BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78667_g1_i1 len=1044 path=[1022:0-1043]

Length=1044
                                                                      Score     E

ref|XP_009766381.1|  PREDICTED: early light-induced protein, chlo...    236   1e-72   
ref|XP_004247604.1|  PREDICTED: early light-induced protein 1, ch...    231   4e-71   
ref|XP_004247605.1|  PREDICTED: early light-induced protein 1, ch...    230   9e-71   
ref|XP_006363471.1|  PREDICTED: early light-induced protein, chlo...    230   1e-70   
ref|XP_009616081.1|  PREDICTED: early light-induced protein, chlo...    221   4e-67   
gb|ADM72804.1|  early light-inducible protein                           219   1e-66   
ref|XP_009778398.1|  PREDICTED: early light-induced protein, chlo...    211   4e-63   
gb|AFK41568.1|  unknown                                                 202   9e-60   
ref|XP_007034868.1|  Early light-induced protein, putative              201   4e-59   
gb|AAO33591.1|AF479309_1  putative early light induced protein          200   4e-59   Arachis hypogaea [goober]
ref|XP_002517068.1|  early light-induced protein, putative              198   3e-58   Ricinus communis
gb|ACV89760.1|  putative early light induced protein 2                  197   3e-58   Camellia sinensis [black tea]
gb|AFK38527.1|  unknown                                                 198   3e-58   
ref|XP_011027193.1|  PREDICTED: early light-induced protein 1, ch...    196   1e-57   
gb|ACB20694.1|  putative cold-inducible protein                         196   1e-57   Camellia sinensis [black tea]
ref|XP_002312551.2|  hypothetical protein POPTR_0008s15770g             195   3e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011027158.1|  PREDICTED: early light-induced protein 1, ch...    195   3e-57   
gb|AFK48277.1|  unknown                                                 194   1e-56   
ref|XP_010279261.1|  PREDICTED: early light-induced protein 1, ch...    193   3e-56   
ref|XP_010279259.1|  PREDICTED: early light-induced protein 1, ch...    192   5e-56   
gb|AFK38098.1|  unknown                                                 192   5e-56   
ref|XP_010043033.1|  PREDICTED: early light-induced protein 1, ch...    192   6e-56   
ref|XP_002312552.2|  early light-induced protein precursor              192   7e-56   Populus trichocarpa [western balsam poplar]
ref|XP_006379854.1|  early light-induced protein precursor              191   1e-55   
ref|XP_010107710.1|  hypothetical protein L484_013325                   191   1e-55   
ref|XP_002312550.2|  hypothetical protein POPTR_0008s15760g             191   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010107713.1|  hypothetical protein L484_013328                   191   2e-55   
ref|XP_010043034.1|  PREDICTED: early light-induced protein 1, ch...    190   2e-55   
ref|XP_006420038.1|  hypothetical protein CICLE_v10006006mg             190   3e-55   
ref|XP_007143316.1|  hypothetical protein PHAVU_007G062000g             190   5e-55   
ref|XP_008224239.1|  PREDICTED: early light-induced protein 1, ch...    190   5e-55   
ref|XP_007225862.1|  hypothetical protein PRUPE_ppa011739mg             189   8e-55   
ref|XP_011027181.1|  PREDICTED: early light-induced protein 2, ch...    188   2e-54   
ref|NP_001267842.1|  uncharacterized protein LOC100263179               188   2e-54   
ref|XP_007225864.1|  hypothetical protein PRUPE_ppa011747mg             187   6e-54   
ref|XP_004496671.1|  PREDICTED: early light-induced protein, chlo...    187   7e-54   
ref|XP_004134120.1|  PREDICTED: early light-induced protein, chlo...    187   8e-54   
ref|XP_010043032.1|  PREDICTED: early light-induced protein 1, ch...    186   1e-53   
ref|XP_011027169.1|  PREDICTED: early light-induced protein 1, ch...    186   1e-53   
gb|ABU98940.1|  early light-induced protein 3                           186   1e-53   Rhododendron catawbiense [Catawba rosebay]
gb|ACU13898.1|  unknown                                                 186   2e-53   Glycine max [soybeans]
