LLDWYT LL++SP++TIVVHR+GA
Sbjct  23    RKSHTKLPKSPLINSHGPPSYPIIGCLISFYKNQHNLLDWYTSLLSNSPSQTIVVHRIGA  82

Query  1429  PRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEF  1250
              RT+VTA+  NVE++LK NF NFPKG+P+ + LGD LG GIFNVDGDLWS QRKLASHEF
Sbjct  83    RRTIVTANPSNVEHVLKTNFTNFPKGKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEF  142

Query  1249  TARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgc  1070
             + +SLRE V+KTLEEEV+ RL PLLE AA   SVLDLQ++LRRFAFDT+CK+        
Sbjct  143   STKSLREFVVKTLEEEVEHRLIPLLEEAAECKSVLDLQEILRRFAFDTVCKV-SLGSDPF  201

Query  1069  lsssdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVE  890
                       LV+AFD ASEISARR  AP++ +WK KRA N+GSE KL+E +K+VH  V 
Sbjct  202   CLDLTRPLPPLVEAFDCASEISARRATAPLYLMWKVKRALNIGSENKLKEAVKLVHGSVH  261

Query  889   EIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFW  710
             EII+ +K+    +       D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FW
Sbjct  262   EIIQNKKKILQKD-EGCESHDMLSRLLLAGHGEEVVRDMVISFILAGRDTTSAAMTWLFW  320

Query  709   LLSKHPNIETTVIKQVLSSDDQKT----LNFDHLREMNYIKACLCESMRLYPPVAWDSKH  542
             LLSKHP+I   ++ +V +   Q T    L F+ L++M +++ACLCESMRLYPPV WDSKH
Sbjct  321   LLSKHPSINHQIVNEVENVLGQNTSTEKLGFEDLQKMRFLRACLCESMRLYPPVPWDSKH  380

Query  541   AANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF------DEQGKLKM  380
             A  D VLPDGT + +G+RVT+ PY MGRME LWG D  EF P+RWF      D+ G LK 
Sbjct  381   AEVDTVLPDGTWVGKGDRVTYFPYGMGRMEELWGKDRFEFNPNRWFDIEPGCDDGGVLKS  440

Query  379   ISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCE-SQPVFVPLLTGYMAK  203
             ISP+KFPVFQAGPRVCLGKEMAFIQMK+V+AS+LRRFEI+ VCE   PVFVPLLT +MA 
Sbjct  441   ISPYKFPVFQAGPRVCLGKEMAFIQMKYVIASVLRRFEIKQVCEKDHPVFVPLLTAHMAG  500

Query  202   GLYV  191
             GL V
Sbjct  501   GLKV  504



>emb|CDP15011.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/464 (65%), Positives = 372/464 (80%), Gaps = 5/464 (1%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYPIIGCL++FY+NR+ LLDWYT++L+ SP++T+V+ R GAPRT+VTA+ +NVEY+
Sbjct  38    HGPKSYPIIGCLVAFYQNRHRLLDWYTEILSQSPSQTMVIKRFGAPRTIVTANPQNVEYI  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG+P  +ILGDFLGRGIFN DG LW  QRKLASHEF+A+SLRE V+KTLEE
Sbjct  98    LKTNFNNYPKGKPFTEILGDFLGRGIFNADGHLWQVQRKLASHEFSAKSLREFVVKTLEE  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             +V  +L P+LE A   + VLDLQDVLRRFAFDTICK+SLG DP CL  S      L  AF
Sbjct  158   QVQNKLFPVLEMAVEKNMVLDLQDVLRRFAFDTICKVSLGMDPRCLDISQPVPP-LAIAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             DKASEI ARRG+AP+ AVWK +RA N+GSEK+L+E + +VH  V++II+ +K  K N IA
Sbjct  217   DKASEICARRGVAPIPAVWKMRRALNLGSEKELKEAVDLVHGCVDDIIQTKKT-KLNEIA  275

Query  844   --AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                 + +D LSRLL AG  DE+VRDMVISFL+AGRDTTSSALTW FWLLS H  ++  V+
Sbjct  276   DKKTSNNDLLSRLLLAGLDDEMVRDMVISFLMAGRDTTSSALTWLFWLLSNHHAVKKNVM  335

Query  670   KQV-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
              ++ + +  +K L+ + L+EM YIKACLCESMRLYPPV WDSKHA NDD+LPDGT +Y+G
Sbjct  336   NELEILNLKEKPLDVEDLKEMKYIKACLCESMRLYPPVVWDSKHAENDDILPDGTIVYKG  395

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
             NRVT+  Y MGR+E LWG D  EF+PDRWFD+ G LKM+ P+KFPVFQAGPRVCLGKEMA
Sbjct  396   NRVTYFQYGMGRIEELWGKDCFEFRPDRWFDDNGMLKMVDPYKFPVFQAGPRVCLGKEMA  455

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVH  182
             FIQMK VVASILRR+EI+ V ++QP+FVPLLT +MA GL VR+H
Sbjct  456   FIQMKHVVASILRRYEIKKVDDNQPIFVPLLTAFMAGGLKVRIH  499



>ref|XP_009762653.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana sylvestris]
Length=496

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 360/474 (76%), Gaps = 5/474 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
              H +  +   +Y P SYPI+GCL+SFYKNR+ LLDWYT LL+ SPT+TI+VHR GAPRT+
Sbjct  25    LHLKSRRSTPIYGPSSYPILGCLISFYKNRHRLLDWYTDLLSKSPTQTILVHRFGAPRTI  84

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+A+NVE++LK NF N+PKG+P  +ILGDFLG GIFNVDG++W+ QRKLASHEF+ +S
Sbjct  85    VTANADNVEHILKTNFTNYPKGQPFTEILGDFLGVGIFNVDGEMWNTQRKLASHEFSTKS  144

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LRE V+K LEEEV+ RL PLLE AA +  VLDLQDVLRRFAFDTICK+            
Sbjct  145   LREFVVKKLEEEVETRLIPLLETAAVSGRVLDLQDVLRRFAFDTICKV-SLGIDLHFLDV  203

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   LV+AFD AS+  A RGMAPV+AVWK KR F +GSE KL+E++  +HD + EII 
Sbjct  204   SQPVPPLVEAFDNASQACAMRGMAPVYAVWKFKRTFKLGSESKLKENVTQIHDSINEIII  263

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +KQ    N      SD LSRLL     D+VVRDMVISFL+AGRDTTSSALTW FWLL+K
Sbjct  264   NKKQNIHEN-GGEKNSDLLSRLLMVDLDDDVVRDMVISFLMAGRDTTSSALTWLFWLLTK  322

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             H N ET ++ +++S    K + +D L+EM Y  ACLCESMRLYPPVAWDSKHAA DD+LP
Sbjct  323   HRNAETEILDEIMSI---KAMKYDELKEMKYTHACLCESMRLYPPVAWDSKHAAKDDILP  379

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPR  338
             DGT +Y+GNRVT+    MGRME LWG D LEF+ +RW DE G+LK +SP+KFPVFQAGPR
Sbjct  380   DGTRVYKGNRVTYFQCGMGRMEELWGKDRLEFEAERWIDENGELKTVSPYKFPVFQAGPR  439

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             VCLGK+MAFIQMK+V+A++L+RFE+ PV   +P+FVPLL+ YMA G  VR+  R
Sbjct  440   VCLGKDMAFIQMKYVLAAVLKRFEVTPVNVDKPIFVPLLSAYMAGGFNVRICNR  493



>ref|XP_010045499.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=528

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/477 (61%), Positives = 361/477 (76%), Gaps = 14/477 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ ENVE++
Sbjct  38    HGPPSHPIIGCLLSFYRNRSRLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPENVEHV  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LKNNF N+PKG P   ILGDFLG GIFNVDG LWS QRKLASHEF+  SLR+ +++TLE 
Sbjct  98    LKNNFHNYPKGVPFTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEA  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+ RL PLL+  A     LDLQD+LRRFAFDT+C++                  LV AF
Sbjct  158   EVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRPLPPLVTAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EKAN  854
             + AS I A R  +PV+ VWK KRA N+GSEKKL E +K+VHD + +IIR RK+   ++ +
Sbjct  217   ENASRICAMRATSPVYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQEND  276

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             +       D LSR L AGH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E  +
Sbjct  277   DQQIKYDGDLLSRFLAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEI  336

Query  673   IKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +V S  D+   K L+F+ L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGT +
Sbjct  337   VSEVDSILDRSYNKCLDFEALKEMKFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTAV  396

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-------QGKLKMISPFKFPVFQAG  344
              RG+RVT+ PY MGR+E LWG D LEFKPDRW  E       +G+L+ +SP+++PVFQAG
Sbjct  397   RRGDRVTYFPYGMGRLEELWGKDRLEFKPDRWLVEPGVEGGAEGELRAVSPYEYPVFQAG  456

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             PRVCLGKEMAFIQMK+VVASILRRFEIRPV E++PVFVPLLT +MA GL V V  R+
Sbjct  457   PRVCLGKEMAFIQMKYVVASILRRFEIRPVLENRPVFVPLLTAHMAGGLKVVVKKRK  513



>gb|AJD25220.1| cytochrome P450 CYP94B50 [Salvia miltiorrhiza]
Length=505

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/466 (64%), Positives = 358/466 (77%), Gaps = 6/466 (1%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             S P +GCL+SFYKNR+ LL WYT+LL+ S  +TIVVHRLGAPRTVVTA+ +NVEYMLK N
Sbjct  39    SPPSLGCLISFYKNRHRLLSWYTELLSESENQTIVVHRLGAPRTVVTANPDNVEYMLKTN  98

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F NFPKG+P  ++LGDFLG GIFNVDG++WS QRKLASHEF+ +SLRE V++ L +EV  
Sbjct  99    FANFPKGKPFTELLGDFLGLGIFNVDGEMWSVQRKLASHEFSTKSLREFVVQVLRDEVAA  158

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+LE AA ++ VLD+Q+VLRRFAFDTICK+SLG DP CL  S  +   L  AFD AS
Sbjct  159   RLIPILENAAEDNGVLDMQEVLRRFAFDTICKVSLGMDPSCLDMSRPAPP-LSSAFDAAS  217

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA--NNIAAG  839
             E+SA RG APVFAVWK KRA NVG EK L++ ++ V   V+E+IR +K+  A       G
Sbjct  218   ELSAMRGAAPVFAVWKLKRALNVGPEKDLKDAVRTVRGCVDEMIRCKKETMAAGGGGGGG  277

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV-  662
              G D LSR L AG + E+VRDMVISFL+AGRDTTS+ALTW FWLL+ H + E   ++++ 
Sbjct  278   GGGDLLSRFLGAGMESEMVRDMVISFLMAGRDTTSAALTWLFWLLTWHRDAERRAVEEIG  337

Query  661   --LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
                     + L FD L+EMN++KACLCE+MRLYPPV WDSKHAA DDVLPDGTP++RGNR
Sbjct  338   DGYGGSCGRELGFDDLKEMNFVKACLCETMRLYPPVVWDSKHAARDDVLPDGTPVFRGNR  397

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFI  308
             VT+ PY MGRME LWG D L F+PDRW D+ G +KM+SP+KFPVFQAGPRVCLGKEMAFI
Sbjct  398   VTYFPYGMGRMEALWGKDRLRFRPDRWLDDAGAVKMVSPYKFPVFQAGPRVCLGKEMAFI  457

Query  307   QMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             QMK+VVAS+L RFE+ PV    PVFVP LT YMA G  VRV  R G
Sbjct  458   QMKYVVASVLARFELVPVRPEPPVFVPQLTAYMAGGFSVRVRRRGG  503



>ref|XP_009359442.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
Length=511

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/475 (61%), Positives = 356/475 (75%), Gaps = 12/475 (3%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
              Y P SYPIIGC +SFYKN++ LLDWYT LL+ SP++TIVVHR+GAPRTVVT +  NVE+
Sbjct  37    TYGPSSYPIIGCFISFYKNQHNLLDWYTSLLSGSPSQTIVVHRIGAPRTVVTGNPSNVEH  96

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF NFPKG+P+ + LGD LG GIFNVDGD+WS QRKLASHEF+ +SLRE V+ TLE
Sbjct  97    ILKTNFANFPKGKPLTEFLGDLLGCGIFNVDGDMWSTQRKLASHEFSIKSLREFVVNTLE  156

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             EEV+ RL PLLE AA +  VLD+Q++LRRFAFDT+ K+                  LV A
Sbjct  157   EEVENRLIPLLEEAAESQRVLDMQEILRRFAFDTVSKV-SLGSDPFCLDLTRPVPPLVKA  215

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             F+ A+EISARRG AP++ +WK KRA ++GSEKKL+E ++VVH  V EII+ +K+    + 
Sbjct  216   FECAAEISARRGTAPLYLMWKMKRALSIGSEKKLKEAVRVVHGSVHEIIQNKKKVFERDG  275

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLSKHP+I   +  
Sbjct  276   ERSESHDMLSRLLLAGHSEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPDITHKIAN  335

Query  667   Q----VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
             +    V+  +  + L FD L++M +++ACLCES+RLYPPV WDSKHA  D VLPDGT + 
Sbjct  336   EVENVVIQRNGTEKLGFDDLQKMRFLRACLCESLRLYPPVPWDSKHAEVDTVLPDGTWVG  395

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQG-----KLKMISPFKFPVFQAGPR  338
             +G+RVT+ PY MGRME LWG D  EF PDRWFD E G      LK +SP+KFPVFQAGPR
Sbjct  396   KGDRVTYFPYGMGRMEELWGKDRFEFNPDRWFDIEPGCDGDKVLKSVSPYKFPVFQAGPR  455

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             VCLGKEMAFIQMK+V+AS+LRRFEIRPVC E QP FVPLLT +MA GL V V  R
Sbjct  456   VCLGKEMAFIQMKYVMASVLRRFEIRPVCGEDQPAFVPLLTAHMAGGLKVLVRKR  510



>ref|XP_010045498.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=518

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/479 (61%), Positives = 359/479 (75%), Gaps = 14/479 (3%)
 Frame = -1

Query  1570  IVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             I Y PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE
Sbjct  36    ISYGPPSHPIIGCLLSFYRNRSHLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPDNVE  95

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++L+ NF N+PKG P   ILGD LG GIFNVDG LWS QRKLASHEF+  SLR+ V++TL
Sbjct  96    HVLRANFHNYPKGVPFTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTL  155

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             E EV+ RL PLL+  A     LDLQD+LRRFAFDT+C++                  LV 
Sbjct  156   EAEVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRPLPPLVT  214

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EK  860
             AF+ AS I A R  +PV+ VWK KRA N+GSEKKL E +K+VHD + +IIR RK+   ++
Sbjct  215   AFENASRICAMRATSPVYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQE  274

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
              ++       D LSR L AGH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E 
Sbjct  275   NDDQQIKYDGDLLSRFLAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEE  334

Query  679   TVIKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
              ++ +V S  D+   K L+F+ L+EM ++KACLCESMRLYP VAWDSKHAA DDVLPDGT
Sbjct  335   EIVSEVDSILDRSYNKCLDFEALKEMKFLKACLCESMRLYPSVAWDSKHAAVDDVLPDGT  394

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMISPFKFPVFQ  350
             P+ +G+RVT+ PY MGRME LWG D LEFKPDRW          +G+L+ +SP+KFPVFQ
Sbjct  395   PVRKGDRVTYFPYGMGRMEELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQ  454

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AGPRVCLGKEMAFIQMK+VVASILRRFEIRPV E++PVFVPLLT +MA GL V V  R+
Sbjct  455   AGPRVCLGKEMAFIQMKYVVASILRRFEIRPVLENRPVFVPLLTAHMAGGLKVVVKKRK  513



>gb|KCW83161.1| hypothetical protein EUGRSUZ_B00116 [Eucalyptus grandis]
Length=511

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/469 (62%), Positives = 357/469 (76%), Gaps = 14/469 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ ENVE++
Sbjct  38    HGPPSHPIIGCLLSFYRNRSRLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPENVEHV  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LKNNF N+PKG P   ILGDFLG GIFNVDG LWS QRKLASHEF+  SLR+ +++TLE 
Sbjct  98    LKNNFHNYPKGVPFTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEA  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+ RL PLL+  A     LDLQD+LRRFAFDT+C++                  LV AF
Sbjct  158   EVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRPLPPLVTAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EKAN  854
             + AS I A R  +PV+ VWK KRA N+GSEKKL E +K+VHD + +IIR RK+   ++ +
Sbjct  217   ENASRICAMRATSPVYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQEND  276

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             +       D LSR L AGH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E  +
Sbjct  277   DQQIKYDGDLLSRFLAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEI  336

Query  673   IKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +V S  D+   K L+F+ L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGT +
Sbjct  337   VSEVDSILDRSYNKCLDFEALKEMKFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTAV  396

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-------QGKLKMISPFKFPVFQAG  344
              RG+RVT+ PY MGR+E LWG D LEFKPDRW  E       +G+L+ +SP+++PVFQAG
Sbjct  397   RRGDRVTYFPYGMGRLEELWGKDRLEFKPDRWLVEPGVEGGAEGELRAVSPYEYPVFQAG  456

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGL  197
             PRVCLGKEMAFIQMK+VVASILRRFEIRPV E++PVFVPLLT +MA GL
Sbjct  457   PRVCLGKEMAFIQMKYVVASILRRFEIRPVLENRPVFVPLLTAHMAGGL  505



>gb|KCW83159.1| hypothetical protein EUGRSUZ_B00114, partial [Eucalyptus grandis]
Length=508

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/473 (62%), Positives = 356/473 (75%), Gaps = 14/473 (3%)
 Frame = -1

Query  1570  IVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             I Y PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE
Sbjct  36    ISYGPPSHPIIGCLLSFYRNRSHLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPDNVE  95

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++L+ NF N+PKG P   ILGD LG GIFNVDG LWS QRKLASHEF+  SLR+ V++TL
Sbjct  96    HVLRANFHNYPKGVPFTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTL  155

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             E EV+ RL PLL+  A     LDLQD+LRRFAFDT+C++                  LV 
Sbjct  156   EAEVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRPLPPLVT  214

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EK  860
             AF+ AS I A R  +PV+ VWK KRA N+GSEKKL E +K+VHD + +IIR RK+   ++
Sbjct  215   AFENASRICAMRATSPVYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQE  274

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
              ++       D LSR L AGH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E 
Sbjct  275   NDDQQIKYDGDLLSRFLAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEE  334

Query  679   TVIKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
              ++ +V S  D+   K L+F+ L+EM ++KACLCESMRLYP VAWDSKHAA DDVLPDGT
Sbjct  335   EIVSEVDSILDRSYNKCLDFEALKEMKFLKACLCESMRLYPSVAWDSKHAAVDDVLPDGT  394

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMISPFKFPVFQ  350
             P+ +G+RVT+ PY MGRME LWG D LEFKPDRW          +G+L+ +SP+KFPVFQ
Sbjct  395   PVRKGDRVTYFPYGMGRMEELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQ  454

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYV  191
             AGPRVCLGKEMAFIQMK+VVASILRRFEIRPV E++PVFVPLLT +MA GL V
Sbjct  455   AGPRVCLGKEMAFIQMKYVVASILRRFEIRPVLENRPVFVPLLTAHMAGGLKV  507



>ref|XP_010045501.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=513

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/477 (61%), Positives = 356/477 (75%), Gaps = 14/477 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE++
Sbjct  38    HGPPSHPIIGCLLSFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHV  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LKNNF N+PKG P   ILGDFLG GIFNVDG LWS QRKLASHEF+  SLR+ V++TLE 
Sbjct  98    LKNNFHNYPKGAPFTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEA  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV  RL PLL+  A     LDLQD+LRRFAFDT+C++              +   LV AF
Sbjct  158   EVGNRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRTLPPLVTAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EKAN  854
             + AS I A R  +PV+ VWK KR  N+GSEKKL E +K+VHD + +IIR RK+   ++ +
Sbjct  217   ENASRICATRANSPVYLVWKIKRGLNIGSEKKLSEAVKLVHDDIVDIIRNRKKKLLQEND  276

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             +       D LSR L  GH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E  +
Sbjct  277   DQQIKYDGDLLSRFLAVGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAI  336

Query  673   IKQVLSSDD---QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +V S  D   +  L+F+ L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGTP+
Sbjct  337   VSEVDSILDRSYKNCLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPV  396

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMISPFKFPVFQAG  344
              +G+RVT+ PY MGRM+ LWG D LEFKPDRW          +G+L+ +SP+KFPVFQAG
Sbjct  397   RKGDRVTYFPYGMGRMKELWGKDRLEFKPDRWLVGPGMEGGTEGELRAVSPYKFPVFQAG  456

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             PRVCLGKEMAFIQMK+VVASIL+RF IRPV E++PVFVPLLT +MA GL V V  R 
Sbjct  457   PRVCLGKEMAFIQMKYVVASILKRFVIRPVLENRPVFVPLLTAHMAGGLKVAVKKRS  513



>ref|XP_010104028.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXB98012.1| Cytochrome P450 94A1 [Morus notabilis]
Length=490

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/472 (61%), Positives = 358/472 (76%), Gaps = 18/472 (4%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             +Y  + CL+SF++NR+ LLDWYT LL+SS ++TIVVHRLGAPRTVVTA+  NVEY+LK N
Sbjct  22    NYTKLKCLISFHRNRHRLLDWYTDLLSSSFSQTIVVHRLGAPRTVVTANRTNVEYVLKTN  81

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F NFPKG+P   ILGD LG GIFNVDG+LWS+QRKLASHEFT RSLRE V+  L++E   
Sbjct  82    FHNFPKGKPFTDILGDLLGLGIFNVDGELWSSQRKLASHEFTTRSLREFVVMALKQETKE  141

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             +L PLLE A    +V+DLQ+VLRRFAFD ICK+        + S       LV+AFD+A+
Sbjct  142   KLLPLLEEACEKETVVDLQEVLRRFAFDVICKV-----SLGIDSCRFDLSRLVNAFDRAA  196

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ-----EKANNI  848
             EISA+RG APVF VWK KRA   GSEK LRE IK++H+ V EII+ +++     +    +
Sbjct  197   EISAKRGTAPVFLVWKVKRALGFGSEKVLREEIKLIHNSVAEIIKNKRKALHDHDHDREV  256

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
              +  G D L+RLL AGH++EVVRDMVISF++AGRDTTS+A+TW FWLLS++P +E  V++
Sbjct  257   RSSCGGDLLTRLLMAGHEEEVVRDMVISFIMAGRDTTSAAMTWLFWLLSENPRVENDVVE  316

Query  667   QVLS--SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             +V S  ++    LN+D L+ M+++KACLCE+MRLYPPV WDSKHA NDDVLPDGT + RG
Sbjct  317   EVKSVMNNGDNVLNYDALQSMSFVKACLCEAMRLYPPVPWDSKHAGNDDVLPDGTAVRRG  376

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVC  332
             +RVT+ PY MGRME +WG D LEF+PDRWF E         L+ +SPFKFP+FQAGPRVC
Sbjct  377   DRVTYFPYGMGRMEEVWGKDCLEFRPDRWFGEPDGDYGSRFLEPVSPFKFPIFQAGPRVC  436

Query  331   LGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             LGKEMAF QMK+VVAS+L RFEIRPV  ++PVFVPLLT +MA GL V V  R
Sbjct  437   LGKEMAFTQMKYVVASVLSRFEIRPVSLNRPVFVPLLTAHMAGGLKVLVRRR  488



>ref|XP_011084785.1| PREDICTED: cytochrome P450 94B3-like [Sesamum indicum]
Length=468

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/439 (64%), Positives = 339/439 (77%), Gaps = 9/439 (2%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             +K + Y  PS   IGCL++FYKNR  LLDWYT+LL+ S T+TIVVHRLGAPRT+VTA+ +
Sbjct  34    RKFVFYCCPS---IGCLMAFYKNRRRLLDWYTELLSQSETQTIVVHRLGAPRTIVTANPD  90

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVEY+LK NF NFPKG+P  ++LGDFLG GIFNVDG+ WS QRKLASHEFTA+SLRE V+
Sbjct  91    NVEYILKTNFANFPKGKPFTELLGDFLGLGIFNVDGEKWSIQRKLASHEFTAKSLREFVV  150

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
             K LE+EV+ RL P+L+ AA N  ++D+Q+VLRRFAFDTICK+                  
Sbjct  151   KVLEDEVESRLIPILDDAAENDRIIDMQEVLRRFAFDTICKV-SLGMDPLCLDLSRPPPP  209

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEK  860
             L  AFD ASEISA RG APVFAVWK KRA NVG EK+L+E +K+VH  V+E+IR +K   
Sbjct  210   LAAAFDAASEISAMRGTAPVFAVWKLKRALNVGLEKELKEAVKLVHGCVDEMIRSKKGTM  269

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
               N    +G D LSR L++G  DE+VRDMVISFL+AGRDTTSSALTW FWLL+ H  IE 
Sbjct  270   GGN----SGGDLLSRFLESGLDDEMVRDMVISFLMAGRDTTSSALTWLFWLLTGHRGIEK  325

Query  679   TVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
              V+ ++ S  +  + L FD L+ +N+IKACLCESMRLYPPV WDSKHA  DDVLPDGTP+
Sbjct  326   QVVDEITSMKNGGEQLGFDDLKGLNFIKACLCESMRLYPPVVWDSKHAVKDDVLPDGTPV  385

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGK  323
             YRGNRVT+  Y MGRME +WG D LEF+P+RW DE G +KM+SP+KF VFQAGPRVCLGK
Sbjct  386   YRGNRVTYFQYGMGRMEEVWGKDRLEFRPERWLDESGMVKMVSPYKFAVFQAGPRVCLGK  445

Query  322   EMAFIQMKFVVASILRRFE  266
             EMAFIQMK+VVAS+LRRFE
Sbjct  446   EMAFIQMKYVVASVLRRFE  464



>gb|KCW83162.1| hypothetical protein EUGRSUZ_B00117, partial [Eucalyptus grandis]
Length=506

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/469 (61%), Positives = 353/469 (75%), Gaps = 14/469 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE++
Sbjct  38    HGPPSHPIIGCLLSFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHV  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LKNNF N+PKG P   ILGDFLG GIFNVDG LWS QRKLASHEF+  SLR+ V++TLE 
Sbjct  98    LKNNFHNYPKGAPFTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEA  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV  RL PLL+  A     LDLQD+LRRFAFDT+C++              +   LV AF
Sbjct  158   EVGNRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRTLPPLVTAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EKAN  854
             + AS I A R  +PV+ VWK KR  N+GSEKKL E +K+VHD + +IIR RK+   ++ +
Sbjct  217   ENASRICATRANSPVYLVWKIKRGLNIGSEKKLSEAVKLVHDDIVDIIRNRKKKLLQEND  276

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             +       D LSR L  GH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E  +
Sbjct  277   DQQIKYDGDLLSRFLAVGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAI  336

Query  673   IKQVLSSDD---QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +V S  D   +  L+F+ L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGTP+
Sbjct  337   VSEVDSILDRSYKNCLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPV  396

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMISPFKFPVFQAG  344
              +G+RVT+ PY MGRM+ LWG D LEFKPDRW          +G+L+ +SP+KFPVFQAG
Sbjct  397   RKGDRVTYFPYGMGRMKELWGKDRLEFKPDRWLVGPGMEGGTEGELRAVSPYKFPVFQAG  456

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGL  197
             PRVCLGKEMAFIQMK+VVASIL+RF IRPV E++PVFVPLLT +MA GL
Sbjct  457   PRVCLGKEMAFIQMKYVVASILKRFVIRPVLENRPVFVPLLTAHMAGGL  505



>ref|XP_007134770.1| hypothetical protein PHAVU_010G074400g [Phaseolus vulgaris]
 gb|ESW06764.1| hypothetical protein PHAVU_010G074400g [Phaseolus vulgaris]
Length=498

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/475 (60%), Positives = 357/475 (75%), Gaps = 11/475 (2%)
 Frame = -1

Query  1585  HHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTAS  1406
             HH     + PPS+PIIGCL+SFY+NR+ LLDWYT+ +A SPT TIVV RLGA RTVVTA+
Sbjct  27    HHN----HAPPSHPIIGCLVSFYQNRHRLLDWYTEHIAQSPTHTIVVQRLGARRTVVTAN  82

Query  1405  AENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLREL  1226
               NVEY+LK NF NFPKG+P  +ILGD LG GIFNVDG+LW AQRKLASHEF+ RSL++ 
Sbjct  83    PYNVEYILKANFGNFPKGKPFTEILGDLLGCGIFNVDGELWQAQRKLASHEFSTRSLKDF  142

Query  1225  VMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssa  1046
             ++KTL+EEV  RL PLLE A+R + V+DLQDVLRR  FDT+CK+       C    +   
Sbjct  143   IVKTLKEEVQHRLIPLLEQASRENHVIDLQDVLRRLTFDTVCKV-SLGYDPCCLDLNKPL  201

Query  1045  eSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ  866
               L+ AFD ASE+SA RG +PVF VWK KR  NVGSEK L+E +K+VH+ V +I++ +K 
Sbjct  202   PPLLTAFDTASEVSAARGASPVFLVWKVKRMLNVGSEKALKEAVKLVHESVMKIVKAKKD  261

Query  865   EKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNI  686
             E  +N   G G+D L RLL+AG ++ VVRDMVIS ++AGRDTTS+A+TW FWLLSKH   
Sbjct  262   EITSNGGKG-GTDLLVRLLEAGQEETVVRDMVISMIMAGRDTTSAAMTWLFWLLSKHGVE  320

Query  685   ETTVIKQVLSSDDQ-KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             E  ++K+V  + ++ + L+++ L+EM  +KACLCESMRLYPPVAWDSKHA   DVLPDGT
Sbjct  321   EALLVKEVYCAKERSEGLDYECLKEMKLLKACLCESMRLYPPVAWDSKHAGFADVLPDGT  380

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQ----GKLKMISPFKFPVFQAGP  341
              + +G+RVT+ PY MGRME LWG D  EFKP RWFDE+    G LK ++P+KFPVFQAGP
Sbjct  381   HVRKGDRVTYFPYGMGRMEGLWGEDCCEFKPQRWFDEENVDKGVLKCVNPYKFPVFQAGP  440

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             RVCLG+EMAFIQM++VVASIL  F I PV    P FVPLLT +MA G  VR+ +R
Sbjct  441   RVCLGREMAFIQMEYVVASILNHFVISPVSHEHPRFVPLLTAHMAGGFNVRIKLR  495



>ref|XP_003601427.1| Cytochrome P450 94A1 [Medicago truncatula]
 gb|AES71678.1| cytochrome P450 family protein [Medicago truncatula]
Length=529

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/503 (58%), Positives = 368/503 (73%), Gaps = 31/503 (6%)
 Frame = -1

Query  1603  RVFHTEHHKKLIVY------TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVH  1442
             R+  T + K  I Y      TPPSYPIIGCL+SFYKN + LLD+YT LL+ SPT+TI+++
Sbjct  19    RIILTHNPKNHISYFTTSTHTPPSYPIIGCLISFYKNSHRLLDFYTHLLSQSPTQTILIN  78

Query  1441  RLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLA  1262
             RLGA RT++TA+  NVEY+LK NF NFPKG+P  +IL D LG GIFNVDG LWS QRK+ 
Sbjct  79    RLGARRTIITANPLNVEYILKTNFTNFPKGKPFTEILSDLLGCGIFNVDGKLWSKQRKIG  138

Query  1261  SHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgs  1082
             SHEFT RSL++ V KTLE+EV  RL PLLE A+  + V+D+QDVLRR  F+ +CK+    
Sbjct  139   SHEFTTRSLKDFVAKTLEDEVQQRLIPLLELASDGNHVIDMQDVLRRLTFEIVCKV-SLG  197

Query  1081  dpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVH  902
                C          L+ AFDKASEISA R  +P+  +WK KR  N+GSEK L+E +K+VH
Sbjct  198   YDPCCLDLSKPLPPLLSAFDKASEISAIRSHSPIHLIWKIKRVLNLGSEKLLKEAVKLVH  257

Query  901   DHVEEIIRVRKQE--KANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSA  728
             + V EIIR +K+E  + NN+   +GSD L++LL+ GH + +VRDMVISF++AGRDTTS+A
Sbjct  258   ESVNEIIRKKKKEISERNNV---SGSDLLTKLLEGGHDEIMVRDMVISFIMAGRDTTSAA  314

Query  727   LTWFFWLLSKHPNIETTVIKQV------LSSDDQ----KTLNFDHLREMNYIKACLCESM  578
             +TW  WLLSK+P+ E  ++K V       + DD+    ++ +++ L+EM Y+KACLCESM
Sbjct  315   MTWLLWLLSKNPSQEDLIVKGVKEVLGGKNKDDEFELMRSFDYEGLKEMKYLKACLCESM  374

Query  577   RLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE  398
             RLYPPVAWDSKHAAN+DVLPDGT + +G+RVT+ PY MGRME LWG DW EFKP+RWF+E
Sbjct  375   RLYPPVAWDSKHAANNDVLPDGTRVGKGDRVTYFPYGMGRMEALWGKDWNEFKPERWFEE  434

Query  397   ---------QGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCES  245
                      +G LK +SP+KF VFQAGPRVCLGK+MAFIQM++VVASIL +FEIRPV   
Sbjct  435   PIEEGGNNNEGVLKYVSPYKFSVFQAGPRVCLGKDMAFIQMEYVVASILNQFEIRPVSID  494

Query  244   QPVFVPLLTGYMAKGLYVRVHMR  176
             QPVFVP LT YM  G  VRVH R
Sbjct  495   QPVFVPFLTAYMDGGFNVRVHKR  517



>gb|KCW83158.1| hypothetical protein EUGRSUZ_B00113, partial [Eucalyptus grandis]
Length=505

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/479 (60%), Positives = 357/479 (75%), Gaps = 14/479 (3%)
 Frame = -1

Query  1570  IVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             I + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE
Sbjct  28    ISHGPPSHPIIGCLLSFYRNRSRLLDWYTDLLSQSPTQTIVIHRLGACRTVVTANPDNVE  87

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++LKNNF N+PKG P   ILGDFLG GIFNVDG LWS QRKLASHEF+  SLR+ V++TL
Sbjct  88    HVLKNNFHNYPKGVPFTCILGDFLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVVRTL  147

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             E EV+ RL PLL+  A     LDLQD+LRRFAFDT+C++                  LV 
Sbjct  148   EAEVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRPLPPLVT  206

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EK  860
             AF+ AS I A RG +PV+ VWK KR  N+GSE KL E + +VHD + +IIR RK+   ++
Sbjct  207   AFENASRICAMRGTSPVYLVWKIKRVLNIGSENKLAEAVNLVHDDILDIIRSRKKKLLKQ  266

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
              ++       D LSR L AGH +E+VRDM ISF++AGRDTTS+A+TW F LL+++ N E 
Sbjct  267   NDDQQIKYDGDLLSRFLAAGHSEEMVRDMAISFVMAGRDTTSAAMTWLFLLLAQNSNAEE  326

Query  679   TVIKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
              ++ +V S  D+   K L+F  L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGT
Sbjct  327   AIVSEVDSILDRSYNKCLDFKALKEMRFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGT  386

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-------QGKLKMISPFKFPVFQ  350
              + +G+RVT+ PY MGRM+ LWG D LEFKPDRW  E       +G+L+ +SP+K+PVFQ
Sbjct  387   LVKKGDRVTYFPYGMGRMKELWGEDRLEFKPDRWLVEPGMDGGAEGELRAVSPYKYPVFQ  446

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AGPRVCLGKEMAFIQMK+VVASIL+RFEIRPV E++PVFVPLLT +MA GL V V  R+
Sbjct  447   AGPRVCLGKEMAFIQMKYVVASILQRFEIRPVLENRPVFVPLLTAHMAGGLKVVVKKRK  505



>ref|XP_010026539.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW83160.1| hypothetical protein EUGRSUZ_B00115 [Eucalyptus grandis]
Length=518

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/477 (60%), Positives = 355/477 (74%), Gaps = 14/477 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT TIV+HRLGA RTVVTA+ +NVE++
Sbjct  38    HGPPSHPIIGCLLSFYQNRSRLLDWYTDLLSRSPTHTIVIHRLGACRTVVTANPDNVEHV  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L+ NF N+PKG P   ILGD LG GIFNVDG LWS QRKLASHEF+  SLR+ +++TLE 
Sbjct  98    LRANFHNYPKGVPFTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEA  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+ RL PLL+  A     LDLQD+LRRFAFDT+C+I                  LV AF
Sbjct  158   EVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQI-SLGTDPDCLDLSRPLPPLVTAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EKAN  854
             + AS I A R  +PV+ VWK KRA N+GSEKKL E +K+VHD + +IIR RK+   ++ +
Sbjct  217   ENASRICAMRATSPVYLVWKIKRALNIGSEKKLAEAVKLVHDDILDIIRNRKKKLLQEND  276

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             +       D LSR L AGH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E  +
Sbjct  277   DQQIKYDGDLLSRFLAAGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAI  336

Query  673   IKQVLSSDD---QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +V S  D   +  L+F+ L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGTP+
Sbjct  337   VSEVDSILDRSYKNCLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPV  396

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMISPFKFPVFQAG  344
              +G+RVT+ PY MGRM+ LWG D LEFKPDRW          +G+L+ +SP+KFPVFQAG
Sbjct  397   RKGDRVTYFPYGMGRMKELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAG  456

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             PRVCLGKEMAFIQMK+VVASIL RFEIRPV E++P FVPLLT +M  GL V V+ R+
Sbjct  457   PRVCLGKEMAFIQMKYVVASILGRFEIRPVLENRPAFVPLLTAHMTGGLKVVVNKRQ  513



>ref|XP_008464443.1| PREDICTED: cytochrome P450 94B3 [Cucumis melo]
Length=513

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/479 (60%), Positives = 357/479 (75%), Gaps = 13/479 (3%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             +K   Y+P SYP +GCL+SFYKNR  LL WYT LL+ SPT+TIV+HRLG+ RT++TA+  
Sbjct  34    RKRFYYSPSSYPFVGCLISFYKNRRRLLAWYTDLLSDSPTRTIVLHRLGSRRTILTANPA  93

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVE+MLK NFLN+PKG+P   ILGD LG GIFNVDGDLWS QRKLASH F+A+SLRE V+
Sbjct  94    NVEHMLKTNFLNYPKGKPFTDILGDLLGCGIFNVDGDLWSTQRKLASHAFSAKSLREFVV  153

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
             KTLE+EV  RL PLL  AAR ++V+DLQDVL R AFDT+CK+                  
Sbjct  154   KTLEDEVHFRLIPLLHNAARTNAVVDLQDVLGRLAFDTVCKV-TLGTDEQCLDMSRPIPE  212

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR----  872
             +V+AFD A+ ISARR +AP++  WK KR  N+GSEKKL+E ++ VH+ +  II  +    
Sbjct  213   IVNAFDVATAISARRAVAPLYLTWKAKRMLNLGSEKKLKEVVQTVHEWISNIIHSKLLNN  272

Query  871   -KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
                   +N      +D LSRLL AG  +EVVRDM++SF++AGRDTTS+A+TW FWLL+ H
Sbjct  273   NNNNTVHNHNQTHNNDLLSRLLSAGLDEEVVRDMIVSFIMAGRDTTSAAMTWLFWLLTNH  332

Query  694   PNIETTVIKQVLS-SDDQKTLN----FDHLREMNYIKACLCESMRLYPPVAWDSKHAAND  530
              NIE T+I +  S SDD KT +    ++ L++M Y+KACLCESMRLYPPVAWDSKHAA  
Sbjct  333   RNIEQTIINEATSLSDDSKTTSLGYGYEELKDMKYLKACLCESMRLYPPVAWDSKHAAAA  392

Query  529   DVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQ  350
             D+LPDGT + +G+RVT+ PY MGRME LWG D LEFKP+RWF + G+LK +SPFKFPVFQ
Sbjct  393   DILPDGTQVRKGDRVTYFPYGMGRMEELWGKDRLEFKPERWF-QNGELKTVSPFKFPVFQ  451

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
             AGPR+CLG EMAFIQMK+V+A++L+RFE RPV E+  PVFVPLLT +MA GL V V  R
Sbjct  452   AGPRMCLGMEMAFIQMKYVMATVLKRFEFRPVSENNVPVFVPLLTAHMAGGLQVFVRER  510



>gb|EYU43048.1| hypothetical protein MIMGU_mgv1a026913mg, partial [Erythranthe 
guttata]
Length=462

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/459 (65%), Positives = 349/459 (76%), Gaps = 4/459 (1%)
 Frame = -1

Query  1537  GCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFP  1358
              CL+SFYKNR  LL WYT LL+ S T+TIVVHRL APRT+VTA+ +NVEY+LK  F NFP
Sbjct  3     ACLISFYKNRRRLLSWYTDLLSESATQTIVVHRLWAPRTIVTANPDNVEYILKTRFSNFP  62

Query  1357  KGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPL  1178
             KG+P  ++LGDFLG GIFNVDG  WS QRKLASHEF+A+SLRE V+K LE+EV  RL P+
Sbjct  63    KGKPFTELLGDFLGVGIFNVDGGQWSVQRKLASHEFSAKSLREFVVKVLEDEVSKRLIPI  122

Query  1177  LEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISAR  998
             LE AA N  VLD+Q+VLRRFAFDTIC +SLG DP CL  S +    L  AFD ASEISA 
Sbjct  123   LENAAENGGVLDMQEVLRRFAFDTICHVSLGIDPCCLDFSRAPPP-LAAAFDAASEISAM  181

Query  997   RGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR-KQEKANNIAAGAGSDFL  821
             RG APV AVW+ KRA N+GSE++L+E +K+V   V+E+I  R K        +G G D L
Sbjct  182   RGAAPVSAVWRLKRALNLGSERELKEAVKLVRGCVDEMISERIKNGGGGGGGSGGGGDLL  241

Query  820   SRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSSDD--  647
             SR L AG +DE+VRDMVISFL+AGRDTTSSA+TW  WLLS H  IE   ++++ S  D  
Sbjct  242   SRFLGAGLEDEMVRDMVISFLMAGRDTTSSAVTWLLWLLSGHRGIEKRAVEEIASIGDTT  301

Query  646   QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYA  467
             Q+ L FD L+EMN+I+ACLCESMRLYPPV WDSKHAA DDVLPDGTP+ RG+RVT+  Y 
Sbjct  302   QRQLGFDDLKEMNFIQACLCESMRLYPPVVWDSKHAAEDDVLPDGTPVSRGDRVTYFQYG  361

Query  466   MGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVA  287
             MGRME LWG D LEF+PDRW D  G +K +SP+K+PVFQAGPRVCLGKEMAFIQMK+VVA
Sbjct  362   MGRMEELWGPDRLEFRPDRWLDRAGSVKKVSPYKYPVFQAGPRVCLGKEMAFIQMKYVVA  421

Query  286   SILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             S+L RFE+ PV    P FVPLLT YMA G  VRV  R G
Sbjct  422   SVLSRFELVPVRPETPAFVPLLTAYMAGGFNVRVRRRRG  460



>ref|XP_010026558.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW83164.1| hypothetical protein EUGRSUZ_B00119 [Eucalyptus grandis]
Length=514

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/477 (60%), Positives = 351/477 (74%), Gaps = 16/477 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPSYPIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE++
Sbjct  39    HGPPSYPIIGCLLSFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHV  98

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG P   ILGD LG GIFNVDG LWS QRKLASHEF+  SLR+ V++ LE 
Sbjct  99    LKANFHNYPKGVPFTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVLRMLEA  158

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+ RL PLL+  A     LDLQD+L+RF FDT+C++                  LV AF
Sbjct  159   EVENRLLPLLQDYADTDRTLDLQDLLKRFTFDTVCQV-SLGTDPDCLDLSRPLPPLVTAF  217

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRK----QEKA  857
             + AS I A R  +PV+ VWK KRA ++GSEKKL E +K+VH  + +IIR RK    QE  
Sbjct  218   ENASRICAMRATSPVYLVWKIKRALSIGSEKKLAEAVKLVHGDILDIIRNRKKKLLQENG  277

Query  856   NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
             +      G D LSR L AGH +E+VRDMVISF++AGRDTTS+A+TW FWLL+++ N E  
Sbjct  278   DQQIKYDG-DLLSRFLAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEQA  336

Query  676   VIKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
             +I ++ S  DQ   K L F++L+EM ++KACLCESMRLYPP+ WDSKHA  DDVLPDGTP
Sbjct  337   IISEIDSILDQSCNKFLEFENLKEMKFLKACLCESMRLYPPITWDSKHATVDDVLPDGTP  396

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMISPFKFPVFQA  347
             + +G+RVT+ PY MGRME LWG D LEFKPDRW          +G+L+ +SPFK+PVFQA
Sbjct  397   VRKGDRVTYFPYGMGRMEELWGKDRLEFKPDRWLVGPGMEDGAKGELRAVSPFKYPVFQA  456

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GPRVCLGK+MAFIQMK+VVASILRRFEIRPV E+ P+FVPLLT +MA GL V V  R
Sbjct  457   GPRVCLGKQMAFIQMKYVVASILRRFEIRPVLENGPIFVPLLTAHMAGGLKVAVKKR  513



>ref|XP_009368544.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
 ref|XP_009375220.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
Length=512

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 358/475 (75%), Gaps = 13/475 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y PPSYPIIGC +SF KN++ LLDWYT LL++SP++TIVVHR+GA R VVTA+  NVE++
Sbjct  38    YGPPSYPIIGCFISFCKNQHNLLDWYTSLLSASPSQTIVVHRIGARRIVVTANPSNVEHI  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF+NFPKG+P+ + LGD LG GIFNVDGDLWS QRKLASHEF+ +SLRE V+KTLEE
Sbjct  98    LKTNFVNFPKGKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEE  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+GRL PLLE AA +  VLD+Q++L+ FAFDT+CK+                  LV AF
Sbjct  158   EVEGRLIPLLEEAAESQRVLDMQEILKMFAFDTVCKV-SLGTDPFCLDLSRPVPPLVKAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A+EISARR  AP++ +WK KRA ++GSEKKLRE +K+VH  V EII+ +K+    +  
Sbjct  217   DCAAEISARRARAPLYLMWKMKRALSIGSEKKLREAVKLVHGSVHEIIQNKKKILQRDEG  276

Query  844   AGAGS-DFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV--  674
                 S D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLSKHP+I   +  
Sbjct  277   KRIESRDILSRLLLAGHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPDITHKIVN  336

Query  673   --IKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
                  V+ ++  + L FD L++M +++A LCE+MRLYPPV WDSKHA  D VLPDGT + 
Sbjct  337   EVENVVVQNNGTEKLGFDDLQKMRFLRASLCETMRLYPPVPWDSKHAEVDTVLPDGTWVG  396

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQG-----KLKMISPFKFPVFQAGPR  338
             +G+RVT+ PY MGRME LWG D  EF PDRWFD E G      LK +SP+KFPVFQAGPR
Sbjct  397   KGDRVTYFPYGMGRMEELWGKDRFEFNPDRWFDIEPGCDGDRVLKFVSPYKFPVFQAGPR  456

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             VCLGKEMAFIQMK+V+AS+LRRFEIRPVC E +P FVPLLT +MA GL V V  R
Sbjct  457   VCLGKEMAFIQMKYVMASVLRRFEIRPVCGEDRPAFVPLLTAHMAGGLKVLVRKR  511



>ref|XP_003516338.1| PREDICTED: cytochrome P450 94A2-like [Glycine max]
Length=506

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/472 (61%), Positives = 354/472 (75%), Gaps = 10/472 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P S+PIIGCL+SFY+NR+ LLDWYT+ LA+SPT+TIVV RLGA RTVVTA+  NVEY+
Sbjct  33    HAPLSHPIIGCLVSFYQNRHRLLDWYTEQLANSPTQTIVVRRLGARRTVVTANPRNVEYI  92

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P  +ILGDFLG GIFNVDG+LW  QRKLAS+ F+ RSL++ ++KTL+E
Sbjct  93    LKTNFGNFPKGKPFTEILGDFLGCGIFNVDGELWHTQRKLASNAFSTRSLKDFIVKTLQE  152

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV  RL PLLE AAR + V+DLQDVL R  FDT+CK+       C          L+ AF
Sbjct  153   EVQQRLVPLLEHAARENHVIDLQDVLSRLTFDTVCKV-SLGYDPCCLDLSKPLPPLLTAF  211

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D ASE+SA RG APVF VWK KR  NVGSEK L+E +K+VH+ V  II+++K+E   N  
Sbjct  212   DTASEVSAARGSAPVFLVWKMKRMLNVGSEKALKEAVKLVHESVMNIIKLKKEEIRFN--  269

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                G+D L RLL+A H++ VVRDMVIS ++AGRDTTS+A+TW FWLLS+H   E +++K+
Sbjct  270   RKNGTDLLDRLLEACHEEIVVRDMVISMIMAGRDTTSAAMTWLFWLLSRHREQEASLVKE  329

Query  664   VLSSDDQKT---LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             V   ++Q     L+++ L+EM  +KACLCESMRLYPPVAWDSKHA   DVLPDGT + +G
Sbjct  330   VYDENNQNQGLGLDYECLKEMKLLKACLCESMRLYPPVAWDSKHAGGADVLPDGTHVEKG  389

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQ----GKLKMISPFKFPVFQAGPRVCLG  326
             +RVT+ PY MGRME LWG +  EFKP RWF E+    G LK ++P+ FPVFQAGPRVCLG
Sbjct  390   DRVTYFPYGMGRMEALWGENCCEFKPQRWFHEENVDNGILKCVNPYMFPVFQAGPRVCLG  449

Query  325   KEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             +EMAFIQMK+VVASIL RF I PV + QP FVPLLT +MA G  VRVH R G
Sbjct  450   REMAFIQMKYVVASILNRFVISPVSDEQPRFVPLLTAHMAGGFIVRVHKRNG  501



>ref|XP_010045497.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=518

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/471 (61%), Positives = 353/471 (75%), Gaps = 14/471 (3%)
 Frame = -1

Query  1570  IVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             I + PPS+PIIGCLLSFY+NR  LLDWYT LL+ SPT+TIV+HRLGA RTVVTA+ +NVE
Sbjct  36    ISHGPPSHPIIGCLLSFYRNRSRLLDWYTDLLSQSPTQTIVIHRLGACRTVVTANPDNVE  95

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++LKNNF N+PKG P   ILGDFLG GIFNVDG LWS QRKLASHEF+  SLR+ V++TL
Sbjct  96    HVLKNNFHNYPKGVPFTCILGDFLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVVRTL  155

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             E EV+ RL PLL+  A     LDLQD+LRRFAFDT+C++                  LV 
Sbjct  156   EAEVENRLLPLLQDYADTDRTLDLQDLLRRFAFDTVCQV-SLGTDPDCLDLSRPLPPLVT  214

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQ---EK  860
             AF+ AS I A RG +PV+ VWK KR  N+GSE KL E + +VHD + +IIR RK+   ++
Sbjct  215   AFENASRICAMRGTSPVYLVWKIKRVLNIGSENKLAEAVNLVHDDILDIIRSRKKKLLKQ  274

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
              ++       D LSR L AGH +E+VRDM ISF++AGRDTTS+A+TW F LL+++ N E 
Sbjct  275   NDDQQIKYDGDLLSRFLAAGHSEEMVRDMAISFVMAGRDTTSAAMTWLFLLLAQNSNAEE  334

Query  679   TVIKQVLSSDDQ---KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
              ++ +V S  D+   K L+F  L+EM ++KACLCESMRLYPPVAWDSKHAA DDVLPDGT
Sbjct  335   AIVSEVDSILDRSYNKCLDFKALKEMRFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGT  394

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-------QGKLKMISPFKFPVFQ  350
              + +G+RVT+ PY MGRM+ LWG D LEFKPDRW  E       +G+L+ +SP+K+PVFQ
Sbjct  395   LVKKGDRVTYFPYGMGRMKELWGEDRLEFKPDRWLVEPGMDGGAEGELRAVSPYKYPVFQ  454

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGL  197
             AGPRVCLGKEMAFIQMK+VVASIL+RFEIRPV E++PVFVPLLT +MA GL
Sbjct  455   AGPRVCLGKEMAFIQMKYVVASILQRFEIRPVLENRPVFVPLLTAHMAGGL  505



>gb|KEH22037.1| cytochrome P450 family protein [Medicago truncatula]
Length=511

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/478 (59%), Positives = 356/478 (74%), Gaps = 12/478 (3%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             KKL+   P +YP+IGCL+SFYKNR+ LLDWYTKLLA SPT TI+V RLGA RT+VTA+  
Sbjct  33    KKLVGTGPTTYPVIGCLISFYKNRFRLLDWYTKLLAQSPTNTILVQRLGARRTIVTANQH  92

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVEY+LK NF NFPKG+P  +IL DFLG+GIFNVD DLW  QRKLASHEF+ RS+ E +M
Sbjct  93    NVEYVLKTNFKNFPKGKPFREILSDFLGKGIFNVDDDLWMIQRKLASHEFSLRSINEFIM  152

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICK----Islgsdpgclsssds  1052
              TLEEEV G+L PL+++ +  + V+D Q++L RF+F+ +CK    I    D  C      
Sbjct  153   HTLEEEVKGKLIPLMDSLSIENKVVDFQELLGRFSFNVVCKFTLGIDDDDDNRCCLDPCF  212

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 L  AFD A+EISARRG AP+F VW+ K+   VGSE++LR+ +K V   V E+I  R
Sbjct  213   PISPLAKAFDVAAEISARRGAAPLFLVWRVKKWLGVGSERRLRDAVKEVKILVMEMILER  272

Query  871   KQEKANNIAAG---AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLS  701
             K  K  N+       G D LSRL+ +GH++EV+RDMVISF++AGRDTTSSALTWFFWLLS
Sbjct  273   K--KMMNVKGEELVGGQDLLSRLISSGHEEEVIRDMVISFIMAGRDTTSSALTWFFWLLS  330

Query  700   KHPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
             ++ +IE  ++K+  +  + +TL+++ L+ MN++KACLCESMRLYPP+AWDSKHA  DDVL
Sbjct  331   RYSDIEHKILKESENKLNNETLDYESLKNMNFLKACLCESMRLYPPIAWDSKHATCDDVL  390

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK---LKMISPFKFPVFQ  350
             PDGT +  G+RVT+ PY MGRMENLWG DW EF+PDRWF E      L  + P+KFP+FQ
Sbjct  391   PDGTLVKCGDRVTYFPYGMGRMENLWGKDWFEFRPDRWFVELNNEIILSEVCPYKFPIFQ  450

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             AGPRVCLGKEMAFIQMK+VVASILRRF I+ V + +P+FVPLLT +MA GL V V  R
Sbjct  451   AGPRVCLGKEMAFIQMKYVVASILRRFRIKIVSDKKPIFVPLLTAHMAGGLKVLVSKR  508



>ref|XP_003522151.1| PREDICTED: cytochrome P450 94A2-like [Glycine max]
 ref|XP_003522152.1| PREDICTED: cytochrome P450 94A2-like [Glycine max]
Length=508

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/470 (61%), Positives = 353/470 (75%), Gaps = 7/470 (1%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P S+PIIGCL+SFY+NR+ LLDWYT+ LA+SPT+TIVV RLGA RTVVTA+  NVEY+
Sbjct  34    HAPLSHPIIGCLVSFYQNRHRLLDWYTEHLANSPTQTIVVRRLGARRTVVTANPRNVEYI  93

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P  +ILGD LG GIFNVDG+LW  QRKLASHEF+ RSL++ ++KTL+E
Sbjct  94    LKTNFGNFPKGKPFTEILGDLLGCGIFNVDGELWHTQRKLASHEFSTRSLKDFIVKTLQE  153

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E   RL PLLE AAR S V+DLQDVLRR  FDT+C++                  L+ AF
Sbjct  154   ETQQRLLPLLEHAARESHVIDLQDVLRRLTFDTVCRV-SLGYDPSCLDLAKPLPPLLTAF  212

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D ASE+SA RG APVF VWK KR  NVGSEK L+E +K+VH+ V +II+ +K + A N  
Sbjct  213   DTASEVSAARGAAPVFLVWKMKRILNVGSEKSLKEAVKLVHESVVKIIKAKKDKIAFN-E  271

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                G D L RLL AGH++ VVRDMVIS ++AGRDTTS+A+TW FWLLSKH   E +++K+
Sbjct  272   RNCGMDLLDRLLKAGHEEIVVRDMVISMIMAGRDTTSAAMTWLFWLLSKHREQEASLVKE  331

Query  664   V-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
                  ++ K L+++ L+EM  +KACLCESMRLYPPVAWDSKHA   DVLPDGT + +G+R
Sbjct  332   FSCGENENKCLDYECLKEMKLLKACLCESMRLYPPVAWDSKHAGGADVLPDGTHVGKGDR  391

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQ----GKLKMISPFKFPVFQAGPRVCLGKE  320
             VT+ PY MGRME LWG D  EFKP+RWFDE+    G LK ++P+KFPVFQAGPRVC+G+E
Sbjct  392   VTYFPYGMGRMEALWGKDCCEFKPERWFDEESVKKGVLKCVNPYKFPVFQAGPRVCIGRE  451

Query  319   MAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             MAFIQM++VVASIL RF I PV +  P FVPLLT +MA G  VRVH R G
Sbjct  452   MAFIQMEYVVASILNRFVISPVSDDYPRFVPLLTAHMAGGFKVRVHYRNG  501



>ref|XP_008346695.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
 ref|XP_008346696.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
Length=513

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/479 (60%), Positives = 357/479 (75%), Gaps = 20/479 (4%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y PPSYPIIGC +SF KN++ LLDWYT LL++SP++TIVVHR+GA R VVTA+  NVE++
Sbjct  38    YGPPSYPIIGCFISFCKNQHNLLDWYTSLLSASPSQTIVVHRIGARRIVVTANPSNVEHI  97

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P+ + LGD LG GIFNVDGDLWS QRKLASHEF+ +SLRE V+KTLEE
Sbjct  98    LKTNFTNFPKGKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEE  157

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+GRL PLLE  A +  VLD+Q++L+ FAFDT+CK+                  LV AF
Sbjct  158   EVEGRLIPLLEEVAESQRVLDMQEILKMFAFDTVCKV-SLGTDPFCLDLSRPVPPLVKAF  216

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEII----RVRKQEKA  857
             D A+EISARR  AP++ +WK KRA ++GSEKKLRE + +VH  V EII    ++ ++++ 
Sbjct  217   DCAAEISARRATAPLYLMWKMKRALSIGSEKKLREAVNLVHGSVHEIIQNKRKILERDEG  276

Query  856   NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
               I +    D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLSKHP+I   
Sbjct  277   ERIES---HDILSRLLLAGHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPDITHK  333

Query  676   V----IKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             +       V+ ++  + L FD L++M +++A LCE+MRLYPPV WDSKHA  D VLPDGT
Sbjct  334   IVNEVENVVVQNNGTEKLGFDDLQKMRFLRASLCETMRLYPPVPWDSKHAEVDTVLPDGT  393

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-------EQGKLKMISPFKFPVFQ  350
              + +G+RVT+ PY MGRM+ LWG D  EF PDRWFD       +   LK +SP+KFPVFQ
Sbjct  394   WVGKGDRVTYFPYGMGRMKELWGKDRFEFNPDRWFDIEPGCDGDNKVLKFVSPYKFPVFQ  453

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             AGPRVCLGKEMAFIQMK+V+AS+LRRFEIRPVC E +PVFVPLLT +MA GL V V  R
Sbjct  454   AGPRVCLGKEMAFIQMKYVMASVLRRFEIRPVCGEDRPVFVPLLTAHMAGGLKVLVRKR  512



>ref|XP_004502138.1| PREDICTED: cytochrome P450 94A2-like [Cicer arietinum]
Length=515

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/481 (59%), Positives = 364/481 (76%), Gaps = 18/481 (4%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
              +TPPS+P+IGCL+SFY NR+ LLDWYT  L+ SPT+TI++HRLGA RT+VTA+  NVEY
Sbjct  31    THTPPSHPLIGCLISFYNNRHRLLDWYTLHLSQSPTQTILLHRLGARRTIVTANPLNVEY  90

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF+NFPKG+P  +ILGD LG GIFNVDG+LWS QRKLASHEF+ RSL+E ++K LE
Sbjct  91    ILKTNFINFPKGKPFTEILGDLLGCGIFNVDGELWSTQRKLASHEFSTRSLKEFIVKNLE  150

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             +EV  RL PLLE A  +++V+D+QDVLRR  FD +CK+       C          L+ A
Sbjct  151   DEVKQRLIPLLEEACNSNNVIDMQDVLRRLTFDIVCKV-SLGYDPCCLDLSKPLPPLLSA  209

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE--KAN  854
             FD+ASEISA R  +PVF +WK KR  N+GSEK L+E +K+VH  V +II+ +K+E  + N
Sbjct  210   FDRASEISAMRATSPVFFIWKVKRLLNIGSEKSLKEAVKLVHQSVIKIIKNKKKELSEKN  269

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             +    +GSD L++LL+AGH + +VRDMVIS ++AGRDTTS+A+TW F LLSKHPN E  +
Sbjct  270   DGNIVSGSDLLTKLLEAGHDEIMVRDMVISMIMAGRDTTSAAMTWLFSLLSKHPNKEALI  329

Query  673   IKQVL------SSDDQ----KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDV  524
             +K V       +++D+    ++ +++ L+EM Y+KACLCESMRLYPPVAWDSKHAA DDV
Sbjct  330   VKGVRKIFGGKNNNDKFELARSFDYEGLKEMKYLKACLCESMRLYPPVAWDSKHAARDDV  389

Query  523   LPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-----DEQGKLKMISPFKFP  359
             LPDGT + +G++VT+ PY MGRME LWG DW EFKPDRWF     D+   LK ++P+KF 
Sbjct  390   LPDGTRVGKGDKVTYFPYGMGRMEELWGKDWREFKPDRWFERREGDDNEVLKYVNPYKFS  449

Query  358   VFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHM  179
             VFQAGPRVCLGKEMAFI+M++VV++IL  FEIRPV   QPV+VPLLT +MA G  VRVH 
Sbjct  450   VFQAGPRVCLGKEMAFIEMEYVVSTILNGFEIRPVSVDQPVYVPLLTAHMAGGFKVRVHK  509

Query  178   R  176
             R
Sbjct  510   R  510



>gb|KFK34160.1| hypothetical protein AALP_AA5G108200 [Arabis alpina]
Length=503

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/473 (59%), Positives = 345/473 (73%), Gaps = 7/473 (1%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             KK  +Y PPSYP+IG +LSF KNR+ LL WYT+LL  SPT+TI +  LG  RT+VT + E
Sbjct  30    KKTTIYEPPSYPLIGSILSFNKNRHRLLQWYTELLRLSPTQTISIPLLGNRRTIVTTNPE  89

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVEY+LK NF NFPKG+P   +LGD LG+GIFNVDG  WS+QRKLASHEF+ RSLR    
Sbjct  90    NVEYILKTNFFNFPKGKPFTDLLGDLLGKGIFNVDGHSWSSQRKLASHEFSTRSLRSFAF  149

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
             + L++EV+ RL P+L  AA   + +DLQDVL+RFAFD +CK+                  
Sbjct  150   EVLKDEVETRLVPVLSTAADVGATMDLQDVLKRFAFDVVCKV-SLGWDPDCLDLSRPVNP  208

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEK  860
             L++AFD A+EISARR   PV+AVWK KR  NVGSE++LRE IK VH  V EI+R +K+  
Sbjct  209   LLEAFDTAAEISARRATEPVYAVWKMKRVLNVGSERRLREAIKTVHVLVSEIVRAKKKSL  268

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
                    A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLL+++  +E 
Sbjct  269   EIGTGVEAKQDLLSRFLAAGHDGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTENGEVER  328

Query  679   TVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
              ++++V        L F+ L++M+Y KACLCE+MRLYPPV+WDSKHAANDDVLPDGT + 
Sbjct  329   KILEEV-DPLVSLGLGFEELKDMSYTKACLCETMRLYPPVSWDSKHAANDDVLPDGTRVK  387

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQGK----LKMISPFKFPVFQAGPRV  335
             RG++VT+ PY MGRME LWG DW +FKP+RWFD E G     LK +SPFKFPVFQAGPRV
Sbjct  388   RGDKVTYFPYGMGRMETLWGKDWEQFKPNRWFDSEPGSIRPVLKPVSPFKFPVFQAGPRV  447

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             C+GKEMAF+QMK+VV S+L RFEI PV + QPVFVPLLT +MA GL V++  R
Sbjct  448   CVGKEMAFMQMKYVVGSVLSRFEIVPVKKDQPVFVPLLTAHMAGGLMVKIKRR  500



>ref|XP_002273811.3| PREDICTED: cytochrome P450 94B3 [Vitis vinifera]
Length=536

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/470 (60%), Positives = 352/470 (75%), Gaps = 9/470 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PP+YPIIGCLLSFY NR  LLDWYT L+A SPT+TIVVHR GA RT+VTA+ ENVEYMLK
Sbjct  64    PPTYPIIGCLLSFYSNRRRLLDWYTDLIAHSPTRTIVVHRFGARRTIVTANPENVEYMLK  123

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  QILGDFLG GIFNVDG+LW  QRKLASHEF A+S R+  +++L+EEV
Sbjct  124   TNFNNFPKGKPFTQILGDFLGCGIFNVDGELWRTQRKLASHEFGAKSWRQFAVRSLQEEV  183

Query  1198  DGRLSPLLEAAARNS-SVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             + RL PLLE+ A ++   +DLQ++LRR AF+ +CK+               A  L  AFD
Sbjct  184   EQRLLPLLESLAEDAHKTVDLQELLRRLAFNMVCKV-SLGIDPFSLDPSLPALPLARAFD  242

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR--VRKQEKANNI  848
              ASEI A R  APVFAVWK KRA  VGSE++LR+ I+ VH  V++IIR   +  EK  + 
Sbjct  243   TASEICAGRAAAPVFAVWKIKRALRVGSERRLRKAIEEVHACVDDIIRKKKKMMEKKGSD  302

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D L+RL+ AGH  EV+RD VISF++AGRDTTS+A+TW FWLLS+H +IE  ++K
Sbjct  303   DDNGNEDLLTRLISAGHGHEVIRDTVISFIMAGRDTTSAAMTWLFWLLSRHQDIEEELVK  362

Query  667   QV-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++  ++D +K L++D L EM  +KACLCESMRLYPPVAWDSKHA   D+LPDGTP+  G+
Sbjct  363   ELWATTDKEKCLDYDSLNEMKLLKACLCESMRLYPPVAWDSKHALTHDILPDGTPVRAGD  422

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCLGK  323
             RVT+ PY MGRME LWG D  EFKPDRWF     E+G+L+ + P++FP+FQAGPRVCLGK
Sbjct  423   RVTYFPYGMGRMEALWGKDRFEFKPDRWFLEPDKERGELRRVCPYRFPIFQAGPRVCLGK  482

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             E+AF+QMK+VV SILR+FEIRPV   +PVFVPLLT +MA GL V V  R+
Sbjct  483   EVAFLQMKYVVGSILRQFEIRPVGLDEPVFVPLLTAHMAGGLNVSVRRRQ  532



>gb|KGN63489.1| hypothetical protein Csa_1G002090 [Cucumis sativus]
Length=515

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/481 (59%), Positives = 353/481 (73%), Gaps = 15/481 (3%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             +K   Y+P SYP IGCL+SFYKNR  LL WYT LL+ SPT+TIV+HRLG+ RT++TA+  
Sbjct  34    RKRFYYSPSSYPFIGCLISFYKNRRRLLTWYTDLLSDSPTQTIVMHRLGSRRTILTANPA  93

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVE+MLK NFLN+PKG+P   ILGD LG GIFNVDGDLWS QRKLASH F+A+SLRE V+
Sbjct  94    NVEHMLKTNFLNYPKGKPFTDILGDLLGCGIFNVDGDLWSTQRKLASHAFSAKSLREFVV  153

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
             KTLE+EV  RL PLL  AAR ++VLDLQDVL R AFDT+CK+                  
Sbjct  154   KTLEDEVHFRLIPLLHNAARTNAVLDLQDVLGRLAFDTVCKV-TLGTDEQCLDMSRPIPE  212

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR----  872
             +V AFD A+ ISARR + P++  WK KR  N+GSEKKL++ ++ VH+ +  II  +    
Sbjct  213   IVKAFDVATAISARRAVTPLYLTWKVKRMLNLGSEKKLKQVVQTVHEWISNIIHNKVLNN  272