ref|XP_010326693.1|  PREDICTED: early light-induced protein 1, ch...    183   3e-53   
emb|CDO99111.1|  unnamed protein product                                185   4e-53   
gb|KCW84128.1|  hypothetical protein EUGRSUZ_B01004                     184   4e-53   
gb|KEH43786.1|  early light-induced-like protein                        185   5e-53   
ref|XP_004296581.1|  PREDICTED: early light-induced protein, chlo...    185   5e-53   
ref|XP_011090668.1|  PREDICTED: early light-induced protein 2, ch...    184   9e-53   
ref|XP_008364578.1|  PREDICTED: early light-induced protein 1, ch...    184   1e-52   
gb|AAQ21120.1|  early light inducible protein                           184   1e-52   Trifolium pratense [peavine clover]
gb|ABU98938.1|  early light-induced protein 1                           183   1e-52   Rhododendron catawbiense [Catawba rosebay]
gb|ABU98939.1|  early light-induced protein 2                           182   4e-52   Rhododendron catawbiense [Catawba rosebay]
gb|AAK63815.1|AF383622_1  early light inducible protein                 182   5e-52   Medicago sativa [alfalfa]
ref|XP_006420039.1|  hypothetical protein CICLE_v10005974mg             182   6e-52   
ref|XP_010045776.1|  PREDICTED: early light-induced protein 1, ch...    181   6e-52   
emb|CDY10676.1|  BnaA05g16860D                                          182   7e-52   
ref|NP_001235754.1|  early light-induced protein                        182   7e-52   
gb|KCW84134.1|  hypothetical protein EUGRSUZ_B01008                     183   8e-52   
ref|XP_009145258.1|  PREDICTED: early light-induced protein 1, ch...    181   9e-52   
ref|XP_010034506.1|  PREDICTED: early light-induced protein 1, ch...    181   1e-51   
gb|ABQ01425.1|  early light inducible protein                           181   1e-51   Medicago falcata [sickle alfalfa]
ref|XP_010043035.1|  PREDICTED: early light-induced protein 1, ch...    181   1e-51   
ref|XP_010043036.1|  PREDICTED: early light-induced protein 1, ch...    181   1e-51   
ref|XP_006414662.1|  hypothetical protein EUTSA_v10026335mg             181   1e-51   
ref|XP_010488320.1|  PREDICTED: early light-induced protein 1, ch...    181   2e-51   
sp|P11432.1|ELI_PEA  RecName: Full=Early light-induced protein, c...    181   2e-51   Pisum sativum [garden pea]
ref|XP_011090667.1|  PREDICTED: early light-induced protein 1, ch...    180   2e-51   
ref|XP_010034436.1|  PREDICTED: early light-induced protein 1, ch...    181   2e-51   
gb|AFD62760.1|  ELIP                                                    181   2e-51   
gb|KEH43785.1|  early light-induced-like protein                        180   3e-51   
ref|XP_010440414.1|  PREDICTED: early light-induced protein 2, ch...    180   3e-51   
gb|AFK35794.1|  unknown                                                 180   3e-51   
ref|XP_010440411.1|  PREDICTED: early light-induced protein 2, ch...    180   3e-51   
ref|XP_006298609.1|  hypothetical protein CARUB_v10014694mg             180   4e-51   
gb|KCW84135.1|  hypothetical protein EUGRSUZ_B01008                     181   4e-51   
gb|AFK46043.1|  unknown                                                 180   4e-51   
ref|XP_010435090.1|  PREDICTED: early light-induced protein 2, ch...    179   5e-51   
gb|KEH43766.1|  early light-induced-like protein                        179   5e-51   
ref|XP_010034491.1|  PREDICTED: early light-induced protein 1, ch...    179   6e-51   
ref|XP_010511764.1|  PREDICTED: early light-induced protein 1, ch...    179   6e-51   
ref|XP_010450010.1|  PREDICTED: early light-induced protein 2, ch...    179   6e-51   
gb|KFK23555.1|  hypothetical protein AALP_AAs41881U000100               179   8e-51   
ref|XP_006414664.1|  hypothetical protein EUTSA_v10026318mg             179   1e-50   
ref|XP_006588384.1|  PREDICTED: uncharacterized protein LOC100306...    178   1e-50   
ref|XP_009108614.1|  PREDICTED: early light-induced protein 1, ch...    178   1e-50   
emb|CDY29755.1|  BnaA01g19110D                                          178   1e-50   