Query  871   -KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
                +  N+      SD LSRLL AG  +EV+RDM++SF++AGRDTTS+A+TW FWLL+ H
Sbjct  273   NDNKDRNHNQTQNNSDLLSRLLSAGLNEEVIRDMIVSFIMAGRDTTSAAMTWLFWLLTNH  332

Query  694   PNIETTVIKQVLSSDDQ---KTLN----FDHLREMNYIKACLCESMRLYPPVAWDSKHAA  536
              NIE T+I +  S  D    KT +    ++ L++M Y+KACLCESMRLYPPVAWDSKHAA
Sbjct  333   RNIEQTIINEATSLSDHDYSKTTSLGYGYEELKDMKYLKACLCESMRLYPPVAWDSKHAA  392

Query  535   NDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPV  356
               D+LPDGT + +G+RVT+ PY MGRME LWG D LEFKP+RWF + G+LK +S FKFPV
Sbjct  393   AADILPDGTQVRKGDRVTYFPYGMGRMEELWGKDRLEFKPERWF-QNGELKTVSAFKFPV  451

Query  355   FQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCE-SQPVFVPLLTGYMAKGLYVRVHM  179
             FQAGPR+CLG EMAFIQMK+V+A++L+RFE R V E ++PVFVPLLT +MA GL V V  
Sbjct  452   FQAGPRMCLGTEMAFIQMKYVMATVLKRFEFRRVSENNEPVFVPLLTAHMAGGLKVYVRE  511

Query  178   R  176
             R
Sbjct  512   R  512



>ref|XP_008368443.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94B3-like [Malus 
domestica]
Length=510

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/474 (61%), Positives = 348/474 (73%), Gaps = 11/474 (2%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
              Y P SYPIIGC +SFYKN + LLDWY  LL+ SP++TIVVHR+GA RTVVT +  NVE+
Sbjct  37    TYGPSSYPIIGCFISFYKNEHNLLDWYASLLSGSPSQTIVVHRIGARRTVVTGNPXNVEH  96

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF NFPK +P+ + LGD LG GIFNVDGDLWS QRKLASHEF+ +SLRE V+ TL 
Sbjct  97    ILKTNFANFPKXKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSIKSLREFVVNTLX  156

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             EEV+ RL PLLE AA +  VLD+Q++LRRFAFDT+ K+                  LV A
Sbjct  157   EEVEHRLIPLLEEAAESQKVLDMQEILRRFAFDTVSKV-SLGSDPFCLDLTRPVPPLVKA  215

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             F+ A+EISARR  A ++ +WK KRA ++GSEKKL+E +KVVH  V EII+ +K+    + 
Sbjct  216   FECAAEISARRSTAXLYLMWKIKRALSIGSEKKLKEAVKVVHGSVHEIIQNKKKVFERDG  275

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLSKHP+I   ++ 
Sbjct  276   ERSESHDMLSRLLLAGHSEEVVRDMVISFILAGRDTTSAAMTWJFWLLSKHPDITHKIVN  335

Query  667   QVLSSDDQKTL---NFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             +V +   Q+      FD L++M +++ACLCESMRLYPPV WDSKHA  D VLPDGT + +
Sbjct  336   EVENVVVQRNGTGNGFDDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVGK  395

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQG-----KLKMISPFKFPVFQAGPRV  335
             G+RVT+ PY MGRME LWG D  EF PDRWFD E G      LK +SP+KFPVFQAGPRV
Sbjct  396   GDRVTYFPYGMGRMEELWGXDRFEFNPDRWFDIESGCAGDKVLKSVSPYKFPVFQAGPRV  455

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             CLGKEMAFIQM +V+AS+LRRFEIRPVC E QP FVPLLT +MA GL V V  R
Sbjct  456   CLGKEMAFIQMMYVMASVLRRFEIRPVCGEDQPAFVPLLTAHMAGGLKVLVRKR  509



>ref|XP_008341677.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
Length=512

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/477 (61%), Positives = 348/477 (73%), Gaps = 15/477 (3%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
              Y P SYPIIGC +SFYKN + LLDWY  LL+ SP++TIVVHR+GA RTVVT +  NVE+
Sbjct  37    TYGPSSYPIIGCFISFYKNEHNLLDWYASLLSGSPSQTIVVHRIGARRTVVTGNPXNVEH  96

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF NFPK +P+ + LGD LG GIFNVDGDLWS QRKLASHEF+ +SLRE V+ TL 
Sbjct  97    ILKTNFANFPKXKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSIKSLREFVVNTLX  156

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             EEV+ RL PLLE AA +  VLD+Q++LRRFAFDT+ K+                  LV A
Sbjct  157   EEVEHRLIPLLEEAAESQKVLDMQEILRRFAFDTVSKV-SLGSDPFCLDLTRPVPPLVKA  215

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             F+ A+EISARR  A ++ +WK KRA ++GSEKKL+E +KVVH  V EII+ +K+    + 
Sbjct  216   FECAAEISARRSTAXLYLMWKIKRALSIGSEKKLKEAVKVVHGSVHEIIQNKKKVFERDG  275

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRLL AGH +EVVRDMVISF++AGRDTTS+A+TW FWLLSKHP+I T  I 
Sbjct  276   ERSESHDMLSRLLLAGHSEEVVRDMVISFILAGRDTTSAAMTWJFWLLSKHPDI-THKIV  334

Query  667   QVLSSDDQKT------LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
               + +   +T      L FD L++M +++ACLCESMRLYPPV WDSKHA  D VLPDGT 
Sbjct  335   NEVENVVVRTKKWYGKLGFDDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTW  394

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQG-----KLKMISPFKFPVFQAG  344
             + +G+RVT+ PY MGRME LWG D  EF PDRWFD E G      LK +SP+KFPVFQAG
Sbjct  395   VGKGDRVTYFPYGMGRMEELWGXDRFEFNPDRWFDIESGCAGDKVLKSVSPYKFPVFQAG  454

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             PRVCLGKEMAFIQM +V+AS+LRRFEIRPVC E QP FVPLLT +MA GL V V  R
Sbjct  455   PRVCLGKEMAFIQMMYVMASVLRRFEIRPVCGEDQPAFVPLLTAHMAGGLKVLVRKR  511



>ref|XP_010250748.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=516

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/474 (60%), Positives = 348/474 (73%), Gaps = 18/474 (4%)
 Frame = -1

Query  1555  PSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKN  1376
             P+YP+IGCL+SFYKNR  LLDWYT LLA SP +TIV+ R GA RTVVTA+ +NVEY+L  
Sbjct  42    PTYPLIGCLISFYKNRRRLLDWYTDLLADSPMQTIVIRRFGARRTVVTANPDNVEYILTT  101

Query  1375  NFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVD  1196
             NF NFPKG+P   ILGD LG GIFNVDG+LW AQRKLASHEF+ +SLRE V KTL + V 
Sbjct  102   NFNNFPKGQPFTDILGDLLGCGIFNVDGELWRAQRKLASHEFSTKSLREFVGKTLNQVVK  161

Query  1195  GRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKA  1016
              RL+P+L +A     ++DLQD+LRRFAFDT+C +           S     +L  AFD A
Sbjct  162   NRLTPVLASAMETDQIVDLQDLLRRFAFDTVCMV-SLGIDPGCLDSSLPVSALAGAFDIA  220

Query  1015  SEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEII---------RVRKQE  863
             SEISARR  APVFAVWK KRA  +GSE++L+E I+ VH  VEEII         RVRK+E
Sbjct  221   SEISARRASAPVFAVWKIKRALCLGSERRLKEAIQHVHGSVEEIIRDKKKLMLNRVRKEE  280

Query  862   KANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIE  683
               NN + G   D LSRL+ +G+ DEV+RDMVISF++AGRDT S+A+TW FWLLS HP+IE
Sbjct  281   INNNNSNG---DLLSRLISSGYDDEVIRDMVISFIMAGRDTASAAMTWLFWLLSCHPHIE  337

Query  682   TTVIKQVLSSDDQKT-LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
               V+K+V + +   + L+++ L+E+  +KACLCESMRLYPP+AWDSKH   DD LPDGT 
Sbjct  338   NEVVKEVEAINTGDSPLDYEALKELPLLKACLCESMRLYPPIAWDSKHVVEDDTLPDGTR  397

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPR  338
             +  G+RVT+ PY MGRME LWG D  EFKPDRWF     E G LK +SPFKFPVFQAGPR
Sbjct  398   VRAGDRVTYFPYGMGRMEGLWGKDRFEFKPDRWFVEPDKEGGALKEVSPFKFPVFQAGPR  457

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             VCLGKEMAF+QMK+V+AS+L++F+ + V   +P FVPLLT +MA GL V +  R
Sbjct  458   VCLGKEMAFVQMKYVMASLLKQFQFKSVGLEEPAFVPLLTAHMAGGLNVLIRPR  511



>ref|XP_010112360.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXC33355.1| Cytochrome P450 94A1 [Morus notabilis]
Length=523

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 343/479 (72%), Gaps = 7/479 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T H      + P +YPIIGCL+SFYKNR+ LL+WYT+LL  S T TIVV R GA RT+VT
Sbjct  43    TTHELSGTCHGPTTYPIIGCLVSFYKNRHRLLEWYTQLLEDSATNTIVVQRFGARRTIVT  102

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
             A+ ENVEYMLK NF NFPKG P  +ILGDFLG GIFNVDG+LW  QRKLASHEF+ +SL+
Sbjct  103   ANPENVEYMLKTNFNNFPKGRPFTEILGDFLGYGIFNVDGELWRTQRKLASHEFSTKSLK  162

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
             E  + T EEEV+ +L P +E+ A    V DLQD+LRRFAF+ ICK+             +
Sbjct  163   EYTVNTFEEEVENQLLPFMESLAMEEKVEDLQDLLRRFAFNIICKV-SMGIDRWSLDPSA  221

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 L  AFD ASEI ARRG AP+F VWK KR   VGSEK+L+  ++ V  HV EII  R
Sbjct  222   PVSPLARAFDAASEICARRGAAPLFLVWKIKRWLGVGSEKRLKSAVEQVRAHVMEIIHKR  281

Query  871   KQEKA-NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
             K E       +    D L+RL+ AGH +EV+RDMVISF++AGRDTTS+A+TW FW LS H
Sbjct  282   KTELIFEGEESSTSEDLLTRLITAGHGEEVIRDMVISFIMAGRDTTSAAMTWLFWSLSCH  341

Query  694   PNIETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             P++E  V+K++     +++ L+++ L+E+  +KACLCESMRLYPPVAWDSKHA +DD+LP
Sbjct  342   PDVEQQVVKEINDIVRERRRLDYESLKELKMLKACLCESMRLYPPVAWDSKHAVSDDLLP  401

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE----QGKLKMISPFKFPVFQ  350
             D T +  G+RVT+ PY MGRME LWG D  EFKPDRWF E    +G LK + PFK+P+FQ
Sbjct  402   DSTHVRAGDRVTYFPYGMGRMEALWGKDRFEFKPDRWFTEPDKDRGALKKVCPFKYPIFQ  461

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AGPRVCLGKEMAFIQMK+ VAS+LRRF+I PV   +PVFVPLLT +MA G  V +  RE
Sbjct  462   AGPRVCLGKEMAFIQMKYAVASVLRRFKIIPVGSDRPVFVPLLTAHMAGGFKVSISKRE  520



>ref|XP_009371650.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
Length=509

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/466 (61%), Positives = 349/466 (75%), Gaps = 8/466 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IGC +SFY NR  LLDWYT LLA S T TIVVHRLGA RTVVTA+ +NVEYMLK
Sbjct  42    PASYPVIGCFISFYNNRSRLLDWYTDLLAESTTNTIVVHRLGARRTVVTANPDNVEYMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDG+LW  QRKLASHEF+ +SLRE ++KTLEEEV
Sbjct  102   TNFNNFPKGKPFTEILGDFLGYGIFNVDGELWRTQRKLASHEFSTKSLREYMVKTLEEEV  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             +  L PL+E+ A  + V+DLQ++LRRFAF+ ICK+       C      ++  L  AFD 
Sbjct  162   EKGLLPLMESLATAAQVVDLQELLRRFAFNVICKV-FLGGERCCLDPSLASPPLAGAFDT  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE-KANNIAA  842
             ASEI ARRG APV  +WK KR   VGSE+KLR  I+ VH + ++II  RK+E +     +
Sbjct  221   ASEICARRGAAPVSIIWKIKRWLGVGSEQKLRVAIEEVHAYFKDIIERRKKEIEEAERDS  280

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             GA  D L+RL+ AGH++EV RDMVISF++AGRDTTS+A+TW FWLLS+ P +E  V+K++
Sbjct  281   GAHEDLLTRLITAGHEEEVTRDMVISFIMAGRDTTSAAMTWLFWLLSRQPGVEDDVVKEI  340

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
               S  +K  +F+ L E++ +KACL E+MRLYPPVAWDSKHA  DD+LPDGT +  G+RVT
Sbjct  341   -ESAGEKMSDFESL-ELSLLKACLYETMRLYPPVAWDSKHAVVDDLLPDGTRVQAGDRVT  398

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
             + PY MGRME LWG D LEFKPDRWF     E+  LK + P+K P+FQAGPRVCLGK+MA
Sbjct  399   YFPYGMGRMEALWGKDRLEFKPDRWFLEPDKERSALKKVCPYKLPIFQAGPRVCLGKDMA  458

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             FIQMK+VVASILRRFEI+PV   +PVFVP LT +MA GL V +  R
Sbjct  459   FIQMKYVVASILRRFEIKPVGSGEPVFVPRLTAHMAGGLKVLIRKR  504



>ref|XP_002300103.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE84908.1| cytochrome P450 family protein [Populus trichocarpa]
Length=514

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/466 (59%), Positives = 350/466 (75%), Gaps = 7/466 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PP+YPIIGCL+SFYKNR  LLDWYT+LLA S T TIVVHRLGA RT+VTA+ +NVEYM
Sbjct  42    HKPPTYPIIGCLISFYKNRGRLLDWYTELLAESATNTIVVHRLGARRTIVTANPKNVEYM  101

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P  +ILGDFLG GIFNVDG+LW AQRK ASHEF+A+SLRE  M TLEE
Sbjct  102   LKTNFNNFPKGQPFTEILGDFLGYGIFNVDGELWRAQRKFASHEFSAKSLREFFMITLEE  161

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+  L P+LE+ A  + V+DLQ++LRRFAF+ + K+       C          L  AF
Sbjct  162   EVEKGLLPILESLAVTAEVVDLQELLRRFAFNMVLKV-SLGIDRCCLDPSQPVPPLTRAF  220

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D+ASEI A+RG AP+F VWK K+   +GSE++L+  ++ VH +V EII  +K+       
Sbjct  221   DEASEICAKRGAAPLFIVWKMKKWLGIGSERQLKSAVEEVHRYVSEIIINKKRMIEE--G  278

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                  D LSRL+ AGH++EV+RDMVISF++AGRDTTS+A+TW FWLLS HP+IE  V+K+
Sbjct  279   ESRSEDLLSRLILAGHEEEVIRDMVISFIMAGRDTTSAAMTWLFWLLSCHPDIEKEVVKE  338

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
                   ++ L++D L+E+N +KACLCESMRLYPP+AWDSKHA   D+LPD TP+  G+RV
Sbjct  339   T-RLLMERMLDYDSLKELNLLKACLCESMRLYPPIAWDSKHAVVSDLLPDNTPVRAGDRV  397

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWF---DEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
             T+ PY MGRME LWG D  +FKPDRWF   +++ +L+ + P KFP+FQAGPRVCLGKEMA
Sbjct  398   TYFPYGMGRMEALWGEDCFKFKPDRWFVEANDRRELQEVCPCKFPIFQAGPRVCLGKEMA  457

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             FIQMK+V+ASIL RF+I+P+  + PVFVPLLT +MA GL V V  R
Sbjct  458   FIQMKYVMASILDRFKIKPLSSASPVFVPLLTAHMAGGLEVLVQKR  503



>ref|XP_006470124.1| PREDICTED: cytochrome P450 94A2-like [Citrus sinensis]
Length=497

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/463 (59%), Positives = 350/463 (76%), Gaps = 8/463 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PP++P+IGCL+SFY+NR+ LLDWYT+LLA S T TIVV R GA RT+VTA+ ENVEY+LK
Sbjct  39    PPTFPVIGCLISFYRNRHRLLDWYTELLAKSATNTIVVSRFGARRTIVTANPENVEYILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDG+LW +QRK+ASHEF+  SLRE VM TL++EV
Sbjct  99    TNFNNFPKGKPFTEILGDFLGYGIFNVDGELWRSQRKMASHEFSTNSLREFVMNTLKDEV  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             D RL PL+++ A++S  +DLQ++L R AF+ ICK+       C     S A  L  AFD 
Sbjct  159   DNRLLPLMDSLAKSSEEVDLQELLTRLAFNMICKV-SMGIDRCCLDPSSPAPPLAKAFDM  217

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             ASEISARRG AP+F VWK K+   +GSE++L++ +++V ++VEEII  +K          
Sbjct  218   ASEISARRGAAPLFIVWKIKKWLGIGSERQLKDAVELVREYVEEIIHNKKMTVRQ--GEN  275

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV-  662
                D LSRL+ +G ++EV+RDM IS ++AGRDTTS+A+ W FWL+S H +IE  ++K+  
Sbjct  276   DSQDLLSRLIASGQEEEVIRDMAISLIMAGRDTTSAAMVWLFWLISCHQDIEQKLVKETG  335

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
             L S+D   ++++ L+E+  +KAC+CESMRLYPPVAWDSKHAA DD+LPDGT +  G+RVT
Sbjct  336   LVSED---IDYESLKELRLLKACICESMRLYPPVAWDSKHAAADDLLPDGTAVQAGDRVT  392

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQM  302
             + PY MGRME LWGNDW EFKP RW   QG+   + P+KFPVFQAGPRVCLGKEMAFIQM
Sbjct  393   YFPYGMGRMEALWGNDWFEFKPQRWLS-QGEPDKVCPYKFPVFQAGPRVCLGKEMAFIQM  451

Query  301   KFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             K+VVAS+LRR++IRPV   QPVFVP LT +MA GL V V  RE
Sbjct  452   KYVVASVLRRYQIRPVRSGQPVFVPRLTAHMAGGLKVFVRRRE  494



>ref|XP_009150186.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
Length=502

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/478 (57%), Positives = 344/478 (72%), Gaps = 7/478 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++  V  PPSYP+IG +LSF KNR+ LL WYTKLL  SP++TI +  LG  RT+VT
Sbjct  25    TKKTQETNVNGPPSYPLIGSILSFNKNRHRLLQWYTKLLRLSPSQTITIPLLGNRRTIVT  84

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
              + ENVEY+LK NF NFPKG P   +LGD LG+GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  85    TNPENVEYILKTNFFNFPKGRPFTDLLGDLLGQGIFNVDGHSWSSQRKLASHEFSTRSLR  144

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L EEV+ R+ P+L  AA   + +DLQDV +RFAFD +CK+              
Sbjct  145   SFAFEVLREEVETRIVPVLSTAADVGTTVDLQDVFKRFAFDVVCKV-SLGWDPDCLDLTR  203

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 L +AFD A+EISARR   P++AVWK KR  NVGSE++LRE I+ VH+ V EI+R +
Sbjct  204   PVNPLAEAFDTAAEISARRATEPLYAVWKAKRVLNVGSERRLREAIRTVHELVSEIVRAK  263

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             ++         A  D LSR L +GH  E VRDMVISF++AGRDTTS+A+TW FWLLS++ 
Sbjct  264   RKSLEIGTGQEAKQDLLSRFLASGHDSEAVRDMVISFIMAGRDTTSAAMTWLFWLLSEND  323

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++++V        L F+ L+EM+Y+KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  324   DVEKKLLQEV-EPLMSLGLGFEELKEMSYMKACLCEAMRLYPPVSWDSKHAANDDVLPDG  382

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVFQA  347
             T + +G++VT+ PY MGRMENLWG D  EFKP RWFD +       LK +SPFKFPVFQA
Sbjct  383   TRVKKGDKVTYFPYGMGRMENLWGKDCEEFKPSRWFDSEPGITEPVLKPVSPFKFPVFQA  442

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             GPRVC+GKEMAF+QMKFVV S+L RFEI PV + +PVFVPLLT +MA GL V++  RE
Sbjct  443   GPRVCIGKEMAFMQMKFVVGSVLSRFEIIPVSKHKPVFVPLLTAHMAGGLKVKIKRRE  500



>ref|XP_006447077.1| hypothetical protein CICLE_v10017920mg [Citrus clementina]
 gb|ESR60317.1| hypothetical protein CICLE_v10017920mg [Citrus clementina]
Length=492

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/463 (59%), Positives = 350/463 (76%), Gaps = 8/463 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PP++P+IGCL+SFY+NR+ LLDWYT+LLA S T TIVV R GA RT+VTA+ ENVEY+LK
Sbjct  34    PPTFPVIGCLISFYRNRHRLLDWYTELLAKSATNTIVVSRFGARRTIVTANPENVEYILK  93

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDG+LW +QRK+ASHEF+  SLRE VM TL++EV
Sbjct  94    TNFNNFPKGKPFTEILGDFLGYGIFNVDGELWRSQRKMASHEFSTNSLREFVMNTLKDEV  153

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             D RL PL+++ A++S  +DLQ++L R AF+ ICK+       C     S A  L  AFD 
Sbjct  154   DNRLLPLMDSLAKSSEEVDLQELLTRLAFNMICKV-SMGIDRCCLDPSSPAPPLAKAFDM  212

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             ASEISARRG AP+F VWK K+   +GSE++L++ +++V ++VEEII  +K          
Sbjct  213   ASEISARRGAAPLFIVWKIKKWLGIGSERQLKDAVELVREYVEEIIHNKKMTVRQ--GEN  270

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV-  662
                D LSRL+ +G ++EV+RDM IS ++AGRDTTS+A+ W FWL+S H +IE  ++K+  
Sbjct  271   DSQDLLSRLIASGQEEEVIRDMAISLIMAGRDTTSAAMVWLFWLISCHQDIEQKLVKETG  330

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
             L S+D   ++++ L+E+  +KAC+CESMRLYPPVAWDSKHAA DD+LPDGT +  G+RVT
Sbjct  331   LVSED---IDYESLKELRLLKACICESMRLYPPVAWDSKHAAADDLLPDGTAVQAGDRVT  387

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQM  302
             + PY MGRME LWGNDW EFKP RW   QG+   + P+KFPVFQAGPRVCLGKEMAFIQM
Sbjct  388   YFPYGMGRMEALWGNDWFEFKPQRWLS-QGEPDKVCPYKFPVFQAGPRVCLGKEMAFIQM  446

Query  301   KFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             K+VVAS+LRR++IRPV   QPVFVP LT +MA GL V V  RE
Sbjct  447   KYVVASVLRRYQIRPVRSGQPVFVPRLTAHMAGGLKVFVRRRE  489



>ref|XP_008341306.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
Length=506

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/466 (61%), Positives = 347/466 (74%), Gaps = 8/466 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IGC +SFY NR  LLDWYT LLA S T TIVVHRLGA RTVVTA+ +NVEYMLK
Sbjct  42    PASYPVIGCFISFYYNRSRLLDWYTDLLAESTTNTIVVHRLGARRTVVTANPDNVEYMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDG+LW  QRKLASHEF+ +SLRE +++TLEEEV
Sbjct  102   TNFNNFPKGKPFTEILGDFLGYGIFNVDGELWRTQRKLASHEFSTKSLREYMVRTLEEEV  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             +  L PL+E+ A  + V+DLQ++LRRFAF+ ICK+       C      +   L  AFD 
Sbjct  162   EKGLLPLMESLATAAQVVDLQELLRRFAFNVICKV-FLGGERCCLDPSLANPPLAGAFDT  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE-KANNIAA  842
             ASEI ARRG APV  +WK KR   VGSE+KLR  I+ VH + ++II  RK+E +     +
Sbjct  221   ASEICARRGAAPVSIIWKMKRWLGVGSEQKLRVAIEEVHAYFKDIIERRKKELEEAERDS  280

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             GA  D L+RL+ AGH++EV RDMVISF++AGRDTTS+A+TW FWLLS+ P +E  V+K++
Sbjct  281   GAHEDLLTRLITAGHEEEVTRDMVISFIMAGRDTTSAAMTWLFWLLSRQPGVEEDVLKEI  340

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
               S  +K  +F+ L E++ +KACL ESMRLYPPVAWDSKHA  DD+LPDGT +  G+RVT
Sbjct  341   -ESAGEKMSDFESL-ELSLLKACLYESMRLYPPVAWDSKHAVVDDLLPDGTRVQAGDRVT  398

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
             + PY MGRME LWG D LEFKPDRWF     E+   K + P+K P+FQAGPRVCLGK+MA
Sbjct  399   YFPYGMGRMEALWGKDRLEFKPDRWFLEPDKERSAXKKVCPYKLPIFQAGPRVCLGKDMA  458

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             FIQMK+VVASILRRFEIRPV   +PVFVP LT +MA GL V +  R
Sbjct  459   FIQMKYVVASILRRFEIRPVGSGEPVFVPRLTAHMAGGLKVLIRKR  504



>ref|XP_002509524.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50911.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/469 (60%), Positives = 347/469 (74%), Gaps = 12/469 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPSYPIIGCL+SFYKN+  LLDWYT+LLA+SPT TIVV+RLGA RT+VTA+ ENVEYM
Sbjct  40    HGPPSYPIIGCLISFYKNQARLLDWYTQLLAASPTNTIVVNRLGARRTIVTANPENVEYM  99

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKGEP  +ILGDFLG GIFNVDG++W  QRKLASHEF+A+SLRE  M TLEE
Sbjct  100   LKTNFNNFPKGEPFTEILGDFLGYGIFNVDGEIWHRQRKLASHEFSAKSLREFYMITLEE  159

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+  L P+LE+ A    V+DLQ++LRR AF+ +CK+               +  L  AF
Sbjct  160   EVEKGLLPVLESLAARKEVVDLQELLRRLAFNMVCKV-SLGIDRYSLDPSLPSPPLATAF  218

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRK---QEKAN  854
             D ASEI ARR  AP+F VWK KR   +GSE++L++ ++ VH +V  II  RK   +E+  
Sbjct  219   DMASEICARRAAAPLFVVWKIKRWLGIGSERRLKDAVEQVHQYVGGIIAERKKVIEERGE  278

Query  853   NIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             N     G DFLSRL+ AGH++ V+RD +ISF++AGRDTTS+A+TW FWLLS HP IE  V
Sbjct  279   N----DGEDFLSRLILAGHEENVIRDTMISFIMAGRDTTSAAMTWLFWLLSCHPGIEQEV  334

Query  673   IKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             +++     ++K  ++D L+E+  +KACLCESMRLYPPVAWDSKHA  DD+LPD T +  G
Sbjct  335   VRETKFMTERKP-DYDSLKELRLLKACLCESMRLYPPVAWDSKHAIVDDLLPDNTSVRAG  393

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK---LKMISPFKFPVFQAGPRVCLGK  323
             +RVTF PY MGRME LWG D LEF+PDRWF E  K   L+ + PFKFP+FQAGPRVCLGK
Sbjct  394   DRVTFFPYGMGRMEALWGKDGLEFRPDRWFLEPEKRTSLRKVCPFKFPIFQAGPRVCLGK  453

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             +MAFIQMK+V AS+L +FEIR V   +PVFVP LT +MA GL V V  R
Sbjct  454   QMAFIQMKYVTASVLSKFEIRHVGSHKPVFVPRLTAHMAGGLKVVVRRR  502



>ref|XP_009784521.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana sylvestris]
Length=511

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 351/473 (74%), Gaps = 7/473 (1%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             V  PP+YPIIGCL+ FYKNRY LLDWYT LL+ SPT+TIV+ RLGA RT+VTA+  NVEY
Sbjct  41    VAGPPTYPIIGCLIPFYKNRYRLLDWYTHLLSKSPTQTIVIDRLGARRTIVTANPYNVEY  100

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             MLK NF NFPKG+P N+ILGDFLG GIF+VDG++W  QRK+ SHEFTARSLR+ V+  L+
Sbjct  101   MLKTNFDNFPKGKPFNEILGDFLGNGIFDVDGEMWYKQRKMVSHEFTARSLRDYVVNALK  160

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             EEV+ +L P+LE     +   D QD+LRR AFD +CK+       C  +   S   L+DA
Sbjct  161   EEVENKLLPILELMEAENRAFDFQDLLRRLAFDVVCKV-SLGFDPCCINESLSFSPLLDA  219

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             F++AS+ISA RG AP+F VWK KR  N+GSEK+L+  I  +H  + +IIR RK +  +  
Sbjct  220   FERASQISAERGAAPIFFVWKVKRWLNIGSEKQLKLAIDQIHSSINDIIRERKIKIKDEN  279

Query  847   AAGAGSDFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                   D LSR++ A + D E VRDMVISF++AGRDTTS+A+TWFF+LLS HP IE  ++
Sbjct  280   QKETNKDLLSRMILAENFDEEEVRDMVISFIMAGRDTTSAAMTWFFYLLSLHPEIENELV  339

Query  670   KQVLSSDDQKTLN-FDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
              + L   + +TL  ++ L+EMN++K+CLCE+MRLYPPVAWDSKHA +DD+LPDGT I  G
Sbjct  340   SKELRFIETETLTKYEILKEMNFLKSCLCETMRLYPPVAWDSKHAISDDILPDGTRIKAG  399

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK--LKMISP-FKFPVFQAGPRVCLGK  323
             NRVT+ PY MGRMENLWG D  EFKP RW +E G+   + IS  +KFPVFQAGPRVCLGK
Sbjct  400   NRVTYFPYGMGRMENLWGKDRFEFKPRRWMEESGEEGTEQISILYKFPVFQAGPRVCLGK  459

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGYN  164
             E+AFIQMK+VVASIL+RF+IRP C   PVF+PLLT +MA G  V VH +  YN
Sbjct  460   ELAFIQMKYVVASILKRFQIRPACSDPPVFLPLLTAHMAGGFKVFVH-KNKYN  511



>ref|XP_009149812.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
 emb|CDY08079.1| BnaA06g16470D [Brassica napus]
Length=506

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/480 (58%), Positives = 346/480 (72%), Gaps = 7/480 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
             + T+  ++     P +YP+IG  LSF KNR+ LL WYT+LL  SP++TI +  LG+ RT+
Sbjct  24    YSTKKIQETTANGPRAYPLIGSTLSFNKNRHRLLQWYTELLRLSPSQTISIPLLGSRRTI  83

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+ ENVEY+LK NF NFPKG+P   +LGD LG+GIFNVDG  WS+QRKLASHEF+ARS
Sbjct  84    VTANPENVEYILKTNFFNFPKGKPFTDLLGDLLGKGIFNVDGHAWSSQRKLASHEFSARS  143

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LR    + L+EEV+ RL P L AAA   + +DLQDVL+RFAFD +CK+            
Sbjct  144   LRSFSFEVLKEEVENRLVPGLSAAADAGTTVDLQDVLKRFAFDVVCKV-SLGWDPDCLDL  202

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   L +AFD A+EISARR   PV+AVWK KRA NVGSE++LRE I+ VH  V EI+R
Sbjct  203   TRPVNPLAEAFDTATEISARRATEPVYAVWKVKRALNVGSERRLREAIRTVHVLVSEIVR  262

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +K+         A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLLS+
Sbjct  263   AKKKSLEIGTGEEAKQDLLSRFLAAGHDGESVRDMVISFIMAGRDTTSAAMTWLFWLLSE  322

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             + N+E  ++++V        L F+ L+EM+Y KACLCE+MRLYPPV+WDSKHAANDDVLP
Sbjct  323   NGNVERKLLEEV-DPLISLGLGFEELKEMSYTKACLCEAMRLYPPVSWDSKHAANDDVLP  381

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQGK----LKMISPFKFPVF  353
             DGT + +G++VT+ PY MGRMENLWG DW EFKP RWFD E G     LK +SPFKFPVF
Sbjct  382   DGTRVKKGDKVTYFPYGMGRMENLWGKDWDEFKPSRWFDSEPGSTRPVLKPVSPFKFPVF  441

Query  352   QAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             QAGPRVC+GKEMAF+QMK+VV  +L RFEI  V + +P FVPLLT +MA GL V++  RE
Sbjct  442   QAGPRVCVGKEMAFMQMKYVVGYVLSRFEIVTVNKDKPAFVPLLTAHMAGGLKVKIKRRE  501



>ref|XP_007215034.1| hypothetical protein PRUPE_ppa004311mg [Prunus persica]
 gb|EMJ16233.1| hypothetical protein PRUPE_ppa004311mg [Prunus persica]
Length=517

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/465 (61%), Positives = 343/465 (74%), Gaps = 7/465 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PPSYPIIGCLLSF  NR  LLDWYT LLA S T TIVVHR GA RTVVTA+ E+VEYMLK
Sbjct  44    PPSYPIIGCLLSFCNNRNRLLDWYTDLLAQSATNTIVVHRFGARRTVVTANPESVEYMLK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDG+LW  QRKLASHEF+++SLRE +M TLEEEV
Sbjct  104   TNFNNFPKGKPFTEILGDFLGCGIFNVDGELWRTQRKLASHEFSSKSLREYIMNTLEEEV  163

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             +  L PL+E+ A  + V+DLQ++LRRF F+ ICK+       C       +  L  AFD 
Sbjct  164   EKGLLPLMESLAMTAQVVDLQELLRRFGFNVICKV-FLGVDRCCLDPSLPSPPLARAFDT  222

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             AS+I ARR  AP+F +WK KR   VGSE++LR  ++ VH +V  +I  RK++     A  
Sbjct  223   ASDICARRAAAPMFIIWKIKRWLGVGSEQRLRAAVEEVHAYVMNVIENRKKKMEEGEADT  282

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSRL+ AGH++EV RDMVISF++AGRDTTS+A+TW FWLLS+ P +E  V+K++ 
Sbjct  283   RQEDLLSRLIMAGHEEEVTRDMVISFIMAGRDTTSAAMTWLFWLLSRQPGVEEDVVKEI-  341

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +  ++ L+F+ L ++  +KACLCESMRLYPPVAWDSKHA  DD+LPDGT +  G+RVT+
Sbjct  342   DAAGERILDFESL-DLRLLKACLCESMRLYPPVAWDSKHAIADDLLPDGTHVRAGDRVTY  400

Query  478   SPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
              PY MGRME LWG D LEF+PDRWF     E   LK +SP+K P FQAGPRVCLGK+MAF
Sbjct  401   FPYGMGRMEALWGKDRLEFRPDRWFLEPEKESSALKKVSPYKLPTFQAGPRVCLGKDMAF  460

Query  310   IQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             IQMK+VVASILRRFEIRPV   +PVFVP LT +MA GL V V  R
Sbjct  461   IQMKYVVASILRRFEIRPVESVEPVFVPRLTAHMAGGLKVLVRKR  505



>ref|XP_009620348.1| PREDICTED: cytochrome P450 94B3 [Nicotiana tomentosiformis]
Length=511

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 350/473 (74%), Gaps = 7/473 (1%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             V  PP+YPIIGCL+ FYKNRY LLDWYT L++ SPT+TIV+ RLGA RT+VTA+  NVEY
Sbjct  41    VAGPPTYPIIGCLIPFYKNRYRLLDWYTHLISKSPTQTIVIDRLGARRTIVTANPYNVEY  100

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             MLK NF NFPKG+P N+ILGDFLG GIFNVDG++W  QRK+ SHEFTARSLR+ V+  L+
Sbjct  101   MLKTNFDNFPKGKPFNEILGDFLGNGIFNVDGEMWYKQRKMVSHEFTARSLRDYVVNALK  160

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             EEV+ +L P+LE     +   DLQD+LRR  FD +CK+       C  +   S   L+DA
Sbjct  161   EEVENKLLPILELMEAENRAFDLQDLLRRLGFDVVCKV-SLGFDPCCLNESLSFSPLLDA  219

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             F++AS+I A RG AP+F VWK KR  N+GSEK+L+  +  +H  +++IIR RK +     
Sbjct  220   FERASQICAERGAAPIFVVWKVKRWLNIGSEKQLKLAVDQIHSSIDDIIRERKIKIREEN  279

Query  847   AAGAGSDFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                   D LS+++ A + D E VRDMVISF++AGRDTTS+A+TWFF+LLS HP IE  ++
Sbjct  280   QKETNKDLLSKMILAANFDEEEVRDMVISFIMAGRDTTSAAMTWFFYLLSLHPEIEYELV  339

Query  670   KQVLSSDDQKTLN-FDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
              + L   + +TL  ++ L+EMN++K+CLCE+MRLYPPVAWDSKHA +DD+LPDGT I  G
Sbjct  340   SKELRFIEAETLTKYEILKEMNFLKSCLCETMRLYPPVAWDSKHAISDDILPDGTRIKAG  399

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWF---DEQGKLKMISPFKFPVFQAGPRVCLGK  323
             NRVT+ PY MGRMENLWG D  EFKP RW    +E+G  ++ + +KFPVFQAGPRVCLGK
Sbjct  400   NRVTYFPYGMGRMENLWGKDRFEFKPRRWMQESEEEGTEQVSNLYKFPVFQAGPRVCLGK  459

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGYN  164
             E+AFIQMK+VVASIL+RF+IRP C   PVF+PLLT +MA G  V VH +  YN
Sbjct  460   ELAFIQMKYVVASILKRFQIRPACSDPPVFLPLLTAHMAGGFKVFVH-KTKYN  511



>ref|XP_011003922.1| PREDICTED: cytochrome P450 94B3 [Populus euphratica]
 ref|XP_011016097.1| PREDICTED: cytochrome P450 94B3-like [Populus euphratica]
Length=550

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/466 (59%), Positives = 349/466 (75%), Gaps = 7/466 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PP+YPIIGCL+SFYKNR  LLDWYT+LLA S T TIVVHRLGA RT+VTA+ +NVEYM
Sbjct  78    HKPPTYPIIGCLISFYKNRGRLLDWYTELLAESATNTIVVHRLGARRTIVTANPKNVEYM  137

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P  +ILGDFLG GIFNVDG+LW AQRK ASHEF+A+SLRE  M TLEE
Sbjct  138   LKTNFNNFPKGQPFTEILGDFLGYGIFNVDGELWRAQRKFASHEFSAKSLREFFMITLEE  197

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+  L P+LE+ A  + V+DLQ++LRRFAF+ + K+       C          L  AF
Sbjct  198   EVEKGLLPILESLAVTAEVVDLQELLRRFAFNMVLKV-SLGIDRCCLDPSQPVPPLTRAF  256

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D+ASEI A+RG AP+F VWK K+   +GSE++L+  ++ VH  V EII  +K+       
Sbjct  257   DEASEICAKRGAAPLFIVWKMKKWLGIGSERQLKSAVEEVHRCVSEIIINKKRMIEE--G  314

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                  D LSRL+ AGH++EV+RDMVISF++AGRDTTS+A+TW FWLLS HP+IE  V+K+
Sbjct  315   ESRSEDLLSRLILAGHEEEVIRDMVISFIMAGRDTTSAAMTWLFWLLSCHPDIEKEVVKE  374

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
                   ++ L++D L+E+N +KACLCESMRLYPP+AWDSKHA   D+LPD TP+  G+RV
Sbjct  375   T-RLLMERMLDYDSLKELNLLKACLCESMRLYPPIAWDSKHAVVSDLLPDNTPVRAGDRV  433

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWF---DEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
             T+ PY MGRME LWG D  +FKPDRWF   +++ +L+ + P KFP+FQAGPRVCLGKEMA
Sbjct  434   TYFPYGMGRMEALWGEDCFKFKPDRWFVEANDRRELQEVCPCKFPIFQAGPRVCLGKEMA  493

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             FIQMK+V+ASIL RF+I+P+  + PVFVPLLT +MA GL V V  R
Sbjct  494   FIQMKYVMASILDRFKIKPLSSASPVFVPLLTAHMAGGLEVLVQKR  539



>ref|XP_008231126.1| PREDICTED: cytochrome P450 94B3 [Prunus mume]
Length=513

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/471 (60%), Positives = 345/471 (73%), Gaps = 7/471 (1%)
 Frame = -1

Query  1576  KLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAEN  1397
             +L    PPSYPIIGCLLSF  NR  LLDWYT LLA S T TIVVHR GA RTVVTA+ E+
Sbjct  38    ELSCQGPPSYPIIGCLLSFCNNRNRLLDWYTDLLAQSATNTIVVHRFGARRTVVTANPES  97

Query  1396  VEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMK  1217
             VEYMLK NF NFPKG+P  +ILGDFLG GIFNVDG+LW  QRKLASHEF+ +SLRE +M 
Sbjct  98    VEYMLKTNFNNFPKGKPFTEILGDFLGCGIFNVDGELWRTQRKLASHEFSTKSLREYIMN  157

Query  1216  TLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSL  1037
             TLEEEV+  L PL+E+ A  + V+DLQ++LRRF F+ ICK+       C       +  L
Sbjct  158   TLEEEVEKGLLPLMESLAMTAQVVDLQELLRRFGFNVICKV-FLGVDRCCLDPSLPSPPL  216

Query  1036  VDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA  857
               AFD AS+I ARR  AP+F +WK KR   VGSE++LR  ++ VH +V  +I  RK++  
Sbjct  217   ARAFDTASDICARRAAAPMFIIWKIKRWLGVGSEQRLRRAVEEVHAYVMNVIENRKKKME  276

Query  856   NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
                A     D LSRL+ AGH++EV RDMVISF++AGRDTTS+A+TW FWLLS+ P +E  
Sbjct  277   EGEADTRQEDLLSRLIMAGHEEEVTRDMVISFIMAGRDTTSAAMTWLFWLLSRQPGMEED  336

Query  676   VIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             V+K++  +  ++ L+F+ L ++  +KACLCESMRLYPPVAWDSKHA  DD+LPDGT +  
Sbjct  337   VVKEI-DAAGERILDFESL-DLRLLKACLCESMRLYPPVAWDSKHAIADDLLPDGTHVRA  394

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCL  329
             G+RVT+ PY MGRME LWG D LEF+PDRWF     E+  LK +SP+K P FQAGPRVCL
Sbjct  395   GDRVTYFPYGMGRMEALWGKDRLEFRPDRWFLEPEKERSALKKVSPYKLPTFQAGPRVCL  454

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GK++AFIQMK+VVASILRRFEIRPV   +PVFVP LT +MA GL V V  R
Sbjct  455   GKDVAFIQMKYVVASILRRFEIRPVESVEPVFVPRLTAHMAGGLKVLVRKR  505



>gb|KDP46287.1| hypothetical protein JCGZ_10127 [Jatropha curcas]
Length=512

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/472 (58%), Positives = 346/472 (73%), Gaps = 7/472 (1%)
 Frame = -1

Query  1576  KLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAEN  1397
             +L  + PP+YPIIGCL+SFYKN+  LLDWYT+L++ S T TIVV+RLGA RT++TA+ +N
Sbjct  34    QLPSHGPPTYPIIGCLISFYKNQSRLLDWYTELISKSATSTIVVNRLGARRTIITANPQN  93

Query  1396  VEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMK  1217
             VEY+LK NF NFPKG+P  +ILGDFLG GIFNVDG+LW++QRKLASHEFTA+SLRE  + 
Sbjct  94    VEYILKTNFNNFPKGKPFTEILGDFLGYGIFNVDGELWNSQRKLASHEFTAKSLREFFIS  153

Query  1216  TLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSL  1037
             TLEEEVD  LSP+ E+ A    V DLQ++LRR AF+ ICK+                  L
Sbjct  154   TLEEEVDKGLSPVFESLAETGEVFDLQELLRRLAFNMICKV-SLGIDRRCLDPSLPVSPL  212

Query  1036  VDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE--  863
               AFD ASEI ARR  AP++ VWK KR   +GSEK L++ ++ VH +V ++I  R++   
Sbjct  213   ARAFDMASEICARRATAPMYLVWKFKRCLGIGSEKMLKDAVQRVHQYVSKVIVNREKMIL  272

Query  862   KANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIE  683
             +          D LSRL+ A H+++V+RDMV+SF++AGRDTTS+A+TW FWLLS HP+IE
Sbjct  273   EQGENNNNQNQDLLSRLILARHEEKVIRDMVVSFIMAGRDTTSAAMTWLFWLLSCHPDIE  332

Query  682   TTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
               V K+     ++K  ++D L+E+ ++KACLCESMRLYPPV WDSKHA  DD+LPD T +
Sbjct  333   QEVFKETNIIKERK-FDYDSLKELRFLKACLCESMRLYPPVVWDSKHALVDDLLPDNTHV  391

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF---DEQGKLKMISPFKFPVFQAGPRVC  332
               G+RVT+ PY MGRME LWG D LEFKP+RWF   ++   LK + P+KFP+FQAGPRVC
Sbjct  392   RAGDRVTYFPYGMGRMEALWGKDCLEFKPNRWFLEPEQSSSLKKVCPYKFPIFQAGPRVC  451

Query  331   LGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             LGKEMAFIQMK+VVASILR+FEIRPV   +PVFVP LT +MA G  V V  R
Sbjct  452   LGKEMAFIQMKYVVASILRQFEIRPVSSDRPVFVPRLTAHMAGGFRVVVRKR  503



>ref|XP_008788895.1| PREDICTED: cytochrome P450 94B3-like [Phoenix dactylifera]
Length=516

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 343/471 (73%), Gaps = 13/471 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P  +P IGCL+ FY+NR  LLDW+T+LLA+SPT+TIV+ RLGA RTVVTA+A+NVEYM
Sbjct  28    HGPEMHPFIGCLIPFYRNRRRLLDWFTELLAASPTQTIVLERLGARRTVVTANADNVEYM  87

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG+P   ILGD LG GIFN DG+LW  QRKLASHEFT RSLRE V+KTL+ 
Sbjct  88    LKTNFDNYPKGKPFTDILGDLLGCGIFNADGELWHTQRKLASHEFTTRSLREFVVKTLDA  147

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E + RL P+L +A ++   +D+QD+LRRFAFDT+CK+                 +L  AF
Sbjct  148   ETNERLLPILSSACKDRRTVDMQDLLRRFAFDTVCKV-ALGTDPGFLDPSLPMSNLAAAF  206

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             + AS I ARRG A V AVWK KR   VGSE +LR  ++++H+ V  +IR RK+E     A
Sbjct  207   EVASGICARRGAALVSAVWKVKRTLGVGSEGRLRASVRLIHESVMGLIRRRKEEA----A  262

Query  844   AGAG---SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
             AG G   SD LSRL+  GH DEV+RDMVISF++AGRDTTS+ALTWFFWL+S+ P IE  V
Sbjct  263   AGKGAERSDLLSRLISGGHSDEVIRDMVISFVMAGRDTTSAALTWFFWLISRQPEIEREV  322

Query  673   IKQVLSSDD--QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
             +++     D  Q    +  L+EM +++ACLCESMRLYPPVAWDSKHAA DDVLPDGT + 
Sbjct  323   VREAADRADRGQGLDRYQELKEMKFLEACLCESMRLYPPVAWDSKHAARDDVLPDGTEVR  382

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-LKMISPFKFPVFQAGPRVCLGK  323
             RG+RVT+ PY MGRME LWG DW+EF+P RW + +G+ L  +S +KF VFQAGPRVCLGK
Sbjct  383   RGDRVTYFPYGMGRMERLWGKDWMEFEPRRWLEAEGRELARVSAYKFAVFQAGPRVCLGK  442

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMR  176
             EMAF+QMK++ A++LR FE+R     Q  PV VPLLT +MA GL + V  R
Sbjct  443   EMAFVQMKYIAAAVLRHFELRRAGGEQRPPVLVPLLTAHMAGGLKMVVRER  493



>ref|XP_004513634.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=511

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/477 (60%), Positives = 351/477 (74%), Gaps = 10/477 (2%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             KKLI   P +YP IGCL+SFYKNR+ LL+WYT+LLA SPT TI+V RLGA RT++TA+ +
Sbjct  33    KKLIGIGPTTYPFIGCLISFYKNRFQLLNWYTELLAQSPTNTILVQRLGARRTILTANQQ  92

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVEY+LK NF NFPKG+P   ILGDFLG+GIFNVDG+LW  QRKLASHEF+ RS+ E +M
Sbjct  93    NVEYILKTNFKNFPKGKPFTDILGDFLGKGIFNVDGNLWIKQRKLASHEFSLRSMNEFIM  152

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdss---  1049
              TLEEEV+ +L PLL++ +    V+D Q++L RF F+ ICK +LG +             
Sbjct  153   HTLEEEVNAKLLPLLDSLSLEKKVVDFQELLGRFTFNVICKFTLGKNNDDNFRCCLDPCF  212

Query  1048  -aeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 L  AFD A+ ISA+RG AP+F VW+ K+ F VGSE+KLRE ++ V   V EII  R
Sbjct  213   PISPLARAFDVAAAISAKRGAAPLFLVWRVKKWFRVGSERKLREAVEEVRTRVMEIILER  272

Query  871   KQEKANNIAAG-AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
             KQ+       G  G D LSRL+ AGH++EV+RDMVISF++AGRDTTSSA+TWFFWLLS +
Sbjct  273   KQKMNVMEEKGVGGQDLLSRLVCAGHEEEVIRDMVISFIMAGRDTTSSAMTWFFWLLSHY  332

Query  694   PNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPD  515
              ++E  ++K+   +    TL++  L+ MN +KACLCESMRLYPPVAWDSKHA  DDVLPD
Sbjct  333   SDMEQEIVKET-ENKSSGTLDYKSLKNMNLLKACLCESMRLYPPVAWDSKHATFDDVLPD  391

Query  514   GTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQGK--LKMISPFKFPVFQA  347
             GT +  G+RVT+ PY MGRMENLWG D  EF+PDRWF  DE G   L  + PFKFPVFQA
Sbjct  392   GTLVQSGDRVTYFPYGMGRMENLWGKDLFEFRPDRWFVKDELGTILLSEVCPFKFPVFQA  451

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GPRVCLGKEMAFIQMK+VVASILRRF+I  V   +P+FVPLLT +MA GL V V  R
Sbjct  452   GPRVCLGKEMAFIQMKYVVASILRRFKIIIVGPEKPLFVPLLTAHMAGGLKVLVSKR  508



>emb|CDY59153.1| BnaC08g48490D [Brassica napus]
Length=506

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 342/480 (71%), Gaps = 7/480 (1%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
             + T+  ++     P +YP+IG  LSF KNR  LL WYT+LL  SP++TI +  LG  RT+
Sbjct  24    YSTKKIQETTANGPRAYPLIGSTLSFNKNRRRLLQWYTELLRLSPSQTISIPLLGNRRTI  83

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
             VTA+ ENVEY+LK NF NFPKG+P   +LGD LG+GIFNVDG  WS+QRKLASH F+ARS
Sbjct  84    VTANPENVEYILKTNFFNFPKGKPFTDLLGDLLGKGIFNVDGHAWSSQRKLASHVFSARS  143

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             LR    + L+EEV+ RL P+L AAA     +DLQDVL+RFAFD +CK+            
Sbjct  144   LRSFSFEVLKEEVENRLVPVLLAAADAGMAVDLQDVLKRFAFDVVCKV-SLGWDPDCLDL  202

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                   L +AFD A+EISARR   PV+AVWK KRA NVGSE++LRE I+ VH  V EI+R
Sbjct  203   TRPVNPLAEAFDTAAEISARRATEPVYAVWKVKRALNVGSERRLREAIRTVHVLVSEIVR  262

Query  877   VRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
              +K+         A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLLS+
Sbjct  263   AKKKSLEIGTGEEAKQDLLSRFLAAGHDGESVRDMVISFIMAGRDTTSAAMTWLFWLLSE  322

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             + ++E  ++++V        L F+ L+EM+Y KACLCE+MRLYPPV+WDSKHAANDDVLP
Sbjct  323   NGDVERKLLEEV-DPLISLGLGFEELKEMSYTKACLCEAMRLYPPVSWDSKHAANDDVLP  381

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVF  353
             DGT + +G++VT+ PY MGRMENLWG DW EFKP RWFD +       LK +SPFKFPVF
Sbjct  382   DGTRVKKGDKVTYFPYGMGRMENLWGKDWDEFKPSRWFDSKPGSTRPVLKPVSPFKFPVF  441

Query  352   QAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             QAGPRVC+GKEMAF+QMK+VV  +L RFEI  V + +P FVPLLT +MA GL V++  RE
Sbjct  442   QAGPRVCVGKEMAFMQMKYVVGYVLSRFEIVTVNKHKPAFVPLLTAHMAGGLKVKIKRRE  501



>ref|XP_010929779.1| PREDICTED: cytochrome P450 94B3-like [Elaeis guineensis]
Length=513

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/467 (58%), Positives = 343/467 (73%), Gaps = 6/467 (1%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P  +P IGCL+SFYKN++ LLDWYT+LL +SPT+TIV+ RLGA R VVTA+ +NVEYM
Sbjct  45    YRPKMHPFIGCLISFYKNQHRLLDWYTELLTASPTQTIVLERLGARRNVVTANPDNVEYM  104

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG+P   ILGD LG GIFN DG+LW  QRKLASHEF+ RSLRE V+KTL+ 
Sbjct  105   LKTNFDNYPKGKPFTDILGDLLGCGIFNADGELWHTQRKLASHEFSTRSLREFVVKTLDN  164

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E + RL P+L +A  +   +D+QD+LRRFAFDTI K+                  L  AF
Sbjct  165   ETNHRLLPILSSACADRRTVDMQDLLRRFAFDTIWKV-TLGTDPGFLDPSLPMSDLAAAF  223

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             + AS ISARRG A V AVWK KRAF VGSE +LR  +K++H+ V  IIR RK+E A +  
Sbjct  224   EVASGISARRGAALVSAVWKVKRAFGVGSEGRLRASVKLIHESVMAIIRRRKEEAAGDKR  283

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
               + SD LSRL+  GH DEV+RDMVISF++AGRDTTS+ALTWFFWL+S HP IE  VIK+
Sbjct  284   PES-SDLLSRLISGGHSDEVIRDMVISFVMAGRDTTSAALTWFFWLMSCHPEIEREVIKE  342

Query  664   VLSSDDQKTLN-FDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             V +    + L+ +  L+EM +++ACLCESMRLYPPVAWDSKHAA++D+LPDGT + RG+R
Sbjct  343   VKNIHKSRELDRYQELKEMKFLEACLCESMRLYPPVAWDSKHAASNDMLPDGTEVRRGDR  402

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-LKMISPFKFPVFQAGPRVCLGKEMAF  311
             VT+ PY MGRME LWG +W EF+P RW   +G+ +  +S +KF VFQ GPRVCLGKEMAF
Sbjct  403   VTYFPYGMGRMERLWGKEWKEFEPRRWMAAEGREVARVSAYKFAVFQGGPRVCLGKEMAF  462

Query  310   IQMKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMR  176
             +QMK+V A++LRRFE+R     +  PV VPL+T +MA GL + V  R
Sbjct  463   VQMKYVAAAVLRRFELRRAGGERRPPVLVPLMTAHMAGGLKMVVGGR  509



>ref|XP_010550730.1| PREDICTED: cytochrome P450 94B3 [Tarenaya hassleriana]
Length=505

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/473 (58%), Positives = 340/473 (72%), Gaps = 11/473 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P SYP IGCL+SFY NR  LL WYT LL+ SP++TI + RLG+ RTVVTA+ +NVEY+
Sbjct  31    YGPSSYPFIGCLISFYANRRRLLQWYTDLLSLSPSQTISLRRLGSRRTVVTANPDNVEYI  90

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF+NFPKG+P   +LGD LG GIFN D D WS+QRK+ASHEFT RS+R+   + L +
Sbjct  91    LKTNFINFPKGKPFTDLLGDLLGGGIFNSDADQWSSQRKVASHEFTTRSIRDFGFEVLRD  150

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E + RL P+LE+AA   + LDLQ+VL+RFAFD +CK                   LV AF
Sbjct  151   EAENRLIPVLESAAYAGATLDLQEVLKRFAFDVVCKF-SLGTDPDCLDLTRPVSPLVVAF  209

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A+EISARR M P++AVWK KR  NVGSE++LRE ++ VH  V EIIR +K+       
Sbjct  210   DTAAEISARRAMEPIYAVWKIKRWLNVGSERRLREAVRTVHVSVSEIIRAKKKSLEIGTG  269

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
               A  D LSR L AGH  + VRDMVISF++AGRDTTS+A+TW FWLL+++   E  V+++
Sbjct  270   DEAKQDLLSRFLSAGHGGDAVRDMVISFIMAGRDTTSAAMTWLFWLLTQNDVAEKKVLEE  329

Query  664   VLS----SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             V S     D    L F+ L+ M+Y KACLCE+MRLYPPVAWDSKHAANDDVLPDGT + R
Sbjct  330   VGSLMKGKDGDLGLGFEDLKVMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGTRVSR  389

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGK---LKMISPFKFPVFQAGPRV  335
             G++VT+ PY MGRME LWG DW EFKPDRW     E G    L+ +SPFKFPVFQAGPRV
Sbjct  390   GDKVTYFPYGMGRMEKLWGKDWDEFKPDRWLACEPEDGARPVLRSVSPFKFPVFQAGPRV  449

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             CLGKE AF+QMK+V+ S+LRRFEI PVC ++P+FVPLLT +MA G  V++  R
Sbjct  450   CLGKETAFMQMKYVIGSVLRRFEIVPVCNNRPIFVPLLTAHMASGFKVKIKRR  502



>ref|XP_010677888.1| PREDICTED: cytochrome P450 94B3 [Beta vulgaris subsp. vulgaris]
Length=532

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/477 (54%), Positives = 345/477 (72%), Gaps = 19/477 (4%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + PPSYP IGCL+SFYKNR  LLDWYT LL+ SPT+TI+V RLGA + +VTA+ +NVEY+
Sbjct  52    HGPPSYPFIGCLISFYKNRKRLLDWYTDLLSESPTQTIIVSRLGARKVIVTANPDNVEYI  111

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P+ +ILGD LG+GIFNVDG+LW+ QRKLASHEFT ++LRE V+KTLEE
Sbjct  112   LKTNFHNFPKGKPLAEILGDLLGKGIFNVDGELWATQRKLASHEFTTKTLREFVVKTLEE  171

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV+ RL PLL+ AA+ + ++DLQ+VL+RF +DTICK+                  L+ AF
Sbjct  172   EVESRLIPLLQLAAQQNKIIDLQEVLKRFTYDTICKV-SLGIDPNCLDLSIPIPPLIAAF  230

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             + A+ ISA+R  +P++A+WK KRA N+GSE +L++ I ++H  V+ II  ++   AN+  
Sbjct  231   ENAAAISAKRATSPIYAIWKLKRALNIGSEHQLKQSINILHGLVKTIISTKQNSIANS-N  289

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK---HPNIETTV  674
                  D LSR L AG+  E+ RDMVISF++AGRDTT++A+TW FWLL      P     +
Sbjct  290   ETENQDLLSRFLSAGYDGELARDMVISFIMAGRDTTAAAMTWLFWLLLSGLADPATRDNI  349

Query  673   IKQVLSSDD----QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
             + ++ S  D      +L+++ ++ M Y+ ACLCE+MRLYPPVAWDSKHA  DD+LPDGT 
Sbjct  350   MSELASGSDPDSGSDSLSYELVKNMKYMHACLCEAMRLYPPVAWDSKHALKDDILPDGTK  409

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQ----------GKLKMISPFKFPV  356
             + +G+RVT+ PY MGRME +WG D L+F PDRWF+ Q           KLKM++P+++P+
Sbjct  410   LKKGDRVTYFPYGMGRMEVIWGEDRLKFNPDRWFESQVDKQSNNYNTRKLKMVNPYEYPI  469

Query  355   FQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRV  185
             FQAGPRVCLGKEMAF+QMK+V+ASI+ RF+   +    PVFVPLLT +M  GL VRV
Sbjct  470   FQAGPRVCLGKEMAFLQMKYVMASIMNRFDFELLSNEPPVFVPLLTAHMGGGLRVRV  526



>ref|XP_010029004.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=513

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/470 (57%), Positives = 345/470 (73%), Gaps = 11/470 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PPSYP+IGCL+SFY+NR  LL+WYT+LLA SPT TIVV RLGA RT+VTAS  NVE++L+
Sbjct  41    PPSYPVIGCLVSFYRNRRRLLEWYTELLARSPTHTIVVRRLGARRTIVTASPANVEHILR  100

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG P  +ILGDFLG GIFNVDG+LW +QRKLASHEF+ RSLRE    TL++ V
Sbjct  101   TNFHNFPKGRPFTEILGDFLGCGIFNVDGELWRSQRKLASHEFSVRSLREYTATTLKDVV  160

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             DGRL P+LE+ +     +DLQ++L+R AFD IC++       C          L  A+D 
Sbjct  161   DGRLMPVLESLSAERRTVDLQELLKRLAFDMICRV-SLGTEVCSLEPSLPDSPLARAYDV  219

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE--KANNIA  845
             +  I ARRG APV A+W+ KR   VGSE++L++ +  VH  +  +IR R +   +  + +
Sbjct  220   SCAICARRGAAPVSAIWRIKRWLGVGSERELKQAVDEVHSSIARLIRDRAERIVETGDRS  279

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
             AG+ SD LSRL  AG+ +E++RDMVISF++AGRDTTS+A+TW FW+LS+   +E  +I +
Sbjct  280   AGSQSDLLSRLASAGYGEELIRDMVISFIMAGRDTTSAAMTWLFWMLSRSQEVERELIGE  339

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             V  +  +  L++D L+E+ ++  CLCE MRLYPPVAWDSKHA  DDVLPDGTP+  G+RV
Sbjct  340   VDGAAGE--LDYDSLKELKFLSGCLCEVMRLYPPVAWDSKHAVGDDVLPDGTPVRAGDRV  397

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQAGPRVCLGKE  320
             T+ PY MGRME++WG D LEFKP RWF+      +G+LK + P+KFPVFQAGPR C+GKE
Sbjct  398   TYFPYGMGRMESIWGRDRLEFKPGRWFEGPEGKPRGELKKVCPYKFPVFQAGPRDCIGKE  457

Query  319   MAFIQMKFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMRE  173
             MAF+QMK+VVAS+LRRFEIRPV  +   VFVPLLT +MA GL V++  RE
Sbjct  458   MAFLQMKYVVASVLRRFEIRPVERDDDGVFVPLLTAHMAGGLPVQIRKRE  507



>ref|XP_010033411.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW53044.1| hypothetical protein EUGRSUZ_J02337 [Eucalyptus grandis]
Length=534

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/483 (56%), Positives = 346/483 (72%), Gaps = 14/483 (3%)
 Frame = -1

Query  1603  RVFHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPR  1424
             +VFH   H       PP+YP+IGCL+SFY+NR  LLDWYT+LL+ SPT TIVV RLGA R
Sbjct  34    QVFHISGHG------PPTYPVIGCLISFYRNRRRLLDWYTQLLSQSPTNTIVVWRLGARR  87

Query  1423  TVVTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTA  1244
             T+VTA+ +NV+Y+LK+NF N+PKG P  +ILGDFLG GIFNVDG LW  QRKL SHEF+ 
Sbjct  88    TIVTANPKNVQYILKSNFKNYPKGRPFTEILGDFLGHGIFNVDGALWRTQRKLVSHEFST  147

Query  1243  RSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpg-cl  1067
             RSLRE VM TL+EEV+ RL P++++    +  +DLQD+L+R  FD ICK+SLG+      
Sbjct  148   RSLREYVMSTLQEEVENRLLPVMQSVLTENKAVDLQDLLKRLTFDMICKVSLGTAYQPRS  207

Query  1066  sssdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEE  887
                      L  AFD +SEI ARRG A +   WK KR   VGSE++L+E ++ VH  V  
Sbjct  208   LDPTFPISPLAKAFDVSSEICARRGAATLSLSWKIKRLIRVGSERRLKEAVREVHGFVSR  267

Query  886   IIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWL  707
             +IR +  E  N  AA    D LS L+ AGH +  +RD++ISF++AGR+TTS+A+TW FWL
Sbjct  268   VIRDKIME-MNGTAASGNDDLLSSLILAGHDERTIRDLMISFIMAGRETTSAAMTWLFWL  326

Query  706   LSKHPNIETTVIKQV-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAAND  530
             LS+HPNI+  ++ +V L    +K L+++ L+E+  + ACL ESMRLYPPVAWDSKHA  D
Sbjct  327   LSQHPNIKQDLVTEVELVLKRRKDLDYESLKELKLLNACLLESMRLYPPVAWDSKHAVED  386

Query  529   DVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-----QGKLKMISPFK  365
             DVLPDGT +  G+RVT+ PY MGRME LWG D LEF+P+RWF E      G+++ + P+K
Sbjct  387   DVLPDGTIVKSGDRVTYFPYGMGRMEELWGKDCLEFRPNRWFLEPEKYGTGEIRKMCPYK  446

Query  364   FPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRV  185
             +PVFQAGPR C+GKEMAFIQMK+VVASIL RF+I PV + +PVFVP LT +MA G  VRV
Sbjct  447   YPVFQAGPRDCIGKEMAFIQMKYVVASILHRFDIEPVNQVRPVFVPFLTAHMAGGFPVRV  506

Query  184   HMR  176
               R
Sbjct  507   RQR  509



>ref|XP_009394066.1| PREDICTED: cytochrome P450 94B3-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/467 (57%), Positives = 340/467 (73%), Gaps = 8/467 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P  +P+IGCL+ FY+NR+ LLDWYT+LLASSPT+TIV+ R GA RTVVTA+  NVE++
Sbjct  39    YGPKMHPVIGCLVPFYRNRHRLLDWYTELLASSPTQTIVIGRFGARRTVVTANPNNVEHV  98

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L+ NF N+PKGE    ILGD LG GIFN DG LW  QRKLASHEFT +SLRE V++TLE 
Sbjct  99    LRTNFPNYPKGEAFTDILGDLLGCGIFNADGQLWHTQRKLASHEFTTKSLREFVVETLES  158

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E + RL P+L +A  +   +D+QD+LRRFAFDTICK+       C   +      L +AF
Sbjct  159   EAEERLLPILASACADRRAVDVQDLLRRFAFDTICKV-SLGTNPCYLDASLPESELANAF  217

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             + AS ISARRG AP+ AVWK KRAF+VGSE++LR  +K++H+ + E+IR RK E      
Sbjct  218   EVASGISARRGAAPMAAVWKLKRAFDVGSERRLRGAVKLIHESIMELIRTRKTEMEKGTE  277

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 +D L+RL+  GH +EV+RDMVISF++AGRDTTS+ALTWFFWL+S+ P++E  ++ +
Sbjct  278   H---NDLLTRLISGGHSEEVIRDMVISFVMAGRDTTSAALTWFFWLISRRPDVEAEIVDE  334

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             V     +  L++  L++M  ++ACLCESMR+YPPVAWDSKHAA  D LPDGT I +G+RV
Sbjct  335   VKRFKGR--LSYQELKDMKVLEACLCESMRMYPPVAWDSKHAAGSDELPDGTRIKKGDRV  392

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQ  305
             T+ PY MGRME LWGN+  EF   RW  E G++   SP+KFPVFQAGPRVCLGKEMAF Q
Sbjct  393   TYFPYGMGRMERLWGNNCREFDHRRWLSEHGEVVRASPYKFPVFQAGPRVCLGKEMAFAQ  452

Query  304   MKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMREG  170
             MK++ A++L RFE+R        PVFVPLLT +MA GL + V  R+G
Sbjct  453   MKYIAAAVLGRFELRRDHRHSRPPVFVPLLTAHMAGGLQMVVEKRKG  499



>ref|XP_003553253.2| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=501

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/468 (56%), Positives = 344/468 (74%), Gaps = 12/468 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             +P +YP+IGCL+SFY+N++ LLDWYT+LLA SPT TIVV RLGA RT+VTA+ +NVEYML
Sbjct  36    SPATYPLIGCLISFYRNKHRLLDWYTELLAQSPTNTIVVQRLGARRTIVTANPQNVEYML  95

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             K NF NFPKG+P  +ILGDFLG+GIFNVDG+ W  QR+LASHEF+ +SLRE VM TLE+E
Sbjct  96    KTNFNNFPKGKPFTEILGDFLGQGIFNVDGEPWLTQRRLASHEFSTKSLREFVMHTLEKE  155

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V  RL P+LEA    + V+DLQ++L RF+F+ IC+        C          L  AFD
Sbjct  156   VCERLVPVLEALCGENKVVDLQELLGRFSFNVICRF-TLGTNRCCLDPSVPTCPLARAFD  214

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+E+SA+RG AP+F +W+ KR    GSE+ L+  +  V  HV  +I+ RK++K      
Sbjct  215   VAAEVSAKRGAAPLFMMWRVKRWLGAGSERLLKNAVGEVQTHVMRMIQERKKQKGERNDD  274

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                 D LSRL+ AGH++E++RDMVISF++AGRDTTS+A+TWFFW+LS + ++E  ++++ 
Sbjct  275   DVEDDLLSRLICAGHEEEIIRDMVISFIMAGRDTTSAAVTWFFWVLSHYSHLEEKIVEEA  334

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                  +  L+++ L+ ++++KACLCESMRLYPPVAWDSKHA +DD+LPDGT +  G+RVT
Sbjct  335   -----KGVLDYESLKNLSFLKACLCESMRLYPPVAWDSKHATDDDLLPDGTVVKAGDRVT  389

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMI------SPFKFPVFQAGPRVCLGKE  320
             + PY MGRME+LWG DW +F+PDRWF E   ++ I      SPF FP+FQAGPRVCLGKE
Sbjct  390   YFPYGMGRMEDLWGKDWFQFRPDRWFVEPRNIEGIIMLNDVSPFSFPIFQAGPRVCLGKE  449

Query  319   MAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             MAFIQMK+VVASIL RF  R V   +P+FVPLLT +MA GL V V  R
Sbjct  450   MAFIQMKYVVASILSRFTFRIVGPEKPIFVPLLTAHMAGGLRVLVCKR  497



>ref|XP_006338805.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=522

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/473 (58%), Positives = 339/473 (72%), Gaps = 9/473 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PP+YPIIGCL+ FYKNRY LLDWYT LL+ SPTKTIV+ RLGA RT+VTA+  NVEYMLK
Sbjct  47    PPTYPIIGCLIPFYKNRYRLLDWYTHLLSHSPTKTIVIDRLGARRTIVTANPHNVEYMLK  106

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P N+ILGDFLG GIFNVDG++W  QRK+ SHEFTAR LR+ V+  L+EEV
Sbjct  107   TNFDNFPKGKPFNEILGDFLGNGIFNVDGEMWYKQRKMVSHEFTARCLRDYVVNALKEEV  166

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + +L P+L+     +   DLQD+LRR  FD +CK+       C  +       L+ AF++
Sbjct  167   ENKLLPMLDLMEAENRAFDLQDLLRRLGFDVVCKV-SLGFDPCCLNHSLPFSPLLHAFER  225

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             AS+I A RG AP+ A+WK KR  N+GSE++LR  I  +H  V +IIR RK +        
Sbjct  226   ASQICAGRGAAPISAIWKVKRWLNIGSERQLRLAIDQIHSSVADIIRERKIKIRGENQQE  285

Query  838   AGSDFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LS+L+ A + D E VRDMVISF++AGRDT S+A+TW F+LL+ HP IE  ++ + 
Sbjct  286   ISKDLLSKLILAENFDEEEVRDMVISFIIAGRDTISAAMTWLFYLLTLHPEIENELVSKE  345

Query  661   LSSDDQKTLN-FDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             L   + +TL   + LREM ++KACLCE+MRLYPPVAWDSKHA  DD+LPDGT I  GNRV
Sbjct  346   LRFIEAETLTKHETLREMKFLKACLCETMRLYPPVAWDSKHAIADDILPDGTRIKAGNRV  405

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWF-----DEQGKLKMISP-FKFPVFQAGPRVCLGK  323
             T+ PY MGRMENLWG D LEFKP+RW      DE G  +  S  +KFPVFQAGPRVCLGK
Sbjct  406   TYFPYGMGRMENLWGKDMLEFKPERWMQNSEEDEGGVAEQASNLYKFPVFQAGPRVCLGK  465

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGYN  164
             E+AFIQMK+VV+SIL+RF+IRP C   PVF+PLLT +MA G  + VH  +  N
Sbjct  466   ELAFIQMKYVVSSILKRFQIRPACSDPPVFLPLLTAHMAGGFKIFVHKTKNVN  518



>ref|XP_010503490.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=507

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/483 (57%), Positives = 348/483 (72%), Gaps = 7/483 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++   Y PPSYP+IG +LSF KNR  LL WYT+LL  SP++TI+V  LG  RT+VT
Sbjct  26    TKKAQETTTYGPPSYPLIGSILSFNKNRLRLLQWYTELLRISPSQTILVPLLGNRRTIVT  85

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
             A+ ENVEY+LK NF NFPKG+P   +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  86    ANPENVEYILKTNFFNFPKGKPFTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLR  145

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L++EV+ RL P+L AAA   + +DLQDVL+RFAFD +CK+              
Sbjct  146   SFAFEVLKDEVENRLVPVLSAAADVGTTVDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTR  204

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
             +   LV+AFD A+EISARR   PV+AVWK KR  NVGSE++L+E IK VH  V +I+R +
Sbjct  205   AVNPLVEAFDTAAEISARRATEPVYAVWKVKRVLNVGSERRLKEAIKTVHVLVSQIVRAK  264

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             K+         A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLL+++ 
Sbjct  265   KKSLEIGTGEEAKQDLLSRFLAAGHDGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTEND  324

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++++V        L F+ L+EMNY KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  325   DVERKILEEV-DPLVSLGLGFEDLKEMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDG  383

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQA  347
             T + +G++VT+ PY MGRME LW  D  EFKP+RWFD      Q  LK +SP+KFPVFQA
Sbjct  384   TRLKKGDKVTYFPYGMGRMETLWEKDSEEFKPNRWFDYEPGSTQPVLKPVSPYKFPVFQA  443

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGY  167
             GPRVC+GKEMAF+QMK+VV S+L RFEI PV + +PVFVPLLT +MA GL V++  R   
Sbjct  444   GPRVCVGKEMAFMQMKYVVGSVLSRFEIVPVNKDRPVFVPLLTAHMAGGLKVKIKRRSHI  503

Query  166   NNN  158
              N+
Sbjct  504   LNS  506



>ref|XP_009407042.1| PREDICTED: cytochrome P450 94B3-like [Musa acuminata subsp. malaccensis]
Length=499

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/466 (58%), Positives = 336/466 (72%), Gaps = 8/466 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P ++P+IGCL+ FYKNR+ LLDWYT+LL +SPT+TIV+ RLGA RT+VTA+ ENVE++
Sbjct  32    YGPKTHPVIGCLIRFYKNRHRLLDWYTELLEASPTQTIVMRRLGARRTIVTANPENVEHV  91

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG P  +ILGD LG GIF+ DG+LW  QRKLASHEF+ RSL + V+  LE 
Sbjct  92    LKINFPNYPKGRPFTEILGDLLGCGIFSADGELWHTQRKLASHEFSTRSLCDFVVNALEF  151

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E   RL P+L +A  +  V+D+Q++LRRFAFDTICK+           +      L DAF
Sbjct  152   ETGERLLPILSSACAHRGVVDMQELLRRFAFDTICKV-SLGTDPGFLDASLPESPLADAF  210

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             + AS ISA+RG APVFAVWK KRA  +GSE +LR  +K++H  V EIIR RK E      
Sbjct  211   EVASAISAKRGAAPVFAVWKAKRALGLGSEGQLRAAVKLIHASVMEIIRTRKTEIKKGTQ  270

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 +D LSRL+  GHKDEV+RDMVISF++AG+DTTS+ALTWFFWLLS HP  ET V K+
Sbjct  271   H---NDLLSRLIVGGHKDEVIRDMVISFVMAGKDTTSAALTWFFWLLSCHPEAETEVAKE  327

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
                +  +  L++  L++M  ++ACLCE MRLYPPV WDSKHAA +D LPDGT I +G+RV
Sbjct  328   AKQAKGR--LDYHTLKDMKVLEACLCECMRLYPPVLWDSKHAAYNDTLPDGTRIKKGDRV  385

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQ  305
             T+ PY MGR E LWG + +EF   RW  E G+L   SPFKFPVFQAGPRVCLGKEMAF+Q
Sbjct  386   TYFPYGMGRSEKLWGKNCMEFDYRRWLSESGELVRQSPFKFPVFQAGPRVCLGKEMAFVQ  445

Query  304   MKFVVASILRRFEIR--PVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             MK+V AS+LR FE+R     + +P  VPLLT +MA GL++ V  RE
Sbjct  446   MKYVAASVLREFELRREESAKQRPALVPLLTAHMAGGLHMVVEKRE  491



>ref|XP_006290939.1| hypothetical protein CARUB_v10017052mg [Capsella rubella]
 gb|EOA23837.1| hypothetical protein CARUB_v10017052mg [Capsella rubella]
Length=506

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/479 (58%), Positives = 345/479 (72%), Gaps = 7/479 (1%)
 Frame = -1

Query  1579  KKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             ++  +Y P SYP+IG LLSF KNR+ LL WYT+LL  SP++TI+V  LG  RT+VT + E
Sbjct  28    QETTIYGPKSYPLIGSLLSFNKNRHRLLQWYTELLRLSPSQTILVPLLGNRRTIVTTNPE  87

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
             NVEY+LK NF NFPKG+P   +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR    
Sbjct  88    NVEYILKTNFFNFPKGKPFTDLLGDLLGGGIFNVDGHTWSSQRKLASHEFSTRSLRSFAF  147

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
             + L++EV+ RL P+L AAA   + LDLQDVL+RFAFD +CK+                  
Sbjct  148   EVLKDEVENRLVPVLSAAADVGTTLDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTRPVNP  206

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEK  860
             LV+AFD A+EISARR   PV+AVWK KR  NVGSE++LRE I  VH  V EI+R +K+  
Sbjct  207   LVEAFDTAAEISARRATEPVYAVWKVKRVLNVGSERRLREAISTVHMLVSEIVRAKKKSL  266

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
                    A  D LSR L AGH  + VRDMVISF++AGRDTTS+A+TW FW L+++ N+E 
Sbjct  267   EIGTGEEAKQDLLSRFLAAGHDGKAVRDMVISFIMAGRDTTSAAMTWLFWSLTENDNVER  326

Query  679   TVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
              ++++V        L F+ L+EMNY KACLCE+MRLYPPV+WDSKHAANDDVLPDGT + 
Sbjct  327   KILEEV-DPLVSLGLGFEDLKEMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRLK  385

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQGK----LKMISPFKFPVFQAGPRV  335
             +G++VT+ PY MGRME LWG D  EFKP+RWFD E G     LK +SP+KFPVFQAGPRV
Sbjct  386   KGDKVTYFPYGMGRMETLWGKDAEEFKPNRWFDYEPGSTRPVLKPVSPYKFPVFQAGPRV  445

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGYNNN  158
             C+GKE+AF+QMK+VV S+L RFEI PV + +PVFVPLLT +MA GL V++  R    NN
Sbjct  446   CVGKELAFMQMKYVVGSVLSRFEIVPVGKDRPVFVPLLTAHMAGGLKVKIKRRSHIINN  504



>ref|NP_190421.1| cytochrome P450, family 94, subfamily B, polypeptide 3 [Arabidopsis 
thaliana]
 sp|Q9SMP5.1|C94B3_ARATH RecName: Full=Cytochrome P450 94B3; AltName: Full=Jasmonoyl-isoleucine-12-hydroxylase 
[Arabidopsis thaliana]
 emb|CAB62341.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|AAU05455.1| At3g48520 [Arabidopsis thaliana]
 gb|AAU94404.1| At3g48520 [Arabidopsis thaliana]
 dbj|BAE98488.1| cytochrome P450 like protein [Arabidopsis thaliana]
 gb|AEE78426.1| cytochrome P450, family 94, subfamily B, polypeptide 3 [Arabidopsis 
thaliana]
Length=506

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/483 (57%), Positives = 346/483 (72%), Gaps = 7/483 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++   Y PPSYP+IG +LSF KNR+ LL WYT+LL  SP++TI+V  LG  RT++T
Sbjct  25    TKKVQENTTYGPPSYPLIGSILSFNKNRHRLLQWYTELLRLSPSQTILVPLLGNRRTIIT  84

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
              +  NVEY+LK NF NFPKG+P   +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  85    TNPLNVEYILKTNFFNFPKGKPFTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLR  144

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L++EV+ RL P+L  AA   + +DLQDVL+RFAFD +CK+              
Sbjct  145   SFAFEVLKDEVENRLVPVLSTAADVGTTVDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTR  203

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 LV+AFD A+EISARR   P++AVWK KR  NVGSE+KLRE I+ VH  V EI+R +
Sbjct  204   PVNPLVEAFDTAAEISARRATEPIYAVWKTKRVLNVGSERKLREAIRTVHVLVSEIVRAK  263

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             K+       A A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLL+++ 
Sbjct  264   KKSLEIGTGAEAKQDLLSRFLAAGHNGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTEND  323

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++++V        L F+ L+EM Y KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  324   DVERKILEEV-DPLVSLGLGFEDLKEMAYTKACLCEAMRLYPPVSWDSKHAANDDVLPDG  382

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQGK----LKMISPFKFPVFQA  347
             T + RG++VT+ PY MGRME LWG D  EF P+RWFD E G     LK ISP+KFPVFQA
Sbjct  383   TRVKRGDKVTYFPYGMGRMETLWGTDSEEFNPNRWFDSEPGSTRPVLKPISPYKFPVFQA  442

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGY  167
             GPRVC+GKEMAF+QMK+VV S+L RFEI PV + +PVFVPLLT +MA GL V++  R   
Sbjct  443   GPRVCVGKEMAFMQMKYVVGSVLSRFEIVPVNKDRPVFVPLLTAHMAGGLKVKIKRRSHI  502

Query  166   NNN  158
              NN
Sbjct  503   LNN  505



>ref|XP_010426348.1| PREDICTED: cytochrome P450 94B3 [Camelina sativa]
Length=506

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/483 (57%), Positives = 347/483 (72%), Gaps = 7/483 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++   Y PPSYP+IG +LSF KNR+ LL WYT+LL  SP++TI+V  LG  RT+VT
Sbjct  25    TKKAQETTTYGPPSYPLIGSILSFNKNRHRLLQWYTELLRISPSQTILVPLLGNRRTIVT  84

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
              + ENVEY+LK NF NFPKG+P   +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  85    TNPENVEYILKTNFFNFPKGKPFTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLR  144

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L++EV+ RL  +L AAA   + LDLQDVL+RFAFD +CK+              
Sbjct  145   SFAFEVLKDEVENRLVTVLSAAADVGTTLDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTR  203

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
             S   LV+AFD A+EISARR   PV+AVWK KR  NVGSE++L+E IK VH  V +I+R +
Sbjct  204   SVNPLVEAFDTAAEISARRATEPVYAVWKVKRVLNVGSERRLKEAIKTVHVLVSQIVRAK  263

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             K+         A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FW L+++ 
Sbjct  264   KKSLEIGTGEEAKQDLLSRFLAAGHDGEAVRDMVISFIMAGRDTTSAAMTWLFWSLTEND  323

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++++V        L F+ L+EMNY KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  324   DVERKILEEV-DPLVSLGLGFEDLKEMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDG  382

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQA  347
             T + +G++VT+ PY MGRME LWG D  EFKP+RWFD      Q  LK +SP+KFPVFQA
Sbjct  383   TRLKKGDKVTYFPYGMGRMETLWGKDSEEFKPNRWFDYEPGSTQPVLKPVSPYKFPVFQA  442

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGY  167
             GPRVC+GKEMAF+QMK+VV S+L RFEI PV + +PVFVPLLT +MA GL V++  R   
Sbjct  443   GPRVCVGKEMAFMQMKYVVGSVLSRFEIVPVNKDRPVFVPLLTAHMAGGLKVKIKRRRHI  502

Query  166   NNN  158
              N+
Sbjct  503   LNS  505



>ref|XP_002877615.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53874.1| CYP94B3 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/483 (58%), Positives = 345/483 (71%), Gaps = 7/483 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++   Y PPSYP+IG +LSF KNR+ LL WYT+LL  SP++TI+V  LG  RT+VT
Sbjct  25    TKKVQETTTYGPPSYPLIGSILSFNKNRHRLLQWYTELLRISPSQTILVPLLGNRRTIVT  84

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
              + ENVEY+LK NF NFPKG+P   +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  85    TNPENVEYILKTNFFNFPKGKPFTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLR  144

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L +EV+ RL P+L AAA   + +DLQDVL+RFAFD +CK+              
Sbjct  145   SFAFEVLIDEVENRLVPVLSAAADVGTTVDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTR  203

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 LV+AFD A+EISARR   PV AVW  KR  NVGSE++LRE I+ VH  V EI+R +
Sbjct  204   PVNPLVEAFDTAAEISARRATEPVCAVWMVKRVLNVGSERRLREAIRTVHVLVSEIVRAK  263

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             K+     I   A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLL+++ 
Sbjct  264   KKSLEIGIGEEAKQDLLSRFLAAGHNGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTEND  323

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++++V        L F+ L+EMNY KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  324   DVERKILEEV-DPLVSLGLGFEDLKEMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDG  382

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-DEQGK----LKMISPFKFPVFQA  347
             T + RG++VT+ PY MGRME LWG D  EFKP+RWF  E G     LK ISP+KFPVFQA
Sbjct  383   TRVKRGDKVTYFPYGMGRMETLWGTDSEEFKPNRWFHSEPGSTRPVLKPISPYKFPVFQA  442

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGY  167
             GPRVC+GKEMAF+QMK+VV S+L RFEI PV   +PVFVPLLT +MA GL V++  R   
Sbjct  443   GPRVCVGKEMAFMQMKYVVGSVLSRFEIIPVNLDRPVFVPLLTAHMAGGLKVKIKRRSHI  502

Query  166   NNN  158
              NN
Sbjct  503   LNN  505



>ref|XP_010515172.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=507

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/483 (57%), Positives = 346/483 (72%), Gaps = 7/483 (1%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++   Y PPSYP+IG +LSF KNR  LL WYT+LL  SP++TI+V  LG  RT+VT
Sbjct  26    TKKAQETTTYGPPSYPLIGSILSFNKNRLRLLQWYTELLRISPSQTILVPLLGNRRTIVT  85

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
             A+ EN+EY+LK NF NFPKG+    +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  86    ANPENIEYILKTNFFNFPKGKHFTDLLGDLLGGGIFNVDGHSWSSQRKLASHEFSTRSLR  145

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L++EV+ RL  +L AAA   + LDLQDVL+RFAFD +CK+              
Sbjct  146   SFAFQVLKDEVENRLVAVLSAAADVGTTLDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTR  204

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                 LV+AFD A+EISARR   PV+AVWK KR  NVGSE++L+E IK VH  V +I+R +
Sbjct  205   PVNPLVEAFDTAAEISARRATEPVYAVWKVKRVLNVGSERRLKEAIKTVHVLVSQIVRAK  264

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             K+         A  D LSR L AGH  E VRDMVISF++AGRDTTS+A+TW FWLL+++ 
Sbjct  265   KKSLEIGTGEEAKQDLLSRFLAAGHDGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTEND  324

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++K+V        L F+ L+EMNY KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  325   DVERKILKEV-DPLVSLGLGFEDLKEMNYTKACLCEAMRLYPPVSWDSKHAANDDVLPDG  383

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQA  347
             T + +G++VT+ PY MGRME LWG D  EFKP+RWFD      Q  LK +SP+KFPVFQA
Sbjct  384   TRLKKGDKVTYFPYGMGRMETLWGKDSEEFKPNRWFDYEPGSTQPVLKPVSPYKFPVFQA  443

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGY  167
             GPRVC+GKEMAF+QMK+VV S+L RFEI PV + +PVFVPLLT +MA GL V++  R   
Sbjct  444   GPRVCVGKEMAFMQMKYVVGSVLSRFEIVPVNKDRPVFVPLLTAHMAGGLKVKIKRRSHI  503

Query  166   NNN  158
              N+
Sbjct  504   LNS  506



>ref|XP_003548522.2| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=513

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/466 (58%), Positives = 346/466 (74%), Gaps = 16/466 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGCL+SFY+NRY LLDWYT+LLA SPT TIVV RLGA RT+VT + +NVEYMLK
Sbjct  42    PATYPLIGCLISFYRNRYRLLDWYTELLAQSPTNTIVVQRLGARRTIVTTNPQNVEYMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG+GIFNVDG+ W A R+LASHEF+ +SLRE VM TLE+EV
Sbjct  102   TNFNNFPKGKPFTEILGDFLGQGIFNVDGESWLASRRLASHEFSTKSLREFVMHTLEKEV  161

Query  1198  DGRLSPLL-EAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss--dssaeSLVDA  1028
               RL P+L EA    + V+DLQ++LRRF+F+ ICK +LG++               L  A
Sbjct  162   CERLVPVLDEALCGENKVVDLQELLRRFSFNVICKFTLGTNNYNRCCLDPSVPTCPLARA  221

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD A+E+SA+RG AP+F +W+ KR F  GSE+ L+  +  V  HV  +I+ RKQ+   N 
Sbjct  222   FDVAAEVSAKRGAAPLFMIWRVKRWFCAGSERLLKIAVGEVQTHVMRMIQERKQKGEINY  281

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D LSRL+ AGH++EV+RDMVISF++AGRDTTS+A+TWFFW+LS + ++E  +++
Sbjct  282   YE---DDLLSRLICAGHEEEVIRDMVISFIMAGRDTTSAAMTWFFWVLSHYSHLEDKIVE  338

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             +      +  L+++ L+ ++++KACLCESMRLYPPVAWDSKHA +DD+LPDGT +  G+R
Sbjct  339   EA-----KGVLDYESLKNLSFLKACLCESMRLYPPVAWDSKHATDDDLLPDGTVVKAGDR  393

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWF-----DEQGKLKMISPFKFPVFQAGPRVCLGK  323
             VT+ PY MGRME+LWG DW EF+P+RWF      E   L  +SPF FP+FQAGPRVCLGK
Sbjct  394   VTYFPYGMGRMEDLWGKDWFEFRPNRWFVEPRNSEGIVLNEVSPFLFPIFQAGPRVCLGK  453

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRV  185
             EMAFIQMK+VVASIL RF  + V   +P+FVPLLT +MA GL V V
Sbjct  454   EMAFIQMKYVVASILSRFTFKIVSPDRPIFVPLLTAHMAGGLRVMV  499



>gb|AAM60854.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=508

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/468 (59%), Positives = 337/468 (72%), Gaps = 8/468 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG +LSF KNR+ LL WYT LL  SP++TI V  L   RT++TA+ ENVE++LK
Sbjct  36    PISYPLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITVDLLFGRRTIITANPENVEHILK  95

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  96    TNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  155

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +A      +D Q+VL+RFAFD +CK+                  LV AFD 
Sbjct  156   QNRLIPVLSSAVDCGETVDFQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPELVKAFDV  214

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  NVGSEK+LRE IK VH  V EIIR +K+         
Sbjct  215   AAEISARRATEPVYAVWKVKRFLNVGSEKRLREAIKTVHLSVSEIIRAKKKSLDIGGDVS  274

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++ET ++ + L
Sbjct  275   DKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVETKILDE-L  333

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +     L F+ LREM+Y KACLCE+MRLYPPVAWDSKHAANDD+LPDGTP+ +G++VT+
Sbjct  334   RNKGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDGTPLKKGDKVTY  393

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GKEM
Sbjct  394   FPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQAGPRVCIGKEM  453

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AF QMK+VV S+L RF+I PVC ++PVFVPLLT +MA GL V++  RE
Sbjct  454   AFTQMKYVVGSVLSRFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRRE  501



>emb|CBI21357.3| unnamed protein product [Vitis vinifera]
Length=538

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/469 (58%), Positives = 334/469 (71%), Gaps = 28/469 (6%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PP+YPIIGCLLSFY NR  LLDWYT L+A SPT+TIVVHR GA RT+VTA+ ENVEYMLK
Sbjct  87    PPTYPIIGCLLSFYSNRRRLLDWYTDLIAHSPTRTIVVHRFGARRTIVTANPENVEYMLK  146

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  QILGDFLG GIFNVDG+LW  QRKLASHEF A+S R+          
Sbjct  147   TNFNNFPKGKPFTQILGDFLGCGIFNVDGELWRTQRKLASHEFGAKSWRQF---------  197

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
                        A     +DLQ++LRR AF+ +CK+               A  L  AFD 
Sbjct  198   -----------ADAHKTVDLQELLRRLAFNMVCKV-SLGIDPFSLDPSLPALPLARAFDT  245

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR--VRKQEKANNIA  845
             ASEI A R  APVFAVWK KRA  VGSE++LR+ I+ VH  V++IIR   +  EK  +  
Sbjct  246   ASEICAGRAAAPVFAVWKIKRALRVGSERRLRKAIEEVHACVDDIIRKKKKMMEKKGSDD  305

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                  D L+RL+ AGH  EV+RD VISF++AGRDTTS+A+TW FWLLS+H +IE  ++K+
Sbjct  306   DNGNEDLLTRLISAGHGHEVIRDTVISFIMAGRDTTSAAMTWLFWLLSRHQDIEEELVKE  365

Query  664   V-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             +  ++D +K L++D L EM  +KACLCESMRLYPPVAWDSKHA   D+LPDGTP+  G+R
Sbjct  366   LWATTDKEKCLDYDSLNEMKLLKACLCESMRLYPPVAWDSKHALTHDILPDGTPVRAGDR  425

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCLGKE  320
             VT+ PY MGRME LWG D  EFKPDRWF     E+G+L+ + P++FP+FQAGPRVCLGKE
Sbjct  426   VTYFPYGMGRMEALWGKDRFEFKPDRWFLEPDKERGELRRVCPYRFPIFQAGPRVCLGKE  485

Query  319   MAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             +AF+QMK+VV SILR+FEIRPV   +PVFVPLLT +MA GL V V  R+
Sbjct  486   VAFLQMKYVVGSILRQFEIRPVGLDEPVFVPLLTAHMAGGLNVSVRRRQ  534



>ref|XP_007161734.1| hypothetical protein PHAVU_001G094200g [Phaseolus vulgaris]
 gb|ESW33728.1| hypothetical protein PHAVU_001G094200g [Phaseolus vulgaris]
Length=496

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/466 (57%), Positives = 343/466 (74%), Gaps = 11/466 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGCL+SFYKN++ LLDWYT+LLA SPT TIVV RLGA RT+VTA+ +NVEY+LK
Sbjct  37    PATYPLIGCLISFYKNKHRLLDWYTELLAQSPTNTIVVQRLGARRTIVTANPQNVEYILK  96

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG+GIFNVDG+LW  QR+ ASHEF+ +SLRE  M TLE EV
Sbjct  97    TNFNNFPKGKPFTEILGDFLGQGIFNVDGELWLTQRRFASHEFSTKSLREFFMHTLEREV  156

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+LEA +  + V+DLQ++L RF+F+ ICK        C         SL  AFD 
Sbjct  157   CERLLPVLEALSDENKVVDLQELLSRFSFNVICKF-TLGTNRCCLDPAVPTCSLAKAFDV  215

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+E+SARRG AP+F +W+ KR    GSE  L++ +  V  HV  +I+ RK++       G
Sbjct  216   AAEVSARRGAAPLFMIWRVKRWLGAGSEGLLKKAVGEVQTHVMRMIQERKEKIEEGEENG  275

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSRLL AGH++E+++DMVISF++AGRDTTS+A+TWFFW+LS + ++E  ++++  
Sbjct  276   GVEDLLSRLLCAGHEEELIKDMVISFIMAGRDTTSAAMTWFFWILSHYSHMEKQIVEEA-  334

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
                 +  L+++ ++ ++++KACLCES+RLYPPVAWDSKHA+ DD+LPDGT +  G+RVT+
Sbjct  335   ----KGVLDYESVKNLSFLKACLCESVRLYPPVAWDSKHASGDDLLPDGTVVKAGDRVTY  390

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVFQAGPRVCLGKEMA  314
              PY MGRME+LWG DW EF+PDRWF E G      L  +SPF FPVFQAGPRVCLGKEMA
Sbjct  391   FPYGMGRMESLWGKDWFEFRPDRWFVEPGNSEGIMLSEVSPFIFPVFQAGPRVCLGKEMA  450

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             FI MK+VVASIL RF+ R +   +P+FVPLLT +MA GL V V  R
Sbjct  451   FIHMKYVVASILSRFKFRIIGPERPIFVPLLTAHMAGGLRVLVCKR  496



>ref|XP_008450098.1| PREDICTED: cytochrome P450 94B3 isoform X1 [Cucumis melo]
Length=505

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/471 (57%), Positives = 339/471 (72%), Gaps = 18/471 (4%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             +PP+YP+IGCL+SFY NR  LLDWYT+LL+ S T TIV+ RLG  RTVVT +  NVEY+L
Sbjct  30    SPPTYPLIGCLISFYINRNRLLDWYTELLSESSTGTIVIRRLGCRRTVVTVNPANVEYIL  89

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
               +FLNFPKG+P  +IL DFLG GIFNVDGD W  QRKLASHEF+A+SL+E V++TL+ E
Sbjct  90    TTHFLNFPKGKPFTEILNDFLGCGIFNVDGDQWRTQRKLASHEFSAKSLQEFVVETLKSE  149

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+ RL P LEA+A N+ V+DLQD+LR FAF  ICKI        L S + +  +L  +F+
Sbjct  150   VEMRLLPALEASAHNAKVVDLQDLLRGFAFRVICKI-------VLGSEEETIFALQKSFE  202

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              ASE+SARR M P++  WK KR   VGSE++L++ +  VH  V  II  R++E+      
Sbjct  203   VASEVSARRAMEPIYVTWKMKRWLGVGSERRLKKEVAEVHRKVMNIIDKRRKEEKIQDIH  262

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
              +  D LSRL+   H DE +RDMVISF++AGRDTTS+A+TW FWLL  HPNIE  +I+++
Sbjct  263   DSTQDLLSRLIKTEHDDEEIRDMVISFIMAGRDTTSAAMTWLFWLLCIHPNIENQLIEEI  322

Query  661   -LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
              L+S     L++  L+E+ Y+KACLCE+MR+YPPV WDSKHA  DD LPDGT +  G+RV
Sbjct  323   DLTS---VKLDYQSLKELKYLKACLCETMRMYPPVPWDSKHAIADDYLPDGTLVRSGDRV  379

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQG-------KLKMISPFKFPVFQAGPRVCLG  326
             T+ PY MGRM  LWG D  EFKP RW  EQ         +K++SP+KFP+FQAGPRVCLG
Sbjct  380   TYFPYGMGRMVALWGKDQFEFKPSRWVVEQDGRGGRRTGVKLVSPYKFPIFQAGPRVCLG  439

Query  325   KEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             KEMAF+QMK+VVASIL +F I+PV    PVFVPLLT +MA G  V +  RE
Sbjct  440   KEMAFLQMKYVVASILSQFRIKPVAGDHPVFVPLLTAHMAGGFKVFIQRRE  490



>ref|XP_009130252.1| PREDICTED: cytochrome P450 94B1-like [Brassica rapa]
Length=512

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/473 (58%), Positives = 343/473 (73%), Gaps = 11/473 (2%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP+IG +LSF KNR+ LL WYT LL  SP++TI V  L   RT+VTA+ +NVE++LK N
Sbjct  39    SYPLIGSILSFKKNRHRLLQWYTDLLRLSPSQTITVELLLNRRTIVTANPKNVEHILKTN  98

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE     L EEV+ 
Sbjct  99    FCNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFGILREEVET  158

Query  1192  RLSPLLEAAAR---NSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             RL P+L +AA        +D Q++L+RFAFD +CK+                  LV+AFD
Sbjct  159   RLVPVLSSAAAECDGGRTVDFQEILKRFAFDVVCKV-SLGWDPDCLDLTRPVPVLVEAFD  217

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+ ISARR   PV+AVWK KR  NVGSE+KLRE IK VH  V EIIR +K+    N   
Sbjct  218   VAAAISARRATEPVYAVWKLKRLLNVGSERKLREAIKTVHMSVSEIIRAKKKSLKINGNV  277

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                 D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++PN+E  ++++V
Sbjct  278   SDKLDLLSRFLAAGHDEESVRDSVISFIMAGRDTTSAAMTWLFWLLSENPNVEKKILEEV  337

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
               +     L  + LREM+Y+KACLCE+MRLYPPVAWDSKHAANDDVLP+GT + +G++VT
Sbjct  338   -RNKGSLGLGVEDLREMSYMKACLCEAMRLYPPVAWDSKHAANDDVLPNGTQVKKGDKVT  396

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKE  320
             + PY MGRMEN+WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GKE
Sbjct  397   YFPYGMGRMENVWGQDWDEFKPNRWFEEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGKE  456

Query  319   MAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREGYNN  161
             MAF+QMK+VV S+L RFEI PVC+++PVFVPLLT +MA GL V++  RE  ++
Sbjct  457   MAFMQMKYVVGSVLSRFEIIPVCKNRPVFVPLLTAHMAGGLKVKIKRRESISD  509



>emb|CDY37921.1| BnaA06g18960D [Brassica napus]
Length=469

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/478 (55%), Positives = 331/478 (69%), Gaps = 40/478 (8%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             T+  ++  V  PPSYP+IG +LSF KNR+ LL WYTKLL  SP++TI +  LG  RT+VT
Sbjct  25    TKKTQETNVNGPPSYPLIGSILSFNKNRHRLLQWYTKLLRLSPSQTITIPLLGNRRTIVT  84

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
              + ENVEY+LK NF NFPKG P   +LGD LG+GIFNVDG  WS+QRKLASHEF+ RSLR
Sbjct  85    TNPENVEYILKTNFFNFPKGRPFTDLLGDLLGQGIFNVDGHSWSSQRKLASHEFSTRSLR  144

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
                 + L EEV+ R+ P+L  AA   + +DLQD                           
Sbjct  145   SFAFEVLREEVETRIVPVLSTAADVGTTVDLQD---------------------------  177

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
                    AFD A+EISARR   P++AVWK KR  NVGSE++LRE I+ VH+ V EI+R +
Sbjct  178   -------AFDTAAEISARRATEPLYAVWKAKRVLNVGSERRLREAIRTVHELVSEIVRAK  230

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             ++         A  D LSR L +GH  E VRDMVISF++AGRDTTS+A+TW FWLLS++ 
Sbjct  231   RKSLEIGTGQEAKQDLLSRFLASGHDSEAVRDMVISFIMAGRDTTSAAMTWLFWLLSEND  290

Query  691   NIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++E  ++++V        L F+ L+EM+Y+KACLCE+MRLYPPV+WDSKHAANDDVLPDG
Sbjct  291   DVEKKLLQEV-EPLMSLGLGFEELKEMSYMKACLCEAMRLYPPVSWDSKHAANDDVLPDG  349

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVFQA  347
             T + +G++VT+ PY MGRMENLWG D  EFKP RWFD +       LK +SPFKFPVFQA
Sbjct  350   TRVKKGDKVTYFPYGMGRMENLWGKDCEEFKPSRWFDSEPGITEPVLKPVSPFKFPVFQA  409

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             GPRVC+GKEMAF+QMKFVV S+L RFEI PV + +PVFVPLLT +MA GL V++  RE
Sbjct  410   GPRVCIGKEMAFMQMKFVVGSVLSRFEIIPVSKHKPVFVPLLTAHMAGGLKVKIKRRE  467



>ref|XP_010545953.1| PREDICTED: cytochrome P450 94B3-like [Tarenaya hassleriana]
Length=504

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/477 (57%), Positives = 338/477 (71%), Gaps = 16/477 (3%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
              + P SYPIIGCL+SFY NR  LL WYT LL+ SP++TI + RLG  RTVVTA+ +NVE+
Sbjct  28    THGPTSYPIIGCLISFYSNRRRLLQWYTDLLSLSPSQTISLRRLGGGRTVVTANPDNVEH  87

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LK NF+NFPKG+P   +LGD LG GIFN DGD W+ QRKLASHEFT RSLRE   + L 
Sbjct  88    ILKTNFINFPKGKPFTDLLGDLLGGGIFNSDGDQWATQRKLASHEFTTRSLREFGFEALR  147

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             +EV+ RL P L +AA     +DLQ++L+RFAFD +CK                   +V+A
Sbjct  148   DEVETRLVPTLSSAAAAGEAVDLQEILKRFAFDVVCKF-SLGTDPNCLDLTRPVSPIVEA  206

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD A+EISARR   PV+AVWK KR  NVGSE++LRE I+ VH  V EIIR +K  K+  I
Sbjct  207   FDAAAEISARRATEPVYAVWKVKRLLNVGSERRLREAIRTVHVSVSEIIRAKK--KSLEI  264

Query  847   AAG---AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
               G   A  D LSR   AG+  +  RDMVISF++AGRDTTS+A+TW FWLL+++   E  
Sbjct  265   GTGNVEAKQDLLSRSPAAGNDGDAARDMVISFIMAGRDTTSAAMTWLFWLLTQNDVAERK  324

Query  676   VIKQVLS----SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             + ++V S     D +  L F+ L+ M+Y KACLCE+MRLYPPVAWDSKHAANDDVLPDGT
Sbjct  325   IREEVASLKREKDGELGLGFEGLKAMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGT  384

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQA  347
              + RG++VT+ PY MGRME LWG DW EFKPDRW  ++        LK +SPFKFPVFQA
Sbjct  385   RVKRGDKVTYFPYGMGRMEKLWGKDWDEFKPDRWLTDEPDNGTRPVLKSVSPFKFPVFQA  444

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             G RVCLGKEMAF+QMK+V+ S+L RFEI PVC+ QPVFVPLLT +MA G  +++  R
Sbjct  445   GQRVCLGKEMAFMQMKYVIGSVLSRFEIVPVCKDQPVFVPLLTAHMAGGFKIKIKRR  501



>ref|NP_201150.1| cytochrome P450, family 94, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9FMV7.1|C94B1_ARATH RecName: Full=Cytochrome P450 94B1 [Arabidopsis thaliana]
 dbj|BAB08810.1| cytochrome P450-like protein [Arabidopsis thaliana]
 gb|ABA61323.1| cytochrome P450 CYP94B1 [Arabidopsis thaliana]
 gb|AED97750.1| cytochrome P450, family 94, subfamily B, polypeptide 1 [Arabidopsis 
thaliana]
Length=510

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 336/468 (72%), Gaps = 8/468 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SY +IG +LSF KNR+ LL WYT LL  SP++TI V  L   RT++TA+ ENVE++LK
Sbjct  38    PTSYQLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITVDLLFGRRTIITANPENVEHILK  97

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  98    TNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  157

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +A      +D Q+VL+RFAFD +CK+                  LV AFD 
Sbjct  158   QNRLIPVLSSAVDCGETVDFQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPELVKAFDV  216

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  NVGSEK+LRE IK VH  V EIIR +K+         
Sbjct  217   AAEISARRATEPVYAVWKVKRFLNVGSEKRLREAIKTVHLSVSEIIRAKKKSLDIGGDVS  276

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++ET ++ + L
Sbjct  277   DKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVETKILDE-L  335

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +     L F+ LREM+Y KACLCE+MRLYPPVAWDSKHAANDD+LPDGTP+ +G++VT+
Sbjct  336   RNKGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDGTPLKKGDKVTY  395

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GKEM
Sbjct  396   FPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQAGPRVCIGKEM  455

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AF QMK+VV S+L RF+I PVC ++PVFVPLLT +MA GL V++  RE
Sbjct  456   AFTQMKYVVGSVLSRFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRRE  503



>ref|XP_004303976.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/469 (59%), Positives = 344/469 (73%), Gaps = 12/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PPS+P+IGCL+SFY+NR+ LLDWYT+LLA S T TIVV RLGA RT+VTA+ ENVEYMLK
Sbjct  42    PPSHPLIGCLVSFYQNRFRLLDWYTELLADSATSTIVVSRLGARRTIVTANPENVEYMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDG+LW  QRKLASHEFT +SLRE +M +LEEEV
Sbjct  102   TNFNNFPKGKPFTEILGDFLGCGIFNVDGELWRTQRKLASHEFTTKSLREHIMNSLEEEV  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             +  L PL+E+ A    V+DLQ++LRRF F+ ICK+       C          L  AFD 
Sbjct  162   EEGLLPLMESLAMKGEVVDLQELLRRFTFNVICKV-FLGVERCSLDPSLPVPELARAFDT  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             ASEI A RG APVF +WK KR   +GSE+KL+  +  VH +V  II  RKQ+  ++ + G
Sbjct  221   ASEICAMRGAAPVFIIWKIKRWLGIGSEQKLKAAVAQVHAYVMNIIETRKQKLDDDQSTG  280

Query  838   ---AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                   D L+RL+ AGH+DEV RDMVISF++AGRDTTS+A+TW FWLLS+H  +E  ++K
Sbjct  281   NIDQDQDLLTRLIMAGHEDEVTRDMVISFIMAGRDTTSAAMTWLFWLLSRHQTVEEDLVK  340

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             ++   ++Q T++ + L +   +KACL ESMRL+PPVAWDSKHA  DD+LPDGT +  G+R
Sbjct  341   EI--EENQTTMDHEPL-DFRLLKACLFESMRLFPPVAWDSKHAKVDDLLPDGTHVRAGDR  397

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVFQAGPRVCLGK  323
             VT+ PY MGRME+LWG D LEFKPDRWF E  K     LK + PFK P+FQAGPRVCLGK
Sbjct  398   VTYFPYGMGRMESLWGKDRLEFKPDRWFLEPDKEARSELKKVCPFKLPIFQAGPRVCLGK  457

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             EMAF QMK+V+ASILR+FEIRPV    PVFVP LT +MA G+ V V  R
Sbjct  458   EMAFAQMKYVMASILRQFEIRPVDSDVPVFVPRLTAHMAGGMKVLVRKR  506



>ref|XP_004233587.1| PREDICTED: cytochrome P450 94B3 [Solanum lycopersicum]
Length=513

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 343/471 (73%), Gaps = 18/471 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PP+YP+IGCL+ FYKNRY LLDWYT LL+ S TKTIV+ RLGA RT+VTA+  NVEYMLK
Sbjct  44    PPTYPVIGCLIPFYKNRYRLLDWYTHLLSHSQTKTIVIDRLGARRTIVTANPHNVEYMLK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P N+ILGDFLG GIFNVDG++W  QRK+ SHEFT R LRE VM  L+EEV
Sbjct  104   TNFDNFPKGKPFNEILGDFLGNGIFNVDGEMWYKQRKMVSHEFTGRCLRECVMNALKEEV  163

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + +L P+L+     +   DLQD+LRR  FD +CK+SLG DP CL+        L+DAF++
Sbjct  164   ENKLLPMLDLMEAENRAFDLQDLLRRLGFDVVCKVSLGFDPCCLNDDSLPFSPLLDAFER  223

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRK------QEKA  857
             AS+I A RG APV A+WK KR  N+GSE++LR  I  +H  V  +IR RK       E+ 
Sbjct  224   ASQICAGRGAAPVSAIWKVKRLLNIGSERQLRLAIDQIHSSVGNMIRERKIQMRGETEQD  283

Query  856   NNIAAGAGSDFLSRLLDAGH-KDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
              NI+     D LS+LL A +  DE VRDMVISF++AGRDTTS+A+TW F+LL+ HP +E 
Sbjct  284   INISK---VDLLSKLLLAANFDDEEVRDMVISFIIAGRDTTSAAMTWLFYLLTLHPEVEN  340

Query  679   TVIKQVLSSDDQKTLN-FDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
              ++ + L   + +TL   + LR+M ++KACLCE+MRLYPPVAWDSKHA  DD+LPDGT I
Sbjct  341   ELVSKELRFIEAETLTKHEILRDMKFLKACLCETMRLYPPVAWDSKHAIVDDILPDGTRI  400

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRV  335
               GNRVT+ PY MGRMENLWG D LEFKP+RW     +++G   +   +KFPVFQAGPRV
Sbjct  401   KAGNRVTYFPYGMGRMENLWGKDRLEFKPERWMHNTEEDEGASNL---YKFPVFQAGPRV  457

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVH  182
             CLGKE+AFIQMK+VV+SIL+RF I P     P+F+PLLT +MA G  + VH
Sbjct  458   CLGKELAFIQMKYVVSSILKRFHITPASSDPPLFLPLLTAHMAGGFNIFVH  508



>dbj|BAC43161.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAO64841.1| At5g63450 [Arabidopsis thaliana]
Length=510

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 335/468 (72%), Gaps = 8/468 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SY +IG +LSF KNR+ LL WYT LL  SP++TI V  L   RT++TA+ ENVE++LK
Sbjct  38    PTSYQLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITVDLLFGRRTIITANPENVEHILK  97

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  98    TNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  157

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +A      +D Q+VL+RFAFD +CK+                  LV AFD 
Sbjct  158   QNRLIPVLSSAVDCGETVDFQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPELVKAFDV  216

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  NVGSEK+LRE IK VH  V EIIR +K+         
Sbjct  217   AAEISARRATEPVYAVWKVKRFLNVGSEKRLREAIKTVHLSVSEIIRAKKKSLDIGGDVS  276

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++ET ++ + L
Sbjct  277   DKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVETKILDE-L  335

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +     L F+ LREM+Y KACLCE+MRLYPPVAWDSKHAANDD+LPDGTP+ +G++VT+
Sbjct  336   RNKGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDILPDGTPLKKGDKVTY  395

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GKEM
Sbjct  396   FPYGMGRMEKVWGKDWDEFKPNRWFEEEPSYGTKPVLKSVSSFKFPVFQAGPRVCIGKEM  455

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AF QMK VV S+L RF+I PVC ++PVFVPLLT +MA GL V++  RE
Sbjct  456   AFTQMKDVVGSVLSRFKIIPVCNNRPVFVPLLTAHMAGGLKVKIKRRE  503



>ref|XP_006282257.1| hypothetical protein CARUB_v10028534mg [Capsella rubella]
 gb|EOA15155.1| hypothetical protein CARUB_v10028534mg [Capsella rubella]
Length=505

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/468 (58%), Positives = 335/468 (72%), Gaps = 8/468 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG +LSF KNR+ LL WYT LL  SP +TI V+ L   RT++TA+ ENVE++LK
Sbjct  38    PASYPLIGSILSFKKNRHRLLQWYTDLLRLSPAQTITVNLLFGRRTIITANPENVEHILK  97

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  ++LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  98    TNFCNFPKGKPFTELLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  157

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +A      +DLQ+VL+RFAFD +CK+                  LV AFD 
Sbjct  158   QNRLIPVLSSAVDVGGTVDLQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVKAFDV  216

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   P++AVWK KR  N+GSE++LRE I  VH+ V EIIR +K+         
Sbjct  217   AAEISARRATEPIYAVWKLKRLLNIGSERRLREAIMTVHESVSEIIRAKKKSLDIGGDVS  276

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L +GH +E VRD VISF++AGRDTTS+A+TW FWLL ++ ++E  ++++V 
Sbjct  277   DKQDLLSRFLASGHGEESVRDSVISFIMAGRDTTSAAMTWLFWLLCQNNDVEKKILEEV-  335

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
                    L F+ LREM+Y KACLCE+MRLYPPVAWDSKHAANDDVLPDGT + +G++VT+
Sbjct  336   KGIGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGTLVRKGDKVTY  395

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWFDE+        LK +S FKFPVFQAGPRVC+GKEM
Sbjct  396   FPYGMGRMEKVWGQDWEEFKPNRWFDEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGKEM  455

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             AF QMK+VV S+L RFEI PV  ++PVFVPLLT YMA GL V++  RE
Sbjct  456   AFTQMKYVVGSVLSRFEIVPVRNNRPVFVPLLTAYMAGGLNVKIKRRE  503



>ref|XP_006394276.1| hypothetical protein EUTSA_v10005707mg [Eutrema salsugineum]
 gb|ESQ31562.1| hypothetical protein EUTSA_v10005707mg [Eutrema salsugineum]
Length=505

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/469 (58%), Positives = 338/469 (72%), Gaps = 10/469 (2%)
 Frame = -1

Query  1555  PSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKN  1376
             PSYP+IG +LSF +NR+ LL WYT LL  SP++TI V  L   RT++TA+ ENVE++LK 
Sbjct  38    PSYPLIGSILSFNRNRHRLLQWYTDLLRLSPSQTITVDLLFRRRTIITANPENVEHILKT  97

Query  1375  NFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVD  1196
             NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV+
Sbjct  98    NFSNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEVE  157

Query  1195  GRLSPLLEAAA--RNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
              RL P+L +AA       +D QDVL+RFAFD +CK+                  LV+AFD
Sbjct  158   NRLIPVLSSAADYDGGRTVDFQDVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVEAFD  216

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+ ISARR   P++AVWK KR  NVGSE++LRE I+ VH  V EIIR +K+        
Sbjct  217   VAAAISARRATEPIYAVWKLKRLLNVGSERRLREAIRSVHVSVSEIIRAKKKSLDIGGDV  276

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                 D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++   E  V+++V
Sbjct  277   ADKKDLLSRFLAAGHDEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSENDCAEKKVVEEV  336

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
               +     L F+ LREM+Y KACLCE+MRLYPPVAWDSKHAANDDVLPDGT + +G++VT
Sbjct  337   -RNKGSLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGTRVKKGDKVT  395

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKE  320
             + PY MGRME +WG DW EFKP+RWF+++        LK +S FKFPVFQAGPRVC+GKE
Sbjct  396   YFPYGMGRMEKVWGLDWSEFKPNRWFEQEANYGTKPVLKSVSSFKFPVFQAGPRVCIGKE  455

Query  319   MAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             MAF+QMKFVV S+L RF+I PVC+++PVFVPLLT +MA GL V++  RE
Sbjct  456   MAFMQMKFVVGSVLSRFKIVPVCDTRPVFVPLLTAHMAGGLKVKIKRRE  504



>ref|XP_002866555.1| hypothetical protein ARALYDRAFT_496532 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42814.1| hypothetical protein ARALYDRAFT_496532 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/469 (58%), Positives = 336/469 (72%), Gaps = 9/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP++G +LSF KNR+ LL WYT LL  SPT+TI V  L   RT++TA+ ENVE++LK
Sbjct  39    PTSYPLVGSILSFNKNRHRLLQWYTDLLRLSPTQTITVDLLFGRRTIITANPENVEHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + + EEV
Sbjct  99    TNFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEIIREEV  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL  +L +A      +D Q+VL+RFAFD +CK+                  LV AFD 
Sbjct  159   QNRLILVLSSAVDGGGTVDFQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVKAFDV  217

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  NVGSEK+LRE IK VH  V EIIR +K+         
Sbjct  218   AAEISARRATEPVYAVWKLKRLLNVGSEKRLREAIKTVHVSVSEIIRAKKKSLDIGGDVS  277

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++++V 
Sbjct  278   DKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVEKKILEEV-  336

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +     L F+ LREM+Y KAC+CE+MRLYPPVAWDSKHAANDDVLPDGT + +G++VT+
Sbjct  337   RNKGSLGLGFEDLREMSYTKACICEAMRLYPPVAWDSKHAANDDVLPDGTLLKKGDKVTY  396

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRMEN+WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GKEM
Sbjct  397   FPYGMGRMENVWGKDWEEFKPNRWFEEEPSNGTKRVLKSVSSFKFPVFQAGPRVCIGKEM  456

Query  316   AFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMRE  173
             AF QMK+VV S+L RFEI PVC+++  VFVPLLT +MA GL V++  RE
Sbjct  457   AFTQMKYVVGSVLSRFEIVPVCDNRAAVFVPLLTAHMAGGLKVKIKRRE  505



>gb|KFK28056.1| hypothetical protein AALP_AA8G465900 [Arabis alpina]
Length=499

 Score =   531 bits (1369),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 270/467 (58%), Positives = 336/467 (72%), Gaps = 8/467 (2%)
 Frame = -1

Query  1555  PSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKN  1376
             PSYP+IG +LSF KNR+ LL WYT LL  SP++TI V  L   RT++TA+ ENVE++LK 
Sbjct  34    PSYPLIGSILSFNKNRHRLLQWYTDLLRQSPSQTITVDLLLRRRTIITANPENVEHILKT  93

Query  1375  NFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVD  1196
             NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV+
Sbjct  94    NFYNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEVE  153

Query  1195  GRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKA  1016
              RL P+L +A      +D Q+VL+RFAFD +CK+                  L  AFD A
Sbjct  154   NRLIPVLSSAGDGGRTVDFQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLFKAFDVA  212

Query  1015  SEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGA  836
             + ISARR   PV AVWK KR  NVG+E++LRE IK VH  V EIIR +K+          
Sbjct  213   AMISARRATEPVQAVWKLKRMLNVGTERRLREAIKTVHVSVSEIIRAKKKILEIGGDVSD  272

Query  835   GSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
               D LSR L AG  +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++++V +
Sbjct  273   KKDLLSRFLAAGDDEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSENNDVEKKILEEVSN  332

Query  655   SDDQK-TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +     L F+ LREM+YIKACLCE+MRLYPPVAWDSKHAANDDVLPDGT + RG++VT+
Sbjct  333   KESLGLGLGFEDLREMSYIKACLCEAMRLYPPVAWDSKHAANDDVLPDGTRVKRGDKVTY  392

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GKEM
Sbjct  393   FPYGMGRMERVWGQDWDEFKPNRWFEEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGKEM  452

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK+VV S+L RFEI PVC+++PVFVPLLT +MA GL V++  R
Sbjct  453   AFLQMKYVVGSVLSRFEIIPVCDNRPVFVPLLTAHMAGGLKVKIKRR  499



>ref|XP_009415113.1| PREDICTED: cytochrome P450 94B3-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   531 bits (1367),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 333/466 (71%), Gaps = 8/466 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P  +P+IG LL FYKNR+ LLDWYT++L +SP  T V+ RLGA R VVTA+ EN+E+M
Sbjct  63    HGPKVHPVIGSLLPFYKNRHRLLDWYTEMLKASPNLTFVMWRLGARRIVVTANPENLEHM  122

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG+P   ILGDFLGRGI + DGDLW  QRKLASHEF+ARSLRE V+  LE 
Sbjct  123   LKTNFPNYPKGKPFTDILGDFLGRGILSADGDLWHMQRKLASHEFSARSLREFVVNVLER  182

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             EV  RL P+L +A  +  V+D+QD+LRRFAFDT+CKI        L        +L  AF
Sbjct  183   EVGERLLPILSSACADRRVVDMQDLLRRFAFDTVCKI-SFGTDPGLLDPSLPESALAGAF  241

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             + AS ISA+RG APVF VWK KRA  VGSE++LR  +K++H  + E+IR RK    N   
Sbjct  242   EVASAISAKRGAAPVFVVWKAKRALGVGSERQLRAAVKLIHASIMEVIRRRKATLENGTQ  301

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                  D LSRL+  GH++EV+RDMVISF++AGRDTTS+ALTWFFWL+S HP +E  ++K+
Sbjct  302   H---KDLLSRLITGGHEEEVIRDMVISFVMAGRDTTSAALTWFFWLVSGHPEVEAELVKE  358

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
                +  +  L+   L++M  ++ACLCESMRLYPPV WDSKHA +DDVLPDGT I  G+RV
Sbjct  359   AKRAKGRSDLH--ALKDMKTLEACLCESMRLYPPVVWDSKHAVSDDVLPDGTRIRGGDRV  416

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQ  305
             T+ PY MGRME LWG + L+F   RW  E G++   SPFKFPVFQAGPR+CLGKEMAF++
Sbjct  417   TYFPYGMGRMERLWGENCLDFDHRRWLSESGEVVRESPFKFPVFQAGPRICLGKEMAFLK  476

Query  304   MKFVVASILRRFEIRPV--CESQPVFVPLLTGYMAKGLYVRVHMRE  173
             MK++ A++LR F +R V     +P  VP+LT +MA GL + V  R+
Sbjct  477   MKYIAAAVLREFALRRVEGERQKPTLVPMLTAHMAGGLQMVVDSRK  522



>ref|XP_010444242.1| PREDICTED: cytochrome P450 94B1 [Camelina sativa]
Length=507

 Score =   529 bits (1362),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 267/467 (57%), Positives = 334/467 (72%), Gaps = 8/467 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG ++SF KNR+ LL WYT LL  SP++TI    L   RT++TA+ ENVE++LK
Sbjct  40    PTSYPLIGSIISFNKNRHRLLQWYTDLLRVSPSQTITFDLLFRRRTIITANPENVEHILK  99

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  ++LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  100   TNFCNFPKGKPFTELLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  159

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +AA     +DLQ+VL+RFAFD +CK+                  LV AFD 
Sbjct  160   QNRLIPVLSSAADGGGTVDLQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVKAFDV  218

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  N+GSE++LRE I  VH  V EIIR +K+         
Sbjct  219   AAEISARRATEPVYAVWKLKRLLNIGSERRLREAIMTVHASVSEIIRAKKKSLDIGGDVS  278

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L +GH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++++V 
Sbjct  279   DKQDLLSRFLASGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVEKNILEEV-  337

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
                    L F+ LREM+Y KACLCE+MRLYPPVAWDSKHAANDDVLPDGT + +G++VT+
Sbjct  338   RGKGPLGLGFEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGTFVRKGDKVTY  397

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GK+M
Sbjct  398   FPYGMGRMEKVWGQDWDEFKPNRWFEEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGKDM  457

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             AF QMK+VV S+L RFEI PV  ++PVFVPLLT +MA GL V++  R
Sbjct  458   AFTQMKYVVGSVLSRFEIVPVRNNRPVFVPLLTAHMAGGLKVKIKRR  504



>ref|XP_010460278.1| PREDICTED: cytochrome P450 94B1-like [Camelina sativa]
Length=507

 Score =   529 bits (1362),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 268/467 (57%), Positives = 334/467 (72%), Gaps = 8/467 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG +LSF KNR+ LL WYT LL  SP++TI    L   RT++TA+ ENVE++LK
Sbjct  40    PTSYPLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITFDLLFRRRTIITANPENVEHILK  99

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  ++LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  100   TNFCNFPKGKPFTELLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  159

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +AA     +DLQ+VL+RFAFD +CK+                  LV AFD 
Sbjct  160   QNRLIPVLSSAADGGCTVDLQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVKAFDV  218

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR FN+GSE++LRE I  VH  V EIIR +K+         
Sbjct  219   AAEISARRATEPVYAVWKLKRLFNIGSERRLREAIMTVHASVSEIIRAKKKSLDIGGDVS  278

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L +GH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++++V 
Sbjct  279   DKQDLLSRFLASGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVEKKILEEV-  337

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
                    L F+ LREM+Y KA LCE+MRLYPPVAWDSKHAANDDVLPDGT + +G++VT+
Sbjct  338   RGKGSLGLGFEDLREMSYTKASLCEAMRLYPPVAWDSKHAANDDVLPDGTLVRKGDKVTY  397

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GK+M
Sbjct  398   FPYGMGRMEKVWGQDWGEFKPNRWFEEEPNYGSKPVLKSVSSFKFPVFQAGPRVCIGKDM  457

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             AF QMK+VV S+L RFEI PV  ++PVFVPLLT +MA GL V++  R
Sbjct  458   AFTQMKYVVGSVLSRFEIVPVRNNRPVFVPLLTAHMAGGLKVKIKRR  504



>gb|KGN58177.1| hypothetical protein Csa_3G585890 [Cucumis sativus]
Length=505

 Score =   528 bits (1360),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 270/469 (58%), Positives = 340/469 (72%), Gaps = 21/469 (4%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             +PP+YP+IGCL+SFY NR  LLDWYT+LL+ SPT TIV+ RLG  RTVVT +  NVEY+L
Sbjct  29    SPPTYPLIGCLISFYINRNRLLDWYTELLSKSPTGTIVIRRLGCRRTVVTVNPVNVEYIL  88

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
               +F NFPKG+P  +IL DFLG GIFNVDGD W  QRKLASHEF+A+SL+E V++TL+ E
Sbjct  89    TTHFHNFPKGKPFTEILNDFLGCGIFNVDGDQWRTQRKLASHEFSAKSLQEFVVETLKSE  148

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+ RL P LEA+A ++ V+D QD+LR FAF  ICKI        L S + +  +L  +FD
Sbjct  149   VEMRLLPALEASAHDAKVVDFQDLLRGFAFRVICKI-------VLGSEEETIFALQKSFD  201

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEII-RVRKQEKANNIA  845
              ASE+ ARR M PV+ +WK KR F VGSE++L+  +  VH  V  II + RK+EK  +I 
Sbjct  202   VASEVCARRAMEPVYVMWKMKRWFGVGSEQRLKMEVAEVHRKVMNIIDKRRKKEKIQDIH  261

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                  D LSRL+  GH DEV+RDMVISF++AGRDTTS+A+TW FWLL  HPNIE  +I++
Sbjct  262   --GTQDLLSRLIKTGHDDEVIRDMVISFIMAGRDTTSAAMTWLFWLLCIHPNIENQLIEE  319

Query  664   V-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             + L+S     L++  L+E+ Y+KACLCE+MR+YPPV WDSKHA  DD LPDGT +  G+R
Sbjct  320   IDLTS---VKLDYQSLKELKYLKACLCETMRMYPPVPWDSKHAVADDYLPDGTLVRSGDR  376

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQG-------KLKMISPFKFPVFQAGPRVCL  329
             VT+ PY MGRM  LWG D  EFKP RW  EQ         +K++SP+KFP+FQAGPRVCL
Sbjct  377   VTYFPYGMGRMVALWGKDQFEFKPSRWVVEQDGRGGRRRGVKLVSPYKFPIFQAGPRVCL  436

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVH  182
             GKEMAF+QMK+VVASIL +F I+PV    PVFVPLLT +MA G  V + 
Sbjct  437   GKEMAFLQMKYVVASILSQFRIKPVAGDHPVFVPLLTAHMAGGFKVFIQ  485



>ref|XP_010484081.1| PREDICTED: cytochrome P450 94B1-like [Camelina sativa]
Length=505

 Score =   524 bits (1349),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 266/467 (57%), Positives = 332/467 (71%), Gaps = 8/467 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG +LSF KNR+ LL WYT LL  SP++TI    L   RT++TA+ ENVE++LK
Sbjct  38    PTSYPLIGSILSFNKNRHRLLPWYTDLLRLSPSQTITFDLLFRRRTIITANPENVEHILK  97

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  ++LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  98    TNFCNFPKGKPFTELLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  157

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +AA     +DLQ+VL+RFAFD +CK+                  LV AFD 
Sbjct  158   QNRLIPVLSSAADGGGTVDLQEVLKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVKAFDV  216

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  N+GSE++LRE I  VH  V EIIR +K+         
Sbjct  217   AAEISARRATEPVYAVWKLKRLLNIGSERRLREAIMTVHASVSEIIRAKKKSLDIGGDVS  276

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                D LSR L +GH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++++V 
Sbjct  277   DKQDLLSRFLASGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSQNDDVEKKILEEV-  335

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
                    L F+ LREM+Y KA LCE+MRLYPPVAWDSKHA NDDVLPDGT + +G++VT+
Sbjct  336   RGKGSLGLGFEDLREMSYTKASLCEAMRLYPPVAWDSKHAENDDVLPDGTLVRKGDKVTY  395

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGKEM  317
              PY MGRME +WG DW EFKP+RWF+E+        LK +S FKFPVFQAGPRVC+GK+M
Sbjct  396   FPYGMGRMEKVWGQDWEEFKPNRWFEEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGKDM  455

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             AF QMK+VV S+L RFEI PV  ++PVFVPLLT +MA GL V++  R
Sbjct  456   AFTQMKYVVGSVLSRFEIVPVRNNRPVFVPLLTAHMAGGLKVKIKRR  502



>ref|XP_009112079.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94B1-like [Brassica 
rapa]
Length=504

 Score =   524 bits (1349),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 268/470 (57%), Positives = 335/470 (71%), Gaps = 8/470 (2%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P SYP+IG +LSF KNR+ LL WYT LL  SP++TI +  L   RT+VT + ENVE++
Sbjct  36    YKPTSYPLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITIDLLFNRRTIVTGNPENVEHI  95

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P   +LGD LG GIFN DG LWS+QRKLASHEFT RSLRE   + L E
Sbjct  96    LKTNFCNFPKGKPFTDLLGDLLGGGIFNSDGQLWSSQRKLASHEFTMRSLREFTFEILRE  155

Query  1204  EVDGRLSPLLEAAA--RNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             EV+ RL P+L +AA       +DLQ++L+RFAFD +CK+                 +LV+
Sbjct  156   EVENRLVPVLSSAADYDGGRTVDLQEILKRFAFDVVCKV-SLGWDPDCLDLTRPVPALVE  214

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AFD A+ ISARR   PV AVWK KR  NVGSE++LRE IK VH  V EIIR +K+    +
Sbjct  215   AFDVAAAISARRATEPVHAVWKLKRLLNVGSERRLREAIKTVHMSVSEIIRAKKKSLDIS  274

Query  850   IAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                    D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++
Sbjct  275   GDLSDKQDLLSRFLAAGHGEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSENGDVEDKIL  334

Query  670   KQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++V  +     L F+ L+EM+Y KACLCE+MRLYPPVAWDSKHAANDDV PDGT + +G+
Sbjct  335   EEV-RNKGSLGLGFEDLKEMSYTKACLCEAMRLYPPVAWDSKHAANDDVXPDGTRVRKGD  393

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPRVCLGK  323
             +VT+ P  MGRME +WG DW EFKP+RW +E       LK +S FKFPVFQAGPRVC+GK
Sbjct  394   KVTYFPCGMGRMEKVWGQDWDEFKPNRWLEEDPSTKPVLKSVSSFKFPVFQAGPRVCIGK  453

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMAF QMK+VV S+L RFEI PV +++PVFVPLLT +MA GL V++  RE
Sbjct  454   EMAFTQMKYVVGSVLSRFEIIPVTKNRPVFVPLLTAHMAGGLKVKIKRRE  503



>ref|XP_003577576.1| PREDICTED: cytochrome P450 94B3 [Brachypodium distachyon]
Length=528

 Score =   521 bits (1342),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 274/491 (56%), Positives = 352/491 (72%), Gaps = 31/491 (6%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP+IGCLL+FY+NR  LLDWYT++LA+SPT+TIVV RLGA RTVVTA+  NVE++
Sbjct  35    HGPRSYPVIGCLLAFYENRRRLLDWYTEMLAASPTQTIVVDRLGARRTVVTANPANVEHI  94

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF N+PKG+P   +LGD LG+GIFNVDG+LW AQRKL SHEF+AR+LREL M  LE 
Sbjct  95    LKGNFGNYPKGKPFTDVLGDLLGKGIFNVDGELWHAQRKLVSHEFSARTLRELEMAVLEA  154

Query  1204  EVDGRLSPLLEAAARN------SSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssae  1043
             E   RL P L+AAA +      ++V+D+QDVLRRFAFD I ++SLG DPGCL  +  +A 
Sbjct  155   EALDRLLPALDAAADHPAGPGGAAVVDMQDVLRRFAFDVISRVSLGVDPGCLDPALPTAP  214

Query  1042  SLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE  863
              L  AFD A+ I ARRG APV AVWK KRA  +GSE++LR+ +KV+H+ V ++IR RK+E
Sbjct  215   RLASAFDTAAGIIARRGAAPVAAVWKIKRALALGSERRLRDEVKVIHEAVMDLIRSRKKE  274

Query  862   K--ANNIAAGAG-SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHP  692
             +   N+   GA  +D LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL++H 
Sbjct  275   RFLVNDDNGGATRNDLLSRMIECGYADEEIRDMVISFIMAGRDTTSSALTWFFWLLTRHR  334

Query  691   NIETTVIKQVL---------SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHA  539
              +E  V+ ++          SS+  +  + +  R+M  + A L E+MRLYPPVAWDSKHA
Sbjct  335   AVERDVLDEISAMALQHAGDSSEGGEGFDLEDFRKMRVLHAALSETMRLYPPVAWDSKHA  394

Query  538   ANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF---------DEQGKL  386
             A  DVLPDGT + RG+RVT+  Y MGRME++WG +   F  DRW          D  G  
Sbjct  395   AAGDVLPDGTRVGRGDRVTYFQYGMGRMESIWGPNAAHFSLDRWLAPSSTSSSVDASGG-  453

Query  385   KMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYM  209
               +SPF++PVFQ GPR CLG+EMAF QMKFV  ++LRRFE+RPV E + P F+PLLT +M
Sbjct  454   --VSPFRYPVFQGGPRTCLGREMAFAQMKFVACAVLRRFELRPVDEGRTPAFLPLLTAHM  511

Query  208   AKGLYVRVHMR  176
               GL V V  R
Sbjct  512   DGGLKVTVRRR  522



>ref|XP_008450099.1| PREDICTED: cytochrome P450 94B3 isoform X2 [Cucumis melo]
Length=492

 Score =   518 bits (1335),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 258/471 (55%), Positives = 329/471 (70%), Gaps = 31/471 (7%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             +PP+YP+IGCL+SFY NR  LLDWYT+LL+ S T TIV+ RLG  RTVVT +  NVEY+L
Sbjct  30    SPPTYPLIGCLISFYINRNRLLDWYTELLSESSTGTIVIRRLGCRRTVVTVNPANVEYIL  89