gb|AAM67121.1|  light-induced protein-like protein                      178   1e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435089.1|  PREDICTED: early light-induced protein 2, ch...    178   2e-50   
ref|XP_004289994.1|  PREDICTED: early light-induced protein, chlo...    178   2e-50   
ref|XP_010045777.1|  PREDICTED: early light-induced protein 1, ch...    177   2e-50   
gb|ABU98944.1|  early light-induced protein 7                           178   2e-50   Rhododendron catawbiense [Catawba rosebay]
gb|KCW85053.1|  hypothetical protein EUGRSUZ_B01896                     177   2e-50   
gb|KHN02753.1|  Early light-induced protein, chloroplastic              178   2e-50   
ref|XP_010450011.1|  PREDICTED: early light-induced protein 2, ch...    177   2e-50   
ref|XP_010440412.1|  PREDICTED: early light-induced protein 2, ch...    177   3e-50   
ref|XP_010466577.1|  PREDICTED: early light-induced protein 1, ch...    177   3e-50   
ref|NP_567438.1|  early light-inducible protein 2                       177   3e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ABU98942.1|  early light-induced protein 5                           177   3e-50   Rhododendron catawbiense [Catawba rosebay]
gb|AAD28779.1|AF134132_1  early light-inducable protein                 177   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450014.1|  PREDICTED: early light-induced protein 2, ch...    177   4e-50   
ref|XP_009148406.1|  PREDICTED: early light-induced protein 2, ch...    177   5e-50   
emb|CDY46608.1|  BnaCnng14300D                                          176   7e-50   
ref|XP_010440410.1|  PREDICTED: early light-induced protein 2, ch...    176   7e-50   
ref|XP_010450013.1|  PREDICTED: early light-induced protein 2, ch...    176   1e-49   
ref|XP_008341015.1|  PREDICTED: early light-induced protein 1, ch...    176   1e-49   
ref|XP_002870293.1|  hypothetical protein ARALYDRAFT_330043             180   1e-49   
ref|XP_010435088.1|  PREDICTED: early light-induced protein 2, ch...    176   1e-49   
emb|CBI26312.3|  unnamed protein product                                175   2e-49   
ref|XP_006285275.1|  hypothetical protein CARUB_v10006649mg             175   2e-49   
gb|KCW84137.1|  hypothetical protein EUGRSUZ_B01008                     176   3e-49   
ref|XP_004289995.1|  PREDICTED: early light-induced protein, chlo...    175   3e-49   
emb|CDY10312.1|  BnaC05g29670D                                          175   3e-49   
ref|XP_006285225.1|  hypothetical protein CARUB_v10006584mg             175   3e-49   
ref|XP_010435087.1|  PREDICTED: early light-induced protein 2, ch...    175   3e-49   
ref|XP_002885526.1|  early light-inducable protein                      174   4e-49   
emb|CDY67220.1|  BnaCnng53960D                                          174   6e-49   
ref|XP_009371939.1|  PREDICTED: early light-induced protein 1, ch...    174   6e-49   
ref|XP_010034484.1|  PREDICTED: early light-induced protein 1, ch...    173   7e-49   
gb|KFK23556.1|  hypothetical protein AALP_AAs41881U000200               174   7e-49   
gb|EYU41436.1|  hypothetical protein MIMGU_mgv1a014191mg                173   1e-48   
ref|XP_010279260.1|  PREDICTED: early light-induced protein 1, ch...    172   1e-48   
ref|XP_008438620.1|  PREDICTED: early light-induced protein 1, ch...    173   1e-48   
gb|KHG26201.1|  Early light-induced, chloroplastic                      173   1e-48   
gb|ABU98941.1|  early light-induced protein 4                           172   2e-48   Rhododendron catawbiense [Catawba rosebay]
gb|ABU98943.1|  early light-induced protein 6                           172   2e-48   Rhododendron catawbiense [Catawba rosebay]
gb|KFK39567.1|  hypothetical protein AALP_AA3G261100                    173   2e-48   
gb|KHN15724.1|  Early light-induced protein, chloroplastic              172   2e-48   
emb|CAB10248.1|  light induced protein like                             176   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375990.1|  PREDICTED: early light-induced protein 1, ch...    172   2e-48   