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
               +FLNFPKG+P  +IL DFLG GIFNVDGD W  QRKLASHEF+A+SL+E V++TL+ E
Sbjct  90    TTHFLNFPKGKPFTEILNDFLGCGIFNVDGDQWRTQRKLASHEFSAKSLQEFVVETLKSE  149

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+ RL P LEA+A N+ V+DLQ VL                     S + +  +L  +F+
Sbjct  150   VEMRLLPALEASAHNAKVVDLQIVL--------------------GSEEETIFALQKSFE  189

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              ASE+SARR M P++  WK KR   VGSE++L++ +  VH  V  II  R++E+      
Sbjct  190   VASEVSARRAMEPIYVTWKMKRWLGVGSERRLKKEVAEVHRKVMNIIDKRRKEEKIQDIH  249

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
              +  D LSRL+   H DE +RDMVISF++AGRDTTS+A+TW FWLL  HPNIE  +I+++
Sbjct  250   DSTQDLLSRLIKTEHDDEEIRDMVISFIMAGRDTTSAAMTWLFWLLCIHPNIENQLIEEI  309

Query  661   -LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
              L+S     L++  L+E+ Y+KACLCE+MR+YPPV WDSKHA  DD LPDGT +  G+RV
Sbjct  310   DLTS---VKLDYQSLKELKYLKACLCETMRMYPPVPWDSKHAIADDYLPDGTLVRSGDRV  366

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQG-------KLKMISPFKFPVFQAGPRVCLG  326
             T+ PY MGRM  LWG D  EFKP RW  EQ         +K++SP+KFP+FQAGPRVCLG
Sbjct  367   TYFPYGMGRMVALWGKDQFEFKPSRWVVEQDGRGGRRTGVKLVSPYKFPIFQAGPRVCLG  426

Query  325   KEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             KEMAF+QMK+VVASIL +F I+PV    PVFVPLLT +MA G  V +  RE
Sbjct  427   KEMAFLQMKYVVASILSQFRIKPVAGDHPVFVPLLTAHMAGGFKVFIQRRE  477



>dbj|BAJ97414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   518 bits (1335),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 261/478 (55%), Positives = 332/478 (69%), Gaps = 15/478 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP+IGCL++FY+NR  LLDWYT++L++SPT+TIVV RLGA RTVVTA+  NVEY+
Sbjct  32    HGPRSYPVIGCLVAFYENRRRLLDWYTEMLSASPTQTIVVDRLGARRTVVTANPANVEYI  91

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L  NF N+PKG+P   +LGD LG GIFNVDGD W AQRKL SHEF+AR+LREL +  LE 
Sbjct  92    LLGNFGNYPKGKPFTDVLGDLLGNGIFNVDGDKWYAQRKLVSHEFSARTLRELEIAVLEA  151

Query  1204  EVDGRLSPLLEAAAR-NSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             E   RL P L+AAA      +D+QD+LRRFAFD I ++               A  L  A
Sbjct  152   EALDRLVPALDAAAEPGGGAVDMQDLLRRFAFDVISRV-SLGVDPGCLDPALPAPRLATA  210

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD A+ I ARRG AP+ AVWK KRA N+GSE++LRE +KV+H+ V ++IR RK+E+    
Sbjct  211   FDAAAGIIARRGAAPLAAVWKIKRALNIGSERRLREEVKVIHEAVMDLIRSRKKERFLVN  270

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
             A    +D LSR++D G+ DE +RDMVISF++AGRDTTSSALTWFFWLL +H ++E  V++
Sbjct  271   AGDVRNDLLSRMIDCGYADEDIRDMVISFIMAGRDTTSSALTWFFWLLMRHRDVERDVLE  330

Query  667   QVLSSDDQKT--------LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDG  512
             ++ S     +         + D  R M  + A L E+MRLYPPVAWDSKHAA  DVLPDG
Sbjct  331   EITSMRRDSSNGTYAGEGFDLDDFRRMRVLHAALSETMRLYPPVAWDSKHAAAADVLPDG  390

Query  511   TPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAG  344
             T +  G+RVT+  Y MGRME +WG+D  EF  +RW     D       +SPFK+PVFQ G
Sbjct  391   TRVGLGDRVTYFQYGMGRMEAIWGSDAREFSLERWLTLPADGLAASGGVSPFKYPVFQGG  450

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMRE  173
             PR CLG+EMAF+QMKFV  +ILRRF++RPV E + P F+PLLT +M  GL V V  R+
Sbjct  451   PRTCLGREMAFVQMKFVAGAILRRFDLRPVDEGRTPAFLPLLTSHMDGGLKVTVRRRK  508



>ref|NP_001067905.2| Os11g0483000 [Oryza sativa Japonica Group]
 gb|ABA93683.2| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28268.2| Os11g0483000 [Oryza sativa Japonica Group]
Length=560

 Score =   519 bits (1336),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 344/499 (69%), Gaps = 37/499 (7%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP+IGCL++FY+NR  LLDWYT++LA+SP++TIVV RLGA RTVVTA+  NVE++
Sbjct  43    WGPRSYPVIGCLVAFYRNRRRLLDWYTEMLAASPSQTIVVDRLGARRTVVTANPANVEHI  102

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L+  F N+PKG+P   +LGD LG GIFNVDG+LW AQRKL SHEF+AR+LR+L +  LE 
Sbjct  103   LRARFANYPKGKPFTDVLGDLLGMGIFNVDGELWHAQRKLVSHEFSARALRDLEVTVLEA  162

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E   RL P L AA+R   V+D+QDVLRRFAFD IC++SLG DPGCL  +  +      AF
Sbjct  163   EARDRLVPALAAASRGGGVVDMQDVLRRFAFDVICRVSLGVDPGCLDPALPAPRLAA-AF  221

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA----  857
             D A+ I ARRG APV AVWK KRA + GSE++LRE + V+H+ V  +IR R++E+A    
Sbjct  222   DTAAGIIARRGAAPVAAVWKVKRALDAGSERRLREEVGVIHEAVMGLIRSRRKERALLLV  281

Query  856   ----NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPN  689
                      GA SD LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL +H  
Sbjct  282   NGNGVGGGGGARSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTWFFWLLMRHRG  341

Query  688   IETTVIKQVLSSDDQK-------------TLNFDHLREMNYIKACLCESMRLYPPVAWDS  548
             +E  V+ ++ ++   +              L+ D  R M  + A LCE+MRLYPPVAWDS
Sbjct  342   VEAQVLDEIAATRRARGAGEEGGDDGEGEGLDLDDYRRMRVLHAALCETMRLYPPVAWDS  401

Query  547   KHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----------  401
             KHAA DDVLPDGT + RG+RVT+  Y MGRME +WG D  +F  DRW             
Sbjct  402   KHAAADDVLPDGTAVGRGDRVTYFQYGMGRMEAIWGADAADFSLDRWLSLPRGGGDGAAA  461

Query  400   ---EQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVF  233
                       +SPFK+PVFQ GPR CLGKEMAF+QMKFV +++LRRFE+RPV E + P F
Sbjct  462   ASPAAAAFAGVSPFKYPVFQGGPRTCLGKEMAFVQMKFVASAVLRRFELRPVDEGRTPAF  521

Query  232   VPLLTGYMAKGLYVRVHMR  176
             VPL+T +MA GL V V  R
Sbjct  522   VPLMTAHMAGGLNVTVRRR  540



>gb|EAY80935.1| hypothetical protein OsI_36114 [Oryza sativa Indica Group]
Length=558

 Score =   518 bits (1335),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 271/501 (54%), Positives = 344/501 (69%), Gaps = 39/501 (8%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP+IGCL++FY+NR  LLDWYT++LA+SP++TIVV RLGA RTVVTA+  NVE++
Sbjct  39    WGPRSYPVIGCLVAFYRNRRRLLDWYTEMLAASPSQTIVVDRLGARRTVVTANPANVEHI  98

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L+  F N+PKG+P   +LGD LG GIFNVDG+LW AQRKL SHEF+AR+LR+L +  LE 
Sbjct  99    LRARFANYPKGKPFTDVLGDLLGMGIFNVDGELWHAQRKLVSHEFSARALRDLEVTVLEA  158

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E   RL P L AA+R   V+D+QDVLRRFAFD IC++SLG DPGCL  +  +      AF
Sbjct  159   EARDRLVPALAAASRGGGVVDMQDVLRRFAFDVICRVSLGVDPGCLDPALPAPRLAA-AF  217

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA----  857
             D A+ I ARRG APV AVWK KRA + GSE++LRE + V+H+ V  +IR R++E+A    
Sbjct  218   DTAAGIIARRGAAPVAAVWKVKRALDAGSERRLREEVGVIHEAVMGLIRSRRKERALLLV  277

Query  856   ----NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPN  689
                      GA SD LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL +H  
Sbjct  278   NGNGVGGGGGARSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTWFFWLLMRHRG  337

Query  688   IETTVIKQVLSSDDQK-------------TLNFDHLREMNYIKACLCESMRLYPPVAWDS  548
             +E  V+ ++ ++   +              L+ D  R M  + A LCE+MRLYPPVAWDS
Sbjct  338   VEAQVLDEIAATRRARGAGEEGGDDGEGEGLDLDDYRRMRVLHAALCETMRLYPPVAWDS  397

Query  547   KHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----------  401
             KHAA DDVLPDGT + RG+RVT+  Y MGRME +WG D  +F  DRW             
Sbjct  398   KHAAADDVLPDGTAVGRGDRVTYFQYGMGRMEAIWGADAADFSLDRWLSLPRGGGDGAAA  457

Query  400   -----EQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-P  239
                         +SPFK+PVFQ GPR CLGKEMAF+QMKFV +++LRRFE+RPV E + P
Sbjct  458   AAASPAAAAFAGVSPFKYPVFQGGPRTCLGKEMAFVQMKFVASAVLRRFELRPVDEGRTP  517

Query  238   VFVPLLTGYMAKGLYVRVHMR  176
              FVPL+T +MA GL V V  R
Sbjct  518   AFVPLMTAHMAGGLNVTVRRR  538



>ref|NP_566155.1| cytochrome P450, family 94, subfamily B, polypeptide 2 [Arabidopsis 
thaliana]
 gb|AAF03442.1|AC010797_18 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAF14845.1|AC011664_27 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEE73731.1| cytochrome P450, family 94, subfamily B, polypeptide 2 [Arabidopsis 
thaliana]
Length=496

 Score =   513 bits (1322),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 259/470 (55%), Positives = 330/470 (70%), Gaps = 16/470 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             TP +YP+IGCL+SFY NR  LLDWYT+LL  SP++T+V+ RL A RTVVTA+  NVEY+L
Sbjct  31    TPKTYPVIGCLISFYTNRNRLLDWYTELLTESPSRTVVIRRLAARRTVVTANPSNVEYIL  90

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             K NF N+PKG+P  +ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SLRE V   L  E
Sbjct  91    KTNFDNYPKGKPFTEILGDFLGNGIFNVDGNLWLKQRRLATHDFTPKSLREYVT-VLRNE  149

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+  L   L AAA +S   DLQ++LRRF F+ +C I       C  +  S       AF 
Sbjct  150   VEKELLAFLNAAAEDSQPFDLQELLRRFTFNIVC-IVFLGIDRCTLNPSSPVSEFDRAFQ  208

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              AS +SA RG AP+  VWK KR    GSEK+LR+ +  VH+ V+EIIR +K++ AN    
Sbjct  209   TASAVSAGRGSAPLSFVWKFKRLVGFGSEKELRKAVGEVHNCVDEIIRDKKRKPANQ---  265

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                 DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  FWL++ H   E  ++ ++
Sbjct  266   ----DFLSRLIVAGESDETVRDMVISIIMAGRDTTSAVATRLFWLITGHEETEHDLVSEI  321

Query  661   LSSDDQKTLNFDH--LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
              S  ++ T  FD+  L++++ +KACLCE MRLYPPV WDSKHA  DD LPDGT +  G+R
Sbjct  322   RSVKEEITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTLVRAGDR  381

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVFQAGPRVCLGK  323
             VT+ PY MGRME LWG DW EFKP+RW +   K     LK ++PFKFPVFQAGPRVCLG+
Sbjct  382   VTYFPYGMGRMEELWGEDWDEFKPNRWAESYDKTCCRVLKKVNPFKFPVFQAGPRVCLGE  441

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMA++QMK++VASIL RFEI P+   +P FVP+LT +MA G+ VRVH R+
Sbjct  442   EMAYVQMKYIVASILDRFEIEPIPTDKPDFVPMLTAHMAGGMQVRVHRRD  491



>ref|XP_006404244.1| hypothetical protein EUTSA_v10011125mg [Eutrema salsugineum]
 gb|ESQ45697.1| hypothetical protein EUTSA_v10011125mg [Eutrema salsugineum]
Length=486

 Score =   511 bits (1316),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 253/466 (54%), Positives = 325/466 (70%), Gaps = 30/466 (6%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PPSYP+IG +LSF KNR+ LL WYT+LL  SP++TI +  LG  RT+VT + +NVEY+LK
Sbjct  44    PPSYPLIGSILSFNKNRHRLLHWYTELLRLSPSQTISIPLLGNRRTIVTTNPQNVEYILK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFNVDG  WS+QRKLASHEF+ RSLR    + L++EV
Sbjct  104   TNFFNFPKGKPFTDLLGDLLGNGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLKDEV  163

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P+L  AA     LDLQDVL+RFAFD +CK+                  L +AFD 
Sbjct  164   ENRLVPVLSDAADVGMTLDLQDVLKRFAFDVVCKV-SLGWDPDCLDLTRPVNPLAEAFDT  222

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+EISARR   PV+AVWK KR  NVGSE+KLRE I+ VH  + EI+R RK+         
Sbjct  223   AAEISARRATEPVYAVWKVKRVLNVGSERKLREAIRTVHVLISEIVRARKKS--------  274

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                      L+ G  +E  +D++       RDTTS+A+TW FWLLS++ ++E  ++++V 
Sbjct  275   ---------LEIGTGEEAKQDLL------SRDTTSAAMTWLFWLLSENGDVERKLLEEV-  318

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
                    L F+ L+EM+Y KACLCE+MRLYPPV+WDSKHAANDDVLPDGT + +G++VT+
Sbjct  319   EPLISLGLGFEELKEMSYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTY  378

Query  478   SPYAMGRMENLWGNDWLEFKPDRWFDEQGK-----LKMISPFKFPVFQAGPRVCLGKEMA  314
              PY MGRME LWG DW EFKP+RWF+ + +     LK +SP+KFP+FQAGPRVC+ KEMA
Sbjct  379   FPYGMGRMEKLWGKDWEEFKPNRWFESEPEGTRPVLKPVSPYKFPIFQAGPRVCVAKEMA  438

Query  313   FIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             F+QMK+VV S+L RFEI PV + +PVFVPLLT +MA GL V++  R
Sbjct  439   FMQMKYVVGSVLSRFEIVPVNKDRPVFVPLLTAHMAGGLKVKLKSR  484



>ref|NP_001168221.1| uncharacterized protein LOC100381980 precursor [Zea mays]
 gb|ACG27481.1| cytochrome P450 CYP94B12 [Zea mays]
 gb|ACN27490.1| unknown [Zea mays]
Length=515

 Score =   512 bits (1318),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 273/476 (57%), Positives = 344/476 (72%), Gaps = 15/476 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IGCL+ FYKNR+ LLDWYT+LLA+SPT+TIVV RLGA RTVVTA+  NVE++LK
Sbjct  31    PRSYPVIGCLVDFYKNRWRLLDWYTELLAASPTQTIVVDRLGARRTVVTANPVNVEHILK  90

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             +NF N+PKG+P   ILGD LG GIFNVDG+LW AQRKL SHEF+AR+LREL    LE+E 
Sbjct  91    SNFGNYPKGKPFTDILGDLLGTGIFNVDGELWYAQRKLVSHEFSARALRELEFAVLEDEA  150

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L  AA    V+D+QD+LRRF+FD IC++SLG DPGCL  +  +      AFD 
Sbjct  151   RERLVPALGLAAARGDVVDMQDLLRRFSFDVICRVSLGVDPGCLDPALPAPRLAA-AFDA  209

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ I ARRG APV AVWK KRA +VGSE++LRE I V+H+ V ++I +RK+E    +  G
Sbjct  210   AAGIIARRGAAPVAAVWKAKRALDVGSERQLREEIAVIHEAVMDLIHIRKKECGLRVNGG  269

Query  838   AG--SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
              G  SD LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL++H ++E  V+++
Sbjct  270   DGRRSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTWFFWLLTRHRDVEREVLRE  329

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             + +             +M  + A LCE+MRLYPPVAWDSKHAA  DVLPDGT + RG+RV
Sbjct  330   I-TGGGASHAAAGGQGKMRALHAALCETMRLYPPVAWDSKHAAAGDVLPDGTRVERGDRV  388

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKM-------ISPFKFPVFQAGPRV  335
             T+  Y MGRME++WG D  EF   RW     E+            +SPFK+PVFQAGPR 
Sbjct  389   TYFQYGMGRMESIWGADAGEFSLRRWLSIIPEENAAPAPPAAVAGLSPFKYPVFQAGPRT  448

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMREG  170
             CLGKEMAF+QMKFV +++LRRFE+ PV E + PVF+PL+T +M  GL V V  R G
Sbjct  449   CLGKEMAFVQMKFVASTVLRRFELVPVDEGRVPVFLPLMTAHMGDGLNVTVRSRSG  504



>ref|XP_010552073.1| PREDICTED: cytochrome P450 94B1 [Tarenaya hassleriana]
Length=500

 Score =   511 bits (1317),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 258/461 (56%), Positives = 329/461 (71%), Gaps = 12/461 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YPIIGCL+SFY NR  LLDWYT+LL   P +T+V+ RLGA RT+VTA+  NVEY+L+
Sbjct  33    PKTYPIIGCLVSFYINRNRLLDWYTELLTKCPGRTVVIRRLGARRTIVTANPANVEYILR  92

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P  +ILGDFLG GIFNVDGDLW  QR+LA+H+FT  SLR+ V   L +EV
Sbjct  93    TNFDNFPKGKPFTEILGDFLGHGIFNVDGDLWMKQRRLATHDFTVVSLRDYV-TVLRDEV  151

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L++ A +S  +DLQ++LRRF F+ +C +       C         +L  AF  
Sbjct  152   HNRLLPFLDSVAEDSRPIDLQELLRRFTFNMVCMV-FLGIARCSLDPSLPVSALDKAFQT  210

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             AS ISA+RG  P+F VWK KR   +GSE+KLR  I+ VH  V +IIR    EK   I   
Sbjct  211   ASAISAKRGSEPLFFVWKVKRWVRIGSERKLRRAIEEVHSCVRDIIR----EKKTKITMS  266

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
                DFL+RL+ AG  +E+VRDMVIS ++AGRDTTS+A+T  FW ++    IE  ++ +++
Sbjct  267   ENPDFLARLILAGESEEMVRDMVISLIMAGRDTTSAAMTRLFWSITDRTEIERELVSEIM  326

Query  658   SSDDQKTLNFDH--LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             S  D KT +FD+  LR++ ++KACLCE+MRLYPPV WDSKHA  DD LPDGTP+  G+RV
Sbjct  327   SVKD-KTGDFDYESLRKLKFLKACLCEAMRLYPPVPWDSKHALTDDRLPDGTPVRAGDRV  385

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-LKMISPFKFPVFQAGPRVCLGKEMAFI  308
             T+ PY MGRME++WG +W EFKP+RWF   GK LK +SP+KFPVFQAGPRVCLGKEMAF+
Sbjct  386   TYFPYGMGRMEDIWGKNWDEFKPNRWF--TGKVLKKVSPYKFPVFQAGPRVCLGKEMAFL  443

Query  307   QMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRV  185
             QMK++VA +L RFEI P    +PV VP+LT +MA GL V V
Sbjct  444   QMKYLVAEVLHRFEIIPAGFDKPVVVPMLTAHMAGGLKVFV  484



>gb|EPS66548.1| hypothetical protein M569_08223, partial [Genlisea aurea]
Length=448

 Score =   508 bits (1309),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 264/457 (58%), Positives = 322/457 (70%), Gaps = 14/457 (3%)
 Frame = -1

Query  1534  CLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPK  1355
             CL++FYKNR  LL WYT LL+ S T TIV+HR+GAPRTVVT +  NVEY+L  NF NFPK
Sbjct  2     CLIAFYKNRGRLLSWYTDLLSHSETLTIVIHRVGAPRTVVTGNPLNVEYILSTNFANFPK  61

Query  1354  GEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLL  1175
             G+P   +LGDFLG GIFNVDG++WSAQRKLASHEF+ +SLRE     L +E++ RL P+L
Sbjct  62    GKPFTDLLGDFLGTGIFNVDGEMWSAQRKLASHEFSTKSLREFTAGVLGDEIENRLVPVL  121

Query  1174  EAAARNSSVLDLQDVLRRFAFDTICK-IslgsdpgclsssdssaeSLVDAFDKASEISAR  998
             E AA +  VLD+Q+VLRRF+F+ IC+ +          SS      +  AFD AS ISA 
Sbjct  122   EGAAVSGGVLDVQEVLRRFSFNVICRLVLGTEPFFQDLSSGIPPSGIAAAFDAASAISAM  181

Query  997   RGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLS  818
             RG  PV  VWK KR  N GSE++L+  +K VH+ VEE+I   K  K N      G D LS
Sbjct  182   RGAMPVMGVWKMKRLLNAGSERELKRAVKTVHNCVEEMIG--KSRKGN------GGDLLS  233

Query  817   RLLDAGHKDE---VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSSDD  647
             R L  G  D+   ++RDMVISFL+AGR+TTS+A+TW F+LLS +   E  V+ +    D 
Sbjct  234   RFLKGGVADDDDTLLRDMVISFLMAGRETTSAAMTWLFYLLSANRTFEKRVVAEASGGD-  292

Query  646   QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYA  467
              +   FD  RE N++KAC+CE++RLYPPVAWDSKHA NDDVLPDGT +  G+RVT+ PY 
Sbjct  293   -RLSPFDRARETNFLKACICEALRLYPPVAWDSKHARNDDVLPDGTRVRSGDRVTYFPYG  351

Query  466   MGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVA  287
             MGRME LWG+D L+F PDRW DE G  K +SP+KFPVFQAGPRVCLGKEMAFIQM +VVA
Sbjct  352   MGRMERLWGDDPLKFDPDRWLDEIGGFKRVSPYKFPVFQAGPRVCLGKEMAFIQMNYVVA  411

Query  286   SILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             S+L RFE  PV    PVFVPLLT +MA G  VRV  R
Sbjct  412   SVLTRFEFHPVRTDPPVFVPLLTAHMAGGFNVRVSRR  448



>ref|XP_008678135.1| PREDICTED: cytochrome P450 94B3 [Zea mays]
 gb|AFW60781.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=547

 Score =   512 bits (1319),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 270/470 (57%), Positives = 346/470 (74%), Gaps = 11/470 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGCL+SFY+NR+ LLDWYT++LA+SPT+TIVV RLGA RTVVTA+  NVE++LK
Sbjct  61    PRTYPLIGCLVSFYQNRWRLLDWYTEMLAASPTQTIVVDRLGARRTVVTANPVNVEHILK  120

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKG+P   ILGD LG GIFNVDG+LW AQRKL SHEF+AR+LR+L    LE+E 
Sbjct  121   GNFGNYPKGKPFTDILGDLLGTGIFNVDGELWYAQRKLVSHEFSARALRDLEFAVLEDEA  180

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L  AA     +D+QD+LRRF+FD IC++SLG DPGCL  +  +      AFD 
Sbjct  181   RERLVPALGLAAARGDAVDMQDLLRRFSFDVICRVSLGVDPGCLDPALPAPRLAA-AFDA  239

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA--NNIA  845
             A+ I ARRG APV AVWK KRA  VGSE+ LRE I+V+H+ V ++IR+RK+E+    N A
Sbjct  240   AAGIIARRGAAPVAAVWKAKRALGVGSERMLREEIRVIHEAVMDLIRIRKKERGLQVNDA  299

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
              G  SD LSR+++ G+ DE++RDMVISF++AGRDTTSSALTWFFWLL++H ++E  V+++
Sbjct  300   DGRRSDLLSRMIECGYPDEMIRDMVISFIMAGRDTTSSALTWFFWLLTRHRDVEREVLRE  359

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             V +     +       +M+ + A LCE+MRLYPPVAWDSKHAA  DVLPDGT + RG+RV
Sbjct  360   V-TGGGGASHAAGGQGKMSVLHAALCETMRLYPPVAWDSKHAAAGDVLPDGTRVERGDRV  418

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFD------EQGKLKMISPFKFPVFQAGPRVCLGK  323
             T+  Y MGRME++WG +  +F   RW            +  +SPFK+PVFQAGPR CLGK
Sbjct  419   TYFQYGMGRMESIWGANAADFSVQRWLSIGEDNAPPAAVAGVSPFKYPVFQAGPRTCLGK  478

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
             EMAF+QMKFV +++LRRFEI PV E + PVF+PL+T +MA GL V V  R
Sbjct  479   EMAFVQMKFVASTVLRRFEIVPVDEGRVPVFLPLMTAHMAGGLNVTVRRR  528



>tpg|DAA38877.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=544

 Score =   511 bits (1317),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 273/476 (57%), Positives = 344/476 (72%), Gaps = 15/476 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IGCL+ FYKNR+ LLDWYT+LLA+SPT+TIVV RLGA RTVVTA+  NVE++LK
Sbjct  60    PRSYPVIGCLVDFYKNRWRLLDWYTELLAASPTQTIVVDRLGARRTVVTANPVNVEHILK  119

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             +NF N+PKG+P   ILGD LG GIFNVDG+LW AQRKL SHEF+AR+LREL    LE+E 
Sbjct  120   SNFGNYPKGKPFTDILGDLLGTGIFNVDGELWYAQRKLVSHEFSARALRELEFAVLEDEA  179

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L  AA    V+D+QD+LRRF+FD IC++SLG DPGCL  +  +      AFD 
Sbjct  180   RERLVPALGLAAARGDVVDMQDLLRRFSFDVICRVSLGVDPGCLDPALPAPRLAA-AFDA  238

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ I ARRG APV AVWK KRA +VGSE++LRE I V+H+ V ++I +RK+E    +  G
Sbjct  239   AAGIIARRGAAPVAAVWKAKRALDVGSERQLREEIAVIHEAVMDLIHIRKKECGLRVNGG  298

Query  838   AG--SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
              G  SD LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL++H ++E  V+++
Sbjct  299   DGRRSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTWFFWLLTRHRDVEREVLRE  358

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             + +             +M  + A LCE+MRLYPPVAWDSKHAA  DVLPDGT + RG+RV
Sbjct  359   I-TGGGASHAAAGGQGKMRALHAALCETMRLYPPVAWDSKHAAAGDVLPDGTRVERGDRV  417

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKM-------ISPFKFPVFQAGPRV  335
             T+  Y MGRME++WG D  EF   RW     E+            +SPFK+PVFQAGPR 
Sbjct  418   TYFQYGMGRMESIWGADAGEFSLRRWLSIIPEENAAPAPPAAVAGLSPFKYPVFQAGPRT  477

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMREG  170
             CLGKEMAF+QMKFV +++LRRFE+ PV E + PVF+PL+T +M  GL V V  R G
Sbjct  478   CLGKEMAFVQMKFVASTVLRRFELVPVDEGRVPVFLPLMTAHMGDGLNVTVRSRSG  533



>tpg|DAA38876.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=575

 Score =   511 bits (1316),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 273/476 (57%), Positives = 344/476 (72%), Gaps = 15/476 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IGCL+ FYKNR+ LLDWYT+LLA+SPT+TIVV RLGA RTVVTA+  NVE++LK
Sbjct  91    PRSYPVIGCLVDFYKNRWRLLDWYTELLAASPTQTIVVDRLGARRTVVTANPVNVEHILK  150

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             +NF N+PKG+P   ILGD LG GIFNVDG+LW AQRKL SHEF+AR+LREL    LE+E 
Sbjct  151   SNFGNYPKGKPFTDILGDLLGTGIFNVDGELWYAQRKLVSHEFSARALRELEFAVLEDEA  210

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L  AA    V+D+QD+LRRF+FD IC++SLG DPGCL  +  +      AFD 
Sbjct  211   RERLVPALGLAAARGDVVDMQDLLRRFSFDVICRVSLGVDPGCLDPALPAPRLAA-AFDA  269

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ I ARRG APV AVWK KRA +VGSE++LRE I V+H+ V ++I +RK+E    +  G
Sbjct  270   AAGIIARRGAAPVAAVWKAKRALDVGSERQLREEIAVIHEAVMDLIHIRKKECGLRVNGG  329

Query  838   AG--SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
              G  SD LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL++H ++E  V+++
Sbjct  330   DGRRSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTWFFWLLTRHRDVEREVLRE  389

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             + +             +M  + A LCE+MRLYPPVAWDSKHAA  DVLPDGT + RG+RV
Sbjct  390   I-TGGGASHAAAGGQGKMRALHAALCETMRLYPPVAWDSKHAAAGDVLPDGTRVERGDRV  448

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKM-------ISPFKFPVFQAGPRV  335
             T+  Y MGRME++WG D  EF   RW     E+            +SPFK+PVFQAGPR 
Sbjct  449   TYFQYGMGRMESIWGADAGEFSLRRWLSIIPEENAAPAPPAAVAGLSPFKYPVFQAGPRT  508

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMREG  170
             CLGKEMAF+QMKFV +++LRRFE+ PV E + PVF+PL+T +M  GL V V  R G
Sbjct  509   CLGKEMAFVQMKFVASTVLRRFELVPVDEGRVPVFLPLMTAHMGDGLNVTVRSRSG  564



>gb|KFK37646.1| hypothetical protein AALP_AA3G010200 [Arabis alpina]
Length=520

 Score =   506 bits (1303),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 255/470 (54%), Positives = 327/470 (70%), Gaps = 11/470 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGCL+SFY NR  LLDWYT+LL  SP+ T+V+HRL A RTVVTA+  NVEY+LK
Sbjct  31    PTTYPVIGCLISFYTNRNRLLDWYTELLTGSPSGTVVIHRLAARRTVVTANPSNVEYILK  90

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SLRE V   L  EV
Sbjct  91    TNFDNFPKGKPFTDILGDFLGDGIFNVDGNLWLKQRRLATHDFTPKSLREFVT-VLRTEV  149

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             +  L P L+AAA++S   DL ++LRRF F+ +C   LG D     +  S       AF  
Sbjct  150   NNELLPFLDAAAQDSKHFDLHELLRRFTFNMVCIFFLGIDHRGSLNPSSPVSEFDRAFQT  209

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             AS +SA RG AP+  VWK KR    GSEK L+  +  VH  +  IIR +K++K  + A  
Sbjct  210   ASAVSAGRGSAPLSFVWKLKRMVGFGSEKDLKNAVGEVHRCLHGIIR-QKKKKTKSTAHD  268

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
              G DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+ +T  FW+++ H   E  ++ ++ 
Sbjct  269   RG-DFLSRLIAAGESDETVRDMVISIVMAGRDTTSAVITRLFWVIAGHQETEHDLVNEIR  327

Query  658   SSDDQKTLNFDH--LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             S   + T  FD+  L++++ +KACLCE MRLYPPV WDSKHA  DD LPDGT +  G+RV
Sbjct  328   SVKGEITSGFDYGSLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTVVRAGDRV  387

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGK  323
             T+ PY MGRME LWG DW +FKP+RW +          LK ++PFKFPVFQAGPRVCLG+
Sbjct  388   TYFPYGMGRMEELWGRDWDDFKPNRWVESYDDDRTVRVLKKVNPFKFPVFQAGPRVCLGE  447

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMA++QMK++VAS+L RFEI P+   +PVFVP+LT +MA G+ VRV  R+
Sbjct  448   EMAYVQMKYIVASMLDRFEIEPIATDKPVFVPMLTAHMAGGMQVRVRRRD  497



>emb|CDY70403.1| BnaAnng33550D [Brassica napus]
Length=492

 Score =   499 bits (1286),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 254/469 (54%), Positives = 321/469 (68%), Gaps = 15/469 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             TP +YP+IGCLLSFY NR  LLDWYT+LL  S + T++++RL A RTVVTA+  NVEY+L
Sbjct  32    TPKTYPVIGCLLSFYTNRNRLLDWYTELLTESRSGTVIINRLAARRTVVTANPSNVEYIL  91

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             K NF N+PKG+P  +ILGDFLG GIFNVDG LW  QR+LA+H+FT RSLRE V   L  E
Sbjct  92    KTNFDNYPKGKPFTEILGDFLGGGIFNVDGKLWVKQRRLATHDFTPRSLREYV-DVLRNE  150

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+  L   L+AAA++    DLQ++LRRF F+ +C I       C  +  S       AF 
Sbjct  151   VEDELLSFLDAAAQDYQPFDLQELLRRFTFNIVC-IVFLGIDRCSLNPSSPVSEFDRAFQ  209

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+ +SA RG AP+  VWK KR    GSEK LR  ++ VH  V EIIR +K         
Sbjct  210   TAAAVSAGRGSAPLSFVWKLKRLVGFGSEKDLRHAVQKVHSCVNEIIRDKK--------I  261

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                SDFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  F L+S H   E  ++ ++
Sbjct  262   NTKSDFLSRLIVAGESDEAVRDMVISVVMAGRDTTSAVTTRLFSLISSHKTTECELVNEI  321

Query  661   LSSDD-QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
              S  D     +++ L++++ +KACLCE MRLYPPV WDSKHA  DD LPDGTP+  G+RV
Sbjct  322   RSVKDITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTPVRAGDRV  381

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPRVCLGKEM  317
             T+ PY MGRME LWG DW EFKP+RWF+        LK ++PFKFPVFQAGPRVCLG+EM
Sbjct  382   TYFPYGMGRMEELWGKDWDEFKPNRWFESYDHKTRVLKKVNPFKFPVFQAGPRVCLGEEM  441

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             A++QMK+VVAS+L RF+  P+   +PVFVP+LT +MA G+ VRV  R+G
Sbjct  442   AYLQMKYVVASMLHRFQFEPIGMDKPVFVPMLTAHMAGGMRVRVSRRDG  490



>ref|XP_006848391.1| hypothetical protein AMTR_s00013p00215200 [Amborella trichopoda]
 gb|ERN09972.1| hypothetical protein AMTR_s00013p00215200 [Amborella trichopoda]
Length=502

 Score =   497 bits (1279),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 317/453 (70%), Gaps = 17/453 (4%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P SYP++GC+++++KN+Y LLDWYT+LLA SP  TIVV RLGAPRTVVTA+  NVEYM
Sbjct  46    YGPRSYPLVGCMVAYWKNQYRLLDWYTELLADSPGGTIVVQRLGAPRTVVTANPANVEYM  105

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L   F NFPKG+P  ++LGD LG GIFN DG+LW  QRK+AS EF    LR  V+ TL  
Sbjct  106   LSTQFSNFPKGKPFTEVLGDLLGHGIFNTDGELWHTQRKVASPEFATSHLRRFVLTTLRN  165

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E++GRL P+L   AR+S+VLDLQDV +RF FD+IC +                  L  AF
Sbjct  166   EIEGRLLPILRQEARSSTVLDLQDVFKRFTFDSIC-LVSFGMYPGCLEVPLQESRLAKAF  224

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A+EISARRG A + A+WK KRA N+GSE+KL+E + VV + V EI+R +        A
Sbjct  225   DIAAEISARRGAATLQAIWKIKRALNLGSERKLKEAVGVVREAVAEIVREQ--------A  276

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                G   L+RLL AG  +E+ RDMV+SF++AGRDTTS+ALTW FWLL++H   E  VI++
Sbjct  277   PKGGDHLLARLLRAGLGEELARDMVVSFIMAGRDTTSAALTWLFWLLARHTQAEREVIRE  336

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
                + +  TL++  L  + Y+ ACLCE+MRLYPPVAWDSKHAA DDVLPDGT + +G R+
Sbjct  337   ---AQETTTLDYQGLMGLKYLHACLCETMRLYPPVAWDSKHAARDDVLPDGTGVTKGCRI  393

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQ  305
             T+ PY MGR E +WG DW EF+P+RW +     +++S F+FPVFQ GPR CLGKEMAF+Q
Sbjct  394   TYFPYGMGRTEGIWGKDWAEFRPERWLEG----RIVSAFEFPVFQGGPRQCLGKEMAFLQ  449

Query  304   MKFVVASILRRFE-IRPVCESQPVFVPLLTGYM  209
             MK+V AS+L+ F  +    +  P+FVPLLT  M
Sbjct  450   MKYVAASVLKEFRVVLKEADRVPLFVPLLTACM  482



>ref|XP_002882162.1| CYP94B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58421.1| CYP94B2 [Arabidopsis lyrata subsp. lyrata]
Length=498

 Score =   496 bits (1278),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 255/481 (53%), Positives = 324/481 (67%), Gaps = 22/481 (5%)
 Frame = -1

Query  1579  KKLIVY-----TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVV  1415
             K +++Y      P +YP+IGCL+SFY NR  LLDWYT+LL  S ++T+V+ RL A RTVV
Sbjct  21    KHVVIYPCRNSIPKTYPVIGCLISFYTNRNRLLDWYTELLTESTSRTVVIRRLAARRTVV  80

Query  1414  TASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSL  1235
             TA+  NVEY+LK NF N+PKG+P  +ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SL
Sbjct  81    TANPSNVEYILKTNFDNYPKGKPFTEILGDFLGNGIFNVDGNLWLKQRRLATHDFTPKSL  140

Query  1234  RELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssd  1055
             RE V   L  EV+  L   L AAA +S   DLQ++LRRF F+ +C I       C  +  
Sbjct  141   REYVT-VLRNEVEKELVAFLNAAAEDSQPFDLQELLRRFTFNIVC-IVFLGIDRCSLNPS  198

Query  1054  ssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRV  875
             S       AF  AS +SA RG AP+  VWK KR    GSEK+LR  I  VH  V+EIIR 
Sbjct  199   SPVSEFDRAFHTASAVSAGRGSAPLSFVWKFKRLVGFGSEKELRNAIGQVHSCVDEIIRE  258

Query  874   RKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
             +K+  AN        DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  FWL++ H
Sbjct  259   KKRRPANQ-------DFLSRLIVAGESDETVRDMVISIIMAGRDTTSAVATRLFWLITGH  311

Query  694   PNIETTVIKQVLS-SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
                E  ++ ++ S  +     +++ L++++ ++ACLCE MRLYPPV WDSKHA  DD LP
Sbjct  312   KETEHDLVSEIRSVKETTGGFDYESLKKLSLLRACLCEVMRLYPPVPWDSKHALTDDRLP  371

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK-------LKMISPFKFP  359
             DGT +  G+RVT+ PY MGRME  WG DW EFKP+RW DE          LK ++PFKFP
Sbjct  372   DGTLVRAGDRVTYFPYGMGRMEEHWGEDWDEFKPNRWVDESSYDKTCCRVLKKVNPFKFP  431

Query  358   VFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHM  179
             VFQAGPRVCLG+EMA++QMK+VVASIL RFEI P+   +P FV +LT +MA G+ VRV  
Sbjct  432   VFQAGPRVCLGEEMAYVQMKYVVASILDRFEIEPIPTDKPDFVAMLTAHMAGGMQVRVRR  491

Query  178   R  176
             R
Sbjct  492   R  492



>ref|XP_009124051.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
Length=492

 Score =   496 bits (1276),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 320/469 (68%), Gaps = 15/469 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             TP +YP+IGCLLSFY NR  LLDWYT+LL  S + T++++RL A RTVVTA+  NVEY+L
Sbjct  32    TPKTYPVIGCLLSFYTNRNRLLDWYTELLTESRSGTVIINRLAARRTVVTANPSNVEYIL  91

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             K NF N+PKG+P  +ILGDFLG GIFNVDG LW  QR+LA+H+FT RSLRE V   L  E
Sbjct  92    KTNFDNYPKGKPFTEILGDFLGGGIFNVDGKLWVKQRRLATHDFTPRSLREYV-DVLRNE  150

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+  L   L+AAA++    DLQ++LRRF F+ +C I       C  +  S       AF 
Sbjct  151   VEDELLSFLDAAAQDYQPFDLQELLRRFTFNIVC-IVFLGIDRCSLNPSSPVSEFDRAFQ  209

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+ +SA RG AP+  VWK KR    GSEK LR  ++ VH  V EIIR +K         
Sbjct  210   TAAAVSAGRGSAPLSFVWKLKRLVGFGSEKDLRHAVQKVHSCVNEIIRDKK--------I  261

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                SDFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  F L+S H   E  ++ ++
Sbjct  262   NTKSDFLSRLIVAGESDEAVRDMVISVVMAGRDTTSAVTTRLFSLISSHKTTECELVNEI  321

Query  661   LSSDD-QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
              S  D     +++ L++++ +KACLCE MRLYPPV WDSKHA  DD LPDGTP+  G+RV
Sbjct  322   RSVKDITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTPVRAGDRV  381

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPRVCLGKEM  317
             T+ PY MGRME LWG D  EFKP+RWF+        LK ++PFKFPVFQAGPRVCLG+EM
Sbjct  382   TYFPYGMGRMEELWGKDLDEFKPNRWFESYDHKTRVLKKVNPFKFPVFQAGPRVCLGEEM  441

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             A++QMK+VVAS+L RF+  P+   +PVFVP+LT +MA G+ VRV  R+G
Sbjct  442   AYLQMKYVVASMLHRFQFEPIGMDKPVFVPMLTAHMAGGMRVRVSRRDG  490



>ref|XP_004962539.1| PREDICTED: cytochrome P450 94A2-like [Setaria italica]
Length=529

 Score =   496 bits (1278),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 337/481 (70%), Gaps = 23/481 (5%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P S+P++GCL+ +Y+NR  LLDWYT LLA+SP++T+VV RLGA RTVVTA+  NVE++
Sbjct  43    HAPRSHPVLGCLVEYYRNRRRLLDWYTGLLAASPSQTVVVERLGARRTVVTANPVNVEHI  102

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK+NF N+PKG+P  ++LGD LG GIFN DG+ W AQRKL SHEFTAR+LRE V   LE 
Sbjct  103   LKDNFGNYPKGKPFTEVLGDLLGGGIFNADGEPWRAQRKLVSHEFTARALRERVGAALEA  162

Query  1204  EVDGRLSPLLE--AAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             E   RL P L+  AAA    V+D+Q++LRRFAF+ IC++           +      L  
Sbjct  163   EARSRLLPALDTAAAAGGDVVVDVQELLRRFAFNVICRM-SLGADDPGDEAALPLSRLAA  221

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AFD A+ I A RG APV AVWK KRA  VGSE++LRE ++V+HD + E++R  ++ +  +
Sbjct  222   AFDAAAAIVAGRGAAPVAAVWKAKRALGVGSERRLREEVRVIHDAITELVRRGRRRRHEH  281

Query  850   IAAGAGS--DFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
               A      D +SR+  AG+ DE +RDMVISF++AGRDTTS+ALTWFFWL+++H ++E  
Sbjct  282   RPAARRDDLDLVSRMAAAGYGDEAIRDMVISFIMAGRDTTSAALTWFFWLMTRHRDVERE  341

Query  676   VIKQVLSS-----DDQKTLNFDHL---REMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
             V+ ++ SS     DD+       L   R+M  + A LCE+MRLYPPVAWDSKHAA  DVL
Sbjct  342   VLGEIDSSSSRACDDRGGGVGVDLDGSRKMRVLHAALCETMRLYPPVAWDSKHAAKADVL  401

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF-----DEQGKLKMISPFKFPV  356
             PDGT + RG+RVT+ PY MGRME++WG D  EF+P RW      DE G    +SPFKFPV
Sbjct  402   PDGTRVGRGDRVTYFPYGMGRMESIWGADAGEFRPRRWLALPSRDEGG----VSPFKFPV  457

Query  355   FQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCES-QPVFVPLLTGYMAKGLYVRVHM  179
             FQ GPR CLG+EMAF+QMKFV  ++LRRFE+R V E  QPVFVPLLT +MA GL V V  
Sbjct  458   FQGGPRTCLGREMAFLQMKFVATAVLRRFELRAVDEGRQPVFVPLLTAHMAGGLKVTVRR  517

Query  178   R  176
             R
Sbjct  518   R  518



>emb|CDX77090.1| BnaC04g38850D [Brassica napus]
Length=492

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 255/469 (54%), Positives = 322/469 (69%), Gaps = 15/469 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
             TP +YP+IGCLLSFY NR  LLDWYT+LL  SP+ T++++RL A RTVVTA+  NVEY+L
Sbjct  32    TPKTYPVIGCLLSFYTNRNRLLDWYTELLTESPSGTVIINRLAARRTVVTANPSNVEYIL  91

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             K NF N+PKG+P  +ILGDFLG GIFNVDG+LW  QR+LA+H+FT RSLRE V   L  E
Sbjct  92    KTNFDNYPKGKPFTEILGDFLGGGIFNVDGNLWVKQRRLATHDFTPRSLREYV-DVLRNE  150

Query  1201  VDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
             V+  L   L+AAA++    DLQ++LRRF F+ +C I       C  +  S       AF 
Sbjct  151   VEDELLSFLDAAAQDYQPFDLQELLRRFTFNIVC-IVFLGIDRCSLNPSSPVSEFDRAFQ  209

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+ +SA RG AP+  VWK KR    GSEK LR  ++ VH  V EIIR +K         
Sbjct  210   TAAAVSAGRGSAPLSFVWKLKRLVGFGSEKDLRHAVQKVHSCVNEIIREKK--------I  261

Query  841   GAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                SDFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  F L+S H   E  ++ ++
Sbjct  262   NTKSDFLSRLIVAGESDEAVRDMVISVVMAGRDTTSAVTTRLFSLISCHKTTECELVNEI  321

Query  661   LSSDD-QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
              S  D     +++ L++++ +KACLCE MRLYPPV WDSKHA  DD LPDGT +  G+RV
Sbjct  322   RSVKDITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTAVRAGDRV  381

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPRVCLGKEM  317
             T+ PY MGRME LWG DW EFKP+RWFD        LK ++PFKFPVFQAGPRVCLG+EM
Sbjct  382   TYFPYGMGRMEELWGKDWDEFKPNRWFDSYDHKTRVLKKVNPFKFPVFQAGPRVCLGEEM  441

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             A++QMK+VVAS+L RF+  P+   +PVFVP+LT +MA G+ VRV  R+G
Sbjct  442   AYLQMKYVVASMLHRFQFEPIGTDKPVFVPMLTAHMAGGMRVRVRRRDG  490



>ref|XP_006296783.1| hypothetical protein CARUB_v10016004mg [Capsella rubella]
 gb|EOA29681.1| hypothetical protein CARUB_v10016004mg [Capsella rubella]
Length=500

 Score =   484 bits (1247),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 251/469 (54%), Positives = 321/469 (68%), Gaps = 15/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGC++SFY NR  LLDWYT+LL  SP+ T+V+ RL + RTVVTA+  NVEY+LK
Sbjct  37    PRTYPVIGCIVSFYSNRNRLLDWYTELLTESPSGTVVIRRLASRRTVVTANPSNVEYILK  96

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKG+P   ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SLR+ V   L  EV
Sbjct  97    TNFDNYPKGKPFTDILGDFLGNGIFNVDGNLWLKQRRLATHDFTPKSLRDYV-TVLRNEV  155

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             D  L P L+AAA  S  LDL ++LRRF F+ +C + LG D  C     S       AF  
Sbjct  156   DHELLPFLDAAAGASQPLDLHELLRRFFFNLVCIVFLGIDHRCSLDPLSPVSVFDRAFQT  215

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             AS +SA RG AP+  VWK KR    GSEK+LR  +  VH  V +IIR +K+   N+    
Sbjct  216   ASAVSAGRGSAPLSFVWKLKRLVGFGSEKELRSAVGQVHSCVHDIIREKKRMITNH----  271

Query  838   AGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKH--PNIETTVIKQ  665
                DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  FW ++       E  ++ +
Sbjct  272   ---DFLSRLIVAGESDETVRDMVISIVMAGRDTTSAVTTRLFWFITTGHMKQTEHDLVSE  328

Query  664   VLSSDDQKTLNFDH--LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             + S  +     FD+  L++++ +KACLCE MRLYPPV WDSKHA +DD LPDGT +  G+
Sbjct  329   IRSVKEMTRGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALSDDRLPDGTEVRAGD  388

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRW--FDEQGK-LKMISPFKFPVFQAGPRVCLGKE  320
             RVT+ PY MGRME LWG DW EF+P+RW   D+  + LK ++PF FPVFQAGPRVCLG+E
Sbjct  389   RVTYFPYGMGRMEELWGEDWGEFRPNRWVVVDQTCRVLKKVNPFMFPVFQAGPRVCLGEE  448

Query  319   MAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             MA++QMK+VVASIL RF   P+   +PVFVP+LT +MA G+ VRV  R+
Sbjct  449   MAYVQMKYVVASILDRFVFEPILTDKPVFVPMLTAHMAGGMQVRVRRRD  497



>emb|CDY71281.1| BnaA06g38770D [Brassica napus]
Length=478

 Score =   483 bits (1244),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 324/470 (69%), Gaps = 33/470 (7%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PPSYP+IG +LSF KNR+ LL WYT LL  SP++T+ +  L   RT++TA+ ENVE++LK
Sbjct  33    PPSYPLIGSILSFNKNRHHLLQWYTDLLRLSPSQTVTIDLLLNRRTIITANPENVEHILK  92

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  93    TNFCNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  152

Query  1198  DGRLSPLLEAAAR--NSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             + RL P+L +AA       +D Q++L+RFAFD +CK+                  LV+AF
Sbjct  153   ETRLVPVLSSAADYGRGRTVDFQEILKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVEAF  211

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A+ ISARR   PV AVWK KR FNVGSE++L+E I+ VH  V +IIR +K        
Sbjct  212   DVAAAISARRATEPVNAVWKLKRFFNVGSERRLKEAIRTVHVSVSKIIRAKK--------  263

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                      + LD G      +D++       RDTTS+A+TW FWLLS++ ++E  ++++
Sbjct  264   ---------KCLDIGGDVSDKQDLL------SRDTTSAAMTWLFWLLSENDDVEKKILEE  308

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             V        L F+ LREM+Y KA LCE+MRLYPPVAWDSKHAANDDVLPDGT + +G++V
Sbjct  309   V-RDKGSLGLGFEDLREMSYTKASLCEAMRLYPPVAWDSKHAANDDVLPDGTHVKKGDKV  367

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGK  323
             T+ PY MGRME +WG DW +FKP+RWFDE+        LK +S FKFPVFQAGPRVC+GK
Sbjct  368   TYFPYGMGRMEKVWGQDWDKFKPNRWFDEEPNYGIKPVLKSVSSFKFPVFQAGPRVCIGK  427

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMAF+QMK+VV S+L RFEI PVC++ PVFVPLLT +MA GL V++  R+
Sbjct  428   EMAFMQMKYVVGSVLSRFEIIPVCKNPPVFVPLLTAHMAGGLKVKIKKRK  477



>gb|EAY82999.1| hypothetical protein OsI_38222 [Oryza sativa Indica Group]
Length=529

 Score =   485 bits (1248),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 256/482 (53%), Positives = 329/482 (68%), Gaps = 15/482 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
              P SYP++GCLL FY+NR  LL WYT LLA+SP++TIVV RLGA RTVVTA+  NVE++L
Sbjct  46    APRSYPLVGCLLDFYRNRRRLLAWYTGLLAASPSQTIVVDRLGARRTVVTANPANVEHVL  105

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             + NF N+PKG+    +LGD LG GIFN DG+ W AQRKL SHEF+AR +RE V   LE E
Sbjct  106   RANFGNYPKGKAFTDVLGDLLGGGIFNADGERWFAQRKLVSHEFSARVMREAVGVALERE  165

Query  1201  VDGRLSPLLEAAARNSSVL---DLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
                RL P L+AAA     +   D+Q++LR+FAF+ IC+++LG   G ++ +   +  L  
Sbjct  166   ARARLLPALDAAAEGGGGVVVVDVQELLRQFAFNVICRVALGGGGGEVALALPLSR-LAA  224

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AFD A+ ISARRG APV A WK KRA  VGSE++LRE +KV+ D + E +R     +   
Sbjct  225   AFDAAAAISARRGAAPVAAAWKVKRALGVGSERRLREEVKVIRDAIMEFVRDSSSRRRRE  284

Query  850   --IAAGAG-SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
               +AA  G  D +SR+  AG+ DE + DMV+SF++AGRDTTSSALTWFFWL+++H ++E 
Sbjct  285   QLLAAARGRDDLVSRMAAAGYPDEAICDMVVSFIMAGRDTTSSALTWFFWLMTRHRDVER  344

Query  679   TVIKQV-------LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
              V+ +V               ++ +  R    + A LCE+MRLYPPVAWDSKHAA DDVL
Sbjct  345   EVLDEVDACMGDGGDGGGLAGVDLEGSRRARVLHAALCETMRLYPPVAWDSKHAAEDDVL  404

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGP  341
             PDGT + RG+RVT+ PY MGRME +WG D  EF+P RW         +SPFK+PVFQ GP
Sbjct  405   PDGTRVGRGDRVTYFPYGMGRMEAIWGADAGEFRPGRWLAAAAAGGGVSPFKYPVFQGGP  464

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMREGYN  164
             R CLGK+MAF+QMKFV +++LRRFE+RPV  E  P FVPLLT +MA GL V V  R+  N
Sbjct  465   RTCLGKDMAFVQMKFVASAVLRRFELRPVAPEGSPEFVPLLTAHMAGGLKVTVRRRQRQN  524

Query  163   NN  158
               
Sbjct  525   GT  526



>gb|EYU45403.1| hypothetical protein MIMGU_mgv1a006399mg [Erythranthe guttata]
Length=445

 Score =   482 bits (1240),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 248/447 (55%), Positives = 323/447 (72%), Gaps = 16/447 (4%)
 Frame = -1

Query  1480  LLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFN  1301
             +L+ SP++TI + RLG  RTVVTA+ +NVEY+LK NF N+PKG P  +ILGDFLG GIFN
Sbjct  1     MLSVSPSQTITISRLGGRRTVVTANPQNVEYILKTNFTNYPKGNPFTEILGDFLGNGIFN  60

Query  1300  VDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAA--RNSSVLDLQDVL  1127
             VDGDLW  QRKL  H+F A SLR  V   L+EEV+ +L P+LE+AA       +DLQD+L
Sbjct  61    VDGDLWYNQRKLVVHQFNATSLRGYVENALKEEVEKKLIPVLESAADDEQGKSVDLQDLL  120

Query  1126  RRFAFDTICKIslgsd-pgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAF  950
             RR AFD +CK+SLG D       S  +   +V+AFD AS++SARRG AP+  +WK KR F
Sbjct  121   RRVAFDLVCKVSLGYDPGCVEYRSLDTPHPIVEAFDVASDMSARRGAAPISLMWKFKRLF  180

Query  949   NVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVVRDMV  770
             N+GSEK+LRE I  +H  +  IIR R+    N ++ G  SD +S+++  G +DEVVRD +
Sbjct  181   NLGSEKRLREAISRIHLFIHGIIRDRR----NVVSTGEYSDLMSKMVLDGEEDEVVRDTM  236

Query  769   ISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ---VLSSDDQKTLN-FDHLREMNYI  602
             ISF++AGRDTTS+A+TW F+LLS H   E  V+++   V+  +++ +L+  + L+E+ ++
Sbjct  237   ISFIMAGRDTTSAAMTWLFYLLSCHTEAENEVVREIEKVVGDEEEISLSKLERLKELRWL  296

Query  601   KACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEF  422
             KAC+CESMRLYPPVAWDSKHA  +D+LPDGT +  G+RVT+ PY MGRM+ LWG D  EF
Sbjct  297   KACVCESMRLYPPVAWDSKHATANDMLPDGTGVRAGDRVTYFPYGMGRMKGLWGEDRFEF  356

Query  421   KPDRWFD--EQGKLKMI---SPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRP  257
             KP+RW    E G++K I   SP+KFPVFQAGPR CLGKEMAF QMK+V+ASIL+RF IRP
Sbjct  357   KPERWVSEVEGGEIKAIKNVSPYKFPVFQAGPRACLGKEMAFAQMKYVMASILKRFTIRP  416

Query  256   VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             V   +PVFVPLLT +MA G  V V  R
Sbjct  417   VNSDRPVFVPLLTAHMAGGFKVFVRRR  443



>ref|NP_001066704.2| Os12g0443000 [Oryza sativa Japonica Group]
 gb|ABA97733.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29723.2| Os12g0443000 [Oryza sativa Japonica Group]
Length=529

 Score =   484 bits (1245),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 256/482 (53%), Positives = 329/482 (68%), Gaps = 15/482 (3%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
              P SYP++GCLL FY+NR  LL WYT LLA+SP++TIVV RLGA RTVVTA+  NVE++L
Sbjct  46    APRSYPLVGCLLDFYRNRRRLLAWYTGLLAASPSQTIVVDRLGARRTVVTANPVNVEHVL  105

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             + NF N+PKG+    +LGD LG GIFN DG+ W AQRKL SHEF+AR +RE V   LE E
Sbjct  106   RANFGNYPKGKAFTDVLGDLLGGGIFNADGERWFAQRKLVSHEFSARVMREAVGVALERE  165

Query  1201  VDGRLSPLLEAAARNSSVL---DLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
                RL P L+AAA     +   D+Q++LR+FAF+ IC+++LG   G ++ +   +  L  
Sbjct  166   ARARLLPALDAAAEGGGGVVVVDVQELLRQFAFNVICRVALGGGGGEVALALPLSR-LAA  224

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AFD A+ ISARRG APV A WK KRA  VGSE++LRE +KV+ D + E +R     +   
Sbjct  225   AFDAAAAISARRGAAPVAAAWKVKRALGVGSERRLREEVKVIRDAIMEFVRDSSSRRRRE  284

Query  850   --IAAGAG-SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
               +AA  G  D +SR+  AG+ DE + DMV+SF++AGRDTTSSALTWFFWL+++H ++E 
Sbjct  285   QLLAAARGRDDLVSRMAAAGYPDEAICDMVVSFIMAGRDTTSSALTWFFWLMTRHRDVER  344

Query  679   TVIKQV-------LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
              V+ +V               ++ +  R    + A LCE+MRLYPPVAWDSKHAA DDVL
Sbjct  345   EVLDEVDACMGDGGDGGGLAGVDLEGSRRARVLHAALCETMRLYPPVAWDSKHAAEDDVL  404

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGP  341
             PDGT + RG+RVT+ PY MGRME +WG D  EF+P RW         +SPFK+PVFQ GP
Sbjct  405   PDGTRVGRGDRVTYFPYGMGRMEAIWGADAGEFRPGRWLAAAAAGGGVSPFKYPVFQGGP  464

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMREGYN  164
             R CLGK+MAF+QMKFV +++LRRFE+RPV  E  P FVPLLT +MA GL V V  R+  N
Sbjct  465   RTCLGKDMAFVQMKFVASAVLRRFELRPVAPEGSPEFVPLLTAHMAGGLKVTVRRRQRQN  524

Query  163   NN  158
               
Sbjct  525   GT  526



>emb|CDX84409.1| BnaC03g50910D [Brassica napus]
Length=478

 Score =   480 bits (1236),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 322/470 (69%), Gaps = 33/470 (7%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             PPSYP+IG +LSF KNR+ LL WYT LL  SP++TI +  L   RT++TA+ ENVE++LK
Sbjct  33    PPSYPLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITIDLLLNRRTIITANPENVEHILK  92

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L EEV
Sbjct  93    TNFCNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILREEV  152

Query  1198  DGRLSPLLEAAAR--NSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             + RL P+L +AA       +D Q++L+RFAFD +CK+                  LV+AF
Sbjct  153   ETRLIPVLYSAADYCGGRTVDFQEILKRFAFDVVCKV-SLGWDPDCLDLTRPVPDLVEAF  211

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A+ ISARR   PV AVWK KR FNVGSE++LRE I+ VH  V +IIR +K        
Sbjct  212   DVAAAISARRATEPVNAVWKLKRFFNVGSERRLREAIRTVHVSVSKIIRAKK--------  263

Query  844   AGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                      + LD G      +D++       RDTTS+A+TW FWLLS++ ++E  ++++
Sbjct  264   ---------KCLDIGGDVSDKQDLL------SRDTTSAAMTWLFWLLSENDDVEKKILEE  308

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             V  +     L  + LREM+Y KACLCE+MRLYPPVAWDSKHAANDDVLPDGT +  G++V
Sbjct  309   V-RNKGSLGLGCEDLREMSYTKACLCEAMRLYPPVAWDSKHAANDDVLPDGTHVKEGDKV  367

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK------LKMISPFKFPVFQAGPRVCLGK  323
             T+ PY MGRME +WG DW +FKP RWFDE+        LK +S FKFPVFQAGPRVC+GK
Sbjct  368   TYFPYGMGRMEKVWGQDWDQFKPTRWFDEEPNYGTKPVLKSVSSFKFPVFQAGPRVCIGK  427

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMAF+QMK+VV  +L RFEI P+C++ PVFVPLLT +MA GL V++  R+
Sbjct  428   EMAFMQMKYVVGLVLSRFEIIPLCKNPPVFVPLLTAHMAGGLKVKIKRRK  477



>ref|XP_010436732.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=511

 Score =   472 bits (1214),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 253/478 (53%), Positives = 323/478 (68%), Gaps = 21/478 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGC++SFY NR  LLDWYT+LL  S + T+V+ RL A RTVVTA+  NVEY+LK
Sbjct  36    PKTYPVIGCIISFYSNRNRLLDWYTELLNESLSGTVVIRRLAARRTVVTANPSNVEYILK  95

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKG+P   ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SLR  V   L  EV
Sbjct  96    TNFDNYPKGKPFTDILGDFLGNGIFNVDGNLWLRQRRLATHDFTPKSLRYYVT-VLRNEV  154

Query  1198  DGRLSPLLEAAARNSSV-----LDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLV  1034
             D  L P L+AAA   S       DL ++LRRF F+ +C + LG D        SS  S  
Sbjct  155   DHELLPFLDAAAAGGSKQQQVPFDLHELLRRFFFNVVCIVFLGIDDDRCCLDPSSPVSDF  214

Query  1033  D-AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA  857
             D AF  AS +SA RG AP+  VWK KR    GSEK+LR  ++ VH  V++IIR +K++  
Sbjct  215   DRAFQTASAVSAGRGSAPLSFVWKLKRLVGFGSEKELRNAVREVHRCVDDIIREKKRKTT  274

Query  856   NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLS--KHPNIE  683
              N       DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  FW ++  +    E
Sbjct  275   TN----HEYDFLSRLIAAGESDETVRDMVISIVMAGRDTTSAVTTRLFWFITTGRMKETE  330

Query  682   TTVIKQVLSSDD--QKTLNFDH--LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPD  515
               ++ ++ S  +     L FD+  L++++ +KACLCE MRLYPPV WDSKHA +DD LPD
Sbjct  331   HDLVNEIRSVKELTGGGLGFDYGTLKKLSLLKACLCEVMRLYPPVPWDSKHALSDDRLPD  390

Query  514   GTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQA  347
             GT +  G+RVT+ PY MGRME LWG DW +FKP+RW  +       LK ++PF FPVFQA
Sbjct  391   GTEVRAGDRVTYFPYGMGRMEELWGEDWDDFKPNRWLVDNKTCRLVLKKVNPFMFPVFQA  450

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             GPRVCLG+EMA++QMK+VVASIL RF I P+   +PVFVP+LT +MA G+ VRV  R+
Sbjct  451   GPRVCLGEEMAYVQMKYVVASILDRFVIEPIPADKPVFVPMLTAHMAGGMQVRVRRRD  508



>ref|XP_010485350.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=511

 Score =   470 bits (1209),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 251/475 (53%), Positives = 322/475 (68%), Gaps = 15/475 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGC++SFY NR  LLDWYT+LL  S + T+V+ RL A RTVVTA+  NVEY+LK
Sbjct  36    PKTYPVIGCIISFYSNRNRLLDWYTELLNESLSGTVVIRRLAARRTVVTANPSNVEYILK  95

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKG+P   ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SLR  V   L  EV
Sbjct  96    TNFDNYPKGKPFTDILGDFLGNGIFNVDGNLWLRQRRLATHDFTPKSLRYYV-TVLRNEV  154

Query  1198  DGRLSPLLEAAARNSSV-----LDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLV  1034
             D  L P L+AAA   S       DL ++LRRF F+ +C + LG D        SS  S  
Sbjct  155   DHELLPFLDAAAAGGSKQQQVPFDLHELLRRFFFNVVCIVFLGIDDDRCCLDPSSPVSDF  214

Query  1033  D-AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA  857
             D AF  AS +SA RG AP+  VWK KR    GSEK+LR  ++ VH  V++IIR  K++K 
Sbjct  215   DRAFQTASAVSAGRGSAPLSFVWKLKRLVGFGSEKELRTAVREVHRCVDDIIR-EKKKKR  273

Query  856   NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
                      DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  FW ++  P ++ T
Sbjct  274   KTTTNHDEYDFLSRLIAAGESDETVRDMVISIVMAGRDTTSAVTTRLFWFITTGPCMKET  333

Query  676   ---VIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
                ++ ++ S       +++ L++++ +KACLCE MRLYPPV WDSKHA +DD LPDGT 
Sbjct  334   EHDLVNEIRSVKGGLGFDYETLKKLSLLKACLCEVMRLYPPVPWDSKHALSDDRLPDGTE  393

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPR  338
             +  G+RVT+ PY MGRME LWG DW +FKP+RW  +       LK ++PF FPVFQAGPR
Sbjct  394   VRAGDRVTYFPYGMGRMEELWGEDWDDFKPNRWLVDNKTCRLVLKKVNPFMFPVFQAGPR  453

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             VCLG+EMA++QMK+VVASIL RF I P+   +PVFVP+LT +MA G+ VRV  R+
Sbjct  454   VCLGEEMAYVQMKYVVASILDRFVIEPIPADKPVFVPMLTAHMAGGMQVRVRRRD  508



>ref|XP_010496429.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=516

 Score =   469 bits (1206),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 254/478 (53%), Positives = 324/478 (68%), Gaps = 17/478 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IGC++SFY NR  LLDWYT+LL  SP+ T+V+ RL A RTVVTA+  NVEY+LK
Sbjct  36    PKTYPVIGCIISFYSNRNRLLDWYTELLTESPSGTVVIRRLAARRTVVTANPSNVEYILK  95

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKG+P   ILGDFLG GIFNVDG+LW  QR+LA+H+FT +SLR  V   L  EV
Sbjct  96    TNFDNYPKGKPFTDILGDFLGNGIFNVDGNLWLRQRRLATHDFTPKSLRGYV-TVLRNEV  154

Query  1198  DGRLSPLLEAAARNSSV----LDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             D  L P L+AAA   S      DL ++LRRF F+ +C + LG D        SS  S  D
Sbjct  155   DNELLPFLDAAAAGVSQEQVPFDLHELLRRFFFNVVCIVFLGVDDDRCCLDPSSPVSDFD  214

Query  1030  -AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR-VRKQEKA  857
              AF  AS +SA RG AP+  VWK KR    GSEK+LR  ++ VH  V++IIR  +K++K 
Sbjct  215   RAFQTASAVSAGRGSAPLSFVWKLKRLVGFGSEKELRNAVREVHRCVDDIIREKKKKKKK  274

Query  856   NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLS--KHPNIE  683
                      DFLSRL+ AG  DE VRDMVIS ++AGRDTTS+  T  FW ++  +    E
Sbjct  275   RKTTTNHEYDFLSRLIVAGESDETVRDMVISIVMAGRDTTSAVTTRLFWFITTGRMKETE  334

Query  682   TTVIKQVLSSDD--QKTLNFDH--LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPD  515
               ++ ++ S  +     L FD+  L++++ +KACLCE MRLYPPV WDSKHA +DD LPD
Sbjct  335   HDLVNEIRSVKELTGGGLGFDYETLKKLSLLKACLCEVMRLYPPVPWDSKHALSDDRLPD  394

Query  514   GTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQA  347
             GT +  G+RVT+ PY MGRME LWG DW +FKP+RW  +       LK ++PF FPVFQA
Sbjct  395   GTEVRAGDRVTYFPYGMGRMEELWGEDWDDFKPNRWLVDNKTCRLVLKKVNPFMFPVFQA  454

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             GPRVCLG+EMA++QMK+VVASIL RF I P+   +PVFVP+LT +MA G+ VRV  R+
Sbjct  455   GPRVCLGEEMAYVQMKYVVASILDRFVIEPIPADKPVFVPMLTAHMAGGMQVRVRRRD  512



>gb|EEE53156.1| hypothetical protein OsJ_35982 [Oryza sativa Japonica Group]
Length=495

 Score =   459 bits (1180),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 239/482 (50%), Positives = 308/482 (64%), Gaps = 49/482 (10%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYML  1382
              P SYP++GCLL FY+NR  LL WYT LLA+SP++TIVV RLGA RTVVTA+  NVE++L
Sbjct  46    APRSYPLVGCLLDFYRNRRRLLAWYTGLLAASPSQTIVVDRLGARRTVVTANPVNVEHVL  105

Query  1381  KNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEE  1202
             + NF N+PKG+    +LGD LG GIFN DG+ W AQRKL SHEF+AR +RE V   LE E
Sbjct  106   RANFGNYPKGKAFTDVLGDLLGGGIFNADGERWFAQRKLVSHEFSARVMREAVGVALERE  165

Query  1201  VDGRLSPLLEAAARNSSVL---DLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
                RL P L+AAA     +   D+Q++LR+FAF+ IC+++LG                  
Sbjct  166   ARARLLPALDAAAEGGGGVVVVDVQELLRQFAFNVICRVALG------------------  207

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
                   E+               KRA  VGSE++LRE +KV+ D + E +R     +   
Sbjct  208   --GGGGEV---------------KRALGVGSERRLREEVKVIRDAIMEFVRDSSSRRRRE  250

Query  850   --IAAGAG-SDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
               +AA  G  D +SR+  AG+ DE + DMV+SF++AGRDTTSSALTWFFWL+++H ++E 
Sbjct  251   QLLAAARGRDDLVSRMAAAGYPDEAICDMVVSFIMAGRDTTSSALTWFFWLMTRHRDVER  310

Query  679   TVIKQV-------LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVL  521
              V+ +V               ++ +  R    + A LCE+MRLYPPVAWDSKHAA DDVL
Sbjct  311   EVLDEVDACMGDGGDGGGLAGVDLEGSRRARVLHAALCETMRLYPPVAWDSKHAAEDDVL  370

Query  520   PDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGP  341
             PDGT + RG+RVT+ PY MGRME +WG D  EF+P RW         +SPFK+PVFQ GP
Sbjct  371   PDGTRVGRGDRVTYFPYGMGRMEAIWGADAGEFRPGRWLAAAAAGGGVSPFKYPVFQGGP  430

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMREGYN  164
             R CLGK+MAF+QMKFV +++LRRFE+RPV  E  P FVPLLT +MA GL V V  R+  N
Sbjct  431   RTCLGKDMAFVQMKFVASAVLRRFELRPVAPEGSPEFVPLLTAHMAGGLKVTVRRRQRQN  490

Query  163   NN  158
               
Sbjct  491   GT  492



>emb|CDY16724.1| BnaA09g06580D [Brassica napus]
Length=471

 Score =   457 bits (1177),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 246/470 (52%), Positives = 309/470 (66%), Gaps = 41/470 (9%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P SYP+IG +LSF KNR+ LL WYT LL  SP++TI +  L   RT+VT + ENVE++
Sbjct  36    YKPTSYPLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITIDLLFNRRTIVTGNPENVEHI  95

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NFPKG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L E
Sbjct  96    LKTNFCNFPKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILRE  155

Query  1204  EVDGRLSPLLEAAA--RNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             EV+ RL P+L +AA       +DLQ++L+RFAFD +CK+                 +LV+
Sbjct  156   EVENRLVPVLSSAADYDGGRTVDLQEILKRFAFDVVCKV-SLGWDPDCLDLTRPVPALVE  214

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AFD A+ ISARR   PV AVWK KR  NVGSE++LRE IK VH  V EIIR +K+    +
Sbjct  215   AFDVAAAISARRATEPVHAVWKLKRLLNVGSERRLREAIKTVHMSVSEIIRAKKKSLDIS  274

Query  850   IAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                    D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++
Sbjct  275   GDVSDKQDLLSRFLAAGHDEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSENGDVEDKIL  334

Query  670   KQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++V  +     L F+ L+EM+Y KACLCE+MRLYPPVA                      
Sbjct  335   EEV-RNKGSLGLGFEDLKEMSYTKACLCEAMRLYPPVA----------------------  371

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPRVCLGK  323
                        ME +WG DW EFKP+RW +E       LK +S FKFPVFQAGPRVC+GK
Sbjct  372   -----------MEKVWGQDWDEFKPNRWLEEDPSTKPVLKSVSSFKFPVFQAGPRVCIGK  420

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMAF QMK+VV S+L RFEI PV +++PVFVPLLT +MA GL V++  RE
Sbjct  421   EMAFTQMKYVVGSVLSRFEIIPVTKNRPVFVPLLTAHMAGGLKVKIKRRE  470



>gb|EEE52103.1| hypothetical protein OsJ_33900 [Oryza sativa Japonica Group]
Length=526

 Score =   457 bits (1175),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 249/499 (50%), Positives = 319/499 (64%), Gaps = 67/499 (13%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP+IGCL++FY+NR  LLDWYT++LA+SP++TIVV RLGA RTVVTA+  NVE++
Sbjct  39    WGPRSYPVIGCLVAFYRNRRRLLDWYTEMLAASPSQTIVVDRLGARRTVVTANPANVEHI  98

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L+  F N+PKG+P   +LGD LG GIFNVDG+LW AQRKL SHEF+AR+LR+L +  LE 
Sbjct  99    LRARFANYPKGKPFTDVLGDLLGMGIFNVDGELWHAQRKLVSHEFSARALRDLEVTVLEA  158

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E   RL P L AA+R   V+D+QDVLRRFAFD IC++SLG DPGCL  +  +      AF
Sbjct  159   EARDRLVPALAAASRGGGVVDMQDVLRRFAFDVICRVSLGVDPGCLDPALPAPRLAA-AF  217

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA----  857
             D A+ I ARRG APV AVWK KRA + GSE++LRE + V+H+ V  +IR R++E+A    
Sbjct  218   DTAAGIIARRGAAPVAAVWKVKRALDAGSERRLREEVGVIHEAVMGLIRSRRKERALLLV  277

Query  856   ----NNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPN  689
                      GA SD LSR+++ G+ DE +RDMVISF++AGRDTTSSALTWFFWLL +H  
Sbjct  278   NGNGVGGGGGARSDLLSRMIECGYPDEAIRDMVISFIMAGRDTTSSALTWFFWLLMRHRG  337

Query  688   IETTVIKQVLSSDDQK-------------TLNFDHLREMNYIKACLCESMRLYPPVAWDS  548
             +E  V+ ++ ++   +              L+ D  R M  + A LCE+MRLYP      
Sbjct  338   VEAQVLDEIAATRRARGAGEEGGDDGEGEGLDLDDYRRMRVLHAALCETMRLYP------  391

Query  547   KHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----------  401
                                     PY MGRME +WG D  +F  DRW             
Sbjct  392   ------------------------PYGMGRMEAIWGADAADFSLDRWLSLPRGGGDCAAA  427

Query  400   ---EQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVF  233
                       +SPFK+PVFQ GPR CLGKEMAF+QMKFV +++LRRFE+RPV E + P F
Sbjct  428   ASPAAAAFAGVSPFKYPVFQGGPRTCLGKEMAFVQMKFVASAVLRRFELRPVDEGRTPAF  487

Query  232   VPLLTGYMAKGLYVRVHMR  176
             VPL+T +MA GL V V  R
Sbjct  488   VPLMTAHMAGGLNVTVRRR  506



>emb|CDY48144.1| BnaCnng15860D [Brassica napus]
Length=474

 Score =   450 bits (1157),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 242/470 (51%), Positives = 308/470 (66%), Gaps = 41/470 (9%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P SY +IG +LSF KNR+ LL WYT LL  SP++TI V  L   RT+VT + ENVE++
Sbjct  36    YKPTSYLLIGSILSFNKNRHRLLQWYTDLLRLSPSQTITVDFLFNRRTIVTGNPENVEHI  95

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK NF NF KG+P   +LGD LG GIFN DG+LWS+QRKLASHEFT RSLRE   + L E
Sbjct  96    LKTNFSNFTKGKPFTDLLGDLLGGGIFNSDGELWSSQRKLASHEFTMRSLREFTFEILRE  155

Query  1204  EVDGRLSPLLEAAA--RNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             EV+ RL P+L +AA       +DLQ++L+RFAFD +CK+                 +LV+
Sbjct  156   EVENRLVPVLSSAADYDGGRTVDLQEILKRFAFDVVCKV-SLGWDPDCLDLTRPVPALVE  214

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AFD A+ ISARR    V AVWK KR  NVGSE++LRE IK VH  V EIIR +K+    +
Sbjct  215   AFDVAAAISARRATESVHAVWKLKRLLNVGSERRLREAIKTVHMSVSEIIRAKKKSLDIS  274

Query  850   IAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                    D LSR L AGH +E VRD VISF++AGRDTTS+A+TW FWLLS++ ++E  ++
Sbjct  275   GDVSGKQDLLSRFLAAGHDEEAVRDSVISFIMAGRDTTSAAMTWLFWLLSENGDVEDKIL  334

Query  670   KQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++V  +     L F+ L++M+Y KACLCE+MRLYPPVA                      
Sbjct  335   EEV-RNKGSLGLGFEDLKDMSYTKACLCEAMRLYPPVA----------------------  371

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGK----LKMISPFKFPVFQAGPRVCLGK  323
                        ME +WG DW EFKP+RWF+E+      LK +S FKFPVFQAGPRVC+GK
Sbjct  372   -----------MEKVWGQDWEEFKPNRWFEEEPSTKPVLKSVSVFKFPVFQAGPRVCIGK  420

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             EMAF QMK+V+ S+L RFE+ PV +++PVFVPLLT +MA GL V++  RE
Sbjct  421   EMAFTQMKYVIGSVLSRFEVVPVSKNRPVFVPLLTAHMAGGLKVKIKRRE  470



>gb|EMS53696.1| Cytochrome P450 94A1 [Triticum urartu]
Length=485

 Score =   448 bits (1152),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 238/470 (51%), Positives = 305/470 (65%), Gaps = 44/470 (9%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             + P SYP+IGCLL+FY+NR  LLDWYT++LA+SPT+TIVV RLGA RTVVTA+  NVEY+
Sbjct  32    HGPRSYPVIGCLLAFYENRRRLLDWYTEMLAASPTQTIVVDRLGARRTVVTANPANVEYI  91

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             L  NF NFPKG+P   +LGD LG GIFNVDGD W AQRKL SHEF+AR+LREL +  LE 
Sbjct  92    LLGNFGNFPKGKPFTDVLGDLLGNGIFNVDGDKWFAQRKLVSHEFSARTLRELEIAVLEA  151

Query  1204  EVDGRLSPLLEAAAR-NSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
             E   RL P +EAAA      +D+QDVLRRFAFD IC++               A  L  A
Sbjct  152   EALDRLVPAMEAAAEPGGGAVDMQDVLRRFAFDVICRV-SLGVDPGCLDPALPAPRLATA  210

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD A+ I ARRG AP+ AVWK KRA N+GSE++LRE +KV+++ V ++IR RK+E+    
Sbjct  211   FDAAAGIIARRGAAPLAAVWKIKRALNIGSERRLREEVKVIYEAVMDLIRSRKKERFLVN  270

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
             A    +D LSR++D G+ DE +RDMVISF++AGRDTTSSALTWFFWLL +H ++E  V++
Sbjct  271   AGAERNDLLSRMIDCGYADEDIRDMVISFIMAGRDTTSSALTWFFWLLMRHRDVERDVLE  330

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             ++                          SMR         + ++N     +G  +    R
Sbjct  331   EI-------------------------TSMR---------RDSSNGTYAGEGFDLDDFRR  356

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMISPFKFPVFQAGPRVCLGKE  320
             +    Y MGRME +WG+D  EF  +RW     D       +SPFK+PVFQ GPR CLG+E
Sbjct  357   MR---YGMGRMEAIWGSDAGEFSLERWLALPTDSNSASGGVSPFKYPVFQGGPRTCLGRE  413

Query  319   MAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMRE  173
             MAF+QMKFV  +ILRRF++RPV E + P F+PLLT +M  GL V V  R+
Sbjct  414   MAFVQMKFVAGAILRRFDLRPVDEGRTPAFLPLLTSHMHGGLKVTVRRRK  463



>gb|ADE75655.1| unknown [Picea sitchensis]
Length=559

 Score =   447 bits (1149),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 240/513 (47%), Positives = 324/513 (63%), Gaps = 49/513 (10%)
 Frame = -1

Query  1573  LIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENV  1394
             ++ Y P  YP++G L +F+KNR   ++W  ++LA SPT+TIVV RLG  RTV+TA+ EN+
Sbjct  42    ILKYGPNRYPLVGSLFAFWKNRRRHIEWAAEMLAESPTQTIVVERLGGIRTVLTANPENL  101

Query  1393  EYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKT  1214
             E++LK  F N+PKG P   IL D LG+GIFN DGD W  QRK+AS+EF++ SLR  V+K 
Sbjct  102   EHILKTRFDNYPKGNPFTAILHDLLGKGIFNADGDTWKLQRKVASYEFSSGSLRNFVLKV  161

Query  1213  LEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLV  1034
             +EE  D RL P+L  A+     L+LQD+L+RFAFDTICK++ G DP  L    + +E L 
Sbjct  162   VEEVTD-RLLPMLHNASETGRCLNLQDILQRFAFDTICKVAFGVDPAWLDGRFAESE-LA  219

Query  1033  DAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKAN  854
              A D A+++SA R  AP+  VWK KR  N+GSEK+L E + VVH+   E+IR R+ + +N
Sbjct  220   GALDVAAKLSAGRSAAPIQLVWKMKRMLNIGSEKRLSEAVAVVHEFAMEVIRRRRSQISN  279

Query  853   NIAAGAGS-----DFLSRLL------------DAGH---------------KDEVVRDMV  770
                  + S     D LSR +              GH                DE +RDM+
Sbjct  280   GGCTASDSKWEQSDLLSRFMVLSSTNSNSTCKGHGHDMPTDAMGVEREDCCSDEFLRDMI  339

Query  769   ISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV---LSSDDQKT---------LNFD  626
             ISF++AGRDTTSSALTWFFWLLS HP++   + K++   +++  Q            ++ 
Sbjct  340   ISFILAGRDTTSSALTWFFWLLSSHPHVGEAIYKEIAHLIAARSQDIDSSSSSPVLFSYK  399

Query  625   HLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENL  446
              ++ M+Y+ A +CESMRLYPPV  DSKHA ++DVLPDGT + +G RVT+ PYAMGRM  +
Sbjct  400   EMQNMHYLHASICESMRLYPPVLLDSKHALHNDVLPDGTFVGKGTRVTYHPYAMGRMNAI  459

Query  445   WGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFE  266
             WG D L+FKP+RW ++ G     SPFKF VFQ G RVCLGKEMAFI+MKFV A+++  F 
Sbjct  460   WGADCLQFKPERWVNKDGHFVPQSPFKFAVFQGGVRVCLGKEMAFIEMKFVAATVISMFR  519

Query  265   IRPVCESQ---PVFVPLLTGYMAKGLYVRVHMR  176
             ++P  +S+   P  V  LT  M  G  V V  R
Sbjct  520   LQPPVDSRQRTPKLVHCLTARMEGGFPVVVQRR  552



>ref|XP_009610819.1| PREDICTED: cytochrome P450 94A1-like [Nicotiana tomentosiformis]
Length=510

 Score =   441 bits (1133),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 307/469 (65%), Gaps = 11/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   S   N    + W + ++ S+P  T  + R     T+ TA+  NV++MLK
Sbjct  44    PRSYPLIGSYFSILANHDQRIKWISDIILSTPNLTFTLIRPLNFHTIFTANPSNVQHMLK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  + KG   N  L DFL  GIFNVDGD+W  QR++ASHEF  RSLR+ V   ++ E+
Sbjct  104   TNFQVYQKGHNSNTTLKDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTEL  163

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA N +VLD QD+L+RFAFD ICKI+ G DPG L  S   AE  V AF+ 
Sbjct  164   SERLIPILATAAANKTVLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAV-AFED  222

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  +S  R + P   +WK KRA N+GSEKKLR  ++ V +  +EI+R  KQ +  + ++ 
Sbjct  223   AVRLSTERFILPFPLIWKMKRALNIGSEKKLRFAVEQVREFAKEIVR-EKQRELKDKSSL  281

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+SKHP +E+ ++K++
Sbjct  282   DSADLLSRFLSTGHSDENFVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQILKEI  341

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                  +  L +D ++ M Y  A LCESMR YPPV  D+K A  DD+LPDGT + +GNRVT
Sbjct  342   -GEKSESLLLYDEVKNMIYTHASLCESMRFYPPVPMDTKEATKDDILPDGTFVKKGNRVT  400

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E +WG DW EF+P+RW D+    G    +S   + +PVFQAGPRVCLGKEM
Sbjct  401   YHPYAMGRVEKVWGKDWAEFRPERWLDKDEVTGNWTFVSKDAYTYPVFQAGPRVCLGKEM  460

Query  316   AFIQMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +LRRF++ PV E  ++PVF+  LT  M  G  V +  R
Sbjct  461   AFLQMKRVVAGVLRRFKVVPVVEQGAEPVFISYLTAKMKGGFPVTIEER  509



>ref|XP_009763713.1| PREDICTED: cytochrome P450 94A1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009763715.1| PREDICTED: cytochrome P450 94A1-like isoform X2 [Nicotiana sylvestris]
 gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum]
Length=511

 Score =   439 bits (1130),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 306/469 (65%), Gaps = 11/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   S   N    + W + ++ ++P  T  + R    RT+ TA+  NV+++LK
Sbjct  45    PRSYPLIGSYFSILANHDRRIKWISDIILTTPNLTFTLIRPLNFRTIFTANPSNVQHVLK  104

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  + KG      L DFL  GIFNVDGD+W  QR++ASHEF  RSLR+ V   ++ E+
Sbjct  105   TNFQVYQKGHGSYSTLKDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTEL  164

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA N +VLD QD+L+RFAFD ICKI+ G DPG L  S   AE  V AF+ 
Sbjct  165   SERLIPILATAAANKTVLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAV-AFED  223

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  +S  R + P   +WK KRA N+GSEKKLR  ++ V +  +EI+R  KQ++ N+ ++ 
Sbjct  224   AVRLSTERFIVPFSLIWKIKRALNIGSEKKLRVAVEQVREFAKEIVR-EKQKELNDKSSL  282

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+SKHP +E+ ++K+V
Sbjct  283   DSADLLSRFLSTGHSDEDFVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQIMKEV  342

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                  +  L +D ++ M Y  A LCESMR YPPV  DSK A  DD+LPDGT + +G RVT
Sbjct  343   -GEKSESLLLYDEVKNMMYTHASLCESMRFYPPVPMDSKEATKDDILPDGTFVKKGTRVT  401

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMI--SPFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E +WG DW EFKP+RW D+    G    +    + +PVFQAGPR+CLGKEM
Sbjct  402   YHPYAMGRVEKVWGEDWAEFKPERWLDKDEVTGNWTFVPKDAYTYPVFQAGPRICLGKEM  461

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +LRRF++ PV E   +PVF+  LT  M  G  V +  R
Sbjct  462   AFLQMKRVVAGVLRRFKVVPVVEQGVEPVFISYLTAKMKGGFPVTIEER  510



>gb|AAL54884.1|AF092913_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum]
Length=510

 Score =   438 bits (1127),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 307/469 (65%), Gaps = 11/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   S   N    + W + ++ S+P  T  + R     T+ TA+  NV++MLK
Sbjct  44    PRSYPLIGSYFSILANHDQRIKWISDIILSTPNLTFTLIRPLNFHTIFTANPSNVQHMLK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  + KG   N  L DFL  GIFNVDGD+W  QR++ASHEF  RSLR+ V   ++ E+
Sbjct  104   TNFQVYQKGHNSNTTLKDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTEL  163

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA N +VLD QD+L+RFAFD ICKI+ G DPG L  S   AE  V AF+ 
Sbjct  164   SERLIPILATAAANKTVLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAV-AFED  222

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  +S  R + P   +WK KRA N+GSEKKLR  ++ V +  +EI+R  KQ +  + ++ 
Sbjct  223   AVRLSTERFILPFPLIWKMKRALNIGSEKKLRFAVEQVREFAKEIVR-EKQRELKDKSSL  281

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+SKHP +E+ ++K++
Sbjct  282   DSADLLSRFLSTGHSDENFVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQILKEI  341

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                  +  L +D ++ M Y  A LCESMR YPPV  D+K A  DD+LPDGT + +GNRVT
Sbjct  342   -GEKSESLLLYDEVKNMIYTHASLCESMRFYPPVPMDTKEATKDDILPDGTFVKKGNRVT  400

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E +WG DW EF+P+RW D+    G    +S   + +PVFQAGPRVCLGKEM
Sbjct  401   YHPYAMGRVEKVWGKDWAEFRPERWLDKDEVTGNWTFVSKDAYTYPVFQAGPRVCLGKEM  460

Query  316   AFIQMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +LRRF++ PV E  ++PVF+  LT  M +   V +  R
Sbjct  461   AFLQMKRVVAGVLRRFKVVPVVEQGAEPVFISYLTAKMKEVFPVTIEER  509



>ref|XP_007050381.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOX94538.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=504

 Score =   436 bits (1121),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 302/468 (65%), Gaps = 11/468 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG  L+   NR   + W T++L +SP+ T  +H L   R ++TA+  NV++MLK
Sbjct  37    PKSYPIIGSYLAVKSNRSNRMQWMTQILQTSPSATFTLHHLFGHRQILTANPANVQHMLK  96

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F N+ KG     +L DFLG GIFNVDG+ W  QR+++SHEF  +SLR+ V   ++ E+
Sbjct  97    THFNNYQKGPFSISVLFDFLGNGIFNVDGESWKFQRQVSSHEFNTKSLRKFVQTVVDTEL  156

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+   AA + +VLDLQ++L+RFAFD +CKI                    +AF+ 
Sbjct  157   HDRLIPMFSEAASDKTVLDLQEILQRFAFDNVCKI-AFGFDPACLLPSLPQSRFAEAFED  215

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ +S+ R        WK KR FN+GSEK+L+  +  V D  ++I+R +KQE A+  ++ 
Sbjct  216   ATNLSSERFRTFHNIAWKIKRFFNIGSEKRLKIAVSQVRDFAKKIVREKKQELADK-SSL  274

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWL+ KHP +E  ++K++
Sbjct  275   ESVDLLSRFLQSGHSDENFVTDIVISFILAGRDTTSAALTWFFWLVYKHPEVEKEILKEI  334

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                D      F+ ++EM Y  A LCE MRLYPPV  DSK A +DDVLPDGT + +G  +T
Sbjct  335   --KDKSAMPVFEEVKEMVYTHASLCECMRLYPPVPADSKLAMDDDVLPDGTVVKKGTLMT  392

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWF--DEQGKLKMIS--PFKFPVFQAGPRVCLGKEMA  314
             + PYAMGRME +WG+DW +FKP+RW   DE GK   +   P+ +PVFQAGPR+C+GKEMA
Sbjct  393   YHPYAMGRMEKIWGSDWEDFKPERWLERDEAGKWSFVGRDPYTYPVFQAGPRICMGKEMA  452

Query  313   FIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             F+QMK VVA +LRRF++ P  E   QP F+  LT  M  G  VRV  R
Sbjct  453   FLQMKRVVAGVLRRFKVVPAVEDGLQPEFLVYLTSKMKGGFPVRVEDR  500



>ref|XP_006838838.1| hypothetical protein AMTR_s00002p00263780 [Amborella trichopoda]
 gb|ERN01407.1| hypothetical protein AMTR_s00002p00263780 [Amborella trichopoda]
Length=486

 Score =   434 bits (1117),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 224/476 (47%), Positives = 316/476 (66%), Gaps = 7/476 (1%)
 Frame = -1

Query  1594  HTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVV  1415
             +++ ++  +   P SYPI+GC LSF  NR+ +  W T+LL  SPT+TIV+ RLG    ++
Sbjct  9     NSDKNRGAVFEGPKSYPILGCTLSFIANRHRVSQWITELLRLSPTQTIVLKRLGGIHQII  68

Query  1414  TASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSL  1235
             TA+  NV+++LK+ F N+PKG+   +I+ DFLG+GI N DG+ W  QRK+A H F  +SL
Sbjct  69    TANPANVQHILKSKFPNYPKGQFGREIMADFLGQGIVNSDGEPWKFQRKIAIHGFNTKSL  128

Query  1234  RELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssd  1055
             ++ +   +EEE+  RL PLLE AA  + +LDLQDVL  FAFD IC I+ G DP CL    
Sbjct  129   KKFIHHVVEEELFTRLIPLLEKAAMENMILDLQDVLESFAFDNICNIAFGWDPCCLHVDA  188

Query  1054  ssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRV  875
                    +AFD A+ +S+ R  +     WK KR F++G+E+KLR  I  V     E+I+ 
Sbjct  189   LLESEFAEAFDSAATLSSERFRSLAPWSWKLKRLFDIGTERKLRISIDKVKGLAIELIQR  248

Query  874   RKQE-KANNIAAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSK  698
             +K E +   I      D LSR L+AG  ++++RD+VI F++AGRDTTS+ALTWFFWLL++
Sbjct  249   KKAEARPTGIEV---EDLLSRFLNAGIDEDIIRDIVICFVLAGRDTTSAALTWFFWLLAR  305

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             HP++E  +IK++    D   +  D ++++NY+ A + ESMRLYPPV  D+K AA +DVLP
Sbjct  306   HPHVEEAIIKEI-GHKDGINMGLDDIKDLNYLHASIYESMRLYPPVPVDTKEAAREDVLP  364

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-EQGKLKMISPFKFPVFQAGP  341
             DGT + +G+RV++ PYAMGRME LWG D+ +FKP+RW D E G       FK+ VFQAGP
Sbjct  365   DGTKVRKGSRVSYHPYAMGRMEALWGKDYEDFKPERWLDKENGMFVPCDSFKYAVFQAGP  424

Query  340   RVCLGKEMAFIQMKFVVASILRRFEIRPVCES-QPVFVPLLTGYMAKGLYVRVHMR  176
             R+C+GKEMAF+QMK VV ++L+RF IR    + + V+V  LT  M  G  VR+  R
Sbjct  425   RICMGKEMAFVQMKTVVVALLKRFRIRIANSNFKAVYVLGLTSKMEGGFSVRIEKR  480



>ref|XP_010246279.1| PREDICTED: cytochrome P450 94A2-like [Nelumbo nucifera]
Length=509

 Score =   433 bits (1113),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 232/472 (49%), Positives = 313/472 (66%), Gaps = 13/472 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   + +KNR     W+ +L+  S   T ++HR    R V+TA+  NV+++LK
Sbjct  41    PRSYPLIGSAFAIFKNRNRRNQWFAELIRDSSNGTFILHRFLGVRHVLTANPANVQHILK  100

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  +PKG      L DFLG GIFN DGD W  QR+++ HEF+ RSLR+ V   +E E+
Sbjct  101   TQFHLYPKGHTARVNLSDFLGDGIFNADGDNWKFQRQVSIHEFSTRSLRKFVETVVEAEL  160

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA  +SVL+L+D+L+RFAFD ICKI+ G DP  L  S  SAE  V AFD 
Sbjct  161   SDRLVPILSKAAAENSVLNLEDILQRFAFDNICKIAFGFDPQYLLPSLPSAEFAV-AFDD  219

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ I++ R  + V A+WK KRA ++GSEK+LR  I  V +  ++++R + +E     ++ 
Sbjct  220   AARITSERLNSVVPAIWKLKRALDIGSEKRLRIAISQVREFAQKVVREKTRELEEK-SSL  278

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR+L +GH DE +V DMVISF++AGRDTTS+ LTWFFWL+S   ++E  ++K++
Sbjct  279   ETVDLLSRILSSGHLDEKLVTDMVISFILAGRDTTSATLTWFFWLVSGDSHVEEEILKEI  338

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                D  +T ++D +++M YI+A LCESMRLYPPV  DSK AA DDVLPDGT + +G RVT
Sbjct  339   --RDKSETPDYDEVKDMVYIQASLCESMRLYPPVPSDSKEAAMDDVLPDGTIVKKGMRVT  396

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMI---SPFKFPVFQAGPRVCLGKE  320
             + PYAMGRME LWG DW EF+P+RW +     GK +      P+ +PVFQAGPRVCLGK+
Sbjct  397   YLPYAMGRMEGLWGQDWREFRPERWLERDEVTGKWRRFVARDPYTYPVFQAGPRVCLGKD  456

Query  319   MAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREG  170
             MAF+QMK V A ILRRF + P  E   +P F+  LT  M  G  VR+  R+G
Sbjct  457   MAFLQMKRVAAGILRRFRVVPAMEKGFEPFFISTLTSKMKGGFPVRIEERKG  508



>ref|XP_006383694.1| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
 gb|ERP61491.1| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
Length=507

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/471 (47%), Positives = 304/471 (65%), Gaps = 16/471 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP+IG  ++ + NR   + W + L+ +SPT T+V+ RL     V+T +  NV++MLK  
Sbjct  39    SYPLIGSSVAIFANRNRFIQWTSDLIQNSPTATVVIRRLFDDSRVLTGNPANVQHMLKTQ  98

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+ KG    + L DFLG GIFN+DGD W  QR+++SHEF  +SLR+ V   ++ EV  
Sbjct  99    FYNYEKGSKARRTLFDFLGNGIFNIDGDSWKFQRQVSSHEFNTKSLRKFVETVVDTEVSQ  158

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L  AA N++VLDLQD+L+RFAFD ICKI            D +       FD+A+
Sbjct  159   RLIPILFTAAANNTVLDLQDILQRFAFDNICKI-AFGYDPAYLLPDLAEAEFAKTFDEAA  217

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
             +IS+ R       +WK KR FN+GSEK+L+E    + +    II+ +KQE +N  ++   
Sbjct  218   KISSDRFSTLFPFLWKIKRVFNIGSEKRLKEASSELREFARNIIKEKKQELSNK-SSLET  276

Query  832   SDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
              D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLLS++P +E  +++++  
Sbjct  277   VDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWYFWLLSQNPEVEKEIVREI--  334

Query  655   SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFS  476
              D  ++  ++ +++M Y  A LCESMRLYPPV  D K A  DDVLPDGT I +G RV++ 
Sbjct  335   KDKSESPVYEEVKDMVYTHASLCESMRLYPPVPIDGKVAMQDDVLPDGTVIKKGMRVSYH  394

Query  475   PYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMIS--PFKFPVFQAGPRVCLGK  323
             PYAMGR+E LWG DW +FKP+RW        +  GK   +   P+ +PVFQAGPR+CLGK
Sbjct  395   PYAMGRLEMLWGPDWEKFKPERWLQGSGDGVNSNGKWSFVGRDPYSYPVFQAGPRICLGK  454

Query  322   EMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             +MAF+QMK VVA ILRRF++ P  E   +PVFV  LT  M  G  VR   R
Sbjct  455   DMAFLQMKRVVAGILRRFKVVPAAEEGFEPVFVSYLTSKMQGGFPVRFEER  505



>ref|XP_010246280.1| PREDICTED: cytochrome P450 94A2-like [Nelumbo nucifera]
Length=508

 Score =   432 bits (1111),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 227/469 (48%), Positives = 305/469 (65%), Gaps = 10/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   + +KNR     W+ +L+  SPT T V+HR    R V+TA+  NV+++LK
Sbjct  43    PRSYPLIGSAFAIFKNRKRRNQWFAELMRDSPTGTFVLHRFFGVRHVLTANPSNVQHILK  102

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  +PKG      L D +G GIFN DGD W  QR+++ HEF+ RSLR+ V   +E E+
Sbjct  103   TKFHLYPKGHTARVNLSDLMGDGIFNADGDNWKFQRQVSGHEFSTRSLRKFVETVVEAEL  162

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA  +SVLDL+D+L+RF FD ICKI+ G DP  L  S  + E  V AFD 
Sbjct  163   SDRLVPILSKAAAENSVLDLEDILQRFTFDNICKIAFGFDPQYLLPSLPATEFAV-AFDN  221

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  I++ R  +   A WK KRA N+GSEK+LR  +  V +  + I+R + +E     ++ 
Sbjct  222   AVRITSERMYSIFPATWKLKRALNIGSEKQLRISVSQVREFAQNIVREKTRELEQK-SSL  280

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR+L +GH DE  V DMVISF++AGRDTTS+ALTWFFWL+S   ++E  ++K++
Sbjct  281   ETVDLLSRILSSGHLDEKFVTDMVISFILAGRDTTSAALTWFFWLVSNDSHVEEEILKEI  340

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                D  +   +D  ++M YI+A LCESMRLYPPV  D+K AA DDVLPDGT + +G RV 
Sbjct  341   --RDKPEISVYDEAKDMVYIQASLCESMRLYPPVPSDTKEAAMDDVLPDGTIVRKGTRVI  398

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGRME LWG+DW EFKP+RW +     GK   ++  P+ +PVFQAGPR+CLGKEM
Sbjct  399   YLPYAMGRMEGLWGSDWREFKPERWLERDELTGKWSFMNRDPYTYPVFQAGPRICLGKEM  458

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMREG  170
             A +QMK V A +LRRF + P  E +P ++  LT  M  G  VR+  R+G
Sbjct  459   AVLQMKRVAAGLLRRFRMVPAGEKEPFYISTLTSKMKGGFPVRIEERKG  507



>ref|XP_006383696.1| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
 gb|ERP61493.1| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
Length=507

 Score =   429 bits (1103),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 222/472 (47%), Positives = 307/472 (65%), Gaps = 18/472 (4%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP+IG  ++ + NR   + W + L+ +SPT T+V+ R      V+T +  NV++MLK  
Sbjct  39    SYPLIGSSVAIFANRNRFIQWTSDLIQNSPTATVVIRRFLDHSRVLTGNPANVQHMLKTQ  98

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+ KG    + L DFLG GIFN DGD W  QR+++SHEF  ++LR+ V   ++ EV  
Sbjct  99    FYNYEKGSKARRTLFDFLGNGIFNTDGDSWKFQRQVSSHEFNTKALRKFVETVVDTEVSQ  158

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L  AA N++VLDLQD+L+RFAFD ICKI            D    +    F++A+
Sbjct  159   RLIPILSTAAANNTVLDLQDILQRFAFDNICKI-AFGYDPAYLLPDLPEAAFAKTFEEAA  217

Query  1012  EISARRGMAPVFA-VWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGA  836
             +IS+ R +A +F  +WK KR FN+GSEK+L+E    + +    II+ +K+E +N  ++  
Sbjct  218   KISSDR-LATIFPLLWKIKRVFNIGSEKRLKEASSELREFARNIIKEKKKELSNK-SSLE  275

Query  835   GSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
               D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLLS++P +E  ++ ++ 
Sbjct  276   TVDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWYFWLLSQNPEVEKEIVGEI-  334

Query  658   SSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTF  479
              +D  ++  F+ +++M Y  A LCESMRLYPPV  DSK A  DDVLPDGT I +G RV++
Sbjct  335   -NDKSESPVFEEVKDMVYTHASLCESMRLYPPVPRDSKVAMQDDVLPDGTVIKKGMRVSY  393

Query  478   SPYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMIS--PFKFPVFQAGPRVCLG  326
              PYAMGR+E LWG DW +FKP+RW        +  GK   +   P+ +PVFQAGPR+CLG
Sbjct  394   HPYAMGRLEMLWGPDWEKFKPERWLQGAGDGVNSNGKWSFVGRDPYSYPVFQAGPRICLG  453

Query  325   KEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             K+MAF+QMK VVA ILRRF++ P  E   +PVFV  LT  M  G  VR   R
Sbjct  454   KDMAFLQMKRVVAGILRRFKVVPAAEEGFEPVFVSYLTSKMQGGFPVRFEER  505



>ref|XP_009414555.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=512

 Score =   429 bits (1102),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 230/447 (51%), Positives = 302/447 (68%), Gaps = 12/447 (3%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWYT LL +SPT+T+ VH LG     VTA+++NVE+MLK  F N+PKG+P   ILGD 
Sbjct  58    LCDWYTHLLRTSPTRTVTVHVLGC---TVTANSDNVEHMLKTRFDNYPKGKPFATILGDL  114

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLD  1142
             LGRGIFNVDGDLW  QRK+AS E  + ++R    +T+  EV GRL PLL+ A     VLD
Sbjct  115   LGRGIFNVDGDLWRFQRKMASTELGSAAVRAFASRTVAAEVGGRLLPLLDVACECGRVLD  174

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
             LQDV +RFAFD ICKIS G DPGC   S S +E    AFDKA+ +SARR    +  +WK 
Sbjct  175   LQDVFQRFAFDNICKISFGLDPGCFELSLSLSE-FAAAFDKATRLSARRATHTIPLIWKA  233

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVV  782
             KR FN GSE++LRE I +V    +E+I  R++     +   +  D LSR +     D+ +
Sbjct  234   KRLFNWGSERELREAIGLVDLLAKEVILQRRK-----LGFASDQDLLSRFMGCVDNDKYL  288

Query  781   RDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV--LSSDDQKTLNFDHLREMN  608
             RD+V+SF++AGRDT +SALT FF LLS+HP   T +  +V  +  + Q   + D LR+M+
Sbjct  289   RDIVVSFMLAGRDTVASALTSFFMLLSRHPAACTAIRDEVELIVGNSQALPSCDQLRKMH  348

Query  607   YIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWL  428
             Y+ A +CESMRLYPPV +DSK   +DDVLPDGT + +G R+T+  YAMGRME+LWG+DW 
Sbjct  349   YLNAAICESMRLYPPVQFDSKFCLDDDVLPDGTFVRKGTRMTYHVYAMGRMEDLWGSDWA  408

Query  427   EFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCE  248
             EF+P+RW    G     SPFK+PVFQ G RVCLGKEMA ++MK V+AS++R F++  +  
Sbjct  409   EFRPERWLRHTGAFTPESPFKYPVFQGGLRVCLGKEMALMEMKSVIASVVREFDVEVIEG  468

Query  247   SQ-PVFVPLLTGYMAKGLYVRVHMREG  170
             ++ P F P LT   + GL VRVH R+G
Sbjct  469   NRPPKFAPGLTAIFSGGLAVRVHRRKG  495



>ref|XP_008364314.1| PREDICTED: cytochrome P450 94A1-like [Malus domestica]
Length=508

 Score =   428 bits (1100),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 234/476 (49%), Positives = 309/476 (65%), Gaps = 18/476 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S YKN +  L W+T LL SSP+ T  +H       VVTA+   V+++LK
Sbjct  35    PKSYPIIGTFPSLYKNHHRRLQWFTDLLRSSPSNTFTLHHSXGRXWVVTANPTXVQHILK  94

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+ KGE     L D LG GIFNVDGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  95    TNFPNYQKGEXSRSTLADLLGDGIFNVDGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  154

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A+A  +SVLD QD+L+RFAFD IC+I+ G DP  L  S   A+  V AFD 
Sbjct  155   SDRLIPILSASAAXNSVLDFQDILQRFAFDNICRIAFGYDPDYLLPSLPEAKFAV-AFDD  213

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS+ R   P   VWK KRA  +GSEK+LR  +  V +    I+R +K++ +   A  
Sbjct  214   AVQISSERFGLP-HPVWKLKRALGIGSEKRLRAVVSEVREFANTIVREKKRDLSEXXALE  272

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             +  D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++P +E  ++K++
Sbjct  273   S-XDLLSRFLSSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNPRVEQEILKEI  331

Query  661   ---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
                 SS+      +D ++EM Y  A LCESMRLYPPV  DSK AANDD+LPDGT + +G 
Sbjct  332   NDTASSESAAGGGYDEVKEMVYTHAALCESMRLYPPVPVDSKQAANDDILPDGTKVKKGM  391

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF---DEQG---KLKMIS--PFKFPVFQAGPRV  335
             +VT+  YAMGRME +WG DW E++P+RW    +E G   K K +    + +PVFQAGPR+
Sbjct  392   KVTYHVYAMGRMEEIWGEDWAEYRPERWLERGEEXGTHKKWKFVGRDTYSYPVFQAGPRI  451

Query  334   CLGKEMAFIQMKFVVASILRRFEIRP---VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             CLGKEMAF+QMK VV+ +L+RF++ P       +P  +  LTG M  GL V V  R
Sbjct  452   CLGKEMAFLQMKRVVSGVLKRFKLVPREREGGDEPELLAYLTGKMKGGLPVTVLER  507



>gb|AAZ39645.1| cytochrome P450 monooxygenase [Petunia x hybrida]
Length=509

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 304/469 (65%), Gaps = 11/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   L W + ++ S+P  T  + R     T+ TA+  NV++MLK
Sbjct  43    PTSYPIIGSYFSILANKDHRLQWISDIILSTPNLTFTLMRPLNFHTIFTANPANVQHMLK  102

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  + KGE  +  + DFLG GIFN++G+ W  QR++ASHEF  RSLR+ V   ++ E+
Sbjct  103   TNFHVYQKGEKSSSTVSDFLGNGIFNINGEKWKYQRQVASHEFNTRSLRKFVETVVDTEL  162

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P+L  AA N  VLD QD+L+RFAFD ICKI+ G DPG L  S   AE  V AF+ 
Sbjct  163   NERLIPILATAAANKIVLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPQAEFAV-AFED  221

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             +  +S+ R   P   +WK KRA ++GSEKKLR  +  V ++ ++I+R  KQ +    ++ 
Sbjct  222   SVRLSSERINVPFPLIWKIKRALDIGSEKKLRIAVGKVREYAKKIVR-EKQSELKEKSSL  280

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+SKHP +E+ ++K++
Sbjct  281   DSADLLSRFLSTGHSDEDFVTDIVISFILAGRDTTSAALTWFFWLVSKHPEVESQILKEI  340

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                 +   L +D ++ M Y  A LCESMR YPPV  D+K A  +D+LPDGT + +G RVT
Sbjct  341   GEKSETVVL-YDEVKNMMYTHASLCESMRFYPPVPMDTKEATQNDILPDGTFVKKGTRVT  399

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E +WG DW EFKP+RW D     G    +S  P+ +PVFQAGPR+CLGKEM
Sbjct  400   YHPYAMGRVEKVWGKDWAEFKPERWLDINEVTGNCTFVSKDPYTYPVFQAGPRICLGKEM  459

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +L+RF++ P  E   +P F+  LT  M  G  V +  R
Sbjct  460   AFLQMKRVVAGVLQRFKVVPAVEQGVEPEFISYLTAKMKGGFPVTIEER  508



>ref|XP_009354911.1| PREDICTED: cytochrome P450 94A1-like [Pyrus x bretschneideri]
Length=508

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 233/476 (49%), Positives = 307/476 (64%), Gaps = 18/476 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S YKN    L W+T LL +SPT T  +H       VVTA+   V+++LK
Sbjct  35    PKSYPIIGSFPSLYKNHRRRLQWFTDLLRASPTNTFTLHHSLGRHWVVTANPTVVQHILK  94

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+ KGE     L D LG GIFNVDG+ W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  95    TNFPNYQKGEASRSTLADLLGDGIFNVDGENWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  154

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A+A N+SVLD QD+L+RFAFD IC+I+ G DP  L  S   A+  V AFD 
Sbjct  155   SDRLIPILSASAANNSVLDFQDILQRFAFDNICRIAFGYDPDYLLPSLPEAKFAV-AFDD  213

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS+ R   P   VWK KRA  +GSEK+LR  +  V +    I+R +KQ+  +   A 
Sbjct  214   AVQISSERFGLP-HPVWKLKRALGIGSEKRLRAVVSEVREFANTIVREKKQD-LSEAKAL  271

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++P +E  ++K++
Sbjct  272   ESVDLLSRFLSSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNPRVEQEILKEI  331

Query  661   ---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
                 SS+      +D ++EM Y  A LCESMRLYPPV  DSKHA NDD+LPDGT + +G 
Sbjct  332   NDTASSESAAGGGYDEVKEMVYTHAALCESMRLYPPVPVDSKHAVNDDILPDGTKVKKGM  391

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF---DEQG---KLKMIS--PFKFPVFQAGPRV  335
             +VT+  YAMGRME +WG  W E++P+RW    +E G   K K +    + +PVFQAGPR+
Sbjct  392   KVTYHVYAMGRMEEIWGEHWAEYRPERWLERGEESGTHKKWKFVGRDTYSYPVFQAGPRI  451

Query  334   CLGKEMAFIQMKFVVASILRRFEIRP---VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             CLGKEMAF+QMK VV+ +L+RF++ P       +P  +  LTG M  GL V +  R
Sbjct  452   CLGKEMAFLQMKRVVSGVLKRFKVVPREREGGDEPELLAYLTGKMKGGLPVTILER  507



>ref|XP_002300789.2| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
 gb|EEE80062.2| cytochrome P450 CYP94A1 family protein [Populus trichocarpa]
Length=517

 Score =   426 bits (1094),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 221/481 (46%), Positives = 307/481 (64%), Gaps = 16/481 (3%)
 Frame = -1

Query  1564  YTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYM  1385
             Y P  YP+IG  ++ Y NR  ++ W + L+ +SPT TIV+HR      V T +  NV+++
Sbjct  35    YLPKPYPLIGSSVAIYANRNRVIQWTSDLIQNSPTATIVLHRFLDDSRVHTGNPANVQHI  94

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK  F N+ KG    +IL DFLG GIFN+DGD W  QR+++S+EF  +SLR+ V   ++ 
Sbjct  95    LKTQFHNYGKGSKFRRILFDFLGNGIFNIDGDSWKFQRQVSSNEFNTKSLRKFVETLVDT  154

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E+  RL P+L +AA N++VLDLQD+L+RFAFD IC I            D         F
Sbjct  155   ELSQRLIPILSSAAANNTVLDLQDILQRFAFDNICNI-AFGYDPAYLLPDLPEAEFAKTF  213

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A++IS+ R  +    +WK KR  N+GSEK+L+E    +    + II+ +KQE +   +
Sbjct  214   DDAAKISSERLNSVFPYLWKIKRVLNIGSEKRLKEASSQLRQFAKNIIKEKKQELSKKPS  273

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               +  D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLLS++  +E  V++
Sbjct  274   LES-VDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWYFWLLSQNQEVEKEVLR  332

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             ++    +     ++ +++M Y  A LCESMRLYPPV  DSK A +DDVLPDGT + +G R
Sbjct  333   EIKEKSESPV--YEEVKDMVYTHASLCESMRLYPPVPIDSKVAKHDDVLPDGTVVKKGMR  390

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFD-------EQGKLKMIS--PFKFPVFQAGPRV  335
             V++ PYAMGR+E LWG+DW +FKP+RW +       + GK   +   P+ +PVFQAGPR+
Sbjct  391   VSYHPYAMGRLEVLWGSDWEKFKPERWLESAADGATKNGKWSFVGRDPYTYPVFQAGPRI  450

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREGYNN  161
             CLGK+MAF+QMK VVA ILRRF++ PV E   +P FV  LTG M  G  VR   R    N
Sbjct  451   CLGKDMAFLQMKKVVAGILRRFKVVPVAEDGFEPEFVAYLTGKMKGGFPVRFEKRADGKN  510

Query  160   N  158
             +
Sbjct  511   S  511



>gb|AJD25218.1| cytochrome P450 CYP94A48 [Salvia miltiorrhiza]
Length=502

 Score =   425 bits (1092),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 218/480 (45%), Positives = 309/480 (64%), Gaps = 10/480 (2%)
 Frame = -1

Query  1591  TEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVT  1412
             +E   K     P SYPI+G  L+  KN+   + W ++++ S+P  T  +HR      + T
Sbjct  26    SETTSKTSTKLPKSYPILGSFLTIVKNKDRFVQWSSEIVTSTPNLTFPLHRNLGRWIIFT  85

Query  1411  ASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLR  1232
             A+  NV+++LK NF N+ KGE     L DFLG GIFN DG  W  QR++ASHEF  +SLR
Sbjct  86    ANPANVQHLLKENFHNYEKGEFFKTTLRDFLGNGIFNSDGQTWKFQRQVASHEFNTKSLR  145

Query  1231  ELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssds  1052
             + V   ++ E+  RL P+L  AA+  +V+D QD+L+RFAFD +CKI+ G DP  LS S  
Sbjct  146   KFVETVVDSELSQRLIPILRKAAKEETVIDFQDILQRFAFDNVCKIAFGYDPRYLSPSLP  205

Query  1051  saeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR  872
               +  V AF+ A ++S+ R  + +  +WK K+  NVGSEK+L+  I  V +  +E+IR +
Sbjct  206   KEKFAV-AFETAVKLSSERFSSFIPLIWKIKKTINVGSEKQLKIAISEVRNFAKELIREK  264

Query  871   KQEKANNIAAGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKH  695
             KQE  +  ++    D LSR L +GHKDE  + D+VISF++AGRDTTS+ALTWFFWLLS H
Sbjct  265   KQELEHK-SSLESVDLLSRFLSSGHKDEDFITDIVISFILAGRDTTSAALTWFFWLLSDH  323

Query  694   PNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPD  515
               +E+ ++++V  + +  +  +D +++M Y  A +CESMRLYPPV  DSK A  DDVLPD
Sbjct  324   AEVESEILREVKETSETAS-AYDEMKDMVYTHASICESMRLYPPVPTDSKEALGDDVLPD  382

Query  514   GTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD------EQGKLKMISPFKFPVF  353
             GT + +G RV + PYAMGR+E +WG DW EF+P RW +      E+        F +PVF
Sbjct  383   GTVVKKGMRVAYHPYAMGRVEKVWGRDWAEFRPTRWLERAEGGGEKWSFVNRDTFTYPVF  442

Query  352   QAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             QAGPR+CLGKEMAF+QMK V+  ++R+F + PV E++P +V  LT  M  G  VR+  R+
Sbjct  443   QAGPRICLGKEMAFLQMKRVITGVVRQFRVVPVAEAEPTYVADLTAKMKGGFPVRIEERK  502



>ref|XP_006366194.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=504

 Score =   424 bits (1090),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 301/469 (64%), Gaps = 10/469 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   + W + ++ S+P  T  + R     T+ TA+  NV+++LK
Sbjct  37    PKSYPIIGSYFSILANQEQRIQWISDIILSTPKLTFTLIRPLNFHTIFTANPSNVQHILK  96

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  + KG   N  L DFL  GIFNVDGD+W  QR++ASHEF  +SLR+ V   ++ EV
Sbjct  97    TNFSVYQKGHNSNSTLADFLSNGIFNVDGDIWKYQRQVASHEFNTKSLRKFVESVVDIEV  156

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA    V+D+QD+L+RFAFD ICKI+ G DP  L  +   AE  V AF+ 
Sbjct  157   SERLVPILANAAAEKKVVDIQDILQRFAFDNICKIAFGYDPEYLLPNLPEAEFAV-AFED  215

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
                +S+ R + P   +WK KR F +GSEKKLR  ++ V +  ++++R  KQ + N  ++ 
Sbjct  216   CVRLSSERFILPFPLIWKIKRVFGIGSEKKLRIAVEKVREFAKKLVR-EKQRELNEKSSL  274

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+SK+P  E+ ++K++
Sbjct  275   DSADLLSRFLSTGHSDEDFVVDIVISFILAGRDTTSAALTWFFWLISKNPEAESEILKEI  334

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                ++   + +D ++ M Y  A LCESMR YPPV  DSK A  DDVLPDGT + +G RVT
Sbjct  335   GEKEEDVLMRYDEVKNMMYTHASLCESMRFYPPVPMDSKEAVKDDVLPDGTFVKKGMRVT  394

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR E +WG DW EFKP+RW ++    G    +    F +PVFQAGPRVCLGKEM
Sbjct  395   YHPYAMGRSEEIWGEDWAEFKPERWLNKDEMTGNWMFVGKDAFTYPVFQAGPRVCLGKEM  454

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +L+RF++ PV E   +P+F+  LT  M  G  V +  R
Sbjct  455   AFLQMKRVVAGVLQRFKVVPVAEKGVEPMFISYLTAKMKGGFPVTIEER  503



>ref|XP_002282477.2| PREDICTED: cytochrome P450 94A1-like [Vitis vinifera]
 emb|CBI17962.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   426 bits (1094),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 224/466 (48%), Positives = 309/466 (66%), Gaps = 12/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YPIIG  L    N    + W + L+ +SP+ T+V+HR    R V+T +  NV+++LK +F
Sbjct  98    YPIIGSSLEILANLNRRIQWTSDLIRASPSATVVIHRFLGTRVVLTGNPSNVQHILKTHF  157

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+ KG+     L DFLG GIFN DGD W  QR+++SHEF  +SLR+ +   ++ E+  R
Sbjct  158   HNYHKGQTFAINLSDFLGGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDR  217

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  AA N+S+LD QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF+ A+ 
Sbjct  218   LIPILSMAAANNSILDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV-AFEDAAR  276

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             IS+ R  +    VW+ KR   VGSEK+L+  +  V +  + IIR +K+E  +  +  + +
Sbjct  277   ISSERFSSIRPTVWRLKRLMGVGSEKRLKLAVGEVREFAKNIIREKKEELKHKSSLDS-T  335

Query  829   DFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSS  653
             D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLL K+P++E  ++ ++  +
Sbjct  336   DLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWFFWLLFKNPDVEDQILNEI--N  393

Query  652   DDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSP  473
             +  +   FD +++M Y  A LCESMR YPPV  DSK A +DDVLPDGT + +G RVT+ P
Sbjct  394   EKSELPVFDEVKDMIYTHASLCESMRFYPPVPADSKEAVSDDVLPDGTVVRKGMRVTYHP  453

Query  472   YAMGRMENLWGNDWLEFKPDRWFD---EQGKLKMIS--PFKFPVFQAGPRVCLGKEMAFI  308
             YAMGR+E LWG+DW EF+P+RW     + GK   ++  P+ +PVFQAGPR+CLGKEMAF+
Sbjct  454   YAMGRLEELWGSDWPEFRPERWLQRDPDTGKWSFVARDPYTYPVFQAGPRICLGKEMAFL  513

Query  307   QMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             QMK VVA +LRRF++ PV E   +PVF   LT  M  G  VR+  R
Sbjct  514   QMKRVVAGVLRRFQVVPVVEDGGEPVFTADLTAKMKGGFPVRIVER  559



>ref|XP_011026019.1| PREDICTED: cytochrome P450 94A1-like [Populus euphratica]
Length=507

 Score =   423 bits (1088),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 217/471 (46%), Positives = 301/471 (64%), Gaps = 16/471 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP+IG  ++ + NR  ++ W + L+ +SPT T+V+ R      V+T +  NV++MLK  
Sbjct  39    SYPLIGSSVAIFANRNRVIQWTSDLIQNSPTATVVLRRCLDDSRVLTGNPANVQHMLKTQ  98

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+ KG    + L DFLG GIFN+DGD W  QR+++SHEF  +SL + V   ++ E+  
Sbjct  99    FYNYEKGSKARRTLFDFLGNGIFNIDGDSWKFQRQVSSHEFNTKSLCKFVETVVDTELSQ  158

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L  AA N++VLDLQD+L+RFAFD ICKI            D         FD+A+
Sbjct  159   RLIPILSTAAANNTVLDLQDILQRFAFDNICKI-AFGYDPAYLLPDLPETEFAKTFDEAA  217

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
             +IS+ R       +WK KR FN+GSEK L+E    + +    II+ +KQE +N  ++   
Sbjct  218   KISSDRFATLFPFLWKIKRVFNIGSEKSLKEASSALREFARNIIKEKKQELSNK-SSLET  276

Query  832   SDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
              D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLLS++P +E  +++++  
Sbjct  277   VDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWYFWLLSQNPEVEKEILREI--  334

Query  655   SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFS  476
              D  ++  ++ +++M Y  A LCESMRLYPPV  D K A  DDVLPDGT + +G RV++ 
Sbjct  335   KDKSESPVYEEVKDMVYTHASLCESMRLYPPVPVDGKVAMQDDVLPDGTVVKKGMRVSYH  394

Query  475   PYAMGRMENLWGNDWLEFKPDRWF-------DEQGKLKMIS--PFKFPVFQAGPRVCLGK  323
             PYAMGR+E LWG DW +FKPDRW        +  GK   +   P+ +PVFQAGPR+CLGK
Sbjct  395   PYAMGRLEMLWGPDWEKFKPDRWLKSASDGVNNNGKWSFVGKDPYSYPVFQAGPRICLGK  454

Query  322   EMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             +MAF+QMK +VA I+RRF++ P  E   +PVFV  LT  M  G  VR   R
Sbjct  455   DMAFLQMKRLVAGIVRRFKVVPAAEEGFEPVFVAYLTSKMQGGFPVRFEER  505



>ref|XP_002282468.1| PREDICTED: cytochrome P450 94A1 [Vitis vinifera]
 emb|CBI17961.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   423 bits (1088),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 222/466 (48%), Positives = 305/466 (65%), Gaps = 12/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YPIIG  L    N    + W + L+ +SP+ T+V+HR    R V+T +  NV+++LK +F
Sbjct  40    YPIIGSSLEILANLNRRVQWTSDLIRASPSATVVIHRCLGTRVVLTGNPSNVQHILKTHF  99

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+ KG+    IL DFLG GIFN DGD W  QR+++SHEF  +SLR+ +   ++ E+  R
Sbjct  100   HNYHKGQFFRIILSDFLGGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDR  159

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  AA N+SVLD QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF+ A+ 
Sbjct  160   LIPILSTAAANNSVLDFQDILQRFAFDNICKIAFGYDPDYLLPSLPQAKFAV-AFEDAAR  218

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             IS+ R    +  VWK KR   VGSEK+L+  +  V +  + I+R +K+E  +  +  + +
Sbjct  219   ISSERFTLILPIVWKLKRLMGVGSEKRLKLAVAEVREFAKNIVREKKEELKHKSSLDS-T  277

Query  829   DFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSS  653
             D LSR L +GH DE  + D+VISF++AGRDTTS+ALTWFFWLL KHP++E  ++ ++  +
Sbjct  278   DLLSRFLSSGHSDEDFITDIVISFILAGRDTTSAALTWFFWLLFKHPDVEDQILNEI--N  335

Query  652   DDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSP  473
             +  +   FD +++M Y  A LCESMR YPPV  DSK   +DDVLPDGT + +G RVT+ P
Sbjct  336   EKSELPVFDEVKDMVYTHASLCESMRFYPPVPVDSKEVVSDDVLPDGTVVKKGMRVTYHP  395

Query  472   YAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQAGPRVCLGKEMAFI  308
             YAMGR+E LWG+DW EF+P+RW       E+       P+ +PVFQAGPR+CLGKEMAF+
Sbjct  396   YAMGRLEELWGSDWPEFRPERWLQRDPDTEKWSFVARDPYTYPVFQAGPRICLGKEMAFL  455

Query  307   QMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             QMK VVA +LRRF++ PV E   +PV+   L   M  G  VR+  R
Sbjct  456   QMKRVVAGVLRRFQVVPVVEDGGEPVYTADLAAKMKGGFLVRIVER  501



>ref|XP_010111213.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXC30691.1| Cytochrome P450 94A1 [Morus notabilis]
Length=508

 Score =   423 bits (1088),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 230/486 (47%), Positives = 305/486 (63%), Gaps = 18/486 (4%)
 Frame = -1

Query  1597  FHTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTV  1418
             FH    KK I      YPI+G L  F  NR+ LLDW T++L+ +PT T V  RLG  R V
Sbjct  23    FHRSPKKKHINTGFKIYPIVGMLPGFLSNRHRLLDWLTEVLSQTPTNTAVARRLGNVRGV  82

Query  1417  VTASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARS  1238
              TA+  NVEYMLK NF N+PKG+    +LG+FLG+GIFN DG++W  QRK AS+EF  +S
Sbjct  83    TTANPLNVEYMLKTNFENYPKGDGFVSVLGNFLGQGIFNSDGEIWKVQRKTASYEFNTKS  142

Query  1237  LRELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsd---pgcl  1067
             LR  VM+ +  E+  RL P L  A     VLD+QDVL RFAFD ICK++   D       
Sbjct  143   LRNFVMENVVVEIKTRLVPGLNKAVETGQVLDIQDVLERFAFDNICKLAFNVDPCCLAGD  202

Query  1066  sssdssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEE  887
                 +     + AF++A+ +S+ R       +WK KR FNVGSEK+LRE I  VH   +E
Sbjct  203   GFFGNDTGEFMKAFEEAATLSSGRFRYAFPYLWKIKRFFNVGSEKRLRECIATVHQFADE  262

Query  886   IIRVRKQEKANNIAAGAGSDFLSRLLDAGHKD--EVVRDMVISFLVAGRDTTSSALTWFF  713
             II  R + K  N       D LSR + A H    E +RD++ISF++AGRDTTSSALTWFF
Sbjct  263   IILRRMENKEENTE----EDLLSRFM-ACHNGSPEFLRDIIISFILAGRDTTSSALTWFF  317

Query  712   WLLSKHPNIETTVIKQVLS------SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWD  551
             W+LS  P+IE  ++ ++ +       D  +T NF+ LR+M+Y+ A + ESMRLYPPV  D
Sbjct  318   WILSSRPDIEEKILNELETIRTRNGKDIGETYNFNELRDMHYLHAAISESMRLYPPVPAD  377

Query  550   SKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISP  371
             +K   NDDV+PDGT + +   VT+  YAMGRMEN+WG + LEF P+RW  E G  +  SP
Sbjct  378   TKVCRNDDVMPDGTFVGKDWFVTYHTYAMGRMENIWGKNCLEFVPERWL-ENGICRQESP  436

Query  370   FKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLY  194
             F+FP+F AGPR+CLGK+MA+IQMK + A+++ +F I    + + P +V  LT  M  GL 
Sbjct  437   FRFPIFHAGPRMCLGKDMAYIQMKSIAATVIEKFHIEVQDKGKTPDYVLSLTLRMRGGLL  496

Query  193   VRVHMR  176
             +RV  R
Sbjct  497   LRVRER  502



>emb|CAN75729.1| hypothetical protein VITISV_031409 [Vitis vinifera]
Length=506

 Score =   422 bits (1085),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 222/466 (48%), Positives = 307/466 (66%), Gaps = 12/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YPIIG  L    N    + W + L+ +SP+ T+V+HR    R V+T +  NV+++LK +F
Sbjct  41    YPIIGSSLEILANLNRRVQWTSDLIRASPSATVVIHRCLGTRVVLTGNPSNVQHILKTHF  100

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+ KG+    IL DFLG GIFN DGD W  QR+++SHEF  +SLR+ +   ++ E+  R
Sbjct  101   HNYHKGQFFRIILSDFLGGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDR  160

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  AA N+SVLD QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF+ A+ 
Sbjct  161   LIPILSTAAANNSVLDFQDILQRFAFDNICKIAFGYDPDXLLPSLPQAKFAV-AFEDAAR  219

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             IS+ R    +  VWK KR   VGSEK+L+  +  V +  + I+R +K+E  +  +  + +
Sbjct  220   ISSERFTLILPIVWKLKRLMGVGSEKRLKLAVAEVREFAKNIVREKKEELKHKSSLDS-T  278

Query  829   DFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSS  653
             D LSR L +GH DE  + D+VISF++AGRDTTS+ALTWFFWLL KHP++E  ++ ++  +
Sbjct  279   DLLSRFLSSGHSDEDFITDIVISFILAGRDTTSAALTWFFWLLFKHPDVEDQILNEI--N  336

Query  652   DDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSP  473
             +  +   FD +++M Y  A LCESMR YPPV  DSK   +DDVLPDGT + +G RVT+ P
Sbjct  337   EKSELPVFDEVKDMVYTHASLCESMRFYPPVPVDSKEVVSDDVLPDGTVVKKGMRVTYHP  396

Query  472   YAMGRMENLWGNDWLEFKPDRWFD---EQGKLKMIS--PFKFPVFQAGPRVCLGKEMAFI  308
             YAMGR+E LWG+DW EF+P+RW     +  K   ++  P+ +PVFQAGPR+CLGKEMAF+
Sbjct  397   YAMGRLEELWGSDWPEFRPERWLQRDPDTXKWSFVARDPYTYPVFQAGPRICLGKEMAFL  456

Query  307   QMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             QMK VVA +LRRF++ PV E   +PV+   L   M  G  VR+  R
Sbjct  457   QMKRVVAGVLRRFQVVPVVEDGGEPVYTADLAAKMKGGFLVRIVER  502



>ref|XP_004242690.1| PREDICTED: cytochrome P450 94A1-like [Solanum lycopersicum]
Length=502

 Score =   421 bits (1083),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 303/469 (65%), Gaps = 13/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   + W + ++ S+P  T  + R     T++TA+  NV+++LK
Sbjct  38    PKSYPIIGSYFSLLANQEQRIQWLSDIILSTPKLTFTLIRPLNFHTIITANPSNVQHILK  97

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  + KG+  N  L DFL  GIFNVDGD+W  QR++ASHEF  RSLR+ V   ++ EV
Sbjct  98    TNFSVYQKGQNSNNTLADFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVESVVDVEV  157

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA   +V+DLQDVL+RFAFD ICKI+ G DP  L  +   AE  V AF+ 
Sbjct  158   SERLVPILANAAAEKNVVDLQDVLQRFAFDNICKIAFGYDPKYLLPNLPEAEFAV-AFED  216

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
                +S+ R   P   +WK KRAF +GSEKKLR  +  V +  + I+R    EK N  ++ 
Sbjct  217   CVRLSSERFAVPFPLIWKMKRAFGIGSEKKLRIAVGEVREFAKRIVR----EKLNERSSL  272

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+SK+ ++E+ +++++
Sbjct  273   DSADLLSRFLSTGHSDEDFVVDIVISFILAGRDTTSAALTWFFWLISKNADVESEILREI  332

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                ++  ++ +D ++ M Y  A LCESMR YPPV  DSK    DDVLPDGT + +G RVT
Sbjct  333   GGKEEDVSMRYDEVKNMMYTHASLCESMRFYPPVPMDSKEVMKDDVLPDGTFVKKGMRVT  392

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR E +WG DW EFKP+RW ++    G    +   PF +PVFQAGPRVCLGKEM
Sbjct  393   YHPYAMGRSEEIWGKDWAEFKPERWLNKDEMTGNWMFVGKDPFAYPVFQAGPRVCLGKEM  452

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +L+RF++ PV E   +P+F+  LT  M  G  V +  R
Sbjct  453   AFLQMKRVVAGVLQRFKVVPVVEKGVEPMFISYLTAKMKGGFPVTIEER  501



>ref|XP_002278009.1| PREDICTED: cytochrome P450 94A1 [Vitis vinifera]
Length=500

 Score =   421 bits (1083),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 217/467 (46%), Positives = 310/467 (66%), Gaps = 13/467 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             +YP++G +  F KNR+  LDW T +L+  PT T  + R G    V+TA+  NVE+MLK N
Sbjct  33    AYPLLGSIPEFLKNRHRFLDWTTDVLSRCPTNTSTIRRPGGIHGVITANPLNVEHMLKTN  92

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+PKG     IL DFLGRGIFN D DLW  QRK AS+EF  +SLR  V +++  E   
Sbjct  93    FENYPKGPQFISILEDFLGRGIFNSDADLWKVQRKTASYEFNTKSLRNFVFESVTVETQT  152

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L+ AA    VLD+QD+L RFAFD +CK++   DP CL    ++    + AF+ A+
Sbjct  153   RLVPILKKAAETGRVLDVQDILERFAFDNVCKLAFNVDPACLGGDATAGGDFMRAFEDAA  212

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
              +S+ R M    ++WK ++ FN+  EK+L++ I +VH+  E+II+ R ++KA N      
Sbjct  213   TLSSGRFMYAFQSIWKMEKFFNMRKEKRLKKSIAIVHEFAEKIIQSRLEQKAEN----KD  268

Query  832   SDFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
              D LSR + +  +  E +RD+VISF++AGRDTTSSALTWFFWLLS +P +ET ++K++ +
Sbjct  269   QDLLSRFVGNYDNSPEFLRDIVISFILAGRDTTSSALTWFFWLLSLNPEVETNILKELET  328

Query  655   SDDQK------TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
                +       T NFD LRE++Y+ A + E+MRLYPPV  D+K+  NDDVLPDGT + +G
Sbjct  329   VRARNGKSIGDTYNFDELRELHYLHAAISETMRLYPPVPVDTKYCLNDDVLPDGTFVGKG  388