ref|XP_009341096.1|  PREDICTED: early light-induced protein 1, ch...    172   3e-48   
ref|XP_009135830.1|  PREDICTED: early light-induced protein 1, ch...    172   4e-48   
emb|CDX92959.1|  BnaA03g36810D                                          172   4e-48   
gb|KCW84133.1|  hypothetical protein EUGRSUZ_B010071                    170   5e-48   
ref|XP_010525221.1|  PREDICTED: early light-induced protein 1, ch...    171   6e-48   
gb|AAL32038.1|AF439279_1  early light-induced protein-like protein      169   6e-48   Retama raetam [retem]
ref|XP_011028244.1|  PREDICTED: early light-induced protein 1, ch...    169   1e-47   
ref|XP_006406123.1|  hypothetical protein EUTSA_v10021557mg             170   2e-47   
emb|CDY42783.1|  BnaC01g22830D                                          169   4e-47   
ref|NP_188923.1|  chlorophyll A-B binding, early light-inducible ...    169   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224237.1|  PREDICTED: early light-induced protein 1, ch...    168   8e-47   
ref|XP_004292245.1|  PREDICTED: early light-induced protein, chlo...    168   9e-47   
gb|KCW84141.1|  hypothetical protein EUGRSUZ_B01008                     166   1e-46   
ref|XP_006286322.1|  hypothetical protein CARUB_v100071911mg            165   2e-46   
ref|XP_007225903.1|  hypothetical protein PRUPE_ppa011907mg             167   2e-46   
gb|KEH43789.1|  early light-induced-like protein                        167   3e-46   
ref|XP_007224626.1|  hypothetical protein PRUPE_ppa026587mg             166   5e-46   
gb|KDP40234.1|  hypothetical protein JCGZ_02232                         166   8e-46   
ref|XP_009337531.1|  PREDICTED: early light-induced protein 1, ch...    166   1e-45   
gb|KEH43787.1|  early light-induced-like protein                        164   3e-45   
ref|XP_010676775.1|  PREDICTED: early light-induced protein 1, ch...    164   3e-45   
ref|XP_008224234.1|  PREDICTED: early light-induced protein 1, ch...    163   3e-45   
ref|XP_010676773.1|  PREDICTED: early light-induced protein 2, ch...    163   4e-45   
gb|EPS65382.1|  early light inducible protein                           163   4e-45   
gb|KCW84143.1|  hypothetical protein EUGRSUZ_B01008                     162   5e-45   
ref|XP_010935701.1|  PREDICTED: early light-induced protein 1, ch...    162   9e-45   
ref|XP_010935694.1|  PREDICTED: early light-induced protein 1, ch...    162   1e-44   
ref|XP_008224236.1|  PREDICTED: early light-induced protein 1, ch...    162   1e-44   
gb|ADV19257.1|  putative cold-inducible protein-like protein            161   1e-44   
ref|XP_009413904.1|  PREDICTED: early light-induced protein 1, ch...    162   2e-44   
ref|XP_003637637.1|  Early light inducible protein                      160   3e-44   
sp|Q01931.1|DS22_CRAPL  RecName: Full=Desiccation stress protein ...    162   4e-44   Craterostigma plantagineum
ref|XP_007226151.1|  hypothetical protein PRUPE_ppa014920mg             161   4e-44   
emb|CAA63338.1|  unnamed protein product                                160   8e-44   Helianthus annuus
ref|XP_010923519.1|  PREDICTED: early light-induced protein 1, ch...    160   8e-44   
ref|XP_008786056.1|  PREDICTED: early light-induced protein 1, ch...    160   9e-44   
gb|ABK22971.1|  unknown                                                 159   2e-43   Picea sitchensis
ref|XP_008392721.1|  PREDICTED: early light-induced protein 1, ch...    159   3e-43   
ref|XP_008777102.1|  PREDICTED: early light-induced protein 1, ch...    159   3e-43   
ref|XP_008391008.1|  PREDICTED: early light-induced protein 1, ch...    159   4e-43   
gb|AGH13354.1|  early light-inducible protein                           155   6e-43   
gb|AGH13359.1|  early light-inducible protein                           155   8e-43   
ref|XP_008224238.1|  PREDICTED: early light-induced protein 1, ch...    157   8e-43   
gb|ABK24316.1|  unknown                                                 157   2e-42   Picea sitchensis
gb|ABR16737.1|  unknown                                                 155   3e-42   Picea sitchensis