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
               +T+ PY+MGR+E++WG D L+FKP+RW  E G  +  +PF++P+F AGPR+CLGK+MA
Sbjct  389   WFMTYIPYSMGRIESIWGKDCLQFKPERWL-ENGVYRQENPFRYPIFHAGPRMCLGKDMA  447

Query  313   FIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
             +IQMK + AS++ +FE++   + + P     LT  M  GL VRV  R
Sbjct  448   YIQMKSIAASVMEQFEVKVEEKDKCPEHYLSLTLRMTGGLEVRVKER  494



>ref|XP_002322606.2| hypothetical protein POPTR_0016s03160g [Populus trichocarpa]
 gb|EEF04367.2| hypothetical protein POPTR_0016s03160g [Populus trichocarpa]
Length=499

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 225/466 (48%), Positives = 306/466 (66%), Gaps = 13/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YPI+G L  F +NR+  L+W T+ L+  PT T V HR G    ++TA+  NVEY+LK NF
Sbjct  39    YPIVGALPEFLRNRHRFLEWTTETLSHCPTNTAVFHRPGKVHGIITANPLNVEYILKTNF  98

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKG+    +L DFLGRGIFN DG+LW  QRK AS+EF  +SLR  VM+ +E E+  R
Sbjct  99    ENYPKGDRFINLLEDFLGRGIFNSDGELWRVQRKTASYEFNTKSLRNFVMENVEVEISTR  158

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  A++   VLDLQD+L RFAFD ICK++   DP CL    +S    + AF+ A+ 
Sbjct  159   LVPILAKASKTKQVLDLQDILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAAT  218

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
              S+ R M  +   WK  R FNVG+EK LRE +K+VH+  +E+IR R + K          
Sbjct  219   FSSGRFMYVLPVFWKINRFFNVGTEKTLRESVKIVHEFADEMIRSRMELKTEK----NDE  274

Query  829   DFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ---V  662
             DFLSR +       E +RD+VISF++AGRDTTSSAL+WFFWLLS +P++E  ++K+   +
Sbjct  275   DFLSRFIGKDENSTEFLRDIVISFILAGRDTTSSALSWFFWLLSLNPDVEGNILKELETI  334

Query  661   LSSDDQK---TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
              SS+ +    T +F+ LR+M+Y++A + E++RLYPPV  D+K   +DDVLPDGT + +  
Sbjct  335   RSSNGKNLGDTYSFEELRDMHYLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKNW  394

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
              VT+  YAMGRME++WG +  +F P+RW  E G  +  SPFKFPVF AGPR+CLGK+MA+
Sbjct  395   FVTYHAYAMGRMESIWGKNCRDFVPERWL-ENGIYRQESPFKFPVFHAGPRMCLGKDMAY  453

Query  310   IQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             IQMK + AS++ RFEI     E  P  +  LT  M  GL V+V  R
Sbjct  454   IQMKSIAASVIERFEIDVQNKEKCPDHLLSLTLRMKGGLQVKVKER  499



>ref|XP_011041380.1| PREDICTED: cytochrome P450 94A1-like [Populus euphratica]
Length=499

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 225/466 (48%), Positives = 305/466 (65%), Gaps = 13/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YPI+G L  F +NR+  L+W T+ L+  PT T V HR G    ++TA+  NVEY+LK NF
Sbjct  39    YPIVGALPEFIRNRHRFLEWTTETLSHCPTNTAVFHRPGKVHGIITANPLNVEYILKTNF  98

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKG+    +L DFLGRGIFN DG+LW  QRK AS+EF  +SLR  VM  +E E+  R
Sbjct  99    ENYPKGDRFINLLEDFLGRGIFNSDGELWRVQRKTASYEFNTKSLRNFVMDNVEVEISTR  158

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  A++   VLDLQD+L RFAFD ICK++   DP CL    +S    + AF+ AS 
Sbjct  159   LVPILAQASKTKQVLDLQDILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAST  218

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M  +   WK  R FNVG+EK LRE +K+VH+  +E+IR R ++    I      
Sbjct  219   LSSGRFMYVLPVFWKINRFFNVGTEKTLRESVKIVHEFADEMIRSRMEQ----ITEKNDE  274

Query  829   DFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ---V  662
             D LSR +       E +RD+VISF++AGRDTTSSAL+WFFWLLS +P +E  ++K+   +
Sbjct  275   DLLSRFIGKDENSTEFLRDIVISFILAGRDTTSSALSWFFWLLSLNPAVEGNILKELETI  334

Query  661   LSSDDQK---TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
              SS+ +    T +F+ LR+M+Y++A + E++RLYPPV  D+K   +DDVLPDGT + +  
Sbjct  335   RSSNGKNLGDTYSFEELRDMHYLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKKW  394

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
              VT+  YAMGRME++WG +  +F P+RW  E G  +  SPFKFPVF AGPR+CLGK+MA+
Sbjct  395   FVTYHAYAMGRMESIWGKNCRDFVPERWL-ENGIYRQESPFKFPVFHAGPRMCLGKDMAY  453

Query  310   IQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             IQMK + AS++ RFEI     E  P  +  LT  M  GL V+V  R
Sbjct  454   IQMKSIAASVIERFEIDVQNKEKCPEHLLSLTLRMKGGLQVKVKER  499



>ref|XP_008235727.1| PREDICTED: cytochrome P450 94A1-like [Prunus mume]
Length=509

 Score =   421 bits (1082),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 229/475 (48%), Positives = 309/475 (65%), Gaps = 19/475 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG  ++ YKN    L W+T LL SSP+ T  +H       VVTA+   V+++LK
Sbjct  39    PKSYPIIGSFITLYKNHERRLPWFTDLLRSSPSNTFTLHHSLGKHFVVTANPTVVQHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  + KG      L D LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  99    TQFPIYEKGNTFRTTLTDLLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A A N+S+LD QD+L+RFAFD IC+I+ G DP  L  S   A+  V AFD+
Sbjct  159   SDRLIPILSAPATNNSILDFQDILQRFAFDNICRIAFGYDPAYLLPSLPEAKFAV-AFDE  217

Query  1018  ASEISAR--RGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             A +IS+   R + P   VWK KR   +GSEK LR  +  V +  + I+R +K+E +   A
Sbjct  218   AVQISSDRFRSLPP---VWKLKRVLGIGSEKHLRAAVSEVREFAKTIVREKKRELSETKA  274

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               +  D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++P++E  ++K
Sbjct  275   LES-VDLLSRFLGSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNPHVENEILK  333

Query  667   QVLSSDDQKTL--NFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             ++  + + ++    +D ++EM Y  A LCESMRLYPPVA DSK A  DDVLPDGT + +G
Sbjct  334   EISGTAEPESAAGGYDEVKEMVYTHAALCESMRLYPPVAVDSKQAMKDDVLPDGTKVKKG  393

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG--KLKMIS--PFKFPVFQAGPRVC  332
               VT+  YAMGRME +WG DW +++P+RW   +E G  K K +    F +PVFQAGPR+C
Sbjct  394   MTVTYHVYAMGRMEEIWGEDWAQYRPERWLEREENGAHKWKFVGRDSFSYPVFQAGPRIC  453

Query  331   LGKEMAFIQMKFVVASILRRFEIRPV---CESQPVFVPLLTGYMAKGLYVRVHMR  176
             LGKEMAF+QMK VV+++L+RF++ PV     +QP FV  LTG M  G  V +  R
Sbjct  454   LGKEMAFLQMKRVVSAVLKRFKVVPVEREGGAQPEFVAYLTGKMKGGFPVTIVER  508



>gb|AAL54885.1|AF092914_1 cytochrome P450-dependent fatty acid hydroxylase [Vicia sativa]
Length=512

 Score =   421 bits (1081),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/469 (46%), Positives = 297/469 (63%), Gaps = 12/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPI G + S   N +  + W + +L ++P+ T ++HR    R V TA+   V+++LK
Sbjct  43    PKSYPIFGSIFSIAANFHRRVQWISDILQTTPSSTFILHRAFGSRQVFTANPLVVQHILK  102

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF  +PKG  +N+ LGDFLG GIFN DG+ W  QR+++SHEF A+SLR+ V   ++ E+
Sbjct  103   TNFPCYPKGLTLNRSLGDFLGNGIFNADGETWKLQRQISSHEFNAKSLRKFVETVVDVEL  162

Query  1198  DGRLSPLLEAAARNSSVL-DLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
              GRL P+L  A++   +L D QD+L+RF FD IC I                 +   AFD
Sbjct  163   SGRLLPILSEASKTEKILPDFQDILQRFTFDNIC-IIAFGFDPEYLLPSLPETAFAKAFD  221

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
               + IS+ R  A V  +WK K+  N+G+E++L+E +  V      I+R +KQE     +A
Sbjct  222   YGTRISSLRFNAAVPLIWKVKKILNIGTEQRLKEAVAEVRGLASRIVREKKQELLEK-SA  280

Query  841   GAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLSKH ++ET ++K+
Sbjct  281   LESLDILSRFLSSGHSDESFVIDIVISFILAGRDTTSAALTWFFWLLSKHSHVETEILKE  340

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             V +  +  ++++D +++M Y  A LCESMRLYPPV  D+K  A DDVLPDGT + +G RV
Sbjct  341   VTAKSE--SVSYDEVKDMVYTHAALCESMRLYPPVPVDTKEVAYDDVLPDGTFVKKGWRV  398

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWF--DEQGKLKMIS--PFKFPVFQAGPRVCLGKEM  317
              +  YAMGR E +WG+DW EF+P+RW   DE G    +   P+ +PVFQAGPRVCLGKEM
Sbjct  399   AYHIYAMGRSEKIWGSDWAEFRPERWLRRDEDGMWSFVGMDPYAYPVFQAGPRVCLGKEM  458

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK V A +LR F + P  E+  +P +   LT  M  G  VR+  R
Sbjct  459   AFLQMKRVAAGVLREFRVVPAMENGIEPEYTAHLTALMKGGFPVRIEKR  507



>ref|XP_004170788.1| PREDICTED: cytochrome P450 94A2-like [Cucumis sativus]
 gb|KGN44126.1| hypothetical protein Csa_7G198310 [Cucumis sativus]
Length=510

 Score =   420 bits (1080),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 217/481 (45%), Positives = 296/481 (62%), Gaps = 19/481 (4%)
 Frame = -1

Query  1564  YTPP-----SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             +TPP     SYPI+G   + + NR+  L W + +L  SP  T  +HRL   R   TA+  
Sbjct  31    FTPPIKLPKSYPIVGSFFALFANRHRRLQWLSDVLQISPAATFTLHRLFGQRQFFTANPA  90

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
              V+++LK  F  + KG+    I  DFLG GIFN DG+ W  QR+++SHEFT +SLR+ V 
Sbjct  91    VVQHILKTKFHIYQKGDSFRSIFTDFLGDGIFNADGESWKFQRQVSSHEFTTKSLRKFVE  150

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
               ++ E+  RL P+L  AA +  VLDLQDVL+RFAFD +CKI          S       
Sbjct  151   TVVDAELSDRLVPILHTAASSCCVLDLQDVLQRFAFDNVCKI-AFGYDPAYLSPSFVQSK  209

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEK  860
                AF++A  IS+ R  + +  VWK K+  N+GSEK+LR  +  V  +  +II  +K E 
Sbjct  210   FAKAFEEAVRISSLRIQSLIPNVWKLKKFLNIGSEKQLRIAVAEVRGYANKIINDKKAEL  269

Query  859   ANNIAAGAGSDFLSRLLDAGHKDEVVR-DMVISFLVAGRDTTSSALTWFFWLLSKHPNIE  683
               N +  A  D LSR L +GH +     D++ISF++AG+DTTS+ALTW FWLL+KHP +E
Sbjct  270   KANSSIDA-VDLLSRFLTSGHSNHNFNIDIIISFILAGQDTTSAALTWLFWLLAKHPQVE  328

Query  682   TTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             T + +++ S   +    +D ++++ Y  A LCESMRLYPPV  D K AA DDVLPDGT +
Sbjct  329   TRIFEEI-SQKSEHLFGYDEVKDLVYTHAALCESMRLYPPVPVDGKQAAADDVLPDGTVV  387

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKM----ISPFKFPVFQA  347
              +G RV + PYAMGRME +WG DW EF+P+RW     DE G +K        + +PVFQA
Sbjct  388   RKGERVAYHPYAMGRMEGIWGKDWAEFRPERWLESGGDEAGAVKWRFVGRDNYTYPVFQA  447

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMRE  173
             GPR+CLGKEMAF+QMK +VA I++RF + P  E   +P FV  +T  M  G  VR+ +RE
Sbjct  448   GPRICLGKEMAFMQMKRIVAGIVKRFRVVPAAEEGVEPRFVQYMTAKMEGGFPVRIKVRE  507

Query  172   G  170
             G
Sbjct  508   G  508



>ref|XP_010247228.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=530

 Score =   421 bits (1081),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 225/466 (48%), Positives = 309/466 (66%), Gaps = 12/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP  G L  F+KNR   ++W T +LAS+PT T V HR    R ++TA+  NV++MLKNNF
Sbjct  68    YPFFGSLPEFFKNRNRFVEWVTDILASNPTNTAVYHRPVNIRGIMTANPLNVQHMLKNNF  127

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKGE     L DFLGRGIFNVDG LW  QRK AS EF+ +SLR  VM  + EE   R
Sbjct  128   DNYPKGELFTSHLEDFLGRGIFNVDGHLWKVQRKTASSEFSTKSLRNFVMDIVNEETLSR  187

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L PLL  A+    V+D+QD++ RFAFD +CK++   DPGCL   +++    + AF+ A+ 
Sbjct  188   LVPLLRKASGQKIVVDMQDIMERFAFDHVCKLAFNVDPGCLGGDNTAGAEFMKAFNDAAT  247

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +SA R +  +  +WK KRA N+GSE++LR  I  VHD  ++IIR R QEK          
Sbjct  248   LSAGRFLYFLPYLWKMKRALNIGSEERLRSAISTVHDFADKIIRSRMQEKEEK---QNDE  304

Query  829   DFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---IKQV  662
             D LSR + +  +  E +RD++I+F++AGRDTTS+ L+WFFWLLS  P +E  +   +K +
Sbjct  305   DLLSRFIANESNSPEFLRDIIINFILAGRDTTSTTLSWFFWLLSNRPEVERKILDELKLI  364

Query  661   LSSDDQK---TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
              +S+ +K   T +F+ LREM Y++A L E++RLYPPVA D+K    DDV+PDGT + +G 
Sbjct  365   RASNGKKIDDTYSFNELREMQYLQAALSEALRLYPPVALDTKVCRKDDVMPDGTFVGKGW  424

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
              VT+  YAMGRME++WG D LEFKP+RW  E G  +  SPF+FP F AGPR+CLGK+MA+
Sbjct  425   FVTYHAYAMGRMESIWGKDCLEFKPERWL-ENGVCRRESPFRFPAFHAGPRICLGKDMAY  483

Query  310   IQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
             I MK + AS+++RF++  V + + P  V  LT  M +GL +RV  R
Sbjct  484   ILMKSITASVIQRFQMEVVDKDKCPELVVSLTLRMKEGLPMRVKER  529



>ref|XP_007199792.1| hypothetical protein PRUPE_ppa004444mg [Prunus persica]
 gb|EMJ00991.1| hypothetical protein PRUPE_ppa004444mg [Prunus persica]
Length=509

 Score =   420 bits (1079),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 227/473 (48%), Positives = 308/473 (65%), Gaps = 15/473 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG  ++  KN    L W+T LL SSP+ T  +H       VVTA+   V+++LK
Sbjct  39    PKSYPIIGSFITLSKNHERRLPWFTDLLRSSPSNTFTLHHSLGKHFVVTANPTVVQHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F  + KG      L D LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  99    THFPIYEKGNTFRTTLTDLLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDAEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L ++A ++S+LD QD+L+RFAFD I +I+ G DP  L  S   A+  V AFD 
Sbjct  159   SDRLIPILSSSATSNSILDFQDILQRFAFDNISRIAFGYDPAYLLPSLPEAKFAV-AFDD  217

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS+ R  + +  VWK KR   +GSEK+LR  +  V +    I+R +K+E  N   A 
Sbjct  218   AVQISSDR-FSSLPPVWKLKRVLGIGSEKRLRAAVSEVREFANTIVREKKRE-LNETKAL  275

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++P++E  ++K++
Sbjct  276   ESVDLLSRFLGSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNPHVEDEILKEI  335

Query  661   LSSDDQKTL--NFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
               + + ++    +D ++EM Y  A LCESMRLYPPVA DSK A  DDVLPDGT + +G  
Sbjct  336   SGTAELESAAGGYDEVKEMVYTHAALCESMRLYPPVAADSKQAMKDDVLPDGTKVKKGMT  395

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG--KLKMIS--PFKFPVFQAGPRVCLG  326
             VT+  YAMGRME +WG DW E++PDRW   +E G  K K +    F +PVFQAGPR+CLG
Sbjct  396   VTYHVYAMGRMEEIWGEDWAEYRPDRWLEREENGAHKWKFVGRDSFSYPVFQAGPRICLG  455

Query  325   KEMAFIQMKFVVASILRRFEIRPV---CESQPVFVPLLTGYMAKGLYVRVHMR  176
             KEMAF+QMK VV+++L+RF++ PV     +QP FVP +TG M  G  V +  R
Sbjct  456   KEMAFLQMKRVVSAVLKRFKVVPVEREGRAQPEFVPYITGKMKGGFPVTIVER  508



>ref|XP_010038019.1| PREDICTED: cytochrome P450 94A1-like [Eucalyptus grandis]
 gb|KCW49814.1| hypothetical protein EUGRSUZ_K03295 [Eucalyptus grandis]
Length=525

 Score =   420 bits (1080),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 221/473 (47%), Positives = 298/473 (63%), Gaps = 11/473 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YPI G   SF+ N    +DW   L+ +SP+ T V HR    R V T +  NV+++LK
Sbjct  53    PRVYPIFGSYFSFFPNIERRIDWTADLVRNSPSATYVFHRPLGNRHVFTGNPANVQHILK  112

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F N+ KG      L D LG GIFN DG+ W  QR++ASHEF  RSLR+ +   ++ E+
Sbjct  113   THFGNYEKGGVFKITLRDVLGDGIFNTDGESWKFQRQVASHEFNTRSLRKFIETVVDTEL  172

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdss-aeSLVDAFD  1022
               RL PLL +AA++ SV+D+QD+L+RFAFD ICKI+ G D   LS S         +AF+
Sbjct  173   KERLMPLLASAAKSGSVIDMQDILQRFAFDNICKIAFGYDAENLSPSLPQPKAKFAEAFE  232

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE-KANNIA  845
              A  IS+ R       +W+ KR FN+GSEK+LR  +  + +  ++I+R +K+E    +  
Sbjct  233   DAVRISSGRFQEFFSVIWRIKRFFNLGSEKRLRVAVSEIREFAKKIVREKKRELSEKSPP  292

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               A  D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLL K+P +E  V  
Sbjct  293   ESAADDLLSRFLSSGHSDENFVTDIVISFILAGRDTTSAALTWYFWLLHKNPEVEAKVRG  352

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             +++   D     ++ ++EM Y  A LCESMR YPPV  D+K A +DDVL DGT + +G R
Sbjct  353   EIMEKSDGHVARYNDVKEMVYTHASLCESMRFYPPVPVDTKEAISDDVLEDGTVVKKGMR  412

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQGKLKMI----SPFKFPVFQAGPRVCLG  326
             V + PYAMGR+E LWG DW EFKP+RW    E G  K +      F++PVFQAGPRVCLG
Sbjct  413   VAYHPYAMGRLEQLWGKDWPEFKPERWLRAAEDGSEKWVFVNRDAFEYPVFQAGPRVCLG  472

Query  325   KEMAFIQMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMRE  173
             KEMAF+QMK VVA +LR+F + P  E   +PVF   L+  M  G  VR+ +R+
Sbjct  473   KEMAFLQMKRVVAEVLRQFRVVPAAEEGEEPVFTAYLSSKMKGGFPVRIEVRK  525



>emb|CDP03714.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   419 bits (1078),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 224/469 (48%), Positives = 309/469 (66%), Gaps = 12/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   S   N+   + W + ++ SSP  T  +HR    R V+TA+   V+++LK
Sbjct  42    PRSYPLIGSYFSILANKERRVQWTSDIVRSSPNFTFTLHRPLGHRLVLTANPSTVQHILK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             ++F  + KG+     L DFLG GIFN DG  W  QR+++SHEF  RSLR+ V   ++ E+
Sbjct  102   SHFHVYGKGDVFRTTLSDFLGEGIFNTDGANWKFQRQVSSHEFNTRSLRKFVETVVDTEL  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L AAA N +VLD QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF+ 
Sbjct  162   SERLVPILAAAADNKTVLDFQDILQRFAFDNICKIAFGYDPAYLLPSLPEAKFAV-AFED  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ IS+ R  + V  +WK KRA NVGSE+KL+E +  V +  ++II+ +K E     +  
Sbjct  221   ATRISSERFNSLVPLIWKVKRALNVGSERKLKEAVDQVREFAKQIIKEKKAELEEKSSID  280

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             +  D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWL+  +PN+E  +++++
Sbjct  281   S-VDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWFFWLVFGNPNVEKKIVEEI  339

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                +  ++  +D +++M Y  A LCESMRLYPPV  D+K A  DDVLPDGT + +G RVT
Sbjct  340   --KEKSESPEYDEVKDMVYTHASLCESMRLYPPVPTDTKEATEDDVLPDGTVVRKGTRVT  397

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E +WG+DW EFKP+RW + +   GK   +    + +PVFQAGPR+CLGKEM
Sbjct  398   YHPYAMGRIEEVWGSDWAEFKPERWLEREGLSGKWNFVGKDSYTYPVFQAGPRICLGKEM  457

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +LRRF++ P  E   +PVF+  LT  M  G  VR+  R
Sbjct  458   AFLQMKRVVAGVLRRFKVVPAIEEGVEPVFMAYLTSKMKGGFPVRIFER  506



>ref|XP_006373690.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP51487.1| cytochrome P450 family protein [Populus trichocarpa]
Length=499

 Score =   419 bits (1077),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 222/466 (48%), Positives = 306/466 (66%), Gaps = 14/466 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YPI+G +  F +NR+  L+W T+ L+  PT T V  R G    ++TA+  NVEY+LK NF
Sbjct  40    YPIVGAIPEFLRNRHRFLEWTTETLSHCPTNTAVFPRPGKVHGIITANPLNVEYILKTNF  99

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKG    ++LGDFLGRGIFN DG+LW  QRK AS+EF  +SLR  VM  +E E+  R
Sbjct  100   ENYPKGNRFIKLLGDFLGRGIFNSDGELWRVQRKTASYEFNTKSLRNFVMDNVEVEISTR  159

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  A++   VLDLQD+L RFAFD ICK++   DP CL    +S    + AF+ A+ 
Sbjct  160   LVPILAKASKTKQVLDLQDILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAAT  219

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             + + R M+     WK  R FNVG+EK LRE +K+VH+  +E+IR R ++K          
Sbjct  220   LCSGRFMSVHRVFWKINRFFNVGTEKTLRESVKIVHEFADEMIRSRMEQKTEK-----NE  274

Query  829   DFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ---V  662
             DFLSR +       E +RD++ISF++AGRDTTSSAL+WFFWLLS +P++E  ++K+   +
Sbjct  275   DFLSRFIGKDENSTEFLRDIIISFILAGRDTTSSALSWFFWLLSLNPDVEGNILKELETI  334

Query  661   LSSDDQK---TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
              SS+ +    T +F+ LR+M+Y++A + E++RLYPPV  D+K   +DDVLPDGT + +  
Sbjct  335   RSSNGKNLGDTYSFEELRDMHYLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKKW  394

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
              VT+  YAMGRME++WG +  +F P+RW  E G  +  SPFKFPVF AGPR+CLGK+MA+
Sbjct  395   FVTYHAYAMGRMESIWGKNCRDFVPERWL-ENGIYRQESPFKFPVFHAGPRMCLGKDMAY  453

Query  310   IQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             IQMK + AS++ RFEI     E  P  +  LT  M  GL V+V  R
Sbjct  454   IQMKSIAASVIERFEIDVQNKEKCPDHLLSLTLRMKGGLQVKVKER  499



>ref|XP_002264897.1| PREDICTED: cytochrome P450 94C1 [Vitis vinifera]
 emb|CAN76753.1| hypothetical protein VITISV_011074 [Vitis vinifera]
Length=504

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 225/450 (50%), Positives = 303/450 (67%), Gaps = 14/450 (3%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWYT LL  SP++TI VH LG    ++TA+ ENVEYMLK  F N+PKG+P + ILGD 
Sbjct  65    LSDWYTHLLRKSPSRTIHVHVLG---NIITANPENVEYMLKTRFDNYPKGKPFSAILGDL  121

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEA-AARNSSVL  1145
             LGRGIFNVDGD W  QRK+AS E  + S+R    + +  E+  RL PL+ + A R+ ++L
Sbjct  122   LGRGIFNVDGDSWKFQRKMASLELGSVSIRTFAFEIVTSEIKNRLIPLMSSIAGRSEAIL  181

Query  1144  DLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWK  965
             DLQDVLRRF+FD IC+ S G DPGCL  S   +E   +AFD AS++SA R M     +WK
Sbjct  182   DLQDVLRRFSFDNICRFSFGLDPGCLQLSLPMSE-FAEAFDLASKLSAERAMTASPLIWK  240

Query  964   CKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEV  785
              KR  N+GSE+KL+E IK+V +   E+I+ R+             D LSR + +   D+ 
Sbjct  241   MKRLLNIGSERKLKEAIKMVDELAHELIKQRR-----TAGFSTQRDLLSRFMCSVSDDQY  295

Query  784   VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV--LSSDDQKTLNFDHLREM  611
             +RD+VISFL+AGRDT +SALT FFWLLS+HP + + + ++   +    ++  +F+ +REM
Sbjct  296   LRDIVISFLLAGRDTVASALTSFFWLLSQHPEVVSAIREESDRIMGQTEEQASFEQMREM  355

Query  610   NYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDW  431
             +Y++A + ESMRL+PP+ +DSK +  +DVLPDGT + +G RVTF PYAMGRME  WG D 
Sbjct  356   HYLQASVYESMRLFPPIQFDSKFSLQEDVLPDGTFVRKGTRVTFHPYAMGRMEKAWGPDC  415

Query  430   LEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVC  251
             LEFKP+RW  + G+    +PFK+PVFQAGPRVCLGKEMA +QMK V  +++RRF+I+   
Sbjct  416   LEFKPERWL-KNGEFMAENPFKYPVFQAGPRVCLGKEMAVVQMKSVALALVRRFDIQDAV  474

Query  250   ESQPV-FVPLLTGYMAKGLYVRVHMREGYN  164
              S+   F P LT  +  G  VRVH R  + 
Sbjct  475   PSRAQRFAPGLTATVRGGFQVRVHERRQHQ  504



>ref|XP_011070085.1| PREDICTED: cytochrome P450 94A1 [Sesamum indicum]
Length=504

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 311/467 (67%), Gaps = 14/467 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G L  F +NR+  LDW T +L+  PT T V HR G    V+TA+ + VE+MLK+NF
Sbjct  39    YPLVGTLPDFLRNRHRFLDWSTGVLSGCPTNTAVFHRPGKVHGVITANPQIVEHMLKSNF  98

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKG     +L DFLG+GIFN DG+LW  QRK AS+EF  +SLR  VM+ +  E+  R
Sbjct  99    ENYPKGPRFRILLTDFLGKGIFNTDGELWRIQRKTASYEFNTKSLRNFVMENVYVELQTR  158

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+LE+AAR   VLD+QD+L RFAFD ICK++   DPGCL    ++    + AF+ A+ 
Sbjct  159   LIPILESAARTDRVLDVQDILERFAFDNICKVAFNVDPGCLGGDGTAGAEFMQAFEDAAT  218

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M  + +++  K+  N+GSEKKLR++I  VH+  ++IIR R +EKA         
Sbjct  219   LSSGRFMYALPSLFAIKKFLNLGSEKKLRKYIATVHEFADKIIRTRLEEKAEK----KDE  274

Query  829   DFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSS  653
             D LSR + ++ +  E +RD+VISF++AGRDTTSSAL+WFFWLLS  P++E  ++K++ + 
Sbjct  275   DLLSRFIANSENSAEFLRDIVISFILAGRDTTSSALSWFFWLLSSRPDVEERILKELENI  334

Query  652   DDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
               Q      +  +FD LREM+Y+ A + E+MRLYPPV  D+K    +D+LPDGT I +  
Sbjct  335   RRQNGKSIGEIYSFDELREMHYLHAAISEAMRLYPPVPVDTKACKENDILPDGTVIGKDW  394

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
              +++  +AMGRME++WG D  EFKP+RW  E G  K  SPFK+PVF AGPR+CLGK+MA+
Sbjct  395   FISYHTFAMGRMESIWGEDCCEFKPERWI-ENGICKQESPFKYPVFHAGPRMCLGKDMAY  453

Query  310   IQMKFVVASILRRFEIRPVCESQPVFVPL--LTGYMAKGLYVRVHMR  176
             IQMK + AS+L RF +  + E+     PL  LT  M  GL VRV  R
Sbjct  454   IQMKSIAASVLERFGMDVLLENGNPPEPLLSLTLRMKGGLPVRVKER  500



>emb|CDP03713.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   418 bits (1074),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 223/472 (47%), Positives = 309/472 (65%), Gaps = 12/472 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   S   N    + W + ++ SSP  T  +HR    R V+TA+   V+++LK
Sbjct  41    PRSYPLIGSYFSILANNERRVQWTSDIVRSSPNLTFTLHRPLGHRMVLTANPSTVQHILK  100

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             ++F  + KG+     L DFLG GIFN DG  W  QR+++SHEF  RSLR+ V   ++ E+
Sbjct  101   SHFHVYGKGDVFRGTLSDFLGEGIFNTDGANWKFQRQVSSHEFNTRSLRKFVETVVDTEL  160

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L AAA N +VLD QD+L+RFAFD ICKI+ G DP  L  S   A   V AF+ 
Sbjct  161   SERLVPILAAAADNKTVLDFQDILQRFAFDNICKIAFGYDPAYLLPSLPEAAFAV-AFED  219

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  IS++R  +PV  +WK KRA NVGSE+KL+E +  V +  ++II+ +K E     +  
Sbjct  220   AMRISSQRFYSPVPLIWKVKRALNVGSERKLKEAVHQVREFAKQIIKEKKAELEEKSSID  279

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             +  D LSR L +G+ DE  + D+VISF++AGRDTTS+ALTW FWL+  +PN+E  +++++
Sbjct  280   S-VDLLSRFLSSGNYDEDFITDIVISFILAGRDTTSAALTWLFWLVFGNPNVEKKIVEEI  338

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                +  ++  +D +++M Y  A LCESMRLYPPV  D+K A  DDVLPDGT + +G RV 
Sbjct  339   --KEKSESPVYDEVKDMVYTHASLCESMRLYPPVPTDTKEATEDDVLPDGTVVRKGTRVA  396

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMIS-----PFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E++WG+DW EFKP+RW ++ G   M +      + +PVFQAGPR+CLGKEM
Sbjct  397   YHPYAMGRIEDVWGSDWAEFKPERWLEKDGLSGMWNFIGKDSYTYPVFQAGPRICLGKEM  456

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREGY  167
             AF+QMK VVA +LRRF++ P  E   +PVF+  LT  M  G  VR+  R GY
Sbjct  457   AFLQMKRVVAGVLRRFKVVPAIEEGVEPVFMAYLTSKMKGGFPVRIFERVGY  508



>ref|XP_011028759.1| PREDICTED: cytochrome P450 94A1-like [Populus euphratica]
Length=516

 Score =   418 bits (1074),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 216/475 (45%), Positives = 303/475 (64%), Gaps = 17/475 (4%)
 Frame = -1

Query  1561  TPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRT-VVTASAENVEYM  1385
              P SYP+IG  L+ + NR   + W + L+ +SPT T+V+HR     + ++T +  NV++M
Sbjct  37    APKSYPLIGSSLAIFANRSRRIQWISDLIQNSPTATVVLHRFFLDDSHILTGNPANVQHM  96

Query  1384  LKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEE  1205
             LK  F N+ KG    +IL DFLG GIFN++GD W  QR+++SHEF  +SLR+ V   ++ 
Sbjct  97    LKTQFHNYEKGNKTRRILFDFLGNGIFNINGDSWKFQRQVSSHEFNTKSLRKFVETVVDA  156

Query  1204  EVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAF  1025
             E+  RL P+L   A N++VLDLQD+L+RFAFD IC I            D         F
Sbjct  157   ELSQRLIPILSTFAANNTVLDLQDILQRFAFDNICNI-AFGYDPAYLLPDLPEAEFAKTF  215

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             D A  IS+RR  +    +WK K+  N+GSEK+L+E    +    + II+ +KQE +   +
Sbjct  216   DDAVNISSRRFNSVFPYLWKIKKFLNIGSEKRLKEASSQLRQFAKNIIKEKKQELSKK-S  274

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
             +    D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLLS++  +E  V++
Sbjct  275   SLESVDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWYFWLLSQNQEVEKEVLR  334

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             ++    +     ++ +++M Y  A LCESMRLYPPV  DSK A +DDVLPDGT + +G+R
Sbjct  335   EIKEKSESPV--YEEVKDMVYTHASLCESMRLYPPVPVDSKVAKHDDVLPDGTVVKKGSR  392

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFD-------EQGKLKMIS--PFKFPVFQAGPRV  335
             V + PYAMGR+E LWG+DW +FKP+RW +       + GK   +   P+ +PVFQAGPR+
Sbjct  393   VCYHPYAMGRLEVLWGSDWGKFKPERWLESAADGANKNGKWSFVGRDPYTYPVFQAGPRI  452

Query  334   CLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             CLGK+MAF+QMK +VA ILRRF++ PV E   +PVF+  LT  M  G  VR   R
Sbjct  453   CLGKDMAFLQMKRIVAGILRRFKVVPVAEDGFEPVFIADLTSKMKGGFPVRFEER  507



>ref|XP_009377719.1| PREDICTED: cytochrome P450 94A1-like isoform X1 [Pyrus x bretschneideri]
Length=503

 Score =   417 bits (1072),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 232/474 (49%), Positives = 312/474 (66%), Gaps = 16/474 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S YKN    L W+T LL +SP+ T  +H   + R VVTA+   V+++LK
Sbjct  32    PKSYPIIGTFPSLYKNHRRRLPWFTDLLRTSPSNTFTLHHSLSRRFVVTANPTVVQHILK  91

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+ KGE     L + LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  92    TNFPNYQKGETFRTTLAELLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  151

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A+A +SSVLD QD+L+RF FD IC+I+ G DP  L  S   A+  V AFD+
Sbjct  152   SNRLIPILSASAASSSVLDFQDILQRFGFDNICRIAFGYDPDYLLPSLPEAKFAV-AFDE  210

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS+ R   P   VWK KRA  +GSEK+LR  +  V +  + I+R +K++  +   A 
Sbjct  211   ALQISSDRFRLP-HPVWKLKRALGIGSEKRLRAVVSEVREFAKTIVREKKRD-LSEAKAL  268

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLS++P +E  +++++
Sbjct  269   ESVDLLSRFLSSGHTDEKFVTDIVISFILAGRDTTSAALTWFFWLLSQNPRVENEILREI  328

Query  661   ---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
                 SS+      +D ++EM Y  A LCESMRLYPPV  DSK  ANDDVLPDGT + +G 
Sbjct  329   NEAASSESAAGGGYDEVKEMVYTHAALCESMRLYPPVPTDSKQVANDDVLPDGTKVKKGM  388

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG--KLKMIS--PFKFPVFQAGPRVCL  329
              VT+  YAMGRME +WG DW E++P+RW   +E+G  K K +    + +PVFQAGPR+CL
Sbjct  389   TVTYHVYAMGRMEEIWGADWAEYRPERWLEREERGAHKWKFVGRDTYSYPVFQAGPRICL  448

Query  328   GKEMAFIQMKFVVASILRRFEIRP---VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF+QMK VV+++L+RF++ P      +QP  +P LT  M  GL V V  R
Sbjct  449   GKEMAFLQMKRVVSAVLKRFKVVPREREGGAQPELLPYLTAKMKGGLPVTVLER  502



>ref|XP_008447772.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94A2-like [Cucumis 
melo]
Length=510

 Score =   417 bits (1072),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 218/481 (45%), Positives = 298/481 (62%), Gaps = 19/481 (4%)
 Frame = -1

Query  1564  YTPP-----SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAE  1400
             +TPP     SYPI+G   + + NR   L W + +L  SP  T  +HRL   R V TA+  
Sbjct  31    FTPPIKLPKSYPIVGSFFAVFANRSRRLQWLSDVLQISPAATFTLHRLFGQRQVFTANPA  90

Query  1399  NVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVM  1220
              V+++LK  F  + KG+    +  DFLG GIFN DG+ W  QR+++SHEFT +SLR+ V 
Sbjct  91    VVQHILKTKFHIYQKGDSFRSVFTDFLGDGIFNADGESWKFQRQVSSHEFTTKSLRKFVE  150

Query  1219  KTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeS  1040
               ++ E+  RL P+L  AA   SVLDLQDVL+RFAFD +CKI          S       
Sbjct  151   TVVDAELSERLVPILYTAASTCSVLDLQDVLQRFAFDNVCKI-AFGYDPAYLSPSFGQSK  209

Query  1039  LVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEK  860
                AF++A  IS+ R  + +  VWK K+  NVGSEK+LR  I  V  +  +II+ ++ E 
Sbjct  210   FARAFEEAVRISSLRFQSLLPIVWKLKKFLNVGSEKQLRIAIAEVRGYANKIIKDKETEL  269

Query  859   ANNIAAGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIE  683
               N +  A  D LSR L +GH +   + D++ISF++AG+DTTS+ALTWFFWLL+K+P +E
Sbjct  270   KANSSIDA-VDLLSRFLTSGHSNHNFIVDIIISFILAGQDTTSAALTWFFWLLAKYPQVE  328

Query  682   TTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             T + +++ S   +    +D ++++ Y  A LCESMRLYPPV  D K AA DDVLPDGT +
Sbjct  329   TRIFQEI-SQKPEDLFGYDEVKDLVYTHAALCESMRLYPPVPVDGKQAAADDVLPDGTVV  387

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKM----ISPFKFPVFQA  347
              +G RV + PYAMGRME  WG DW EF+P+RW     DE+G +K        + +PVFQA
Sbjct  388   RKGERVAYHPYAMGRMEGFWGKDWAEFRPERWLESCGDEEGPVKWRFVGRDNYTYPVFQA  447

Query  346   GPRVCLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMRE  173
             GPR+CLGKEMAF+QMK +VA I++RF +    E   +P FV  +T  M  G  VR+ +RE
Sbjct  448   GPRICLGKEMAFLQMKRIVAGIVKRFRVVLAAEEGVEPRFVQYMTAKMEGGFPVRIKVRE  507

Query  172   G  170
             G
Sbjct  508   G  508



>gb|KDP21346.1| hypothetical protein JCGZ_21817 [Jatropha curcas]
Length=504

 Score =   417 bits (1071),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 213/473 (45%), Positives = 299/473 (63%), Gaps = 16/473 (3%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHR-LGAPRTVVTASAENVE  1391
             ++ P  +P++G      +N +  + W +  + +SP+ T V+HR LG+ + ++T +  NV+
Sbjct  38    LHAPKPHPLMGNYFHLKQNWHRRIQWISDAVVNSPSATWVLHRPLGSGQFIITGNPANVQ  97

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++LK NF  + KG  +   L DFLG GIFN DG+ W  QR++ASHEF  +SLR+ V   +
Sbjct  98    HILKTNFHIYEKGPIVRSTLFDFLGNGIFNTDGETWKIQRQIASHEFNTKSLRKFVQTVV  157

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             + E+  RL P+L  AA N +VLD QD+L+RFAFD ICKI                    D
Sbjct  158   DTELSQRLIPILSTAAANQTVLDFQDILQRFAFDNICKI-AFGYDPGYLLPSLPQTKFAD  216

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AF+ +  IS  R  +     WK KRAF +GSEK+L+E +  V D    I++ +K+E   N
Sbjct  217   AFEDSVRISFERFNS---LFWKIKRAFGIGSEKRLKEAMLEVRDFALNIVKKKKEELKQN  273

Query  850   IAAGAGSDFLSRLLDAGHKDEV-VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
              ++   +D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLS+   +ET +
Sbjct  274   -SSLESADLLSRFLSSGHSDETFVTDIVISFILAGRDTTSAALTWFFWLLSRSTEVETKI  332

Query  673   IKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             +K++    +     F+ +++M Y  A LCESMRLYPPV  DSK A  DDVLPDGTP+ +G
Sbjct  333   LKEIKEKSENPV--FEEVKDMVYTHASLCESMRLYPPVPSDSKFAVADDVLPDGTPVRKG  390

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQAGPRVCL  329
             +RVT+ PYAMGR+E LWG+DW +FKP+RW +     E+       P+ +PVFQAGPR+CL
Sbjct  391   SRVTYHPYAMGRLEMLWGSDWADFKPERWLERDAVNEKWNFVGKDPYTYPVFQAGPRICL  450

Query  328   GKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF+QMK VVA +L +F++ P  E   +P F+  LT  M  G  VR+  R
Sbjct  451   GKEMAFLQMKRVVAGVLNKFKVVPAAEDGFEPEFIAYLTSKMKGGFPVRIVER  503



>gb|EPS72518.1| hypothetical protein M569_02237, partial [Genlisea aurea]
Length=500

 Score =   417 bits (1071),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 309/465 (66%), Gaps = 13/465 (3%)
 Frame = -1

Query  1546  PIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFL  1367
             PI G      KN++  + W  +++ S+PT T  +HR    + V+TA+ +NV ++LK++F 
Sbjct  41    PIFGSYFDVRKNKHRYVQWTGEIVNSTPTSTFTLHRTLGQKQVITANPDNVHHVLKSHFH  100

Query  1366  NFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRL  1187
              + KG+ M  +L D LG GIFN DGD+W  QR+LASHEF  +SLR+     ++ E+  RL
Sbjct  101   LYGKGDLMKMVLRDLLGNGIFNADGDVWKFQRQLASHEFNTKSLRKFTENVVDAELFDRL  160

Query  1186  SPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEI  1007
              P+L  AA N +V+DLQD+L+RFAFD ICKI+ G DP  L+ S   A+  V AFDKA +I
Sbjct  161   LPILRTAAANKTVVDLQDLLQRFAFDNICKIAFGYDPEYLTPSLQQAKFAV-AFDKAVKI  219

Query  1006  SARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSD  827
             S+ R  + V  VWK KR  N G+E++L+  +  V +  +EIIR   ++KA + ++ +  D
Sbjct  220   SSDRFNSLVPFVWKLKRILNFGAERELKSAVAEVQNLAKEIIR---RKKAKSSSSSSDED  276

Query  826   FLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSSD  650
              LSR L +GH D E V D+VISF +AGRDTTS+ALTWFFWLLSK+P +E  ++++V +  
Sbjct  277   LLSRFLSSGHSDEEFVMDIVISFTLAGRDTTSAALTWFFWLLSKNPQVEKNILEEV-NVK  335

Query  649   DQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPY  470
               ++  ++ ++E+ Y  A + ESMRLYPPV  D+K A  DDVLPDGT + +G RV++ PY
Sbjct  336   VSESAAYEEVKELVYTHASISESMRLYPPVPTDTKCAVADDVLPDGTVVKKGTRVSYHPY  395

Query  469   AMGRMENLWGNDWLEFKPDRWFDE---QGKLKMIS--PFKFPVFQAGPRVCLGKEMAFIQ  305
             AMGR E LWG DW E+KP+RW ++    GKL  ++   + +PVFQAGPR+CLGKEMAF+Q
Sbjct  396   AMGRSEKLWGADWSEYKPERWLEKAAGSGKLTFVNKDAYTYPVFQAGPRICLGKEMAFMQ  455

Query  304   MKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             MK V+A ILR F + P  E+  +P+F+  LT  M  G  VR   R
Sbjct  456   MKSVIAGILREFRVVPAAETGEEPIFISFLTAKMKSGFPVRFEAR  500



>ref|XP_010247227.1| PREDICTED: cytochrome P450 94B3 [Nelumbo nucifera]
Length=507

 Score =   416 bits (1070),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 308/469 (66%), Gaps = 18/469 (4%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP+IG L  F KNR+  LDW T +L+ +PT T   +R G    ++TA+  NVE+MLK NF
Sbjct  39    YPLIGTLPEFIKNRHRFLDWTTDVLSRTPTNTATFYRPGKVNGIITANPLNVEHMLKANF  98

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKG+    +L DFLG+GIFN DGDLW  QRK AS EF  +SLR  VM+ ++ E++ R
Sbjct  99    ENYPKGDRFIALLKDFLGQGIFNSDGDLWRVQRKTASFEFNTKSLRSFVMENVKAEIETR  158

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L PLL+ A+  + +LD+QD+L RFAFD +CK++   DP CL    +++   + AF++A+ 
Sbjct  159   LIPLLKRASETNQILDIQDILERFAFDNVCKLAFDIDPVCLGGDGTTSGEFMQAFEEAAR  218

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR---KQEKANNIAAG  839
             +SA R M     +WK K+A N+GSE++L++ I  VHD  ++II  R   +++K NN    
Sbjct  219   LSAGRFMYLFPFLWKVKKALNIGSERRLKQAISTVHDFADKIIWSRMENRRQKQNN----  274

Query  838   AGSDFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR + D  +  E +RD+VISF++AGRDTTSS+L WFFW+LS  P+IE  ++ ++
Sbjct  275   --DDLLSRFMEDEFNSAEFLRDIVISFILAGRDTTSSSLAWFFWILSSRPDIERNILDEL  332

Query  661   LSSDDQK------TLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
              S   +K      T ++D LREM Y++A L E +RLYPPVA D+K    DDVLPDG+ I 
Sbjct  333   ESVRARKGKCIGDTYSYDELREMQYLQAALSEGLRLYPPVAVDTKACREDDVLPDGSFIK  392

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKE  320
             +G  +T+  YAMGRME +WG D  EFKP RW  E G  +  SPF++P+F AGPR+CLGK+
Sbjct  393   KGWFITYHTYAMGRMEAIWGKDCREFKPQRWL-ESGTCRQESPFRYPIFHAGPRMCLGKD  451

Query  319   MAFIQMKFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMR  176
             MA+IQMK + AS++ RF +  V  +  P  +  LT  +  GL VR+  R
Sbjct  452   MAYIQMKSIAASVIERFHVDVVDGDKCPEHLLSLTLRIKGGLRVRIKQR  500



>ref|XP_008235725.1| PREDICTED: cytochrome P450 94A1-like [Prunus mume]
Length=509

 Score =   416 bits (1069),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 228/475 (48%), Positives = 308/475 (65%), Gaps = 19/475 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG  ++ YKN    L W+T LL SSP+ T  +H       VVTA+   V+++LK
Sbjct  39    PKSYPIIGSFITLYKNHERRLPWFTDLLRSSPSNTFTLHHSLGKHFVVTANPTVVQHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F  + KG  +   L D LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  99    THFPIYEKGNTIRTTLTDLLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L ++A N+S+LD QD+L+RFAFD I +I+ G DP  L  S   A+  V AFD 
Sbjct  159   SDRLIPILSSSATNNSILDFQDILQRFAFDNIGRIAFGYDPAYLLPSLPQAKFAV-AFDD  217

Query  1018  ASEISAR--RGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             A +IS+   R ++P   VWK KR   +GSEK LR  +  V +    I+R +K+E +   A
Sbjct  218   AVQISSDRFRSLSP---VWKLKRVLGIGSEKHLRAAVSEVREFANTIVREKKRELSETKA  274

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               +  D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++ ++E  ++K
Sbjct  275   LES-VDLLSRFLGSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNQHVEDEILK  333

Query  667   QV--LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             ++   +S +     +D ++EM Y  A LCESMRLYPPVA DSK A  DDVLPDGT + +G
Sbjct  334   EISETASSESAAGGYDEVKEMVYTHAALCESMRLYPPVAADSKEAIKDDVLPDGTKVKKG  393

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG--KLKMIS--PFKFPVFQAGPRVC  332
               VT+  YAMGRME +WG DW E++P+RW   +E G  K K +    F +PVFQAGPR+C
Sbjct  394   MTVTYHVYAMGRMEEIWGEDWAEYRPERWLEREENGAHKWKFVGRDSFSYPVFQAGPRIC  453

Query  331   LGKEMAFIQMKFVVASILRRFEIRPV---CESQPVFVPLLTGYMAKGLYVRVHMR  176
             LGKEMAF+QMK VV+++L+RF++ PV     +QP FV  LTG M  G  V +  R
Sbjct  454   LGKEMAFLQMKRVVSAVLKRFKVVPVEREGGAQPEFVAYLTGKMKGGFPVTIVER  508



>ref|XP_002521002.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41419.1| cytochrome P450, putative [Ricinus communis]
Length=497

 Score =   416 bits (1068),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 291/469 (62%), Gaps = 15/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YPIIG  L    N      W + LL +SP+ T V+HR    R +VT +  NV+++LK
Sbjct  34    PKPYPIIGNYLDIKANWNRRFQWTSDLLQNSPSATYVIHRPLGGRWIVTGNPANVQHILK  93

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F  + KG      L DFLG GIFNVDGD W  QR++ASHEF  +SLR+ V   ++ E+
Sbjct  94    THFHLYQKGHTFRSALFDFLGNGIFNVDGDTWKFQRQVASHEFNTKSLRKFVETVVDTEL  153

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L AAA N +VLD QD+L+RFAFD ICKI                     AF+ 
Sbjct  154   IQRLIPFLSAAAENGTVLDFQDILQRFAFDNICKI-AFGYDPAYLLPSLPQAKFAQAFED  212

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
                IS+ R  +P    W+ KRAFN+GSEKKL+E I  V D    ++  +KQE   N ++ 
Sbjct  213   GVRISSDRFNSP---FWRIKRAFNIGSEKKLQEAISQVRDFAAHVVEEKKQELKEN-SSL  268

Query  838   AGSDFLSRLLDAGHKDEV-VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+AL WFFWL++K+P +ET +++++
Sbjct  269   ESVDLLSRFLSSGHSDETFVIDIVISFILAGRDTTSAALAWFFWLINKNPQVETRILEEI  328

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
               ++  +   F+ +++M Y  A LCESMRLYPPV  DSK A  DDVLPDGT + +G+RVT
Sbjct  329   --NEKSEMPIFEEVKDMVYTHASLCESMRLYPPVPTDSKLAIGDDVLPDGTVVTKGSRVT  386

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFD-----EQGKLKMISPFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E LWG DW +FKP+RW +     E+        + +PVFQAGPR+CLGKEM
Sbjct  387   YHPYAMGRLEMLWGADWADFKPERWLERDIVNEKWNFVGRDAYTYPVFQAGPRICLGKEM  446

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +L +F++ P  E   +P  V  LT  M  G  VR+  R
Sbjct  447   AFLQMKRVVAGVLSKFKVVPAFEDGFEPELVAYLTAKMDGGFPVRIVER  495



>ref|XP_004247227.1| PREDICTED: cytochrome P450 94A1-like [Solanum lycopersicum]
Length=502

 Score =   415 bits (1067),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 218/471 (46%), Positives = 307/471 (65%), Gaps = 14/471 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N++  + W + ++ ++   T  + R    R + TA+  NV+YMLK
Sbjct  35    PKSYPIIGSYFSILANKHRRIQWSSDIIQTTTNLTFTLIRPFGNRQIFTANPSNVQYMLK  94

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F  + KG      + DFLG GIFNVDG++W  QR++ASHEF  +SLR+ +   ++ E+
Sbjct  95    THFHIYQKGHMFKSTMADFLGDGIFNVDGEIWKYQRQVASHEFNTKSLRKFIETVVDAEL  154

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL PLL  AA    V+DLQD+L+RFAFD ICKI+ G DP  LS S    +  V AF++
Sbjct  155   NERLIPLLAVAASEKKVVDLQDILQRFAFDNICKIAFGYDPAYLSPSLPQEKFAV-AFEE  213

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A ++S+ R  A    +WK KR F+ GSEK+ R  +  V    ++++R  KQ + N  ++ 
Sbjct  214   AVKLSSERFNAIFPFLWKIKRHFDFGSEKRFRIAVDEVRQFAKQLVR-EKQSELNQKSSL  272

Query  838   AGSDFLSRLLDAGHK-DEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L  GH+ D+ V D+VISF++AGRDTTS+ALTWFFWL+S+HP +E++++ ++
Sbjct  273   DSVDLLSRFLSVGHRDDDFVTDVVISFILAGRDTTSAALTWFFWLISEHPVVESSILNEI  332

Query  661   -LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
              L S    T  ++ ++EM Y  A LCESMR YPPV  DSK A  D+VLPDGT + +G RV
Sbjct  333   KLKS---HTPVYEEVKEMIYTHASLCESMRFYPPVPIDSKTATEDNVLPDGTFVKKGTRV  389

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMISP--FKFPVFQAGPRVCLGKE  320
             ++ PYAMGR E LWG+DW +FKP+RW D+    G    ++   + +PVFQAGPR+CLGKE
Sbjct  390   SYHPYAMGRAEELWGSDWNKFKPERWLDKDEVTGNWNFVTKDMYTYPVFQAGPRICLGKE  449

Query  319   MAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMRE  173
             MAF+QMK VVA +LRRF++ PV E   +PVF+  LT  M  G +V +  R+
Sbjct  450   MAFLQMKRVVAGVLRRFKVVPVTEKGVEPVFISYLTAKMKGGFHVTIEERD  500



>ref|XP_011024239.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=499

 Score =   415 bits (1066),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 222/447 (50%), Positives = 305/447 (68%), Gaps = 15/447 (3%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             + DWYT LL +SP +TI +H LG     +TA+ +NVEY+LK  F N+PKG P + ILGDF
Sbjct  59    ICDWYTHLLQNSPRQTIHIHVLG---NTITANPDNVEYILKTKFENYPKGRPFSMILGDF  115

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSS--V  1148
             LG+GIFNVDGDLW  QRK+AS E  + S+R    + +  E+  RL PLL +AA+++   +
Sbjct  116   LGKGIFNVDGDLWLFQRKMASLELASVSIRNYAFEIVNTEIKCRLLPLLTSAAKSTDGDL  175

Query  1147  LDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVW  968
             +DLQDV RRF+FD IC+ S G DPGCL SS   +    ++FD AS++SA R MA +  VW
Sbjct  176   IDLQDVFRRFSFDNICRFSFGLDPGCLESSLPISV-FAESFDLASKLSAERAMATLPLVW  234

Query  967   KCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDE  788
             K KR FN+G+EK L+E I+VV+   +E+I  +++     +      D LSR +     D 
Sbjct  235   KIKRYFNIGTEKNLKEAIEVVNILADEVIMQKRK-----LGFSTNQDLLSRFMACITDDR  289

Query  787   VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV--LSSDDQKTLNFDHLRE  614
              +RD+VISF++AGRDT +SALT FFWLL+ HPN+ + + ++   + + +Q++ +++ +RE
Sbjct  290   YLRDIVISFILAGRDTMASALTTFFWLLASHPNVVSKIREESNRVMASNQESASYEQIRE  349

Query  613   MNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGND  434
             M+Y+ A + ES+RLYPPV +DSK A  DDVLPDGTP+ RG RVT+ PYAMGRME +WG D
Sbjct  350   MHYLHAVVNESLRLYPPVQFDSKFAMEDDVLPDGTPVRRGTRVTYHPYAMGRMERIWGID  409

Query  433   WLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPV  254
              LEF+P+RW  E G    ISPFK PVFQAG RVCLGKEM+ ++MK V  S++RRF+I+ V
Sbjct  410   CLEFRPERWL-ENGTFCPISPFKCPVFQAGIRVCLGKEMSLVEMKIVALSVVRRFDIKIV  468

Query  253   -CESQPVFVPLLTGYMAKGLYVRVHMR  176
               E  P F   LT  ++ GL   +  R
Sbjct  469   PPEVSPRFNSGLTAMLSGGLQAEIRER  495



>ref|XP_010039240.1| PREDICTED: cytochrome P450 94A1-like [Eucalyptus grandis]
 gb|KCW49815.1| hypothetical protein EUGRSUZ_K03296 [Eucalyptus grandis]
Length=514

 Score =   415 bits (1067),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 220/473 (47%), Positives = 298/473 (63%), Gaps = 11/473 (2%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YPI G   SF+ N    +DW   L+ +SP+ T V HR    R V T +  NVE++LK
Sbjct  42    PRVYPIFGSYFSFFANIKRRIDWTADLVRNSPSATYVFHRTLGNRQVFTGNPANVEHILK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F N+ KG      L D LG GIFN+DG+ W  QR++ASHEF  RSLR+ V   ++ E+
Sbjct  102   THFGNYEKGGVFTITLRDVLGDGIFNIDGESWKFQRQVASHEFNTRSLRKFVENVVDAEL  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdss-aeSLVDAFD  1022
             + RL PLL +AA++ SV+D++D+L+RFAFD ICKI+ G D   LS S         +AF+
Sbjct  162   NERLVPLLASAAKSGSVIDMEDILQRFAFDNICKIAFGFDAEYLSPSLPQPRAKFAEAFE  221

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKAN-NIA  845
              A  IS+ R       +W+ KR FNVGSEK+LR  +  V +  ++I+R +K+E    ++ 
Sbjct  222   DAVRISSARFREFFSVIWRIKRFFNVGSEKRLRVAVSEVREFAKKIVREKKRELGEKSLP  281

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               A  D LSR L +GH DE  V D+VISF++AGRDTTS+ALTW+FWLL K+P +E  V  
Sbjct  282   ESAADDLLSRFLSSGHSDENFVIDIVISFILAGRDTTSAALTWYFWLLHKNPEVEAKVRA  341

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             +++         +D ++EM Y  A LCESMR YPPV  D+K A +DDVL DGT + +G  
Sbjct  342   EIMEKSAAHAAGYDDVKEMVYTHASLCESMRFYPPVPLDTKVAMSDDVLEDGTVVKKGMW  401

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWF----DEQGKLKMIS--PFKFPVFQAGPRVCLG  326
             VT+  YAMGR+E LWG DW EF+P+RW     D   K   ++   F +PVF AGPRVCLG
Sbjct  402   VTYHTYAMGRLEQLWGKDWPEFRPERWLRAAEDGSEKWAFVNRDAFAYPVFNAGPRVCLG  461

Query  325   KEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMRE  173
             KEMAF+QMK VVA +LR+F + P  E   +PVF+  L+  M  G  VR+ +R+
Sbjct  462   KEMAFLQMKRVVAGVLRQFRVVPAAEEGREPVFISYLSSKMEGGFPVRIEVRK  514



>emb|CDY56777.1| BnaAnng14430D [Brassica napus]
Length=494

 Score =   414 bits (1065),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 300/466 (64%), Gaps = 11/466 (2%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYPI+G +    KNR+  LDW  ++L+  PT+T V  R G  + V+TA+  NVEYMLK  
Sbjct  32    SYPIVGSIPGLVKNRHRFLDWTVEILSRCPTQTAVFRRPGKQQFVMTANPANVEYMLKTK  91

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F NFPKGE   +IL DFLGRGIFN +G++W  QRK ASHEF+ +SLR+ VM  +  E++ 
Sbjct  92    FDNFPKGERFIEILEDFLGRGIFNSEGEIWWKQRKTASHEFSTKSLRDFVMTNVTVEINT  151

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L AAA    +L+L DVL RF FD ICK++   D  CL    ++    + AFD AS
Sbjct  152   RLVPVLAAAATTGKLLNLDDVLERFTFDNICKLAFNVDSACLGDDKAAGIEFMKAFDTAS  211

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
             +I ++R  +     WK K+  N+GSE+ LRE I  VH   ++I+R +  +  NN      
Sbjct  212   KIISQRFQSAFSYTWKIKKKLNIGSERLLRESIVTVHKFADDIVRHKIDQSNNN---NKS  268

Query  832   SDFLSRLLDAGHKD--EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
              D LSR +     +  E +RD VI F++AGRDTTSSAL+WFFWLLSKHP++E  +I Q L
Sbjct  269   DDLLSRFISTEELNSPEKLRDNVIGFILAGRDTTSSALSWFFWLLSKHPHVEDKII-QEL  327

Query  658   SSDDQKT---LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             +S  ++T     F+ L+ MNY+ A + ES+RLYPP+  D+     D VLPDGT + +   
Sbjct  328   NSIGKRTGEAYGFEDLKLMNYLHAAITESLRLYPPIPLDTMSCLEDSVLPDGTFVGKAWG  387

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDE-QGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
             ++++ YAMGRME++WG D   F P+RW DE  G  +  SP+KFPVF AGPR+CLGKEMA+
Sbjct  388   ISYNAYAMGRMESIWGKDCDRFDPERWIDETNGGFRGESPYKFPVFHAGPRMCLGKEMAY  447

Query  310   IQMKFVVASILRRFEIR-PVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             IQMK +V+++L RF +  P    +P  +  +T  +  GL+VRVH R
Sbjct  448   IQMKSIVSAVLDRFVVEVPGKNERPEILLSVTIRIKGGLFVRVHER  493



>ref|XP_010278943.1| PREDICTED: cytochrome P450 94A2-like [Nelumbo nucifera]
Length=507

 Score =   415 bits (1066),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 301/469 (64%), Gaps = 12/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG  ++  KNR    +W  ++L  SP+ T V+HR    R V+TA+  NV+++LK
Sbjct  39    PMSYPLIGSYIALSKNRNRWPEWIAEILRHSPSGTFVLHRPFGVRQVLTANPSNVQHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  +PKG      L D LG GIF  DGD W +QR+++SH F  +SL   V   ++ E+
Sbjct  99    TQFYRYPKGHFFRSTLSDLLGDGIFTADGDSWKSQRQISSHAFNTKSLHNFVETVVDTEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L AAA + SV++LQD+L+RFAFD ICKI          S    +     AFD 
Sbjct  159   TKRLIPILSAAAADKSVINLQDILQRFAFDNICKI-AFGFDPEYLSPSFPSPEFTTAFDS  217

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  +S+ R  +   A+WK KRAF +GSEK+L+  +  +    + I+R +K+E     +  
Sbjct  218   AIRLSSERFGSINPALWKLKRAFGIGSEKQLQLAVSQIRGFAQRIVREKKRELDEKSSLE  277

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
              G D LSR+L++GH DE +V D+VISF++AGRDTTS+ALTWFFWL+S H ++E  +++++
Sbjct  278   NG-DLLSRILNSGHVDENLVTDLVISFILAGRDTTSAALTWFFWLISSHSHVEEEILREI  336

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
               +++     +  ++ M Y  A LCESMRLYPPV  DSK AA DD+LPDGT + +G RVT
Sbjct  337   --TENPVAPIYTEVKNMVYTHASLCESMRLYPPVPGDSKEAAEDDILPDGTVVKKGVRVT  394

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             + PYAMGRME LWG++W +F+P+RW ++    GK   ++   + +PVFQAGPR+CLGK+M
Sbjct  395   YLPYAMGRMEALWGSNWPDFRPERWLEKDEVTGKWSFVARDQYTYPVFQAGPRICLGKDM  454

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AF+QMK VVA +LRRF + P  E   +PV+V  LT  M  G  VR+  R
Sbjct  455   AFLQMKQVVAGVLRRFRVVPAMEEGCEPVYVSYLTSKMKGGFPVRIEER  503



>ref|XP_004493756.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=510

 Score =   415 bits (1066),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 212/473 (45%), Positives = 301/473 (64%), Gaps = 15/473 (3%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKN-RYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             +  P SYPIIG  LS  KN R   + W + +   +P  T  ++R    R ++T +   V+
Sbjct  42    ITIPKSYPIIGSYLSIRKNMRTRRIQWLSDVTQIAPAATFRLNRPLGSRQIITGNPSTVQ  101

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++LK +F N+ KG    + L DFLG GIFN DG  W  QR++ASHEF  +SLR  V   +
Sbjct  102   HILKTHFTNYQKGTTFTKTLSDFLGNGIFNTDGATWKFQRQVASHEFNTKSLRNFVEHVV  161

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             + E+  RL P+L ++++N + LD QD+L+RF FD ICKI          +  ++      
Sbjct  162   DTELTNRLIPILTSSSQNKTTLDFQDILQRFTFDNICKI-AFGFDPEYLTPSTNRTQFAQ  220

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             AF+ A+EIS++R  AP+  +WK K+ FN+GSEK+L+E +K + D  ++II+ +K+E   N
Sbjct  221   AFEDATEISSKRFRAPLPIIWKLKKHFNIGSEKRLKEAVKEIRDFAKKIIQEKKREL--N  278

Query  850   IAAGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
               +    D LSR L +GH +E  V D++ISF++AG+DTTS+ALTW FWLL K+P +E  +
Sbjct  279   KKSLETEDMLSRFLSSGHAEEDFVTDIIISFILAGKDTTSAALTWLFWLLWKNPRVEEEI  338

Query  673   IKQV-LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             +K++ L S+   +L +D ++EM Y  A L ESMRLYPPV  DSK A NDDVLPDGT + +
Sbjct  339   LKEIKLKSE---SLVYDEVKEMVYTHAALSESMRLYPPVPMDSKEAVNDDVLPDGTVVKK  395

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQGKLKMIS--PFKFPVFQAGPRVCL  329
             G  VTF  YAMGRME+LWG+DW EF+P+RW   D  GK   +    F +PVFQAGPR+CL
Sbjct  396   GTMVTFHVYAMGRMESLWGDDWAEFRPERWLEKDVNGKWVFVGRDSFSYPVFQAGPRICL  455

Query  328   GKEMAFIQMKFVVASILRRFEI--RPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF+QMK +VA I+ +F++   P  +  P F+  L+  M  G  V +  R
Sbjct  456   GKEMAFMQMKRMVAGIVGKFKVVPEPHLDEHPNFISFLSSQMEGGFPVTIQKR  508



>ref|XP_003553484.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=512

 Score =   415 bits (1066),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 223/474 (47%), Positives = 304/474 (64%), Gaps = 11/474 (2%)
 Frame = -1

Query  1570  IVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             I   P  YP+IG  L         + W + ++  SP  T  +HR    R V+T +   VE
Sbjct  41    ITTIPKPYPLIGHYLDLKGVGNRRIQWLSDIVKISPAATFTLHRPLGSRQVITGNPATVE  100

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++LK  F N+ KG      L DFLG GIFN DG+ W  QR++ASHEF  +SLR+ V   +
Sbjct  101   HILKTRFSNYIKGSIFINNLSDFLGTGIFNADGNTWKFQRQVASHEFNTKSLRKFVEHVV  160

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             + E+  RL P+L +AA+    LD QD+L+RFAFD ICKI+ G D   L+ S   ++  V 
Sbjct  161   DVELSDRLVPVLASAAQQDQTLDFQDILQRFAFDNICKIAFGYDAEYLTPSTEQSKFAV-  219

Query  1030  AFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANN  851
             A+++A+EIS++R   P+  VWK KR  N+GSEK+LR  +K V D  ++I+R +K+E    
Sbjct  220   AYEEATEISSKRFREPLPLVWKIKRLLNIGSEKRLRIAVKEVRDFAKKIVREKKKELKEK  279

Query  850   IAAGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV  674
              +     D LSR L +GH DE  V D+VISF++AG+DTTS+AL WFFWLLSK+P +E  V
Sbjct  280   ESL-EQVDMLSRFLSSGHSDEDFVTDIVISFILAGKDTTSAALMWFFWLLSKNPGVEKEV  338

Query  673   IKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             +K+++  +  +T  +D +++M YI A LCESMRLYPPV+ DSK A +DDVLPDGT + +G
Sbjct  339   LKEIM--EKPETPAYDEVKDMVYIHAALCESMRLYPPVSMDSKEAVDDDVLPDGTVVKKG  396

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFD--EQGKLKMIS--PFKFPVFQAGPRVCLG  326
               VT+  YAMGRME++WG DW EFKP+RW +  E GK K +    F +PVFQAGPR+CLG
Sbjct  397   TLVTYHVYAMGRMESIWGEDWAEFKPERWLEKVETGKWKFVGRDSFTYPVFQAGPRICLG  456

Query  325   KEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREG  170
             KEMAF+QMK +VA ILRRF + P      +P +   LT  M  G  V++  RE 
Sbjct  457   KEMAFMQMKRLVAGILRRFTVVPAMAKGVEPHYFAFLTSQMEGGFPVKIIDREA  510