ref|XP_008360363.1|  PREDICTED: early light-induced protein 1, ch...    156   3e-42   
ref|XP_008360362.1|  PREDICTED: early light-induced protein 1, ch...    156   3e-42   
ref|NP_001237842.1|  uncharacterized protein LOC100306375               156   4e-42   
gb|ACN39996.1|  unknown                                                 156   5e-42   Picea sitchensis
ref|XP_006838940.1|  hypothetical protein AMTR_s00002p00270470          156   5e-42   
ref|XP_009343965.1|  PREDICTED: early light-induced protein 1, ch...    156   5e-42   
ref|XP_009343966.1|  PREDICTED: early light-induced protein 1, ch...    155   6e-42   
ref|XP_009341095.1|  PREDICTED: early light-induced protein 1, ch...    155   6e-42   
ref|XP_009341094.1|  PREDICTED: early light-induced protein 1, ch...    155   7e-42   
ref|XP_010676774.1|  PREDICTED: early light-induced protein 2, ch...    155   1e-41   
ref|XP_009343974.1|  PREDICTED: early light-induced protein 1, ch...    154   2e-41   
gb|AGH13356.1|  early light-inducible protein                           152   2e-41   
ref|XP_009343962.1|  PREDICTED: early light-induced protein 1, ch...    154   3e-41   
gb|AEW08119.1|  hypothetical protein 2_114_01                           151   6e-41   
gb|AFG63029.1|  hypothetical protein 2_114_01                           151   6e-41   
gb|ACN40010.1|  unknown                                                 150   3e-40   Picea sitchensis
ref|XP_009341105.1|  PREDICTED: early light-induced protein 1, ch...    149   4e-40   
gb|ABR16462.1|  unknown                                                 149   8e-40   Picea sitchensis
gb|ABK24238.1|  unknown                                                 148   5e-39   Picea sitchensis
gb|ACJ09655.1|  putative cold-inducible protein                         146   1e-38   Cupressus sempervirens
gb|EMT18433.1|  High molecular mass early light-inducible protein...    144   9e-38   
ref|XP_004955632.1|  PREDICTED: low molecular mass early light-in...    143   3e-37   
ref|XP_003557495.1|  PREDICTED: high molecular mass early light-i...    143   4e-37   
dbj|BAJ97969.1|  predicted protein                                      143   5e-37   
dbj|BAJ86766.1|  predicted protein                                      143   5e-37   
ref|XP_002461536.1|  hypothetical protein SORBIDRAFT_02g004380          144   6e-37   Sorghum bicolor [broomcorn]
ref|XP_004955631.1|  PREDICTED: high molecular mass early light-i...    142   8e-37   
gb|EMS57269.1|  hypothetical protein TRIUR3_20794                       142   9e-37   
dbj|BAJ86949.1|  predicted protein                                      142   1e-36   
ref|NP_001152703.1|  early light-induced protein                        142   1e-36   Zea mays [maize]
ref|NP_001152683.1|  early light-induced protein                        141   2e-36   Zea mays [maize]
ref|NP_001152927.1|  early light-induced protein                        141   2e-36   Zea mays [maize]
gb|ACG24515.1|  early light-induced protein                             141   2e-36   Zea mays [maize]
ref|XP_004955633.1|  PREDICTED: low molecular mass early light-in...    140   3e-36   
dbj|BAJ90265.1|  predicted protein                                      140   3e-36   
ref|XP_010228291.1|  PREDICTED: high molecular mass early light-i...    140   5e-36   
gb|EMT24337.1|  High molecular mass early light-inducible protein...    139   8e-36   
dbj|BAD30330.1|  putative low molecular mass early light-induced ...    139   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059030.1|  Os07g0178800                                       139   1e-35   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89047.1|  predicted protein                                      138   2e-35   
tpg|DAA42559.1|  TPA: early light-induced protein                       138   3e-35   
ref|XP_004955634.1|  PREDICTED: low molecular mass early light-in...    137   3e-35   
ref|XP_006379855.1|  hypothetical protein POPTR_0008s15800g             134   5e-35   