>dbj|BAO45862.1| cytochrome P450 94A1 [Acacia mangium]
Length=507

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/470 (47%), Positives = 303/470 (64%), Gaps = 15/470 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YP+IG       N    + W + ++  SP+ T V+H     R V T +   V+++LK
Sbjct  39    PKRYPLIGSYFDLIANFDNRIQWLSDVIQISPSNTYVLHLFLGQRIVQTGNPAVVQHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             NNF  + KG+   + L DFLG GIFN DGD W  QR++ASH F  RSLR+ V + ++ E+
Sbjct  99    NNFPVYQKGQAFRETLTDFLGNGIFNTDGDTWKFQRQVASHVFNTRSLRKFVEQVVDNEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P+L  AA  + +LDLQD+L+RFAFD ICKI+ G DP  LS S   ++  + AFD 
Sbjct  159   NDRLIPILATAAAQNQILDLQDILQRFAFDNICKIAFGFDPEYLSPSLGQSKFAL-AFDA  217

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A EIS RR       +W+ K+ F++GSEKKLR  I  V +  + IIR +K++  +  A+ 
Sbjct  218   AVEISGRRSSQIHPLIWRIKKLFDIGSEKKLRLAISEVREFAKNIIRNKKRQLLDG-ASL  276

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
               +D LSR L +GH DE  V D+VISF++AG+DTTS+ALTWFFWLLSKHP +   ++K+ 
Sbjct  277   ESADMLSRFLSSGHSDEDFVTDIVISFILAGKDTTSAALTWFFWLLSKHPEVAKKIVKE-  335

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
              +S+  +   +D +++M Y  A L ESMRLYPPV  DSK   +DDVLPDGT + +G RVT
Sbjct  336   -ASEKSEVTVYDEVKDMVYTHAALSESMRLYPPVPLDSKEVVSDDVLPDGTTVKKGMRVT  394

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWF------DEQGKLKMIS--PFKFPVFQAGPRVCLG  326
             +  YAMGRME LWG+DW E+KP+RW       +E  K + ++  PF +PVFQAGPR+CLG
Sbjct  395   YHVYAMGRMEKLWGSDWAEYKPERWLEREGSGEESEKWRYVARDPFSYPVFQAGPRICLG  454

Query  325   KEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVH  182
             KEMA++QMK VV +IL RF + P      +P F+ +LT  M  G  V++H
Sbjct  455   KEMAYLQMKRVVGAILTRFTVVPAMPEGMEPQFISILTSRMKDGFPVKIH  504



>ref|XP_010679201.1| PREDICTED: cytochrome P450 94A1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   415 bits (1066),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/478 (45%), Positives = 306/478 (64%), Gaps = 18/478 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P +YP+IG LL+  K++   L W T L+ +SPT T V+HRL   ++++T +  NV+++LK
Sbjct  44    PKAYPLIGHLLAVLKHKNERLRWLTSLVHNSPTFTFVIHRLLGQKSILTGNPANVQHILK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  + KG     IL D LG GIFNVDG++W  QR++ASHEF+ +SLR  V   ++ E+
Sbjct  104   TQFPLYEKGPLFKTILQDLLGDGIFNVDGEMWKFQRQIASHEFSTKSLRNFVETVVDTEL  163

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA+N +VLDLQD+L+RFAFD ICKI          S          AF+ 
Sbjct  164   SDRLIPILSDAAKNKTVLDLQDILQRFAFDNICKI-AFGYDPEYLSPSLPHSKFAAAFED  222

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA--  845
             A  IS +R       +WK +R  N+GSEKKL+E +  + +  + ++  +KQ    N+   
Sbjct  223   AVMISTQRFRTFFPIIWKIRRFLNIGSEKKLKEAVSEIRNFAKSLVSQKKQGMLKNLEGF  282

Query  844   -AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
              +    D LSR L +GH DE  V D+VISF++AGRD+TSSALTWF+WLL K+ ++E  +I
Sbjct  283   HSSESEDLLSRFLKSGHSDENFVTDIVISFILAGRDSTSSALTWFYWLLYKNKHVEEEII  342

Query  670   KQVLSSDDQKTLNFDH------LREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGT  509
             +++  +  +++   +H      +++M YI A L ESMRLYPPV  D+K A  +DVLPDGT
Sbjct  343   QEINKNRGKQSNKTEHSSVLEEVKDMVYIHAALYESMRLYPPVPIDTKQANANDVLPDGT  402

Query  508   PIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKMI--SPFKFPVFQAG  344
              + +G+ VT+ PYAMGRM+++WG DW E++P+RW +    + K K +   P+ +PVFQAG
Sbjct  403   RVEKGSWVTYHPYAMGRMKSIWGIDWAEYRPERWLEVGTGEVKWKFVPKDPYSYPVFQAG  462

Query  343   PRVCLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             PRVCLGK+MAF+QMK VVA IL RF + PV +   +PV++P LT  M  GL VR   R
Sbjct  463   PRVCLGKDMAFLQMKRVVAGILERFRVVPVVDDGFEPVYIPNLTAKMQGGLQVRFEER  520



>ref|XP_010271731.1| PREDICTED: cytochrome P450 94C1-like [Nelumbo nucifera]
Length=503

 Score =   414 bits (1063),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 224/438 (51%), Positives = 299/438 (68%), Gaps = 13/438 (3%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWYT LL  SP+KTI VH L   R  +TA+ +NVEYMLK  F N+PKG+P + ILGD 
Sbjct  63    LCDWYTHLLKKSPSKTIHVHVL---RNTITANPDNVEYMLKTRFENYPKGKPFSVILGDL  119

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLD  1142
             LGRGIFNVDGD W  QRKLAS E  + S+R    + +  E+  RL PLL +AA    VLD
Sbjct  120   LGRGIFNVDGDTWKFQRKLASLELGSVSIRSFAFEIVTTEIKRRLVPLLSSAAGEGRVLD  179

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
             LQDV RRF FD IC+ S G DPGCL  S   +E  + AFD AS +SA+R ++    +WK 
Sbjct  180   LQDVFRRFTFDNICRFSFGLDPGCLELSLPISEFAM-AFDLASRLSAQRALSLSPLIWKI  238

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVV  782
             KR  N+GSEKKL++ I++++   +E+IR R++     +   A  D LSR +   + D+ +
Sbjct  239   KRLLNLGSEKKLKKAIRLINVLAKEVIRQRRK-----MGFSASQDLLSRFMGTINDDKYL  293

Query  781   RDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV--LSSDDQKTLNFDHLREMN  608
             RD+VISFL+AGRDT +SALT FFWLL+KHP +  T++ +   +    Q+  +F+ +REM+
Sbjct  294   RDIVISFLLAGRDTVASALTSFFWLLAKHPEVAATILNESDRVMGPTQELASFEQIREMH  353

Query  607   YIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWL  428
             Y+ + + ES+RLYPPV +DSK +  DDVLPDGT + RG RVT+ PYAMGRME LWG D L
Sbjct  354   YLHSAVYESLRLYPPVQFDSKFSQEDDVLPDGTAVKRGTRVTYHPYAMGRMEELWGPDCL  413

Query  427   EFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCE  248
             EFKP+RW  + G     +PFK+PVFQAG RVCLGKEM+ +++K VV +++R FEI+ V +
Sbjct  414   EFKPERWL-KNGIFSPENPFKYPVFQAGLRVCLGKEMSLVEIKSVVLAVVRSFEIQVVED  472

Query  247   S-QPVFVPLLTGYMAKGL  197
             +  P F P LT  ++ GL
Sbjct  473   NDSPRFAPGLTATVSGGL  490



>emb|CDP03715.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   414 bits (1064),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 217/472 (46%), Positives = 308/472 (65%), Gaps = 15/472 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG   +   N +   +W  +++ + P  T  + R      V TA+  NV+++LK
Sbjct  40    PRSYPLIGSYFAIKANMHRRAEWTGEIVTTLPNLTFTLRRPLGHSQVFTANPANVQHILK  99

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF ++ KGE M+    DFLG GIFN+DG+ W  QR+++SHEF  +SLR+ V    E E+
Sbjct  100   TNFSSYRKGELMHVTNRDFLGDGIFNIDGEKWKFQRQVSSHEFNTKSLRKFVETVAETEL  159

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L +AA N +VLDLQD+L+RFAFD ICK++ G DP  L  S   AE  V AF+ 
Sbjct  160   SERLIPILTSAAANKTVLDLQDILQRFAFDNICKVAFGYDPAYLLPSLPEAEFPV-AFED  218

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ + + R  +P+  VWK KR FNVGSEK+L+E +++V +  +E++R +KQE     + G
Sbjct  219   ATRLISERLNSPLPLVWKIKRVFNVGSEKQLKEAVRIVREFAKEVVREKKQELREKSSIG  278

Query  838   AGSDFLSRLLDAG-HKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             +  D LSR L +G + +E V D+VISF++AGRDTTS+AL WFFWL+   P +E  +++++
Sbjct  279   S-VDILSRFLTSGYYNEEFVTDVVISFILAGRDTTSAALIWFFWLVFCDPRVEKEILREI  337

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
                 +     +D +++M Y  A LCE+MRLYPPV  D+K A   DVLPDGT + +G +V 
Sbjct  338   REKSESPV--YDEVKDMTYTHASLCETMRLYPPVPLDTKVAMKHDVLPDGTAVKKGTKVI  395

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDE------QGKLKMIS--PFKFPVFQAGPRVCLG  326
             + PYAMGR+E +WG DW +F+P+RW +E      +GK K ++  P+ +PVFQAGPRVCLG
Sbjct  396   YHPYAMGRVEAVWGEDWADFRPERWLEEEAAGDGEGKWKFVARDPYTYPVFQAGPRVCLG  455

Query  325   KEMAFIQMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             K+MAF+QMK VVA +LRRF + P  E   +PVFV  LT  M  G  VR+  R
Sbjct  456   KDMAFLQMKKVVAGVLRRFRVVPALEEGEKPVFVSYLTSKMKGGFPVRIEER  507



>ref|XP_009377720.1| PREDICTED: cytochrome P450 94A1-like isoform X2 [Pyrus x bretschneideri]
Length=503

 Score =   414 bits (1063),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 309/474 (65%), Gaps = 16/474 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S YKN    L W+T LL +SP+ T  +H   + R VVTA+   V+++LK
Sbjct  32    PKSYPIIGTFPSLYKNHRRRLPWFTDLLRTSPSNTFTLHHSLSRRFVVTANPTVVQHILK  91

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+ KGE     L + LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  92    TNFPNYQKGETFRTTLAELLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  151

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A+A +SSVLD QD+L+RF FD IC+I+ G DP  L  S   A+  V AFD+
Sbjct  152   SNRLIPILSASAASSSVLDFQDILQRFGFDNICRIAFGYDPDYLLPSLPEAKFAV-AFDE  210

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS+ R   P   VWK KRA  +GSEK+LR  +  V +  + I+R +K++  +   A 
Sbjct  211   ALQISSDRFRLP-HPVWKLKRALGIGSEKRLRAVVSEVREFAKTIVREKKRD-LSEAKAL  268

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLS++P +E  +++++
Sbjct  269   ESVDLLSRFLSSGHTDEKFVTDIVISFILAGRDTTSAALTWFFWLLSQNPRVENEILREI  328

Query  661   ---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
                 SS+      +D ++EM Y  A LCESMRLYPPV  DSK AANDDVLPDGT + +G 
Sbjct  329   NEAASSESAAGKGYDEVKEMVYTHAALCESMRLYPPVPTDSKQAANDDVLPDGTKVKKGM  388

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG----KLKMISPFKFPVFQAGPRVCL  329
              V +  YAMGRME LWG DW E++P+RW   +E+G    K      + +PVFQAGPR+CL
Sbjct  389   SVMYHVYAMGRMEELWGADWAEYRPERWLEREERGAHRWKFVGRDTYSYPVFQAGPRICL  448

Query  328   GKEMAFIQMKFVVASILRRFEIRP---VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF+QMK VV+++L+RF++ P      +QP  +  LT  M  GL V V  R
Sbjct  449   GKEMAFLQMKRVVSAVLKRFKVVPREREGGAQPELLSYLTAKMKGGLPVTVLER  502



>ref|XP_009367721.1| PREDICTED: cytochrome P450 94A1-like [Pyrus x bretschneideri]
Length=503

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 309/474 (65%), Gaps = 16/474 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S YKN    L W+T LL +SP+ T  +H   + R VVTA+   V+++LK
Sbjct  32    PKSYPIIGTFPSLYKNHRRRLPWFTDLLRTSPSNTFTLHHSLSRRFVVTANPTVVQHILK  91

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+ KGE     L + LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  92    TNFPNYQKGETFRTTLAELLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  151

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A+A +SSVLD QD+L+RF FD IC+I+ G DP  L  S   A+  V AFD+
Sbjct  152   SNRLIPILSASAASSSVLDFQDILQRFGFDNICRIAFGYDPDYLLPSLPEAKFAV-AFDE  210

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS+ R   P   VWK KRA  +GSEK+LR  +  V +  + I+R +K++  +   A 
Sbjct  211   ALQISSDRFRLP-HPVWKLKRALGIGSEKRLRAVVSEVREFAKTIVREKKRD-LSEAKAL  268

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLS++P +E  +++++
Sbjct  269   ESVDLLSRFLSSGHTDEKFVTDIVISFILAGRDTTSAALTWFFWLLSQNPRVENEILREI  328

Query  661   ---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
                 SS+      +D ++EM Y  A LCESMRLYPPV  DSK AANDDVLPDGT + +G 
Sbjct  329   NEAASSESAAGKGYDEVKEMVYTHAALCESMRLYPPVPTDSKQAANDDVLPDGTKVKKGM  388

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG----KLKMISPFKFPVFQAGPRVCL  329
              V +  YAMGRME LWG DW E++P+RW   +E+G    K      + +PVFQAGPR+CL
Sbjct  389   SVMYHVYAMGRMEELWGADWAEYRPERWLEREERGAHRWKFVGRDTYSYPVFQAGPRICL  448

Query  328   GKEMAFIQMKFVVASILRRFEIRP---VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF+QMK VV+++L+RF++ P      +QP  +  LT  M  GL V V  R
Sbjct  449   GKEMAFLQMKRVVSAVLKRFKVVPREREGGAQPELLSYLTAKMKGGLPVAVLER  502



>gb|KEH23874.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=504

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 295/471 (63%), Gaps = 11/471 (2%)
 Frame = -1

Query  1567  VYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             +  P SYP+IG  LS        + W + ++  +P+ T  ++R    R ++T +   V++
Sbjct  36    ITIPKSYPLIGSYLSIRNIGNRRIQWLSDIVQIAPSATFNLNRPLGTRQIITGNPSTVQH  95

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             +LKN F N+ KG    + L DFLG GIFN +G+ W  QR++ASHEF  +SLR+ V   ++
Sbjct  96    ILKNQFTNYQKGTIFTKTLSDFLGNGIFNTNGENWKFQRQVASHEFNTKSLRKFVEDVVD  155

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
              E+  RL P+L ++ +   +LD QD+L+RF FD ICKI          +  +       A
Sbjct  156   TELTNRLIPILSSSTQTKQILDFQDILQRFTFDNICKI-AFGFDPEYLTPSAKRTKFAQA  214

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             F+ A+EIS+RR   P+  +WK K+ FN+GSEK+LRE +  + ++  +I+R +K+E   N 
Sbjct  215   FEDATEISSRRFRLPLPVIWKMKKRFNIGSEKRLREAVTEIREYANKIVREKKKELKEND  274

Query  847   AAGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
             +     D LSR L +GH +E  V D+VISF++AG+DTTS+ALTWFFWLL K+P +E  ++
Sbjct  275   SLHT-QDMLSRFLSSGHSEEDFVTDIVISFILAGKDTTSAALTWFFWLLWKNPRVEEEIL  333

Query  670   KQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             K++  +   ++L++D ++ M Y  A L ESMRLYPPV  DSK A NDDVLPDG  + +G 
Sbjct  334   KEI--NKKSESLDYDEVKTMVYTHAALSESMRLYPPVPMDSKEAINDDVLPDGIVVKKGT  391

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMI----SPFKFPVFQAGPRVCLGK  323
              +T+  YAMGRME+LWG DW EFKP+RW +  G  K       PF +PVFQAGPR+CLGK
Sbjct  392   MITYHVYAMGRMESLWGEDWAEFKPERWLENDGYGKRAFVPRDPFTYPVFQAGPRICLGK  451

Query  322   EMAFIQMKFVVASILRRFEI--RPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             EMAF+QMK +VA I+ +F++   P     P F+  L+  M  G  V ++ R
Sbjct  452   EMAFMQMKRIVAGIVGKFKVVPEPHLAEHPNFISFLSSQMEGGFPVTINKR  502



>ref|XP_002521004.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF41421.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   413 bits (1062),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 214/482 (44%), Positives = 303/482 (63%), Gaps = 13/482 (3%)
 Frame = -1

Query  1594  HTEHHKKLIVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVV  1415
             + +  + L ++ P SYP+IG   +   N    + W + +L + P+ T V+HR    R + 
Sbjct  27    YGDSKRSLPIHIPKSYPLIGSSFAIKSNFDRRVQWTSDILQTLPSATFVLHRPMGHRQIF  86

Query  1414  TASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSL  1235
             T +  NV+++LK +F  + KG      L DFLG GIFN DG+ W  QRK+ASHEF+ +SL
Sbjct  87    TGNPANVQHILKTHFHLYQKGPFTRYTLFDFLGNGIFNADGNTWKFQRKVASHEFSTKSL  146

Query  1234  RELVMKTLEEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssd  1055
             R+ V   ++ E+  RL P+L AAA N +VLDLQD+L+RF FD+ICKI             
Sbjct  147   RKFVEIVVDTEISQRLVPILSAAAANKTVLDLQDILQRFTFDSICKI-AFGYDPAYLLPS  205

Query  1054  ssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRV  875
                    DAF+++  I + R       +WK ++   VGSEK+L E +  V D  + I++ 
Sbjct  206   LPPAPFADAFEESIRIISDRFNCAFPILWKIRKLLGVGSEKRLTETMSQVRDFAKNIVKE  265

Query  874   RKQEKANNIAAGAGSDFLSRLLDAGHKDEV-VRDMVISFLVAGRDTTSSALTWFFWLLSK  698
             +KQE A N ++    D LSR L +G  DE  V D+VISF++AGRDTTS+ALTWFFWL+S+
Sbjct  266   KKQELAKN-SSLESVDLLSRFLSSGISDETFVTDVVISFILAGRDTTSAALTWFFWLISR  324

Query  697   HPNIETTVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             +P +ET + K++   ++ +   F+ +++M Y  A LCE+MRLYPPV  DSK A  +DVLP
Sbjct  325   NPQVETEIFKEI--QENTEAPIFEEVKDMIYTHASLCETMRLYPPVPVDSKTAIGNDVLP  382

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQ-GKLKMIS-----PFKFPV  356
             DGTP+ +G RVT+ PYAMGR+E LWG DW++F+P+RW  +Q G  K  S     PF +PV
Sbjct  383   DGTPVKKGTRVTYHPYAMGRLEALWGADWVDFRPERWLLQQDGARKKWSFVGRDPFTYPV  442

Query  355   FQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVH  182
             FQAGPRVCLGKEMAF+QMK VV+ +L +F++ P  E   +PV++   T  M  G  VR+ 
Sbjct  443   FQAGPRVCLGKEMAFLQMKRVVSGVLSKFKVVPAMEDGHEPVYIADFTNKMRGGFPVRIE  502

Query  181   MR  176
              R
Sbjct  503   ER  504



>gb|AJD25219.1| cytochrome P450 CYP94A49 [Salvia miltiorrhiza]
Length=502

 Score =   413 bits (1061),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 220/467 (47%), Positives = 303/467 (65%), Gaps = 12/467 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             +YP++G +L+ +KN+   + W + ++ S+PT T  +HR    R + TA+A NV+++LKN+
Sbjct  37    TYPVVGSILTIWKNKERRVQWISDMIISTPTLTFTLHRPLGYRQMFTANAANVQHILKNH  96

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+PKG     IL DFLG GIFN DGD W  QR+LASH+F  RSLR+ V   ++ E+  
Sbjct  97    FYNYPKGATFRTILSDFLGDGIFNADGDTWKFQRQLASHQFNTRSLRKFVETVVDSELSD  156

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P L  AA +++ +DLQD+L+RFAFD IC+I+ G DP  L  S    E  V  FD+A 
Sbjct  157   RLVPTLAIAASSAAAVDLQDILQRFAFDNICRIAFGYDPAYLLPSLPEVEFAV-VFDEAL  215

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
              + + R  + +  +WK KRA  VG EK+LRE +  + +  + I R +K+E     ++   
Sbjct  216   HLISERFNSNIPFLWKMKRALGVGKEKQLREKVGEIREFAKRITREKKEELRRK-SSLES  274

Query  832   SDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI---KQ  665
              D LSR L +G+ DE  V D+V+ F++AGRDTTS+ALTWFFWLLS HP +E  ++   KQ
Sbjct  275   EDLLSRFLSSGNSDEDFVTDVVVCFILAGRDTTSAALTWFFWLLSSHPEVEEEILREMKQ  334

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
                SDD  +  +D ++ M Y  A LCE+MRLYPPV   +K A+ DDVLPDGT + +G R+
Sbjct  335   GRESDDGGS--YDEVKSMVYTHAALCEAMRLYPPVPVSTKSASCDDVLPDGTVVKKGTRI  392

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQ-GKLKMIS--PFKFPVFQAGPRVCLGKEMA  314
             ++ PYAMGR+E +WG DW EF+P RW D   GK   +   P+ +PVFQAGPR+CLGK+MA
Sbjct  393   SYHPYAMGRVEKVWGPDWAEFRPLRWLDHAGGKWSFVGRDPYTYPVFQAGPRICLGKDMA  452

Query  313   FIQMKFVVASILRRFEIRPVCES-QPVFVPLLTGYMAKGLYVRVHMR  176
             F+QMK V A ILRRF + P  ES  PV+V   T  M  G  VR+  R
Sbjct  453   FLQMKRVAAGILRRFRVLPAEESVAPVYVSDFTSKMKGGFMVRIQER  499



>ref|XP_011080016.1| PREDICTED: cytochrome P450 94A2-like [Sesamum indicum]
Length=508

 Score =   413 bits (1061),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 217/469 (46%), Positives = 305/469 (65%), Gaps = 12/469 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP++G +L  +KN+   + W + +L S P  T  + R    R + TA+A NV++MLK
Sbjct  38    PSSYPVLGSILVIWKNKERRVQWISDILTSVPNLTFTLRRPFGYRQIFTANAANVQHMLK  97

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             ++F N+PKGE   + L DFLG  IFN DGD W  QR+++SH+F  RSLR+ V   ++ E+
Sbjct  98    SHFYNYPKGEVFRRTLRDFLGDSIFNADGDNWKFQRQVSSHQFNTRSLRKFVETVVDSEL  157

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA   +VLD QD+L+RFAFD IC I+ G DP  L  S   A+  V  FD+
Sbjct  158   SNRLVPILTNAAARKTVLDFQDILQRFAFDNICTIAFGYDPAYLLPSLPEAKFAV-TFDR  216

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE-KANNIAA  842
             A  + A R  + +  +WK KRA +VGSE++L+  ++ V +  + IIR +KQE K  N  +
Sbjct  217   ALRLIAERFNSNIPFIWKIKRALSVGSERQLKITVEEVREFAKGIIREKKQELKEKN--S  274

Query  841   GAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWL+  HP +E+ ++K+
Sbjct  275   LESEDVLSRYLSSGHLDEDFVTDVVISFILAGRDTTSAALTWFFWLIFNHPGVESEILKE  334

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             +   + ++ + +D ++ M Y  A LCE+MRLYPPV   +K A  DDVLPDGT + +G R+
Sbjct  335   IKEMNSEEPV-YDEVKSMVYTHASLCEAMRLYPPVPVSTKSALKDDVLPDGTLVKKGTRI  393

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMI-----SPFKFPVFQAGPRVCLGKE  320
             ++ PYAMGR+E +WG DW EF+P RW + +   K         F +PVFQAGPRVCLGKE
Sbjct  394   SYHPYAMGRVEKVWGADWAEFRPGRWLELEETAKKWRFVGRDSFTYPVFQAGPRVCLGKE  453

Query  319   MAFIQMKFVVASILRRFEIRPVCES-QPVFVPLLTGYMAKGLYVRVHMR  176
             MAF+QMK VVA +LRRF++ PV ++ +PV+    T  M  G  V++  R
Sbjct  454   MAFLQMKRVVAGVLRRFKVVPVVQNLEPVYASDFTSKMKGGFLVKIEER  502



>ref|XP_009620147.1| PREDICTED: cytochrome P450 94A2-like [Nicotiana tomentosiformis]
Length=511

 Score =   413 bits (1062),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 216/473 (46%), Positives = 296/473 (63%), Gaps = 12/473 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   + W   ++ ++   T  ++R    R + TA+  NV++MLK
Sbjct  42    PKSYPIIGSYFSILANKDRRIQWTCDVIQNTSNLTFTLNRPFGFRQIFTANPSNVQHMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  + KG  +   + DFLG GIFNVDGD+W  QR++ASHEF  +SLR  V   ++ E+
Sbjct  102   TQFHIYQKGNVLKTTMADFLGDGIFNVDGDIWKYQRQVASHEFNTKSLRNFVETVVDTEL  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P+L  AA   +V+D QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF++
Sbjct  162   NERLIPILATAAAKKTVVDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV-AFEE  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  +S+ R  A    +WK KR  N+GSEKK    +  V    +E+++  KQ +     + 
Sbjct  221   AVRLSSERVNAIFPFLWKIKRKLNIGSEKKFGAAVDEVRQFAKELVK-EKQRELKEKTSL  279

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+S HP +E+ ++K++
Sbjct  280   ESVDLLSRFLSTGHSDENFVTDIVISFILAGRDTTSAALTWFFWLISGHPEVESQILKEI  339

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
              +  +     +D +++M Y  A LCESMR YPPV  DSK AA D++LPDGT + +G RV+
Sbjct  340   KAKSECPV--YDEVKDMIYTHASLCESMRFYPPVPIDSKAAAEDNILPDGTFVKKGTRVS  397

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQG-----KLKMISPFKFPVFQAGPRVCLGKEM  317
             + PYAMGR+E LWG DW EF+P+RW D+           +  + +PVFQAGPR+CLGKEM
Sbjct  398   YHPYAMGRVEKLWGKDWAEFRPERWLDKDDVSDNWTFVAMDTYTYPVFQAGPRICLGKEM  457

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREGYN  164
             AF+QMK VVA +LRRF++ PV E   +PVFV  LT  M  G  V +  R   N
Sbjct  458   AFLQMKRVVAGVLRRFKVVPVVEKGVEPVFVSYLTAKMKGGFPVTIEERNSTN  510



>ref|XP_006351638.1| PREDICTED: cytochrome P450 94A2-like [Solanum tuberosum]
Length=501

 Score =   412 bits (1060),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 214/470 (46%), Positives = 301/470 (64%), Gaps = 12/470 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N++  + W + ++ ++   T  + R    R + TA+  NV+Y+LK
Sbjct  35    PKSYPIIGSYFSILANKHRRIQWTSDVIQTTTNLTFTLIRPFGFRQIFTANPSNVQYILK  94

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F  + KG      + DFLG GIFNVDG++W  QR++ASHEF  +SLR+ V   ++ E+
Sbjct  95    THFHIYQKGHVFKSTMADFLGDGIFNVDGEIWKYQRQVASHEFNTKSLRKFVETVVDTEL  154

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P L  AA    V+D QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF++
Sbjct  155   NERLIPFLAVAAAEKKVVDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV-AFEE  213

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A ++S+ R  A +  +WK KR FN G+EKK +  +  V    +++++  KQ + N  ++ 
Sbjct  214   AVKLSSERFNAILPFLWKIKRHFNFGTEKKFKIAVDEVRQFAKQLVK-EKQRELNEKSSL  272

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L  GH DE  V D+VISF++AGRDTTS+ALTWFFWL+S+HP +E++++ ++
Sbjct  273   DSVDLLSRFLSVGHTDEDFVTDIVISFILAGRDTTSAALTWFFWLISEHPVVESSILNEI  332

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
              S  +    N   ++EM Y  A LCESMR YPPV  DSK A  D+VLPDGT + +G RV+
Sbjct  333   KSKSESPVYN--EVKEMIYTHASLCESMRFYPPVPIDSKTATEDNVLPDGTFVKKGTRVS  390

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMISP--FKFPVFQAGPRVCLGKEM  317
             + PYAMGR + LWG DW +FKP+RW D     G    ++   + +PVFQAGPR+CLGKEM
Sbjct  391   YHPYAMGRADKLWGKDWDKFKPERWLDRDEVTGNWNFVTKDMYTYPVFQAGPRICLGKEM  450

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMRE  173
             AF+QMK VVA +LRRF++ PV E   +PVF+  LT  M  G +V +  R+
Sbjct  451   AFLQMKRVVAGVLRRFKVVPVTEKGVEPVFISYLTAKMKGGFHVTIEERD  500



>ref|XP_009377718.1| PREDICTED: cytochrome P450 94A1-like [Pyrus x bretschneideri]
Length=506

 Score =   412 bits (1060),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 231/474 (49%), Positives = 308/474 (65%), Gaps = 16/474 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SY IIG   S YKN    L W+T LL SSP+ T  +H     R VVTA+   V+++LK
Sbjct  35    PKSYSIIGTFPSLYKNHRRRLPWFTDLLRSSPSNTFTLHHSLGRRFVVTANPTVVQHILK  94

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+ KGE +   L D LG GI N DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  95    TNFPNYQKGEKIRTTLADLLGDGILNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  154

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L A+A +SSVLD QD+L+RF FD IC+I+ G DP  L  S   A+  V AFD 
Sbjct  155   SDRLIPILSASAASSSVLDFQDILQRFGFDNICRIAFGYDPDYLLPSLPEAKFAV-AFDD  213

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A +IS  R   P   VWK KRA  +GSE++LR  +  V +  + I+R +K++  +   A 
Sbjct  214   AVQISGDRFRLP-HPVWKLKRALGIGSERRLRAVVSEVGEFAKTIVREKKRD-LSEAKAL  271

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLS++P +E  +++++
Sbjct  272   ESVDLLSRFLSSGHTDEKFVTDIVISFILAGRDTTSAALTWFFWLLSQNPRVENEILREI  331

Query  661   ---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
                 SS+      +D ++EM Y  A LCESMRLYPPV  DSK  ANDDVLPDGT + +G 
Sbjct  332   NEAASSESAAGGGYDEVKEMVYTHAALCESMRLYPPVPTDSKQVANDDVLPDGTKVKKGM  391

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG--KLKMIS--PFKFPVFQAGPRVCL  329
              VT+  YAMGRME +WG DW E++P+RW   +E+G  K K +    + +PVFQAGPR+CL
Sbjct  392   TVTYHVYAMGRMEEIWGADWAEYRPERWLEREERGAHKWKFVGRDTYSYPVFQAGPRICL  451

Query  328   GKEMAFIQMKFVVASILRRFEIRP---VCESQPVFVPLLTGYMAKGLYVRVHMR  176
             GKEMAF+QMK VV+++L+RF++ P      +QP  +P LT  M  GL V V  R
Sbjct  452   GKEMAFLQMKRVVSAVLKRFKVVPREREGGAQPELLPYLTAKMKGGLPVTVLER  505



>ref|XP_004249120.1| PREDICTED: cytochrome P450 94A2 isoform X1 [Solanum lycopersicum]
Length=496

 Score =   412 bits (1058),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 224/470 (48%), Positives = 303/470 (64%), Gaps = 21/470 (4%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G L  F  NR+  L+W T +L++  T T V +R G    V+TA+  NVE+MLK NF
Sbjct  35    YPLVGALPEFLLNRHQFLEWTTNVLSNCTTNTAVFYRPGNIHGVMTANPLNVEHMLKANF  94

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              NFPKG      L DFLG GIFNVDG++W  QRK AS+EF+ RSLR  VM+T + E+  R
Sbjct  95    ENFPKGFRFYTRLEDFLGDGIFNVDGEIWKIQRKSASYEFSTRSLRNFVMQTAQVEIHTR  154

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+LE A++   ++D+QD+L RFAFD I K++   D  CL  ++S     + AFD A+ 
Sbjct  155   LIPILEEASQRGRIIDIQDILERFAFDNIIKLAFNVDANCLGGAESE---FMQAFDIATT  211

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M  +  ++K K+  N+GSEKKL+E IKVVH+  + II  R +E+          
Sbjct  212   LSSGRFMYAIPFLYKIKKILNIGSEKKLQESIKVVHEFADNIINSRMEERDEK----KDE  267

Query  829   DFLSRLLDAGHKDEV----VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             D LSR +  G  +EV    +RD+VISF++AGRDTTSSALTWFFW+LS   +IE  +++++
Sbjct  268   DLLSRFM--GDSNEVSAKFLRDIVISFILAGRDTTSSALTWFFWILSSRKDIEQKILEEL  325

Query  661   LSSDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
             +    +      +  NFD LREM Y+ A + ESMRLYPPV  D++    D++LPDGT I 
Sbjct  326   VEVRGRNGKKIGEAYNFDELREMQYLHAAISESMRLYPPVPIDTRSCLKDEILPDGTFIG  385

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKE  320
             +   +++  Y+MGRMENLWG D  E+KP+RWFDE G  K  SPFKFPVF AGPR+CLGK+
Sbjct  386   KDWFISYQTYSMGRMENLWGKDCCEYKPERWFDENGVYKQESPFKFPVFHAGPRMCLGKD  445

Query  319   MAFIQMKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMR  176
             MA+IQMK + AS+L  FE     E+   P +V  LT  M  GL V V  R
Sbjct  446   MAYIQMKSIAASVLEMFEFDVQLENGKCPEYVLSLTLRMKGGLPVEVKER  495



>emb|CDX72120.1| BnaC08g27540D [Brassica napus]
Length=495

 Score =   411 bits (1056),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 298/466 (64%), Gaps = 10/466 (2%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYPI+G +    KNR+  LDW  + L+  PT+T V  R G  + V+TA+  NVEYMLK  
Sbjct  32    SYPIVGSIPGLVKNRHRFLDWTVETLSRCPTQTAVFRRPGKQQFVMTANPANVEYMLKTK  91

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F NFPKGE   +IL DFLGRGIFN DG++W  QRK ASHEF+ +SLR+ VM  +  E++ 
Sbjct  92    FDNFPKGERFIEILEDFLGRGIFNSDGEMWWKQRKTASHEFSTKSLRDFVMTNVTLEINT  151

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L AAA    +L+L D+L RF FD ICK++   D  CL    ++    +  FD AS
Sbjct  152   RLVPVLAAAATTGKLLNLDDLLERFTFDNICKLAFNVDSACLGDDKAAGVEFMKVFDTAS  211

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
             +I ++R  +     WK K+  N+GSE+ LRE I  VH   ++I+R +  +  NN      
Sbjct  212   KIISQRFQSAFSYSWKIKKKLNIGSERLLRESIVTVHKFADDIVRHKIDQSNNN--NNKS  269

Query  832   SDFLSRLLDAGHKD--EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
              D LSR +     +  E +RD VI F++AGRDTTSSAL+WFFWLLSKHP++E   I+Q L
Sbjct  270   EDLLSRFISTEELNSPEKLRDNVIGFILAGRDTTSSALSWFFWLLSKHPHVENK-IRQEL  328

Query  658   SSDDQKT---LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             +S   +T     F+ L+ MNY+ A + ES+RLYPP+  D+     D VLPDGT + +   
Sbjct  329   NSIRARTGEAYGFEDLKLMNYLHAAITESLRLYPPIPLDTMSCLEDSVLPDGTFLGKAWG  388

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDE-QGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
             ++++ YAMGRME++WG D   F P+RW DE  G  +  SP+KFPVF AGPR+CLGKEMA+
Sbjct  389   ISYNAYAMGRMESIWGKDCDRFDPERWIDETNGGFRGESPYKFPVFHAGPRMCLGKEMAY  448

Query  310   IQMKFVVASILRRFEIR-PVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             IQMK +VA++L RF +  P  + +P  +  +T  +  GL+VRVH R
Sbjct  449   IQMKSIVAAVLDRFVVEVPGKDERPEILLSVTIRIKGGLFVRVHER  494



>gb|AED99869.1| cytochrome P450 [Panax notoginseng]
Length=489

 Score =   411 bits (1056),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 226/449 (50%), Positives = 299/449 (67%), Gaps = 17/449 (4%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWYT LL  SPT TI VH L     ++T++ ENVEYMLK NF N+PKG+P + ILGD 
Sbjct  49    LCDWYTHLLQESPTGTIHVHVLD---NIITSNPENVEYMLKTNFDNYPKGKPFSTILGDL  105

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAA---RNSS  1151
             LG+GIFNVDG+ W  QRK+AS E  + S+R    +T+  E++ RL PLL ++A   + S 
Sbjct  106   LGKGIFNVDGEKWKFQRKMASLELGSLSIRSYAFETVTWEINNRLIPLLSSSAVGCKKSG  165

Query  1150  VLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAV  971
             V+DLQD+ RRF+FD ICK S G DPGCL  S   +E   +AFD AS++SA+R +     V
Sbjct  166   VVDLQDIFRRFSFDNICKFSFGVDPGCLKLSLPLSE-FAEAFDLASKLSAQRALTASPVV  224

Query  970   WKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKD  791
             WK KR  N+GSEKKLR+ IK V    EE+IR ++      +      D LSR + + + D
Sbjct  225   WKVKRLLNLGSEKKLRKAIKKVDVLAEEVIRQKRL-----MGFSTNDDLLSRFMGSINDD  279

Query  790   EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS---SDDQKTLNFDHL  620
             + +RD+VISFL+AGRDT +SALT FFWLL +HP + T++  ++ S       K    D L
Sbjct  280   KYLRDIVISFLLAGRDTVASALTSFFWLLDQHPGVVTSIRDELSSPSGGQQHKLAGVDQL  339

Query  619   REMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWG  440
             RE +Y++A L ESMRLYPPV +DSK    DDVLPDGT + +G R+T+ PYAMGRME++WG
Sbjct  340   REFHYLQAALYESMRLYPPVQFDSKFCQQDDVLPDGTFVRKGTRLTYHPYAMGRMESIWG  399

Query  439   NDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIR  260
             +D L+FKP RW  E G  +  SP+K+PVFQAG RVCLGKEMA ++MK V  ++++RF+I+
Sbjct  400   SDCLQFKPQRWL-ENGVFQPESPYKYPVFQAGLRVCLGKEMALMEMKSVAVALIQRFDIQ  458

Query  259   PVCESQP-VFVPLLTGYMAKGLYVRVHMR  176
              V  S   +F P LT  M  G  V +  R
Sbjct  459   XVAPSSTMLFAPGLTATMRGGFPVTIRER  487



>ref|XP_007200096.1| hypothetical protein PRUPE_ppa019319mg, partial [Prunus persica]
 gb|EMJ01295.1| hypothetical protein PRUPE_ppa019319mg, partial [Prunus persica]
Length=506

 Score =   410 bits (1055),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 222/472 (47%), Positives = 303/472 (64%), Gaps = 16/472 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYPIIG  ++ YKN    L W+T LL SSP+ T+ +H       VVT +   V+++LK +
Sbjct  37    SYPIIGSFITLYKNHERRLPWFTDLLRSSPSNTLTIHHSLGKHFVVTGNPTVVQHILKTH  96

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F  + KG      L D LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+  
Sbjct  97    FPIYEKGNTFRTTLTDLLGDGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTELSD  156

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L AAA N+ +LD QD+L+RFAFD IC+I+ G DP  L  +   A+  V AFD A 
Sbjct  157   RLIPILSAAATNNLILDFQDILQRFAFDNICRIAFGYDPAYLLPTLPEAKFAV-AFDDAV  215

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
             +IS  R  +    VWK KR   +GSEK+LR  +  V +    I+R +K+E +   A  + 
Sbjct  216   QISGDR-FSSFSQVWKLKRFLGIGSEKRLRAAVSEVREFANTIVREKKRELSEKKALES-  273

Query  832   SDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
              D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++P++E  ++K++  
Sbjct  274   VDLLSRFLGSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNPHVEDEILKEISR  333

Query  655   SD--DQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
             +   +  T  +D + EM Y  A LCESMRLYPPV  +SK A  DDVLPDGT + +G  VT
Sbjct  334   TTELESATGGYDEVMEMVYTHAALCESMRLYPPVPGNSKKAMKDDVLPDGTKVKKGMVVT  393

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQ-----GKLKMIS--PFKFPVFQAGPRVCLGK  323
             ++ Y+MGRME +WG DW E++P+RW +E+      K K +    F +PVFQAGPR+CLGK
Sbjct  394   YNVYSMGRMEEIWGEDWAEYRPERWLEEREENGAHKWKFVGRDSFSYPVFQAGPRICLGK  453

Query  322   EMAFIQMKFVVASILRRFEIRPV---CESQPVFVPLLTGYMAKGLYVRVHMR  176
             EMAF+QMK VV+++L+ F++ PV     +QP FV  LTG M  G  V +  R
Sbjct  454   EMAFLQMKRVVSAVLKSFKLVPVEREGGAQPEFVAYLTGKMKGGFPVTIVER  505



>ref|XP_007162510.1| hypothetical protein PHAVU_001G157900g [Phaseolus vulgaris]
 gb|ESW34504.1| hypothetical protein PHAVU_001G157900g [Phaseolus vulgaris]
Length=514

 Score =   410 bits (1055),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/478 (46%), Positives = 305/478 (64%), Gaps = 15/478 (3%)
 Frame = -1

Query  1570  IVYTPPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVE  1391
             ++  P SYP+IG  L+  +     + W + ++  SP  T   HR      V T +   VE
Sbjct  43    VLTIPKSYPLIGSYLALKRIGNRRIQWLSDIVQISPAATFTFHRPLGGLQVFTGNPATVE  102

Query  1390  YMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTL  1211
             ++LK  F N+ KG      L DFLG GIFN DG+ W  QR++ASHEF  +S+R+ V   +
Sbjct  103   HILKTRFSNYRKGYSFITTLSDFLGTGIFNADGNTWKFQRQVASHEFNTKSIRKFVEDVV  162

Query  1210  EEEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVD  1031
             + E+  RL P++ +AA+    LD QD+L+RFAFD ICKI+ G D   L+ S   ++  V 
Sbjct  163   DAELSDRLLPIMASAAQQDQTLDFQDILQRFAFDNICKIAFGFDAEYLTPSVERSKFAV-  221

Query  1030  AFDKASEISAR--RGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKA  857
             A+++A+EIS++  R ++P+  VWK KRA N GSEK+LR  ++VVH+  + I+R +K+E  
Sbjct  222   AYEEATEISSKRFRELSPL--VWKVKRALNRGSEKRLRMAVRVVHEFAKNIVREKKKELK  279

Query  856   NNIAAGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIET  680
                   +  D LSR L +GH DE  V D+VISF++AG+DTTS+ALTWFFWLLSK+P +E 
Sbjct  280   EKEVLES-VDMLSRFLSSGHSDEDFVTDIVISFILAGKDTTSAALTWFFWLLSKNPRVEK  338

Query  679   TVIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
              ++K+++   +     +D ++ M Y  A LCESMRLYPPV  D+K AA++DVLPDGT + 
Sbjct  339   EIVKEIMEKSEAPV--YDEVKHMVYTHAALCESMRLYPPVPMDTKEAADNDVLPDGTVVK  396

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD--EQGKLKMIS--PFKFPVFQAGPRVC  332
             +G  VT+  YAMGR+E++WG DW EFKP+RW    E  K K +    F +PVFQAGPRVC
Sbjct  397   KGTLVTYHVYAMGRLESIWGEDWAEFKPERWLQKVESEKWKFVGKDSFTYPVFQAGPRVC  456

Query  331   LGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREGYN  164
             LGKEMAF+QM+ VVA ILRRF + P      +P F+  LT  M  G  V++  RE  N
Sbjct  457   LGKEMAFMQMQSVVAGILRRFTVVPTVAEGVEPNFISFLTSQMEGGFPVKIIERETSN  514



>gb|EPS62279.1| hypothetical protein M569_12509, partial [Genlisea aurea]
Length=497

 Score =   410 bits (1053),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 213/470 (45%), Positives = 308/470 (66%), Gaps = 13/470 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G     +KN+   + W  +++ ++P+ T  + R      ++TA  +NV ++LK NF
Sbjct  29    YPVLGSFYDIFKNKDRFVQWTAEIVKTTPSNTFTLRRPLGHEILITADPDNVRHILKTNF  88

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
               + KG+    +LGD LG GIFN DG++W  QR++ASHEF  +SLR+ V   +  E+ GR
Sbjct  89    HVYEKGDLFKDLLGDLLGNGIFNADGEVWKFQRQIASHEFNTKSLRKFVDTAVSAELSGR  148

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L PLL+ AA +++VLD QD+L+RFAFD+ICKI+ G DP CL+ S   +   V AFD A  
Sbjct  149   LLPLLKNAAADNTVLDFQDILQRFAFDSICKIAFGYDPECLAPSLPESAFAV-AFDNAVR  207

Query  1009  ISARRGMAPVFAVWKCKRAFNVG-SEKKLREHIKVVHDHVEEIIRVRKQEKA---NNIAA  842
              S+ R       VWK KRA N+G SE++L+  +  + +  +EIIR +K++K    NN   
Sbjct  208   FSSERFNTFHPGVWKVKRALNLGESERELKSAVTQIQNLAKEIIRQKKKKKNHLDNNDVD  267

Query  841   GAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                SD LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWLLS HP++ET ++++
Sbjct  268   EEDSDLLSRFLSSGHSDEQFVMDIVISFILAGRDTTSAALTWFFWLLSSHPHVETAILQE  327

Query  664   VLSSDDQKTLN-FDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             + ++   ++   +D ++EM YI A + E+MRLYPPV +DSK A  DDVLPDG+ + +   
Sbjct  328   INNAKQPESGGAYDEVKEMLYIHASISEAMRLYPPVPFDSKCATADDVLPDGSIVRKDMV  387

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMI----SPFKFPVFQAGPRVCLGKE  320
             V + PYAMGR + +WG+DW EF+P+RW + +   K+       + FPVFQAGPR+CLGKE
Sbjct  388   VAYHPYAMGRDDKIWGSDWSEFRPERWLENKSADKLTFVNRDAYTFPVFQAGPRICLGKE  447

Query  319   MAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             MAF+QMK V+A ++R F+I PV E   +P ++  LT  M  G  VR+  R
Sbjct  448   MAFMQMKSVIAGVVRDFKIVPVAEEGYEPEYLAFLTAKMKGGFPVRIQTR  497



>ref|XP_010938845.1| PREDICTED: cytochrome P450 94B3-like [Elaeis guineensis]
Length=519

 Score =   410 bits (1055),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 218/475 (46%), Positives = 296/475 (62%), Gaps = 18/475 (4%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G L  F KNR+ + DW  + LA+SPT TI  HR G  R V+TA+  NVE++L++NF
Sbjct  40    YPLLGNLTQFLKNRHRMADWLAEALAASPTNTITFHRPGGVRGVITANPANVEHILRSNF  99

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+ KG     IL DFLGRGIFN DG++W  QRK AS EF  RSLR  V+  +++E+  R
Sbjct  100   DNYTKGSRFASILHDFLGRGIFNSDGEVWRLQRKTASFEFNTRSLRSFVVHCVQDEILHR  159

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIsl----gsdpgclsssdssaeSLVDAFD  1022
             L PLL  A+ +   +DLQDVL RFAFD +CK++                SS     +AF+
Sbjct  160   LLPLLAEASLHGRAIDLQDVLERFAFDNVCKVAFNHDPACLAADGPERSSSDSEFAEAFE  219

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A+ +SA R    V   WK K+   +GSE++LR+ I  VH    +IIR RK+E   + ++
Sbjct  220   DAANLSAGRFRYAVPRFWKIKKLLRIGSERRLRKSIATVHAFANQIIRSRKKENWTSSSS  279

Query  841   GAGSDFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 D LSR + +  H +E +RD+VISFL+AGR+TTSSAL+WFFWLLS  P +E  ++  
Sbjct  280   PRADDLLSRFVANEDHSEEFLRDIVISFLLAGRETTSSALSWFFWLLSSRPEVERKILDD  339

Query  664   VLS-----------SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLP  518
             + S              + T +F+ LREM+Y+ A + E+MRLYPPV  +S     DDVLP
Sbjct  340   IRSVRLRNRSSSGGGGCETTFDFEELREMHYLHAAITEAMRLYPPVPMNSTECQGDDVLP  399

Query  517   DGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPR  338
             DGT + +G  +++S YAMGRME +WG D LE++P+RW  E+G  +  SPFKF  F AGPR
Sbjct  400   DGTAVKKGWFMSYSSYAMGRMEAIWGKDCLEYRPERWL-EEGLFRPESPFKFAAFHAGPR  458

Query  337   VCLGKEMAFIQMKFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMR  176
             +CLGKEMA+IQMK + A +L RF I  V  ++ P  +  LT  M  GL VRV  R
Sbjct  459   MCLGKEMAYIQMKSIAACVLERFVIEVVDKDTCPEKMMSLTLRMRGGLPVRVMQR  513



>gb|AJD25221.1| cytochrome P450 CYP94C54 [Salvia miltiorrhiza]
Length=491

 Score =   409 bits (1052),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 233/470 (50%), Positives = 306/470 (65%), Gaps = 26/470 (6%)
 Frame = -1

Query  1546  PIIGC--LLSFYKNRYCL-----LDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEY  1388
             P  GC    +F  +R+ L      DWY+ LLA SPT TI VH LG    V+TA+ ENVE+
Sbjct  35    PSCGCETCQTFLTSRWALEYNNLCDWYSHLLAKSPTGTIHVHVLG---NVITANPENVEH  91

Query  1387  MLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLE  1208
             MLK  F N+PKG+  + ILGD LGRGIFNVDGDLW  QRK+A  E  + S+R      + 
Sbjct  92    MLKTKFENYPKGKQFSAILGDLLGRGIFNVDGDLWRFQRKMACLELGSVSVRSHAFDIVT  151

Query  1207  EEVDGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDA  1028
              E++ RL PLL    R+SS  DLQD+ RRF+FD+IC+ S G DPGCL+ S  + E    A
Sbjct  152   SEIESRLVPLL----RSSSDFDLQDIFRRFSFDSICRFSFGLDPGCLAPSLPACE-FAAA  206

Query  1027  FDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             FD AS++SA R +A    VWK KR  N+GSE++L++ I+ VH+  E +IR +++      
Sbjct  207   FDLASKLSAERAIATSPLVWKVKRFLNLGSERRLKQAIRSVHELAEGVIRHKREH-----  261

Query  847   AAGAGSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               GA  D LSR +     D  +RD+VISFL+AGRDT +SALT FFWLLS++P +   + +
Sbjct  262   -GGAHGDLLSRFMGTTDDDVFLRDIVISFLLAGRDTVASALTSFFWLLSRNPAVVDAIRE  320

Query  667   Q---VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             +   V+  D ++T+ F  LREM++++A + ESMRL+PPV +DSK   NDDVL DGT + R
Sbjct  321   ESDRVIGGDREETVTFAQLREMHHLQAAVHESMRLFPPVQFDSKFCENDDVLADGTFVSR  380

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEM  317
             G RVT+ PYAMGRME +WG   L+F P+RW  E G  K   PFK+PVFQ G RVCLGKEM
Sbjct  381   GTRVTYHPYAMGRMERIWGEAPLQFAPERWL-ENGVFKHKDPFKYPVFQGGIRVCLGKEM  439

Query  316   AFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMREG  170
             A ++MK V  SI+RRF+I  +   Q P F+P LT  +  GL   V +REG
Sbjct  440   ALVEMKAVALSIIRRFDIEVIGSGQAPKFMPGLTASIRGGLPAIVTVREG  489



>emb|CDY32022.1| BnaC06g16000D [Brassica napus]
Length=499

 Score =   409 bits (1052),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 215/469 (46%), Positives = 300/469 (64%), Gaps = 13/469 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYPI+G +    KNR+  LDW  + L+  PT+T V  R G  + V+TA+  NVE+MLK  
Sbjct  33    SYPIVGSIPGLVKNRHRFLDWTVETLSRCPTQTAVFRRPGNQQFVMTANPANVEFMLKTK  92

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F +FPKGE     L DFLGRGIFN DG++W  QRK AS+EF+ RSLR+ VM  +  E++ 
Sbjct  93    FDSFPKGERFISFLEDFLGRGIFNSDGEMWWKQRKTASYEFSTRSLRDFVMTNVTVEINT  152

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L AAA     +DLQD+L RFAFD ICK++   D  CL    +     + AF+ A+
Sbjct  153   RLVPVLAAAATAGKPIDLQDILERFAFDNICKLAFNVDAACLGDDGADGVEFMKAFETAA  212

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
              I ++R  + V   WK K+  ++GSEK LRE I  VH   ++I+R R  ++A   ++   
Sbjct  213   TIISKRFQSVVSYSWKIKKKLDIGSEKVLRESIVTVHKFADDIVRHRTDDQAR--SSNTN  270

Query  832   SDFLSRLLDAGHKD--EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
              D LSR ++       E++RD+VISF++AGRDTTSSAL+WFFWLLSKHP +E   I+Q L
Sbjct  271   EDLLSRFINIEEMSSPELLRDIVISFILAGRDTTSSALSWFFWLLSKHPEVEDK-IRQEL  329

Query  658   SSDDQKT-------LNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
             +S   +T         F+ L+ MNY+ A + ES+RLYPPV  D+  +  D+VLPDGT + 
Sbjct  330   NSIRARTGKRVGEVYGFEELKLMNYLHAAITESLRLYPPVPVDTMSSVEDNVLPDGTFVG  389

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-QGKLKMISPFKFPVFQAGPRVCLGK  323
             +   ++++ YAMGRME++WG     F P+RW DE  G  +  +P+KFPVF AGPR+CLGK
Sbjct  390   KAWGISYNAYAMGRMESIWGKGCDRFDPERWIDETNGGFRGENPYKFPVFHAGPRMCLGK  449

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             EMA+IQMK +VA++L RF +    + +P  +  +T  M  GL+ R+H R
Sbjct  450   EMAYIQMKSIVAAVLDRFVVEVRVKERPEILLSMTLRMKGGLFARIHER  498



>ref|XP_010906405.1| PREDICTED: cytochrome P450 94A1 [Elaeis guineensis]
Length=506

 Score =   410 bits (1053),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 306/470 (65%), Gaps = 17/470 (4%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP++G L  + KNR+  L+W T++L  +PT T+    LG    ++TA+  NVE+MLK N
Sbjct  38    SYPLLGNLPQYLKNRHRFLEWSTEILIKTPTYTMTFQSLGQVSGIITANTLNVEHMLKTN  97

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F+N+PKG     +L DFLG+GIFN DG+ W  QRK AS+EF  +SLR  V+ T++ E+  
Sbjct  98    FVNYPKGTRSISMLEDFLGQGIFNSDGEHWKWQRKAASYEFNKKSLRNFVVDTVQYEIVQ  157

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIsl----gsdpgclsssdssaeSLVDAF  1025
             RL PLL+ A++ +  ++LQDVL RFAFD ICK++      S        D+ + + + AF
Sbjct  158   RLLPLLKKASKKNETVNLQDVLERFAFDNICKVAFNEDPASLAEEERVGDTISSNFMKAF  217

Query  1024  DKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             ++A  +  RR +  +   W+ K+  N+GSE++L+E I +VH++   IIR RK+  A+   
Sbjct  218   EEAQNLVLRRFLDALDVTWRIKKLLNIGSERRLKEVISIVHNYAMNIIRSRKERPAHQY-  276

Query  844   AGAGSDFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                  D LSR   +  + +E +RD+V +FL AGR+TTSSALTWFFWLLS  P++E  +++
Sbjct  277   ----QDLLSRFASNKENTEEFLRDVVTNFLTAGRETTSSALTWFFWLLSTRPDVEKKILE  332

Query  667   QV-----LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             +V     L+ +  +  +FD LREM+Y+ A + ESMRLYPPV  D++    DD +PDGT +
Sbjct  333   EVRSVRALNQNSDEIFSFDELREMHYLHAAISESMRLYPPVPIDTQSCKEDDTMPDGTFV  392

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGK  323
              +G  V++S YAMGRMEN+WG D  +++P+RW  E G  +  +PFK+PVF AGPR+CLGK
Sbjct  393   GKGWFVSYSAYAMGRMENIWGKDCNDYRPERWL-ENGVFQPENPFKYPVFHAGPRMCLGK  451

Query  322   EMAFIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
             EMA+IQMK +VA +L RFEI  V + + P  +  LT  M  GL ++V  R
Sbjct  452   EMAYIQMKSIVACVLERFEINAVGKDKSPEHILSLTLRMKGGLPIQVRER  501



>ref|XP_010679199.1| PREDICTED: cytochrome P450 94A2-like [Beta vulgaris subsp. vulgaris]
Length=516

 Score =   410 bits (1054),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 218/480 (45%), Positives = 296/480 (62%), Gaps = 23/480 (5%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+IG L++ YK+R     W++ LL +S T T V+      R++ TA+  NVE++LK
Sbjct  39    PKSYPLIGHLIAIYKHRNERFQWFSSLLLNSRTATFVIDHPFGCRSIDTANPANVEHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  + KG     IL D LG GIFNVDG++W  QR++ASHEF+ +SLR  V   ++ E+
Sbjct  99    TRFPIYQKGPNQKAILQDLLGDGIFNVDGEMWKFQRQIASHEFSTKSLRNFVETVVDTEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA+   VLDLQD+L+RFAFD ICKI          S          AF+ 
Sbjct  159   SDRLIPILSDAAKTRKVLDLQDILQRFAFDNICKI-TFGYDPEYLSPSLPHSEFAAAFED  217

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A  IS++R  A    +WK +R  N+GSEKKL+E +  +      I+   KQ+K   +   
Sbjct  218   AVMISSQRTRAYFPYLWKIRRFLNIGSEKKLKEAVAAIRGFANSIV---KQKKLGIMKNS  274

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH +E  V D+VISF++AGRDTTS+ALTWFFWLL K+ +IE  ++++ 
Sbjct  275   ETEDLLSRFLKSGHCNEKFVTDIVISFILAGRDTTSAALTWFFWLLYKNKHIEEEILRET  334

Query  661   ------LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
                    S+  + +  F+ +++M Y  A LCESMRLYPPV  D+K AA DDVLPDGT + 
Sbjct  335   NKNRGKQSNKTEHSSVFEEVKDMVYTHAALCESMRLYPPVPVDAKQAAADDVLPDGTHVV  394

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD--------EQGKLKMI--SPFKFPVFQ  350
             +G  V + PY MGRM ++WG+DW E++PDRW +         +GK K +   P+ +PVFQ
Sbjct  395   KGMWVAYIPYVMGRMASIWGSDWAEYRPDRWLEVVEDGDKTGKGKWKFVPKDPYSYPVFQ  454

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMR  176
             AG RVCLGKEMAF+QMK VV +IL RF + P  E   +PV+VP LT  M  G  VR+  R
Sbjct  455   AGSRVCLGKEMAFLQMKRVVGAILERFRVVPAVEEGFEPVYVPTLTSKMQGGFAVRIEER  514



>ref|XP_007200970.1| hypothetical protein PRUPE_ppa004449mg [Prunus persica]
 gb|EMJ02169.1| hypothetical protein PRUPE_ppa004449mg [Prunus persica]
Length=509

 Score =   410 bits (1053),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 226/475 (48%), Positives = 306/475 (64%), Gaps = 19/475 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG  ++  KN    L W+T LL SSP+ T  +H       VVTA+   V+++LK
Sbjct  39    PKSYPIIGSFITLSKNHERRLPWFTDLLRSSPSNTFTLHHSLGKHFVVTANPTVVQHILK  98

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              +F  + KG  +   L D LG GIFN DGD W  QR+++SHEF  +SLR+ V + ++ E+
Sbjct  99    THFPIYEKGNTIRTTLTDLLGHGIFNADGDNWKFQRQVSSHEFNTKSLRKFVEQVVDTEL  158

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L ++A ++S+LD QD+L+RFAFD I +I+ G DP  L  S   A+  V AFD 
Sbjct  159   SDRLIPILSSSATSNSILDFQDILQRFAFDNISRIAFGYDPAYLLPSLPEAKFAV-AFDD  217

Query  1018  ASEISAR--RGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIA  845
             A +IS+   R ++P   VWK KR   +GSEK LR  +  V +    I+R +K+E +   A
Sbjct  218   AVQISSDRFRSLSP---VWKLKRVLGIGSEKHLRAAVSEVREFANTIVREKKRELSETKA  274

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
               +  D LSR L +GH DE  V D+VISF +AGRDTTS+ALTWFFWLLS++ ++E  ++K
Sbjct  275   LES-VDLLSRFLCSGHSDEKFVTDIVISFTLAGRDTTSAALTWFFWLLSQNQHVEDEILK  333

Query  667   QVLS--SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             ++    S +     +D ++EM Y  A LCESMRLYPPVA DSK A  DDVLPDGT + +G
Sbjct  334   EISGTVSSESAAGGYDEVKEMVYTHAALCESMRLYPPVAADSKQAMKDDVLPDGTKVKKG  393

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWF--DEQG--KLKMIS--PFKFPVFQAGPRVC  332
               VT+  YAMGRME +WG DW E++P+RW   +E G  K K +    F +PVFQAGPR+C
Sbjct  394   MTVTYHVYAMGRMEEIWGEDWAEYRPERWLEREENGAHKWKFVGKDSFTYPVFQAGPRIC  453

Query  331   LGKEMAFIQMKFVVASILRRFEIRPV---CESQPVFVPLLTGYMAKGLYVRVHMR  176
             LGKEMAF+QMK VV+++L+RF++ PV     +QP FV  LTG M  G  V +  R
Sbjct  454   LGKEMAFLQMKRVVSAVLKRFKVVPVEREGGAQPEFVAYLTGKMKGGFPVTIVER  508



>ref|XP_006364779.1| PREDICTED: cytochrome P450 94A2-like [Solanum tuberosum]
Length=497

 Score =   409 bits (1052),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 304/468 (65%), Gaps = 17/468 (4%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G L  F  NR+  L+W T +L++  T T V +R G    V+TA+  NVE+MLK NF
Sbjct  35    YPLVGALPEFLLNRHRFLEWTTDVLSNCVTNTAVFYRPGNVHGVMTANPLNVEHMLKANF  94

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              NFPKG      L DFLG GIFNVDG++W  QRK AS+EF+ RSLR  VM+T + E+  R
Sbjct  95    ENFPKGFRFYTRLQDFLGDGIFNVDGEIWKIQRKSASYEFSTRSLRNFVMETAQVEIHTR  154

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+LE A +   ++D+QD+L RFAFD I K++   DP CL  ++S     + AFD A+ 
Sbjct  155   LIPILEEATKKDRIIDIQDILERFAFDNIIKLAFNVDPNCLGGAESE---FMQAFDIATT  211

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M  +  ++K K+ FN+GSEKKL++ IK+VH+  + II  R +E+A         
Sbjct  212   LSSGRFMYAIPFLYKIKKTFNIGSEKKLQKSIKIVHEFADNIINSRIEERAEK----KDE  267

Query  829   DFLSRLLDAGHK--DEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
             D LSR +   ++   + +RD+VISF++AGRDTTSSALTWFFW+LS   +IE  ++++++ 
Sbjct  268   DLLSRFMGDSNQVSAKFLRDIVISFILAGRDTTSSALTWFFWILSSRKDIEQKILEELVQ  327

Query  655   SDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
                +      +   FD LREM Y+ A + ESMRLYPPV  D++    DD+LPDGT I + 
Sbjct  328   IRQRNGKKIGEAYTFDELREMQYLHAAISESMRLYPPVPIDTRSCLKDDILPDGTFIGKD  387

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
               +++  Y+MGRMEN+WG D  E+KP+RWFDE G  K  +PFKFPVF AGPR+CLGK+MA
Sbjct  388   WFISYQTYSMGRMENIWGKDCCEYKPERWFDENGVYKQENPFKFPVFHAGPRMCLGKDMA  447

Query  313   FIQMKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMR  176
             +IQMK + AS+L  FE     E+   P +V  LT  M  GL V+V  R
Sbjct  448   YIQMKSIAASVLEMFEFDVQLENGKCPEYVLSLTLRMKGGLPVKVKER  495



>ref|XP_011088865.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1 [Sesamum 
indicum]
Length=505

 Score =   409 bits (1052),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 226/451 (50%), Positives = 297/451 (66%), Gaps = 16/451 (4%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWY+ LL+ SPT TI VH LG    V+TA+ ENVE+MLK  F N+PKG+P + ILGD 
Sbjct  62    LCDWYSHLLSKSPTGTIHVHVLG---NVITANPENVEHMLKTRFDNYPKGKPFSAILGDL  118

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAAR-----N  1157
             LGRGIFN DGDLW  QRK+AS E  + S+R      +  E++ RL PLL + A      +
Sbjct  119   LGRGIFNADGDLWRFQRKMASLELGSVSVRSYAFNIVTTEIESRLIPLLSSVADKCNNDS  178

Query  1156  SSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVF  977
             S  LDLQD+LRRF+FD+IC+ S G DPGCL  S   +E    AFD AS++SA R +    
Sbjct  179   SGSLDLQDILRRFSFDSICRFSFGLDPGCLRLSLPISE-FAAAFDLASKLSAERAITTSP  237

Query  976   AVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGH  797
              +WK KR FN+GSEK+L++ IK VH+  EE+IR    ++ N     +  D LS  +    
Sbjct  238   MIWKLKRFFNLGSEKQLKQAIKSVHELAEEVIR---HKRNNARPDSSHDDLLSHFICTTD  294

Query  796   KDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ---VLSSDDQKTLNFD  626
              D  +RD+V+SFL+AGRDT +SALT FFW+LSK+ ++   + ++   V+  + +K + F 
Sbjct  295   DDIFLRDIVVSFLLAGRDTVASALTSFFWILSKNTHVVEKIREESNRVMGQETEKMVEFA  354

Query  625   HLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENL  446
              LREM+Y++A + ESMRL+PPV +DSK    DDVL DGT + RG RVT+ PYAMGRME +
Sbjct  355   QLREMHYLQAAVHESMRLFPPVQFDSKFCEEDDVLADGTFVTRGTRVTYHPYAMGRMERI  414

Query  445   WGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFE  266
             WG D LEFKPDRW    G  K   PFK+PVFQAG RVCLGKEMA ++MK V  S++RRF+
Sbjct  415   WGPDCLEFKPDRWL-RGGVFKQADPFKYPVFQAGRRVCLGKEMAIVEMKTVALSLIRRFD  473

Query  265   IRPVCESQPVFVPLLTGYMAKGLYVRVHMRE  173
             I+      P F+P LT  +  GL + V  R+
Sbjct  474   IQVAMARAPTFMPGLTATLRGGLPIVVRERK  504



>ref|XP_003606223.1| Cytochrome P450 94A1 [Medicago truncatula]
 gb|ABC59093.1| cytochrome P450 monooxygenase CYP94C9 [Medicago truncatula]
 gb|AES88420.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=517

 Score =   409 bits (1051),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 310/467 (66%), Gaps = 29/467 (6%)
 Frame = -1

Query  1519  YKNRYC-LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPM  1343
             + N++  L+D+YT LL  SPT TI VH LG     +T++ ENVEY+LK NF N+PKG+  
Sbjct  60    WSNKFVNLVDYYTHLLQESPTGTIHVHVLG---NTITSNPENVEYILKTNFNNYPKGKQF  116

Query  1342  NQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAA  1163
             + ILGD LGRGIFNVDG  W  QRK+AS E  +  +R   M+ + EE+  RL PL+ + A
Sbjct  117   STILGDLLGRGIFNVDGHSWKFQRKMASLELGSVVIRSYAMELVIEEIKTRLLPLIASVA  176

Query  1162  RNSS-----------VLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKA  1016
                +           +LD+QD+LRRF+FD ICK S G DP CL  S   +  L +AFD +
Sbjct  177   EKKTASKADNTSEDVLLDMQDILRRFSFDNICKFSFGLDPCCLVPSLPVSN-LANAFDLS  235

Query  1015  SEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGA  836
             S +SA+R +     +WK KR FN+GSEKKL+E IK+V+D   E+I+ R++     I  G 
Sbjct  236   STLSAQRALTASPLIWKMKRFFNIGSEKKLKEAIKIVNDLANEMIKQRRE-----IENGV  290

Query  835   GS--DFLSRLLDA--GHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
              S  D LSR + A   H DE +RD+V+SFL+AGRDT +SALT FF LLSK+P +E  +  
Sbjct  291   ESRKDLLSRFMGALNSHDDEYLRDIVVSFLLAGRDTVASALTGFFILLSKNPKVEEKIRV  350

Query  667   QV--LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
             ++  + + +Q+   F+  REM+Y+   + ESMRL+PPV +DSK A  DDVLPDGT I +G
Sbjct  351   ELDRVMNPNQECATFEQTREMHYLNGAIHESMRLFPPVQFDSKFALEDDVLPDGTFIKKG  410

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMA  314
             +RVT+ PYAMGRMEN+WG D LEFKP+RW  + G      PFK+PVFQAG RVCLGKE+A
Sbjct  411   SRVTYHPYAMGRMENIWGPDCLEFKPERWLKD-GVFVPKCPFKYPVFQAGSRVCLGKELA  469

Query  313   FIQMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
              ++MK VVAS+++RF++R V  +Q P F P LT     GL V+++ R
Sbjct  470   IVEMKSVVASLVKRFDVRVVGPNQEPQFAPGLTASFRGGLPVKIYER  516



>ref|XP_011094380.1| PREDICTED: cytochrome P450 94C1-like [Sesamum indicum]
Length=507

 Score =   408 bits (1049),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 296/447 (66%), Gaps = 16/447 (4%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWY  LL +SPT+TI +H L      +TA+ +NVEYMLK  F NFPKG+P + ILGDF
Sbjct  65    LCDWYAHLLKNSPTRTIHIHVLN---NTITANPDNVEYMLKTRFDNFPKGKPFSAILGDF  121

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLD  1142
             LGRGIFNVDGDLW  QRK+AS E    S+R    + + +E+D RL PLLE+ +  + VLD
Sbjct  122   LGRGIFNVDGDLWRFQRKMASLELGRTSIRAYSFRVVNQEIDQRLLPLLESVSAGNQVLD  181

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
             LQDV RRF+FD+IC+ S G DP CL  S   ++  V +FD AS++SA R M     VWK 
Sbjct  182   LQDVFRRFSFDSICRFSFGLDPKCLELSLPLSKFAV-SFDLASKLSAERAMIASPIVWKI  240

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVV  782
             KR  N+GSEK+LR+ IK+VH    E+IR R++      +    +D LSR + +   +  +
Sbjct  241   KRLLNIGSEKQLRQAIKIVHLLAREVIRQRRK-----FSFSDQNDLLSRFMSSISDETYL  295

Query  781   RDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV--LSSDDQKTLNFDHLREMN  608
             RD++ISFL+AGRD+ +SALT F WL++ H +IE  ++ +   +   +Q   +++ LRE++
Sbjct  296   RDIIISFLLAGRDSMASALTSFIWLVACHQDIEAAILIEAEKIIGPNQDLTSYEQLRELH  355

Query  607   YIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWL  428
             Y+ A + ESMRLYPP+ +DSK    DD+LPDG+ + RG RVT+ PYAMGRME +WG+D L
Sbjct  356   YLHAAIYESMRLYPPIQFDSKFCLEDDLLPDGSFVKRGTRVTYHPYAMGRMEEIWGSDCL  415

Query  427   EFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEI---RP  257
             EFKP+RW          +PFK+PVFQAG RVCLGKEMA +++K V  S+LR+F +   +P
Sbjct  416   EFKPERWLRNGVFFPHENPFKYPVFQAGIRVCLGKEMALVELKTVAISLLRQFHVELAQP  475

Query  256   VCESQPVFVPLLTGYMAKGLYVRVHMR  176
              C   P F P LT   A GL V V  R
Sbjct  476   EC--TPRFSPGLTATFADGLRVLVRPR  500



>ref|XP_009781600.1| PREDICTED: cytochrome P450 94A2-like [Nicotiana sylvestris]
Length=511

 Score =   409 bits (1050),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/471 (45%), Positives = 304/471 (65%), Gaps = 12/471 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   + W + ++ ++   T  ++R    R + TA+  NV++MLK
Sbjct  42    PKSYPIIGSCFSILANKERRIQWTSDIMQNTSNLTFTLNRPFGFRQIFTANPANVQHMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  + KG+     + DFLG GIFNVDGD+W  QR+++SHEF  +SLR+ V   ++ E+
Sbjct  102   TQFHIYQKGDVFKTTMADFLGDGIFNVDGDIWKYQRQVSSHEFNTKSLRKFVETVVDTEL  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P+L  AA   +VLD QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF++
Sbjct  162   NERLIPILATAAVEKTVLDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV-AFEE  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A ++S+ R  A    VWK KR FN+GSEKK+R  +  V    +E+++ +++E     ++ 
Sbjct  221   AVKLSSERFNAIFPFVWKVKRNFNIGSEKKIRVAVNEVRQFAKELVKEKQKELKEK-SSL  279

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWL+S+HP  E  ++K+ 
Sbjct  280   DSVDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWFFWLISEHPETENQILKEA  339

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
              +  +     +D +++M Y  A LCESMR YPP+  D+K A  D++LPDGT + +G RV+
Sbjct  340   KAKSESPV--YDEVKDMIYTHASLCESMRFYPPIPIDTKAATEDNILPDGTFVKKGTRVS  397

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDE---QGKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             +  YAMGR+ENLWG DW EF+P+RW D+    G    ++   + +PVFQAGPR+CLGKEM
Sbjct  398   YHIYAMGRVENLWGKDWAEFRPERWLDKDEASGNWTFVARDTYTYPVFQAGPRICLGKEM  457

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREG  170
             AF+QMK VVA +LRRF++ P+ E   +PVF+  LT  M  G  V +  R G
Sbjct  458   AFLQMKRVVAGVLRRFKVVPLAEKGVEPVFLSYLTAKMKGGFPVTIEERNG  508



>gb|EPS65724.1| hypothetical protein M569_09053, partial [Genlisea aurea]
Length=477

 Score =   407 bits (1047),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 215/472 (46%), Positives = 307/472 (65%), Gaps = 15/472 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP+ G    F++NR   + W  +++ S+PT T  +H     R V TA A+N+ ++LK
Sbjct  7     PKSYPVFGSFFEFFRNRDRFVQWTAEIVNSTPTNTFTLHLTMGQRIVFTADADNIHHILK  66

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             ++F  + KG+       D LG GIFN DG++W  QR+LASHEF  +SLR+ V   ++ E+
Sbjct  67    SHFHVYEKGDLFKTTHRDLLGDGIFNADGEIWKFQRQLASHEFNTKSLRKFVETVVDAEL  126

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+L  AA + +VLD QD+L+RFAFD ICKI+ G DP  L+ +    E  V AF+ 
Sbjct  127   ADRLLPILRTAAADGTVLDFQDILQRFAFDNICKIAFGYDPEYLTPALPQEEFAV-AFET  185

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVG-SEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
             A  +S++R  A +   WK +RA N G SEK+L+  +  V     EIIR RK+ +   I  
Sbjct  186   AVRLSSQRFSAFLPLFWKLRRALNFGTSEKELKSAVSRVQKLAREIIR-RKRNQPGKI--  242

Query  841   GAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
               GSD LSR L +GH DE  + D+VISF++AGRDTTS+ALTWFF+LLSKHP++E  ++++
Sbjct  243   DDGSDLLSRFLSSGHSDEKFMMDIVISFILAGRDTTSAALTWFFYLLSKHPHVEDAILEE  302

Query  664   VLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRV  485
             + ++   ++  +D ++EM Y  A + ESMRLYPPV  D+K A  DDVLPDGT + +G RV
Sbjct  303   I-NAKVSESAAYDEVKEMVYTHASISESMRLYPPVPIDTKCANADDVLPDGTVVKKGMRV  361

Query  484   TFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMIS-----PFKFPVFQAGPRVCLGKE  320
             ++ PYAMGR+E +WG+DW E++P+RW  +      ++      + +PVFQAGPR+CLGKE
Sbjct  362   SYHPYAMGRVEKIWGSDWPEYRPERWLKKSPDSDRVAFVNRDAYTYPVFQAGPRICLGKE  421

Query  319   MAFIQMKFVVASILRRFEIRPVCES---QPVFVPLLTGYMAKGLYVRVHMRE  173
             MAF+QMK VVA +LR F++ PV +    +PV+V  LT  M  G  VR+  R+
Sbjct  422   MAFMQMKSVVAGVLREFKVIPVAKEEGYEPVYVFFLTAKMKGGFPVRIEARK  473



>ref|XP_009594945.1| PREDICTED: cytochrome P450 94A2-like [Nicotiana tomentosiformis]
Length=512

 Score =   408 bits (1049),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/475 (45%), Positives = 297/475 (63%), Gaps = 22/475 (5%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   + W + ++ S PT T  + R    R + T ++ NV+++LK
Sbjct  44    PRSYPIIGSYFSIKSNKNRRIQWTSDIVLSRPTLTFTLRRPFGHRHIFTGNSSNVQHILK  103

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             N+F N+ KG    + L D LG GIFN DG++W  QRKLASHEF ++SLR+ V K +  E+
Sbjct  104   NHFHNYQKGYLGKETLKDLLGNGIFNADGEIWKYQRKLASHEFNSKSLRKFVEKVVNVEL  163

Query  1198  DGRLSPLLE-AAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFD  1022
               RL P+L  AAA  + V+D+QD+L+RFAFD IC +                    +AF+
Sbjct  164   CDRLIPILTMAAASQNCVIDIQDLLQRFAFDNICMV-AYGYDPAYLLPSFPEAKFANAFE  222

Query  1021  KASEISARR--GMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             +   IS+ R   +AP   +WK KR  NVGSEKKL+     + +  +EII+    EK +N+
Sbjct  223   EVVRISSERFNSLAPF--IWKLKRILNVGSEKKLKVCATQIREMAKEIIK----EKKSNL  276

Query  847   AAGAGSDFLSRLLDAGHK---DEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETT  677
                +G D LSR L +  +   +E + D+VISF++AGRDTTS+ALTWFFWL+ K+PN+E  
Sbjct  277   TNSSGDDLLSRFLISSEQYQDEEFIIDIVISFILAGRDTTSAALTWFFWLIFKNPNVEKE  336

Query  676   VIKQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             +++++  S ++ +  +D +++M Y  A LCESMR +PPV  D+K A  DD+LPDGT + R
Sbjct  337   ILEEIAKSSNESS-TYDEVKDMPYTHASLCESMRFFPPVPVDTKEAMQDDILPDGTFVKR  395

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKMI--SPFKFPVFQAGPRVC  332
             G R+++ PYAMGR E +WG DW  FKP+RW +   + G  K +   PF +PVFQAGPRVC
Sbjct  396   GTRISYHPYAMGRAEAIWGKDWQTFKPERWLERDVKTGNWKFVPRDPFVYPVFQAGPRVC  455

Query  331   LGKEMAFIQMKFVVASILRRFEIRPVC---ESQPVFVPLLTGYMAKGLYVRVHMR  176
             LGKEMAF+QMK VV  +LRRF + PV    E +PV +  LT  M  G  VR+  R
Sbjct  456   LGKEMAFLQMKKVVVGVLRRFRVVPVVEKGEEEPVLIAYLTTKMKGGFLVRIEER  510



>ref|XP_007015870.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOY33489.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=516

 Score =   408 bits (1049),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 211/449 (47%), Positives = 293/449 (65%), Gaps = 16/449 (4%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWYT LL  SPT TI +H LG     +TAS  NVE++LK  F N+PKG+  + +LGD 
Sbjct  63    LCDWYTHLLKKSPTGTIHIHVLG---NTITASPANVEHILKTRFENYPKGKQFSALLGDL  119

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLD  1142
             LG+GIFNVDG+ W  QRK+AS E  + S+R      +  E+  RL PLL + +    VLD
Sbjct  120   LGKGIFNVDGESWRFQRKMASLELGSISIRMHAFDIVNSEIQTRLIPLLSSVSSEEQVLD  179

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
             LQDVLRRF+FD ICK                     +AFD AS++SA+RG+A   ++WK 
Sbjct  180   LQDVLRRFSFDNICKF-SFGLDPGCLMLSLPISEFAEAFDLASKLSAQRGLASSPSIWKV  238

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVV  782
             KR  N+G+EK+L+E IK+V +  +E+I  R+++  ++      +D LSR +     D+ +
Sbjct  239   KRLLNLGTEKQLKEAIKMVDEFAQEMINQRREKGFSD-----SNDLLSRFMGTVSDDKYL  293

Query  781   RDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---IKQVLSSDDQKTLNFDHLREM  611
             RD+VISFL+AGRDT +S LT FFWLLS+HP +E+ +   +++V+ S  Q+  +FD +REM
Sbjct  294   RDIVISFLLAGRDTVASGLTSFFWLLSQHPEVESAIRDELERVMGS-SQQFASFDQMREM  352

Query  610   NYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDW  431
             +Y+ A L ES+RL+PPV +DSK A  DD+LPDGT + +G RVT+ PYAMGRME +WG+D 
Sbjct  353   HYLHAALYESLRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVTYHPYAMGRMERVWGSDC  412

Query  430   LEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPVC  251
             LE+KPDRW  + G     +P+K+PVFQAG RVCLGKE++ ++MK VV +++ RF IR   
Sbjct  413   LEYKPDRWL-KNGIYNPENPYKYPVFQAGQRVCLGKEISLVEMKCVVLAVISRFNIRVAT  471

Query  250   E--SQPVFVPLLTGYMAKGLYVRVHMREG  170
             +    P F P LT  +  GL + V  RE 
Sbjct  472   DLNQAPRFAPGLTATVRGGLPILVQEREA  500



>ref|XP_002988642.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ10438.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=491

 Score =   407 bits (1047),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 293/467 (63%), Gaps = 14/467 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YP++G +  F +N +  L+W T+ + +SP+ T    R G+   + T +   VE++LK
Sbjct  33    PVLYPVVGNVFDFLRNSHRFLEWSTEYVINSPSNTFTTGRFGSTFKI-TGNPATVEHILK  91

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKGE + Q L D LG GIFNVDG+LW  QRKLAS EFT RSLRE +M +L +EV
Sbjct  92    TNFENYPKGEHLRQSLTDLLGDGIFNVDGELWKIQRKLASFEFTTRSLREFLMDSLADEV  151

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L + +R+   +DLQD+  RF FD ICK+                     AFDK
Sbjct  152   HSRLLPTLASVSRDGKEIDLQDLFMRFNFDNICKL-SFGVDPACLDPSFPEVKFAQAFDK  210

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ +S  R       VWK  RA NVG E++L+E + VV++    +++ R++EK       
Sbjct  211   ATTLSTLRFQKIHPLVWKLMRALNVGPERELKEVLDVVNEFAVSVVQKRREEKGR-----  265

Query  838   AGSDFLSRLL---DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                D LSR +        DE +RD++ISF++AG+DTT+ +L+WFFWLLS HP ++  +I+
Sbjct  266   VNQDLLSRFIGLDSTSFSDEFLRDIIISFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIR  325

Query  667   QV---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             +V   ++    +   +  LR+M Y++A LCESMRLYPPV  D+K   N DVLPDG  + +
Sbjct  326   EVGSIVAKGSNRPFTYKELRDMVYLQAALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEK  385

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEM  317
             G +V++  YAMGRME+LWG D LEFKP+RW  + G+   +SPFKFPVFQAGPRVCLGKEM
Sbjct  386   GMKVSYHVYAMGRMESLWGKDCLEFKPERWI-QDGQFVEVSPFKFPVFQAGPRVCLGKEM  444

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             A +QMK+VVA+++ +FE+  V + +P +   +T  M  GL V   +R
Sbjct  445   AMLQMKYVVAALVPKFELVVVGKEEPCYGINMTLIMKDGLPVVPKLR  491



>gb|KFK35660.1| cytochrome p450 [Arabis alpina]
Length=497

 Score =   407 bits (1046),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 219/469 (47%), Positives = 302/469 (64%), Gaps = 13/469 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYPI+G L    KNR+  LDW  + L+  PT+T V  R G  + V+TA+  NVEY+LK  
Sbjct  31    SYPILGSLPGLVKNRHRFLDWTVETLSKCPTQTAVFRRPGKRQFVMTANPANVEYILKTK  90

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F +FPKGE    IL DFLGRGIFN DGD+W  QRK AS+EF+ RSLR+ VM  +  E++ 
Sbjct  91    FDSFPKGERFISILEDFLGRGIFNSDGDMWWKQRKTASYEFSTRSLRDFVMSNVTVEINT  150

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L  AA     +D+QDVL RFAFD ICK++   D GCL    ++    + AFD A+
Sbjct  151   RLVPVLSEAAIAGKSIDIQDVLERFAFDNICKLAFNVDSGCLGDDGAAGVEFMRAFDTAA  210

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
              I ++R  + V   WK  +  N+GSE+ LRE I VVH   +EI+R R  +        + 
Sbjct  211   TIISQRFQSVVSFSWKIIKKLNIGSERVLRESIVVVHRFADEIVRNRIDQGRK---TSSN  267

Query  832   SDFLSRLL--DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
              D LSR +  D  +  E++RD+VISF++AGRDTTSSAL+WFFWLLS HP +E  +++++ 
Sbjct  268   EDLLSRFIGNDEMNSPELLRDIVISFILAGRDTTSSALSWFFWLLSLHPEVEHKLVRELK  327

Query  658   SSDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             S  ++      +   F+ L+ MNY+ A + ESMRLYPPVA D+     D+VLPDGT I +
Sbjct  328   SIRERTGKRIGEVFGFEDLKLMNYLHAAITESMRLYPPVAVDTVSCVEDNVLPDGTFIGK  387

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-QGKLKMISPFKFPVFQAGPRVCLGKE  320
                ++++ +AMGRME++WG D   F P+RW DE  G  +  +P+KFPVF AGPR CLGKE
Sbjct  388   DWGISYNAFAMGRMESIWGKDCDRFDPERWIDETTGCFRGENPYKFPVFHAGPRTCLGKE  447

Query  319   MAFIQMKFVVASILRRFEIR-PVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             MA+IQMK +VA++L RF +  P  + +P  +  +T  +  GL+V+VH R
Sbjct  448   MAYIQMKSIVAAVLERFVVEVPGKKDRPEILLSVTLRIKGGLFVKVHER  496



>ref|XP_011087220.1| PREDICTED: cytochrome P450 94A2-like [Sesamum indicum]
Length=510

 Score =   407 bits (1047),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 317/471 (67%), Gaps = 12/471 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPI G   +  KNR     W ++++ S+P  T  + R    R V+TA+A NV+++LK
Sbjct  37    PKSYPIFGSFFAILKNRERYAQWTSEIITSTPNLTFTLRRPFGRRLVLTANATNVQHILK  96

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             ++F N+ KG+     L DFLG GIFN DG+ W  QR+++SHEF  +SLR+ +   ++ E+
Sbjct  97    SHFNNYEKGDFFRSTLRDFLGDGIFNADGENWKFQRQVSSHEFNTKSLRKFLETVVDSEL  156

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P+LE AA + +VLD QD+L+RFAFD ICKI+ G DPG LS+S    +  V AF+K
Sbjct  157   SDRLVPVLENAAAHETVLDFQDILQRFAFDNICKIAFGYDPGYLSASLPEEKLAV-AFEK  215

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQE--KANNIA  845
             A ++S+ R  + +   WK K+  N+GSEK+L+  ++ V +  +EIIR +KQ+    + + 
Sbjct  216   AVKLSSDRFGSFIPYFWKIKKCLNIGSEKQLKIAVRQVREFAKEIIREKKQQLDGKSGLE  275

Query  844   AGAGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
             + +  D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFF+LLS +P +E+ +++
Sbjct  276   SSSADDLLSRFLSSGHSDEDFVADIVISFMLAGRDTTSAALTWFFYLLSINPEVESEILR  335

Query  667   QVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
             ++     + T  +D ++EM YI A LCESMRLYPPV  D+K A +DDVLPDGT + +G R
Sbjct  336   EI-KEKQEATSAYDEVKEMVYIHASLCESMRLYPPVPVDTKEALSDDVLPDGTVVRKGTR  394

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQ---GKLKMIS--PFKFPVFQAGPRVCLGK  323
             VT+ PYAMGR+E +WG DW EF P+RW + +   G+ + ++   + + VFQAGPR+CLGK
Sbjct  395   VTYHPYAMGRVEKVWGKDWAEFGPERWLEREEAAGEWRFVNRDSYTYSVFQAGPRICLGK  454

Query  322   EMAFIQMKFVVASILRRFEIRPVCE--SQPVFVPLLTGYMAKGLYVRVHMR  176
             EMAFIQMK VVA +LRRF + PV    ++PV++  LT  M  G  VR+  R
Sbjct  455   EMAFIQMKRVVAGVLRRFRVVPVVVEGAEPVYIAGLTAKMKGGFPVRIEAR  505



>ref|XP_008801229.1| PREDICTED: cytochrome P450 94C1 [Phoenix dactylifera]
Length=522

 Score =   408 bits (1048),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 290/449 (65%), Gaps = 16/449 (4%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWYT LL  SPT+TI +H L   R  +TA+ +NVE+MLK+ F N+PKG+P + ILGDF
Sbjct  58    LSDWYTHLLRQSPTRTIHIHVL---RNTITANPDNVEHMLKSRFDNYPKGKPFSSILGDF  114

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLD  1142
             LGRGIFNVDGDLW  QR LAS E  + S+R    + +  EV  RL PLL++AA    VLD
Sbjct  115   LGRGIFNVDGDLWRFQRMLASAELGSMSVRSFAFRIVSSEVCRRLLPLLDSAADTGQVLD  174

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
              Q+V RRFAFD ICKI                     AFD AS +SARR  A V A+WK 
Sbjct  175   FQNVFRRFAFDNICKI-SFGLDPGCLELSLPMSEFAAAFDTASRLSARRAAATVPAIWKA  233

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVV  782
             KR  N GSE++LR  I+V+    EE+I  R++     +   +  D LSR + +   D  +
Sbjct  234   KRLLNSGSERELRRAIRVLDLLAEELICQRRK-----LGFSSSHDLLSRFMVSVDDDRYL  288

Query  781   RDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---IKQVLSSDDQKTL--NFDHLR  617
             RD+V+SF++AGRDT SSALT FF LLS+HP  ++ +   I+QV  S        ++D LR
Sbjct  289   RDIVVSFMLAGRDTVSSALTSFFMLLSRHPAAQSKIRSEIEQVTWSGGGGGGGASYDQLR  348

Query  616   EMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGN  437
             EM+Y++A L ESMRLYPPV ++SK + +DD+LPDGT I RG RVT+  YAMGRME LWG 
Sbjct  349   EMHYVRAALYESMRLYPPVQFNSKFSVDDDILPDGTFISRGTRVTYHAYAMGRMEELWGT  408

Query  436   DWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRP  257
             D  EF+P+RW  + G     +PFK+PVFQ G RVCLGKEMA ++MK V+AS+++ F++  
Sbjct  409   DCGEFRPERWL-KNGVFACENPFKYPVFQGGLRVCLGKEMALMEMKTVIASVVQGFDVDV  467

Query  256   VCESQ-PVFVPLLTGYMAKGLYVRVHMRE  173
             +  S+ P F P LT  +  GL VRV  R+
Sbjct  468   IDGSRPPKFSPGLTAGLEGGLPVRVRRRK  496



>ref|XP_003520587.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=509

 Score =   407 bits (1047),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 216/450 (48%), Positives = 293/450 (65%), Gaps = 12/450 (3%)
 Frame = -1

Query  1498  LDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDFL  1319
             + W + ++  SP  T  +HR    R V+T +   VEY+LK  F N+ KG     IL DFL
Sbjct  61    IQWLSDIVKISPAGTFTLHRPLGRRGVITGNPATVEYILKTRFSNYQKGRTTTSILSDFL  120

Query  1318  GRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLL-EAAARNSSVLD  1142
             G GIFN DG+ W  QR++ASHEF  +SLR+ V   ++ E+  RL P+L  AAA     LD
Sbjct  121   GTGIFNADGNTWKFQRQVASHEFNTKSLRKFVEHVVDAELSNRLVPILTSAAAAQDKTLD  180

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
              QD+L+RFAFD ICKI+ G DP  L+ S   ++    AF++A+EIS++R   P+  VWK 
Sbjct  181   FQDILQRFAFDNICKIAFGFDPEYLTLSAERSK-FAQAFEEATEISSKRFREPLPLVWKI  239

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDE-V  785
             KR  N+GSE++LR  +K VH+    I+R +K+E     +  +  D LSR L +GH DE  
Sbjct  240   KRLLNIGSERRLRRAVKEVHEFARNIVREKKKELKEKQSLES-VDMLSRFLSSGHSDEDF  298

Query  784   VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLSSDDQKTLNFDHLREMNY  605
             V D+VISF++AG+DTTS+ALTWFFWLLSK+P IE  V+K+++   +     +D +++M Y
Sbjct  299   VTDIVISFILAGKDTTSAALTWFFWLLSKNPRIEKEVLKEIMEKSEAPV--YDEVKDMVY  356

Query  604   IKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLE  425
               A LCESMRLYPPV  D+K   +DDVLPDGT + +G  VT+  YAMGRME++WG DW E
Sbjct  357   THAALCESMRLYPPVPLDTKETVDDDVLPDGTVVKKGMMVTYHVYAMGRMESIWGEDWSE  416

Query  424   FKPDRWFD--EQGKLKMI--SPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRP  257
             FKP+RW +  E GK K +  + F +PVFQAGPR+CLGKEMAF+QM+ +VA ILRRF + P
Sbjct  417   FKPERWLEKVESGKWKFVGRNSFTYPVFQAGPRICLGKEMAFMQMQRLVAGILRRFTVVP  476

Query  256   VCES--QPVFVPLLTGYMAKGLYVRVHMRE  173
                   +P +   LT  M  G  V++  RE
Sbjct  477   AVAEGVEPHYFAFLTSQMEGGFPVKIIKRE  506



>ref|XP_009790300.1| PREDICTED: cytochrome P450 94A2 [Nicotiana sylvestris]
Length=504

 Score =   407 bits (1046),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 220/472 (47%), Positives = 301/472 (64%), Gaps = 16/472 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G L  F  NR+  L+W T +L++  T T V +R G    V+TA+  NVE+MLK NF
Sbjct  40    YPLVGALPEFLLNRHRFLEWTTDVLSNCTTNTAVFYRPGNVHGVITANPLNVEHMLKTNF  99

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              NFPKG      L DFLG GIFNVDG++W  QRK AS+EF+ RSLR  VM+T + E+  R
Sbjct  100   ENFPKGIRFYTRLEDFLGDGIFNVDGEIWRIQRKSASYEFSTRSLRNFVMETAQVEIHTR  159

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+LEAAA+   ++D+QD+L RFAFD I K+   +     +    +    + AF+ A+ 
Sbjct  160   LIPILEAAAKKDRIIDIQDILERFAFDNIIKL---AFNVDPNCLGGAESEFMQAFEIATT  216

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M  +  ++K K+  N+GSEKKL++ IK+VH+  ++II  R +E+A N       
Sbjct  217   LSSGRFMYAIPFLYKIKKFLNIGSEKKLQKSIKIVHEFADKIINSRMEERAEN----KDE  272

Query  829   DFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV------I  671
             D LSR + D     + +RD+VISF++AGRDTTSSALTWFFW+LS   +IE  +      I
Sbjct  273   DLLSRFMADNQFSAKFLRDIVISFILAGRDTTSSALTWFFWILSSRKDIEEKILEELEDI  332

Query  670   KQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             ++       +  NFD LREM Y+ A + E+MRLYPPV  D++    DD+LPDGT I +  
Sbjct  333   RRRNGKKIGEAYNFDELREMKYLHASISEAMRLYPPVPIDTRSCLKDDILPDGTFIGKDW  392

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
               ++  Y+MGRMEN+WG D  E+KP+RW DE G  K  SPFKFPVF AGPR+CLGK+MA+
Sbjct  393   FFSYQTYSMGRMENIWGKDCGEYKPERWIDENGVYKQESPFKFPVFHAGPRMCLGKDMAY  452

Query  310   IQMKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMREGYNN  161
             IQMK + AS+L +FE+    E+   P +V  LT  M  GL V+V  R   NN
Sbjct  453   IQMKSIAASVLEKFELDVQLENGKCPEYVLSLTLRMKGGLPVKVKERYMTNN  504



>gb|KHN12182.1| Cytochrome P450 94A1 [Glycine soja]
Length=497

 Score =   407 bits (1045),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 218/468 (47%), Positives = 302/468 (65%), Gaps = 18/468 (4%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP+IG L  F KNR+  L+W T++L  SPT T V  R      ++TA+ +NVE++LK  F
Sbjct  36    YPLIGTLPEFLKNRHRFLEWTTQVLRDSPTNTGVFSRPYKLHGILTANPDNVEHVLKTKF  95

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKGE    +L DFLG GIFN DGDLW  QRK AS+EF+ +SLR  V+  +  E+  R
Sbjct  96    DNYPKGERFIHLLQDFLGNGIFNSDGDLWKVQRKTASYEFSTKSLRNFVVDAVTFELQTR  155

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  A+  + VLDLQD+L RFAFD +CK++   DP CL    ++    + AF+ A+ 
Sbjct  156   LLPILSKASETNKVLDLQDLLERFAFDNVCKLAFNVDPACLGGDGTAGGEFMRAFEDAAV  215

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M+ +  VWK K+ FN GSE++LRE I  VH   + IIR R + K          
Sbjct  216   LSSGRFMSILPVVWKIKKLFNFGSERRLRESITTVHQFADSIIRSRLESKDQI----GDE  271

Query  829   DFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---IKQV  662
             D LSR +   +   E +RD+VISF++AGRDTTSSAL+WFFW+LS  P+++  +   I+ V
Sbjct  272   DLLSRFIRTENTSPEFLRDVVISFILAGRDTTSSALSWFFWILSSRPDVQRKIRDEIETV  331

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR--  488
              S   +    ++ ++EM Y++A + E+MRLYPPV  D+K AA+DDVLPDGT + +G    
Sbjct  332   RSEKSKGAFGYEEVKEMRYLQAAISETMRLYPPVPMDTKEAADDDVLPDGTVVKKGTVGK  391

Query  487   ---VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEM  317
                VT+  YAMGRME++WG D  EFKP+RW + + +    SPF++PVF AGPR+CLGKEM
Sbjct  392   GWFVTYHTYAMGRMESVWGKDCTEFKPERWLENRAE----SPFRYPVFHAGPRMCLGKEM  447

Query  316   AFIQMKFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMR  176
             A+IQMK + AS+L RFEI  +  ++ P  V  LT  +  GL V V +R
Sbjct  448   AYIQMKSIAASLLERFEIEALDKDTCPEHVLSLTMRIKGGLPVSVRVR  495



>ref|XP_006577067.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=540

 Score =   408 bits (1049),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 223/450 (50%), Positives = 302/450 (67%), Gaps = 17/450 (4%)
 Frame = -1

Query  1501  LLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNFLNFPKGEPMNQILGDF  1322
             L DWY  LL +SPTKTI +H L   R  +TA+ +NVEYMLK  F NFPKG+  + ILGDF
Sbjct  79    LCDWYAHLLRNSPTKTIHIHVL---RNTITANPDNVEYMLKTRFHNFPKGKTFSTILGDF  135

Query  1321  LGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGRLSPLLEAAARNSSVLD  1142
             LGRGIFNVDG+ WS Q+K+AS E +  S+R    + ++ E+  RL PLL  + +N  VLD
Sbjct  136   LGRGIFNVDGESWSFQKKMASLELSKNSIRSFAFEVVKFEIKDRLIPLLVLSKQNDCVLD  195

Query  1141  LQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASEISARRGMAPVFAVWKC  962
             LQDV +RF+FD+IC+ S G DP CL  S   +E  + +FD AS++SA R M+    +WK 
Sbjct  196   LQDVFKRFSFDSICRFSFGLDPMCLELSLPISEFAM-SFDLASKLSAERAMSVSPLIWKI  254

Query  961   KRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGSDFLSRLLDAGHKDEVV  782
             KR  NVGSEKKLR+ IK++     E+IR R++   ++I+     D LSR +     D  +
Sbjct  255   KRFLNVGSEKKLRKAIKMIDILAREVIRQRRKMGFSSISPHK-DDLLSRFMRTITDDTYL  313

Query  781   RDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI---KQVLSSDDQKTL-NFDHLRE  614
             +D+++SFL+AGRDT +SALT FFWLL+KHP +E+ ++   +QV+ SD  K L +++ L++
Sbjct  314   KDIIVSFLLAGRDTVASALTSFFWLLAKHPEVESQILLEAEQVIGSDYNKDLTSYEELQQ  373

Query  613   MNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVTFSPYAMGRMENLWGND  434
             ++Y++A   ESMRLYPP+ +DSK    DDVLPDGT + RG RVT+ PYAMGR+E +WG+D
Sbjct  374   LHYLQAAANESMRLYPPIQFDSKFCLEDDVLPDGTFVKRGTRVTYHPYAMGRLEEIWGSD  433

Query  433   WLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQMKFVVASILRRFEIRPV  254
               EF+P+RW  E G     +PFK+PVFQAG RVCLGKEMA +++K V  S+LRRF I   
Sbjct  434   CFEFRPERWLKE-GLFCPQNPFKYPVFQAGIRVCLGKEMALLELKSVALSLLRRFHIELA  492

Query  253   C-------ESQPVFVPLLTGYMAKGLYVRV  185
                      S P F P LT   + GL V+V
Sbjct  493   APPPHHHHHSTPRFSPGLTATFSCGLRVKV  522



>ref|XP_010247156.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=504

 Score =   407 bits (1046),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 306/465 (66%), Gaps = 11/465 (2%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             +P  G L  F KNR+  LDW +++LA  PT T+  H  G    ++TA+  NVE+MLK+NF
Sbjct  38    FPCFGVLPEFIKNRHRFLDWSSEVLARLPTNTLDYHHPGKVHGIITANPLNVEHMLKSNF  97

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKG  +   L DFLGRGIFN DG++W  QRK AS+EF  +SLR   MK++EEE+  R
Sbjct  98    HNYPKGSRVTSYLEDFLGRGIFNADGEIWKIQRKTASYEFNTKSLRNFFMKSVEEEIQTR  157

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L+ A+  + V+D+QD+L RF+FDT+C++S   DPGCL S  ++    ++AF +AS 
Sbjct  158   LVPVLKRASVLNQVVDMQDILERFSFDTVCRLSFNMDPGCLGSEGTTGTEFMNAFGEAST  217

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
              SA R    +  +W+ K+A N+GSEK++R+ I +VHD  ++II+ R +EK          
Sbjct  218   YSAGRFFYALPYMWRIKKALNIGSEKRMRKAISIVHDFADDIIKSRMKEKGEKEDT---D  274

Query  829   DFLSRLL-DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS-  656
             D LSR + +  +  E +RD++ISF++AGRDT +S++TWFFW+LS   ++E  ++ ++ S 
Sbjct  275   DLLSRFIANESNSAEFLRDIIISFMLAGRDTMTSSITWFFWVLSSRSDVEGNILHEMKSI  334

Query  655   ----SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNR  488
                     +  NFD + +M+Y+KA L ES+R+YPPV  D K    DD++PDGT + +G  
Sbjct  335   RNRNGTGSEAFNFDDMGQMHYLKAALSESLRMYPPVPLDEKQCLQDDIMPDGTFVGKGWC  394

Query  487   VTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFI  308
             VT+  YAMGRME++WG D L+FKP+RW  E G  +  SPF+FP F AGPR+CLGK++A +
Sbjct  395   VTYHAYAMGRMESIWGKDCLDFKPERWL-ENGICRQESPFRFPAFHAGPRICLGKDVAHM  453

Query  307   QMKFVVASILRRFEIRPVCESQ-PVFVPLLTGYMAKGLYVRVHMR  176
             QMK VVAS+L RF +  V + + P  +  LT  M  GL +RV  R
Sbjct  454   QMKMVVASVLSRFHLDLVDKYRAPKQILSLTLRMKDGLPMRVRER  498



>ref|XP_002979339.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ19747.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=461

 Score =   405 bits (1041),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 207/465 (45%), Positives = 292/465 (63%), Gaps = 12/465 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YP++G +  F +N +  L+W T+ + +SP+ T    R G+   + T +   VE++LK
Sbjct  5     PVLYPVVGNVFDFLRNSHRFLEWSTEYVINSPSNTFTTGRFGSTFKI-TGNPATVEHILK  63

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKGE + Q L D LG GIFNVDG+LW  QR+LAS EFT RSLRE +M +L +EV
Sbjct  64    TNFENYPKGEHLRQSLTDLLGDGIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEV  123

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L + +R+   +DLQD+  RF FD ICK+                     AFDK
Sbjct  124   HSRLLPTLASVSRDGKEIDLQDLFMRFNFDNICKL-SFGVDPACLDPSFPEVKFAQAFDK  182

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ +S  R       VWK  RA NVG E++L+E + VV++    +++ R++EK       
Sbjct  183   ATTLSTLRFQKIHPLVWKLMRALNVGPERELKEVLDVVNEFAVSVVQKRREEKGR-----  237

Query  838   AGSDFLSRLL---DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                D LSR +        DE +RD++ISF++AG+DT + +L+WFFWLLS HP ++  +I+
Sbjct  238   VNQDLLSRFIGLDSTSFSDEFLRDIIISFVLAGKDTIAVSLSWFFWLLSNHPGVQQEIIR  297

Query  667   QVLSS-DDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             +V S+    +   +  LR+M Y++A LCESMRLYPPV  D+K   N DVLPDG  + +G 
Sbjct  298   EVGSTKGSNRPFTYKELRDMVYLQAALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGM  357

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAF  311
             +V++  YAMGRME+LWG D LEFKP+RW  + G+   +SPFKFPVFQAGPRVCLGKEMA 
Sbjct  358   KVSYHVYAMGRMESLWGKDCLEFKPERWI-QDGQFVEVSPFKFPVFQAGPRVCLGKEMAM  416

Query  310   IQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             +QMK+VVA+++ +FE+  V + +P +   +T  M  GL V   +R
Sbjct  417   LQMKYVVAALVPKFELVVVGKEEPCYGINMTLIMKDGLPVVPKLR  461



>ref|XP_004506151.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=505

 Score =   407 bits (1045),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 231/483 (48%), Positives = 317/483 (66%), Gaps = 24/483 (5%)
 Frame = -1

Query  1573  LIVYTPPSYPIIGC-------LLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVV  1415
             L++Y     P   C        +++ KN   L D+YT LL +S T TI +H L      +
Sbjct  31    LLIYISRIKPWCNCNTCKSYLTMNWSKNFTNLCDYYTHLLQNSRTGTIHIHVLA---NTI  87

Query  1414  TASAENVEYMLKNNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSL  1235
             T++ +NVE++LK NF N+PKG+P + ILGD LGRGIFN DGD W  QRK+AS E  + ++
Sbjct  88    TSNPQNVEHILKTNFNNYPKGKPFSAILGDLLGRGIFNADGDSWKFQRKMASLELGSVAI  147

Query  1234  RELVMKTLEEEVDGRLSPLLEAAARNS-SVLDLQDVLRRFAFDTICKIslgsdpgclsss  1058
             R   M+ + EE+  RL P++     N+ + LDLQD+LRRF+FD ICK S G DP CL  S
Sbjct  148   RSYAMELVTEEIKTRLIPIIATNIENNETCLDLQDILRRFSFDNICKFSFGLDPCCLVPS  207

Query  1057  dssaeSLVDAFDKASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIR  878
                +  L +AFD AS++SA R M     +WK KR FNVGSEKKLRE IKVV+D   E+I+
Sbjct  208   LPVSN-LANAFDLASKLSAERAMTASPLIWKMKRFFNVGSEKKLRESIKVVNDLTNEMIK  266

Query  877   VRKQEKANNIAAGAGSDFLSRLLDA--GHKDEVVRDMVISFLVAGRDTTSSALTWFFWLL  704
              R++     I   + +D LSR + +   + DE +RD+V+SFL+AGRDT +SALT FF LL
Sbjct  267   QRRE-----IGFDSRNDLLSRFMGSLNVNDDEYLRDIVVSFLLAGRDTIASALTGFFILL  321

Query  703   SKHPNIETTVIKQVLSSDD--QKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAAND  530
             SK+PN+E  +  ++    D   +   F+  REM+Y+ A + ESMRL+PP+ +DSK+A  D
Sbjct  322   SKNPNVEAKIRVELDRVMDPVHECATFEQTREMHYVTAAIYESMRLFPPIQFDSKYAIED  381

Query  529   DVLPDGTPIYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQ  350
             DVLPDGT + +G+RVT+ PYAMGRME +WG D LEFKP+RW  + G      PFK+PVFQ
Sbjct  382   DVLPDGTLVRKGSRVTYHPYAMGRMEKIWGPDCLEFKPERWLKD-GVFVPKCPFKYPVFQ  440

Query  349   AGPRVCLGKEMAFIQMKFVVASILRRFEIRPVCESQPV-FVPLLTGYMAKGLYVRVHMRE  173
             AG RVCLGKE+A ++MK VVA+++RRF++R V  ++ + F P LT     GL ++V+ R 
Sbjct  441   AGLRVCLGKELAIVEMKSVVAALVRRFDVRVVEPNRDIRFAPGLTATFRGGLPIKVYERT  500

Query  172   GYN  164
              YN
Sbjct  501   -YN  502



>ref|XP_004249121.2| PREDICTED: cytochrome P450 94A2 isoform X2 [Solanum lycopersicum]
Length=493

 Score =   406 bits (1044),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 221/470 (47%), Positives = 299/470 (64%), Gaps = 21/470 (4%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP++G L  F  NR+   DW T +L++ PT T V HR      ++TA+  NVE+MLK NF
Sbjct  32    YPLVGALPGFLHNRHRFHDWMTDVLSNCPTNTAVFHRPVNVHGIMTANPLNVEHMLKTNF  91

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              NFPKG      L D  G G+FNVDG+ W  QRK AS+EF+ RSLR  VM+T + E+  R
Sbjct  92    ENFPKGFRFYTRLQDLFGDGLFNVDGESWRTQRKSASYEFSTRSLRNFVMETAQVEIHTR  151

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+LE A++   ++D+QD+L RFAFD I K++   D  CL  ++S     + AFD A+ 
Sbjct  152   LIPILEEASQRGRIIDIQDILERFAFDNIIKLAFNVDANCLGGAESE---FMQAFDIATT  208

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M  +  ++K K+  N+GSEKKL+E IKVVH+  + II  R +E+          
Sbjct  209   LSSGRFMYAIPFLYKIKKILNIGSEKKLQESIKVVHEFADNIINSRMEERDEK----KDE  264

Query  829   DFLSRLLDAGHKDEV----VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
             D LSR +  G  +EV    +RD+VISF++AGRDTTSSALTWFFW+LS   +IE  +++++
Sbjct  265   DLLSRFM--GDSNEVSAKFLRDIVISFILAGRDTTSSALTWFFWILSSRKDIEQKILEEL  322

Query  661   LSSDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIY  500
             +    +      +  NFD LREM Y+ A + ESMRLYPPV  D++    D++LPDGT I 
Sbjct  323   VEVRGRNGKKIGEAYNFDELREMQYLHAAISESMRLYPPVPIDTRSCLKDEILPDGTFIG  382

Query  499   RGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKE  320
             +   +++  Y+MGRMENLWG D  E+KP+RWFDE G  K  SPFKFPVF AGPR+CLGK+
Sbjct  383   KDWFISYQTYSMGRMENLWGKDCCEYKPERWFDENGVYKQESPFKFPVFHAGPRMCLGKD  442

Query  319   MAFIQMKFVVASILRRFEIRPVCESQ--PVFVPLLTGYMAKGLYVRVHMR  176
             MA+IQMK + AS+L  FE     E+   P +V  LT  M  GL V V  R
Sbjct  443   MAYIQMKSIAASVLEMFEFDVQLENGKCPEYVLSLTLRMKGGLPVEVKER  492



>ref|XP_010516270.1| PREDICTED: cytochrome P450 94B3-like [Camelina sativa]
Length=500

 Score =   406 bits (1044),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 211/469 (45%), Positives = 299/469 (64%), Gaps = 10/469 (2%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP++G L    KNR+  LDW  + L+  PT+T    R G  + V+TA+  NVEYMLK  
Sbjct  31    SYPLVGSLPGLVKNRHRFLDWTVETLSRCPTQTATFRRPGKLQFVMTANPANVEYMLKTR  90

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F +FPKGE    IL DFLGRGIFN DG++W  QRK AS EF+ +SLR+ VM  +  E++ 
Sbjct  91    FDSFPKGERFISILEDFLGRGIFNSDGEMWLKQRKTASSEFSTKSLRDFVMNNVTVEINT  150

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L+ AA    ++DLQD+L RFAFD ICK++   D  CL    +   S + AF+ A+
Sbjct  151   RLVPVLKEAATTGKLIDLQDILERFAFDNICKLAFNVDTACLGDDGADGVSFMRAFETAT  210

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAG  833
             EI ++R  + V   WK K+  N+GSE+ LRE I  VH   +EI+R R  +  ++ +    
Sbjct  211   EIISKRFQSVVSYSWKIKKKLNIGSERVLRESIATVHKFADEIVRQRIDQGRSSTSDDEK  270

Query  832   SDFLSRLL--DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVL  659
              D LSR +  +  +  E++RD+VISF++AGRDTTSSAL+WFFWLLS HP +E  +++++ 
Sbjct  271   EDLLSRFISDEEMNSPEMLRDIVISFMLAGRDTTSSALSWFFWLLSTHPEVEHKILQELN  330

Query  658   SSDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             S  ++      +   F+ L+ M Y+ A L ES+RLYPPV  D+K  A D+VLPDGT + +
Sbjct  331   SIRERTGKRTGEVYGFEDLKLMTYLHAALTESLRLYPPVPVDTKSCAEDNVLPDGTIVGK  390

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-QGKLKMISPFKFPVFQAGPRVCLGKE  320
                ++++ + MGRME++WG D   F P+RW DE  G  +  SP+KFP F AGPR CLGKE
Sbjct  391   DWGISYNAFVMGRMESIWGKDCDRFDPERWIDETTGGFRSESPYKFPAFHAGPRTCLGKE  450

Query  319   MAFIQMKFVVASILRRFEIR-PVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             MA+IQMK +VA++L RF +  P  + +P  +  +T  +  GL+  V  R
Sbjct  451   MAYIQMKSIVAAVLERFVVEIPGKKERPEILLSVTLRIRGGLFASVQER  499



>gb|EPS70135.1| hypothetical protein M569_04626, partial [Genlisea aurea]
Length=489

 Score =   406 bits (1043),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 216/470 (46%), Positives = 305/470 (65%), Gaps = 17/470 (4%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYP IG  + F+KNR   + W  +++ S+PT T  + R    R V+TA   NV ++LK
Sbjct  28    PKSYPFIGSFIDFFKNRDRFVQWTAEIVNSTPTNTYTLRRTMGQRFVITADPRNVHHILK  87

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
             ++F  + KG+    +L D LG GIFN DG++W  QR++ASHEF  +SLR+     ++ E+
Sbjct  88    SHFHVYEKGDHFKAVLRDLLGDGIFNADGEIWKFQRQIASHEFNTKSLRKFFDTIVDAEL  147

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               R  P+L  AA + +VLD QD+L+RFAFD ICK + G DP CL+ +   +E  V AF  
Sbjct  148   SDRFLPILRTAATDGTVLDFQDILQRFAFDNICKFAFGYDPECLTPALPESEFAV-AFRN  206

Query  1018  ASEISARR--GMAPVFAVWKCKRAFNVG-SEKKLREHIKVVHDHVEEIIRVRKQEKANNI  848
             A  +S  R     P+F  WK +RA N+G SEK+L+  +  V +   EIIR RK+     I
Sbjct  207   AVRLSRERFATFLPIF--WKLRRALNLGKSEKELKSAVSKVQNLAREIIR-RKKNHPGKI  263

Query  847   AAGAGSDFLSRLLDAGHKDEV-VRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                 GSD LSR L +GH DEV + D+VISF++AGRDTTS+ LTWFFW+LSKHP +E  ++
Sbjct  264   --DDGSDLLSRFLSSGHTDEVMLMDIVISFILAGRDTTSAVLTWFFWVLSKHPRVEDAIL  321

Query  670   KQVLSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGN  491
             +++ ++   ++  ++ ++EM Y  A + ESMRLYPPV  DSK A  DDVLPDGT + +G 
Sbjct  322   EEI-NTKVSESAAYEEVKEMVYTHASISESMRLYPPVPVDSKSAVADDVLPDGTVVKKGM  380

Query  490   RVTFSPYAMGRMENLWGNDWLEFKPDRWFD---EQGKLKMIS--PFKFPVFQAGPRVCLG  326
             R+ + PYAMGR+E +WG DW EF+P+RW     + G+L  ++  P+ +PVFQAGPR+CLG
Sbjct  381   RIAYHPYAMGRVEKIWGKDWPEFRPERWLQNSPDSGRLTFVNRDPYTYPVFQAGPRICLG  440

Query  325   KEMAFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             K++AF+QMK VVA +LR F I PV  ++P ++  LT  M  G  VR+  R
Sbjct  441   KDLAFLQMKSVVAGVLREFRIIPVV-NEPEYISFLTAKMKGGFPVRIEAR  489



>ref|XP_010906406.1| PREDICTED: cytochrome P450 94B3-like [Elaeis guineensis]
Length=503

 Score =   406 bits (1044),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 215/471 (46%), Positives = 303/471 (64%), Gaps = 20/471 (4%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
              YP++G L    KNR+ LL+W T+ L  +P+ TIV   LG    + TA+  N+E+MLK N
Sbjct  36    GYPLLGILPQLLKNRHRLLEWTTEALIKNPSHTIVFQSLGQDSGIQTANPLNIEHMLKTN  95

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+PKGE   ++L DF G GIFN DG+ W+ QRK AS EF  RSLR  V+ T+++EV  
Sbjct  96    FKNYPKGERTIKMLEDFFGHGIFNSDGEHWNLQRKAASFEFNTRSLRNFVVDTVQQEVAQ  155

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsss---dssaeSLVDAFD  1022
             RL PLL+ A++    +D QDVL RFAFD ICK++   DP CL+     ++ +   + AF 
Sbjct  156   RLLPLLKKASKKEETIDFQDVLERFAFDNICKVAFNEDPACLTEEGFGNTISSRFMKAFG  215

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
             +A  I   R +  +   W+ KR  N+GSE++L+E I +V+++   IIR RK+   +++  
Sbjct  216   EAQNIITERFLDALKISWRIKRLLNIGSERRLKESISIVNNYAINIIRSRKERTLDHL--  273

Query  841   GAGSDFLSRLLDAGHKD---EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVI  671
                SD LSR   A +KD   E +RD+V+SFL AGR+TTSSALTWFFWLLS  P++E  ++
Sbjct  274   ---SDLLSRF--ASNKDNTEEYLRDVVVSFLTAGRETTSSALTWFFWLLSARPDVEKKIL  328

Query  670   KQV-----LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTP  506
              +V     L     +T +FD LREM+Y+ A + ESMRLYPPV  D++    DD +PDGT 
Sbjct  329   DEVRSIRALKQKTSETFSFDELREMHYLHAAISESMRLYPPVPLDTQTCKEDDTMPDGTL  388

Query  505   IYRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLG  326
             +++G  VT++ YA+GR+E++WG D  ++KP+RW  E G  +  +PFK+PVF AGPR+CLG
Sbjct  389   VHKGWFVTYNAYALGRLEDIWGKDCNDYKPERWL-ENGVFQPENPFKYPVFHAGPRMCLG  447

Query  325   KEMAFIQMKFVVASILRRFEIRPVC-ESQPVFVPLLTGYMAKGLYVRVHMR  176
             KEMA+IQMK + A  L  FE   V  +  P ++P LT  M  GL ++V  R
Sbjct  448   KEMAYIQMKSIAACALENFEFNVVGRDKTPEYLPSLTLRMKGGLPIQVRER  498



>ref|XP_003521105.1| PREDICTED: cytochrome P450 94A1 [Glycine max]
Length=492

 Score =   405 bits (1042),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 216/463 (47%), Positives = 299/463 (65%), Gaps = 13/463 (3%)
 Frame = -1

Query  1549  YPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNNF  1370
             YP+IG L  F KNR+  L+W T++L  SPT T V  R      ++TA+ +NVE++LK  F
Sbjct  36    YPLIGTLPEFLKNRHRFLEWTTQVLRDSPTNTGVFSRPYKLHGILTANPDNVEHVLKTKF  95

Query  1369  LNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDGR  1190
              N+PKGE    +L DFLG GIFN DGDLW  QRK AS+EF+ +SLR  V+  +  E+  R
Sbjct  96    DNYPKGERFIHLLQDFLGNGIFNSDGDLWKVQRKTASYEFSTKSLRNFVVDAVTFELQTR  155

Query  1189  LSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKASE  1010
             L P+L  A+  + VLDLQD+L RFAFD +CK++   DP CL    ++    + AF+ A+ 
Sbjct  156   LLPILSKASETNKVLDLQDLLERFAFDNVCKLAFNVDPACLGGDGTAGGEFMRAFEDAAV  215

Query  1009  ISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAGAGS  830
             +S+ R M+ +  VWK K+ FN GSE++LRE I  VH   + IIR R + K          
Sbjct  216   LSSGRFMSILPVVWKIKKLFNFGSERRLRESITTVHQFADSIIRSRLESKDQI----GDE  271

Query  829   DFLSRLLDAGHKD-EVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTV---IKQV  662
             D LSR +   +   E +RD+VISF++AGRDTTSSAL+WFFW+LS  P+++  +   I+ V
Sbjct  272   DLLSRFIRTENTSPEFLRDVVISFILAGRDTTSSALSWFFWILSSRPDVQRKIRDEIETV  331

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
              S   +    ++ ++EM Y++A + E+MRLYPPV  D+    NDDVLPDGT + +G  VT
Sbjct  332   RSEKSKGAFGYEEVKEMRYLQAAISETMRLYPPVPVDTMECLNDDVLPDGTRVGKGWFVT  391

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEMAFIQM  302
             +  YAMGRME++WG D  EFKP+RW + + +    SPF++PVF AGPR+CLGKEMA+IQM
Sbjct  392   YHTYAMGRMESVWGKDCTEFKPERWLENRAE----SPFRYPVFHAGPRMCLGKEMAYIQM  447

Query  301   KFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMR  176
             K + AS+L RFEI  +  ++ P  V  LT  +  GL V V +R
Sbjct  448   KSIAASLLERFEIEALDKDTCPEHVLSLTMRIKGGLPVSVRVR  490



>gb|AAL54886.1|AF092915_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum]
Length=511

 Score =   406 bits (1043),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 303/471 (64%), Gaps = 12/471 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P SYPIIG   S   N+   + W + ++ ++   T  ++R    R + TA+  NV++MLK
Sbjct  42    PKSYPIIGSCFSILANKERRIQWTSDIMQNTSNLTFTLNRPFGFRQIFTANPANVQHMLK  101

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
               F  + KG+     + DFLG GIFNVDGD+W  QR+++SHEF  +SLR+ V   ++ E+
Sbjct  102   TQFHIYQKGDVFKTTMADFLGDGIFNVDGDIWKYQRQVSSHEFNTKSLRKFVETVVDTEL  161

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
             + RL P+L  AA   +VLD QD+L+RFAFD ICKI+ G DP  L  S   A+  V AF++
Sbjct  162   NERLIPILATAAVEKTVLDFQDILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV-AFEE  220

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A ++S+ R  A    VWK KR FN+GSEKK+R  +  V    +E+++ +++E     ++ 
Sbjct  221   AVKLSSERFNAIFPFVWKIKRNFNIGSEKKIRVAVNEVRQFAKELVKEKQKELKEK-SSL  279

Query  838   AGSDFLSRLLDAGHKDE-VVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQV  662
                D LSR L +GH DE  V D+VISF++AGRDTTS+ALTWFFWL+ +HP  E  ++K+ 
Sbjct  280   DSVDLLSRFLSSGHSDEDFVTDIVISFILAGRDTTSAALTWFFWLIFEHPETENQILKEA  339

Query  661   LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRGNRVT  482
              +  +     +D +++M Y  A LCESMR YPP+  D+K A  D++LPDGT + +G RV+
Sbjct  340   KAKSESPV--YDEVKDMIYTHASLCESMRFYPPIPIDTKAATEDNILPDGTFVKKGTRVS  397

Query  481   FSPYAMGRMENLWGNDWLEFKPDRWFDE---QGKLKMIS--PFKFPVFQAGPRVCLGKEM  317
             +  YAMGR+ENLWG DW EF+P+RW D+    G    ++   + +PVFQAGPR+CLGKEM
Sbjct  398   YHIYAMGRVENLWGKDWAEFRPERWLDKDEASGNWTFVARDTYTYPVFQAGPRICLGKEM  457

Query  316   AFIQMKFVVASILRRFEIRPVCES--QPVFVPLLTGYMAKGLYVRVHMREG  170
             AF+QMK VVA +LRRF++ P+ E   +PVF+  LT  M  G  V +  R G
Sbjct  458   AFLQMKRVVAGVLRRFKVVPLAEKGVEPVFLSYLTAKMKGGFPVTIEERNG  508



>gb|EAZ13864.1| hypothetical protein OsJ_03787 [Oryza sativa Japonica Group]
Length=508

 Score =   406 bits (1043),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 222/470 (47%), Positives = 294/470 (63%), Gaps = 13/470 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP++G L  F KN+   L++ T+++  SPT T+    LG    V+TA+  NVEY LK N
Sbjct  40    SYPVVGTLPHFAKNKDRFLEFITEIMKRSPTHTLSFKALGLTGGVITANPANVEYTLKTN  99

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+PKGE    +L DFLG GIFN DG+ W  QRK AS+EF  RSLR  V+ T+  EV  
Sbjct  100   FGNYPKGELAVSMLVDFLGHGIFNSDGEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVVE  159

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsd---pgclsssdssaeSLVDAFD  1022
             RL PLLE A R+   LD+QDVL RFAFD IC ++   D       S +   +   + AF 
Sbjct  160   RLLPLLERAERDGRTLDVQDVLERFAFDNICHVAFDEDPACLAEDSMASPQSAKFMRAFS  219

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A      R M+PV + W+ KR FN+  E+++RE +  +H   E I+R R++     +A 
Sbjct  220   DAQNAVMDRFMSPVKSRWRFKRLFNMEPERQMREALATIHGFAERIVRERRERGEAGLAR  279

Query  841   GAGSDFLSRLLDAG-HKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 DFLSR   +G H DE +RD+V +FL+AGRDTTS+ALTWFFWLLS  P++E  ++++
Sbjct  280   S--DDFLSRFAASGDHSDESLRDVVTNFLIAGRDTTSTALTWFFWLLSGRPDVEDKIVRE  337

Query  664   VLS------SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +           T N D LR+M Y+ A + ESMRLYPPVA DS     DD LPDGT +
Sbjct  338   IHAVRRASGGTGDPTFNLDELRDMQYLHAAITESMRLYPPVAMDSHSCKEDDFLPDGTFV  397

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGK  323
              +G  V++S YAM R+E++WG D  EF+P+RW DE G  +  SPFK+PVF AGPR+CLGK
Sbjct  398   GKGWFVSYSAYAMARVEDIWGADCEEFRPERWLDEAGAFRPESPFKYPVFHAGPRMCLGK  457

Query  322   EMAFIQMKFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMR  176
             EMA+IQMK +VAS+L RF +R    E  P FV  LT  M  GL ++V  R
Sbjct  458   EMAYIQMKSIVASVLERFSLRYAGGEGHPGFVLWLTLRMKGGLPMQVTTR  507



>ref|XP_002964775.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ33613.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=490

 Score =   405 bits (1041),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 207/467 (44%), Positives = 294/467 (63%), Gaps = 15/467 (3%)
 Frame = -1

Query  1558  PPSYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLK  1379
             P  YP++G +  F +N +  L+W T+ + +SP+ T    R G+   + T +   VE++LK
Sbjct  33    PVLYPVVGNVFDFLRNSHRFLEWSTEYVINSPSNTFTTGRFGSTFKI-TGNPATVEHILK  91

Query  1378  NNFLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEV  1199
              NF N+PKGE + Q L D LG GIFNVDG+LW  QR+LAS EFT RSLRE +M +L +EV
Sbjct  92    TNFENYPKGEHLRQSLTDLLGDGIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEV  151

Query  1198  DGRLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDK  1019
               RL P L + +R+   +DLQD+  RF FD ICK+                     AFDK
Sbjct  152   HSRLLPTLASVSRDGKEIDLQDLFMRFNFDNICKL-SFGVDPACLDPSFPEVKFAQAFDK  210

Query  1018  ASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAAG  839
             A+ +S  R       VWK  RA NVG E++L+E + VV++    +++ R++EK       
Sbjct  211   ATTLSTLRFQKIHPLVWKLMRALNVGPERELKEVLDVVNEFAVSVVQKRREEKGR-----  265

Query  838   AGSDFLSRLL---DAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIK  668
                D LSR +        DE +RD++ISF++AG+DTT+ +L+WFFWLLS HP ++  +I+
Sbjct  266   VNQDLLSRFIGLDSTSFSDEFLRDIIISFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIR  325

Query  667   QV---LSSDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYR  497
             +V   ++    +   ++ LR+M Y++A LCESMRLYPPV  D+K   N DVLPDG  + +
Sbjct  326   EVGSIVAKGSDRPFTYEELRDMVYLQAALCESMRLYPPVPIDTKVVKNSDVLPDGNSVEK  385

Query  496   GNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGKEM  317
             G +V++  YAMGRME+LWG D LEFKP+RW  + G+   +SPFKFPVFQAGPRVCLGKEM
Sbjct  386   GMKVSYHVYAMGRMESLWGKDCLEFKPERWI-QDGQFVAVSPFKFPVFQAGPRVCLGKEM  444

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             A +QMK+VVA+++ +FE+  V + +P +   +T  M  GL V   +R
Sbjct  445   AMLQMKYVVAALVPKFEL-VVGKEEPCYGINMTLIMKDGLPVVPKLR  490



>ref|XP_002893825.1| CYP94D1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70084.1| CYP94D1 [Arabidopsis lyrata subsp. lyrata]
Length=498

 Score =   405 bits (1041),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 301/467 (64%), Gaps = 10/467 (2%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYPI+G       NR+  LDW  + L+  PT+T +    G  + ++TA+  NVEYMLK  
Sbjct  33    SYPIVGSFPGLVNNRHRFLDWTVETLSRCPTQTAIFRLPGKKQLIMTANPSNVEYMLKTK  92

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F +FPKGE    +L DFLG GIFN DG++W  QRK AS+EF+ +SLR+ VM  +  E++ 
Sbjct  93    FESFPKGEQFTSVLEDFLGHGIFNSDGEMWWKQRKTASYEFSTKSLRDFVMSNVTVEINT  152

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsdpgclsssdssaeSLVDAFDKAS  1013
             RL P+L  AA    ++DLQD+L RFAFD ICK++   DP CL    ++  + + AF+ A+
Sbjct  153   RLVPVLVEAATTGKLIDLQDILERFAFDNICKLAFNVDPACLGKDGAAGVNFMRAFETAA  212

Query  1012  EISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVR-KQEKANNIAAGA  836
              I ++R  +     WK K+  N+GSE+ LRE I  VH   +EI+R R  Q K+++     
Sbjct  213   TIISQRFRSVASCSWKIKKKLNIGSERVLRESIATVHKFADEIVRKRIDQGKSSDHKEDL  272

Query  835   GSDFLSRLLDAGHKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQVLS  656
              S F+S+  +  +  E++RD+VISF++AGRDTTSSAL+WFFWLLS HP +E  +++++ S
Sbjct  273   LSRFISK--EEMNSPEILRDIVISFILAGRDTTSSALSWFFWLLSMHPEVEDKILQELNS  330

Query  655   SDDQ------KTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPIYRG  494
                +      +   F+HL+ MNY+ A + ES+RLYPPV  D K  A D+VLPDGT + +G
Sbjct  331   IRARTGKRIGEVYGFEHLKLMNYLHAAITESLRLYPPVPVDIKSCAEDNVLPDGTFVGKG  390

Query  493   NRVTFSPYAMGRMENLWGNDWLEFKPDRWFDE-QGKLKMISPFKFPVFQAGPRVCLGKEM  317
               +T++ +AMGRME++WG D   F P+RW DE  G  +  +P+KFP F AGPR+C+GKEM
Sbjct  391   WAITYNTFAMGRMESIWGTDCDRFDPERWIDETNGAFRGENPYKFPAFHAGPRICVGKEM  450

Query  316   AFIQMKFVVASILRRFEIRPVCESQPVFVPLLTGYMAKGLYVRVHMR  176
             A+IQMK +VA++L RF +    + +P  +  +T  +  GL+ RVH R
Sbjct  451   AYIQMKSIVAAVLERFVVEVPGKERPEILLSMTLRIRGGLFARVHER  497



>gb|EAY76183.1| hypothetical protein OsI_04116 [Oryza sativa Indica Group]
Length=508

 Score =   405 bits (1042),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 222/470 (47%), Positives = 293/470 (62%), Gaps = 13/470 (3%)
 Frame = -1

Query  1552  SYPIIGCLLSFYKNRYCLLDWYTKLLASSPTKTIVVHRLGAPRTVVTASAENVEYMLKNN  1373
             SYP++G L  F KN+   L + T+++  SPT T+    LG    V+TA+  NVEY LK N
Sbjct  40    SYPVVGTLPHFAKNKDRFLQFITEIMKRSPTHTLSFKALGLTGGVITANPANVEYTLKTN  99

Query  1372  FLNFPKGEPMNQILGDFLGRGIFNVDGDLWSAQRKLASHEFTARSLRELVMKTLEEEVDG  1193
             F N+PKGE    +L DFLG GIFN DG+ W  QRK AS+EF  RSLR  V+ T+  EV  
Sbjct  100   FGNYPKGELAVSMLVDFLGHGIFNSDGEQWQWQRKAASYEFNKRSLRNFVVDTVRSEVIE  159

Query  1192  RLSPLLEAAARNSSVLDLQDVLRRFAFDTICKIslgsd---pgclsssdssaeSLVDAFD  1022
             RL PLLE A R+   LD+QDVL RFAFD IC ++   D       S +   +   + AF 
Sbjct  160   RLLPLLERAERDGRTLDVQDVLERFAFDNICHVAFDEDPACLAEDSMASPQSAKFMRAFS  219

Query  1021  KASEISARRGMAPVFAVWKCKRAFNVGSEKKLREHIKVVHDHVEEIIRVRKQEKANNIAA  842
              A      R M+PV + W+ KR FN+  E+++RE +  +H   E I+R R++     +A 
Sbjct  220   DAQNAVMDRFMSPVKSRWRFKRLFNMEPERQMREALATIHGFAERIVRERRERGEAGLAR  279

Query  841   GAGSDFLSRLLDAG-HKDEVVRDMVISFLVAGRDTTSSALTWFFWLLSKHPNIETTVIKQ  665
                 DFLSR   +G H DE +RD+V +FL+AGRDTTS+ALTWFFWLLS  P++E  ++++
Sbjct  280   S--DDFLSRFAASGDHSDESLRDVVTNFLIAGRDTTSTALTWFFWLLSGRPDVEDKIVRE  337

Query  664   VLS------SDDQKTLNFDHLREMNYIKACLCESMRLYPPVAWDSKHAANDDVLPDGTPI  503
             + +           T N D LR+M Y+ A + ESMRLYPPVA DS     DD LPDGT +
Sbjct  338   IHAVRRASGGTGDPTFNLDELRDMQYLHAAITESMRLYPPVAMDSHSCKEDDFLPDGTFV  397

Query  502   YRGNRVTFSPYAMGRMENLWGNDWLEFKPDRWFDEQGKLKMISPFKFPVFQAGPRVCLGK  323
              +G  V++S YAM R+E++WG D  EF+P+RW DE G  +  SPFK+PVF AGPR+CLGK
Sbjct  398   GKGWFVSYSAYAMARVEDIWGADCEEFRPERWLDEAGAFRPESPFKYPVFHAGPRMCLGK  457

Query  322   EMAFIQMKFVVASILRRFEIRPV-CESQPVFVPLLTGYMAKGLYVRVHMR  176
             EMA+IQMK +VAS+L RF +R    E  P FV  LT  M  GL ++V  R
Sbjct  458   EMAYIQMKSIVASVLERFSLRYAGGEGHPGFVLWLTLRMKGGLPMQVTTR  507



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4968245977748