dbj|BAJ90110.1|  predicted protein                                      137   6e-35   
gb|AFP90212.1|  early light-induced protein                             135   6e-35   
ref|XP_009341102.1|  PREDICTED: early light-induced protein 1, ch...    137   8e-35   
ref|XP_003557497.1|  PREDICTED: low molecular mass early light-in...    136   9e-35   
ref|XP_009341101.1|  PREDICTED: early light-induced protein 1, ch...    136   1e-34   
sp|P14895.1|ELI5_HORVU  RecName: Full=High molecular mass early l...    137   1e-34   Hordeum vulgare [barley]
ref|XP_009341107.1|  PREDICTED: early light-induced protein 1, ch...    137   1e-34   
gb|EAY73277.1|  hypothetical protein OsI_01151                          135   3e-34   Oryza sativa Indica Group [Indian rice]
ref|NP_001152179.1|  early light-induced protein                        135   3e-34   Zea mays [maize]
ref|NP_001059029.1|  Os07g0178700                                       134   7e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23518.1|  hypothetical protein F775_14184                         135   1e-33   
ref|XP_002980561.1|  LHC-related protein                                133   2e-33   
ref|NP_001042574.1|  Os01g0246400                                       133   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ACG27686.1|  early light-induced protein                             132   3e-33   Zea mays [maize]
gb|ACG24151.1|  early light-induced protein                             132   3e-33   Zea mays [maize]
ref|XP_002461537.1|  hypothetical protein SORBIDRAFT_02g004390          132   4e-33   Sorghum bicolor [broomcorn]
ref|XP_002976832.1|  LHC-related protein                                132   4e-33   
gb|EAZ02969.1|  hypothetical protein OsI_25109                          132   6e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001105051.1|  early light-inducible protein ELIP                 131   7e-33   Zea mays [maize]
ref|XP_009586916.1|  PREDICTED: early light-induced protein 2, ch...    129   8e-33   
gb|EMS65479.1|  hypothetical protein TRIUR3_00475                       130   2e-32   
ref|XP_003557498.1|  PREDICTED: low molecular mass early light-in...    129   5e-32   
gb|EMS68027.1|  hypothetical protein TRIUR3_23641                       129   5e-32   
gb|ABR15761.1|  early light-inducible protein                           129   7e-32   Spirogyra varians
dbj|BAJ88670.1|  predicted protein                                      128   7e-32   
dbj|BAJ86624.1|  predicted protein                                      128   1e-31   
gb|EMS45333.1|  hypothetical protein TRIUR3_35028                       129   1e-31   
dbj|BAJ91644.1|  predicted protein                                      127   1e-31   
sp|P14897.1|ELI9_HORVU  RecName: Full=Low molecular mass early li...    127   2e-31   Hordeum vulgare [barley]
dbj|BAJ84888.1|  predicted protein                                      127   2e-31   
gb|EMS65481.1|  hypothetical protein TRIUR3_00477                       127   2e-31   
ref|XP_009615000.1|  PREDICTED: early light-induced protein 2, ch...    128   2e-31   
dbj|BAJ98694.1|  predicted protein                                      127   2e-31   
dbj|BAJ90447.1|  predicted protein                                      127   2e-31   
ref|XP_009622523.1|  PREDICTED: early light-induced protein 2, ch...    127   3e-31   
gb|EMS51739.1|  hypothetical protein TRIUR3_09306                       127   3e-31   
sp|P14896.1|ELI6_HORVU  RecName: Full=Low molecular mass early li...    126   3e-31   Hordeum vulgare [barley]
gb|KHG26202.1|  Early light-induced, chloroplastic                      126   4e-31   
gb|EMT03102.1|  Low molecular mass early light-inducible protein ...    125   4e-31   
gb|EMT08136.1|  Low molecular mass early light-inducible protein ...    125   9e-31   
emb|CDJ26488.1|  unnamed protein product                                125   1e-30   
gb|AFP90187.1|  early light-induced protein                             123   1e-30   
dbj|BAA76309.1|  early light-inducible protein                          124   2e-30   Triticum aestivum [Canadian hard winter wheat]
gb|ACI87755.1|  putative early light-induced protein                    118   1e-28   Cupressus sempervirens
ref|XP_007210927.1|  hypothetical protein PRUPE_ppa027213mg             117   3e-28   
ref|XP_003557500.1|  PREDICTED: low molecular mass early light-in...    117   1e-27   
ref|XP_010497961.1|  PREDICTED: early light-induced protein 1, ch...    113   2e-27   
ref|XP_003557499.1|  PREDICTED: low molecular mass early light-in...    115   3e-27   
ref|XP_006493973.1|  PREDICTED: uncharacterized protein LOC102620537    119   4e-27   
gb|AFP90175.1|  early light-induced protein                             112   2e-26   
gb|AFP90174.1|  early light-induced protein                             112   2e-26   
gb|AFP90157.1|  early light-induced protein                             111   4e-26   
gb|KDP40233.1|  hypothetical protein JCGZ_02231                         109   1e-25   
gb|EMS68026.1|  hypothetical protein TRIUR3_23640                       111   2e-25   
emb|CDJ26491.1|  unnamed protein product                                110   3e-25   
gb|AFP90210.1|  early light-induced protein                             108   4e-25   
gb|EMS45625.1|  hypothetical protein TRIUR3_10356                       109   5e-25   
gb|EMT08135.1|  hypothetical protein F775_02149                         108   1e-24   
ref|XP_006386973.1|  hypothetical protein POPTR_2515s00200g             105   2e-24   
gb|AFP90192.1|  early light-induced protein                             105   3e-24   
gb|AFP90162.1|  early light-induced protein                             105   3e-24   
gb|AFP90160.1|  early light-induced protein                             105   3e-24   
gb|AFP90205.1|  early light-induced protein                             105   3e-24   
gb|AFP90179.1|  early light-induced protein                             105   3e-24   
gb|AFP90182.1|  early light-induced protein                             105   3e-24   
gb|AFP90185.1|  early light-induced protein                             105   3e-24   
gb|AFP90168.1|  early light-induced protein                             105   3e-24   
gb|AFP90211.1|  early light-induced protein                             105   4e-24   
gb|AFP90159.1|  early light-induced protein                             105   6e-24   
gb|AFP90180.1|  early light-induced protein                             104   1e-23   
gb|AFP90158.1|  early light-induced protein                             103   1e-23   
gb|AFP90193.1|  early light-induced protein                             103   2e-23   
gb|AFP90197.1|  early light-induced protein                             103   2e-23   
gb|AFP90177.1|  early light-induced protein                             103   2e-23   
gb|AFP90166.1|  early light-induced protein                             103   2e-23   
gb|AFP90167.1|  early light-induced protein                             103   2e-23   
gb|AFP90164.1|  early light-induced protein                             103   3e-23   
gb|AFP90201.1|  early light-induced protein                             101   2e-22   
gb|AFP90204.1|  early light-induced protein                             100   3e-22   
gb|AFP90176.1|  early light-induced protein                           99.8    5e-22   
gb|ACI87806.1|  putative early light-induced protein                  97.1    6e-21   
ref|XP_009623411.1|  PREDICTED: desiccation stress protein DSP-22...  95.5    7e-21   
dbj|BAJ87895.1|  predicted protein                                    97.1    8e-21   
gb|ACI87803.1|  putative early light-induced protein                  92.8    2e-19   
gb|AFD61608.1|  putative early light-inducible protein 2              93.6    4e-19   
ref|XP_001754855.1|  predicted protein                                92.4    5e-19   
ref|XP_001781652.1|  predicted protein                                92.4    5e-19   
gb|AAP80747.1|  early light-induced protein                           89.0    1e-18   
ref|XP_001771612.1|  early light-induced protein 10                   92.0    2e-18   
ref|XP_001765645.1|  early light-induced protein 8                    92.4    5e-18   
ref|XP_001774160.1|  early light-induced protein 9                    90.9    6e-18   
ref|XP_005647188.1|  hypothetical protein COCSUDRAFT_63786            89.4    9e-18   
ref|XP_001757063.1|  early light-induced protein 6                    86.7    3e-17   
gb|KDO74447.1|  hypothetical protein CISIN_1g045593mg                 84.0    1e-16   
ref|XP_001779289.1|  predicted protein                                85.1    1e-16   
ref|XP_006420037.1|  hypothetical protein CICLE_v10006775mg           82.4    4e-16   
ref|XP_001783605.1|  early light-induced protein 5                    84.7    4e-16   
gb|AAK59376.1|  early light-inducible protein ELIPA                   85.1    5e-16   
ref|XP_001753766.1|  early light-induced protein 1                    84.3    5e-16   
gb|AAK59377.1|  early light-inducible protein ELIPB                   85.1    6e-16   
ref|XP_001775741.1|  early light-induced protein 12                   85.1    6e-16   
gb|EMS51551.1|  hypothetical protein TRIUR3_06314                     82.0    8e-16   
ref|XP_001753653.1|  early light-induced protein 3                    83.6    2e-15   
gb|EMS51552.1|  hypothetical protein TRIUR3_06315                     81.6    3e-15   
ref|XP_002970600.1|  LHC-related protein                              82.8    4e-15   
ref|XP_002968437.1|  LHC-related protein                              82.4    6e-15   
ref|XP_001779648.1|  early light-induced protein 13                   82.4    6e-15   
ref|XP_007227407.1|  hypothetical protein PRUPE_ppb019918mg           78.6    6e-15   
gb|KCW84132.1|  hypothetical protein EUGRSUZ_B010072                  79.7    1e-14   
ref|XP_005851999.1|  hypothetical protein CHLNCDRAFT_13796            79.3    1e-14   
gb|EMS49711.1|  hypothetical protein TRIUR3_31915                     79.3    2e-14   
ref|XP_002978298.1|  LHC-related protein                              80.9    2e-14   
gb|ABI79071.1|  chloroplast carotene biosynthesis-related protein     79.3    4e-14   
ref|XP_001778462.1|  early light-induced protein 4                    79.0    1e-13   
ref|XP_010045778.1|  PREDICTED: early light-induced protein 1, ch...  77.0    1e-13   
gb|ACJ09653.1|  putative early light-induced protein                  77.0    2e-13   
ref|XP_002506128.1|  early light induced protein-like protein, ch...  77.4    2e-13   
ref|WP_039311765.1|  hypothetical protein                             73.6    2e-12   
ref|XP_005848720.1|  hypothetical protein CHLNCDRAFT_21915            72.8    2e-12   
ref|XP_005651515.1|  hypothetical protein COCSUDRAFT_59463            73.2    5e-12   
ref|XP_002966276.1|  LHC-related protein                              73.6    8e-12   
sp|P27516.1|CBR_DUNSA  RecName: Full=Carotene biosynthesis-relate...  69.3    1e-10   
ref|XP_005649925.1|  hypothetical protein COCSUDRAFT_61600            72.8    1e-10   
gb|AAB25012.1|  early light-inducible protein homolog                 68.9    4e-10   
ref|XP_001694751.1|  early light-inducible protein                    67.8    5e-10   
ref|XP_002954801.1|  hypothetical protein VOLCADRAFT_76453            67.0    7e-10   
gb|AAX92667.1|  chloroplast carotene biosynthesis related protein     66.6    1e-09   
ref|XP_005643265.1|  hypothetical protein COCSUDRAFT_60029            65.9    2e-09   
ref|XP_001694210.1|  predicted protein                                64.7    2e-09   
ref|XP_005648653.1|  chlorophyll a/b-binding protein                  65.5    3e-09   
gb|ACJ09609.1|  putative early light-induced protein                  63.5    5e-09   
dbj|BAD27891.1|  putative early light-induced protein, low molecu...  65.5    6e-09   
ref|XP_002947126.1|  hypothetical protein VOLCADRAFT_103348           63.9    1e-08   
ref|XP_005642666.1|  hypothetical protein COCSUDRAFT_20912            62.4    1e-08   
ref|XP_002502857.1|  early light induced protein-like 5, chloropl...  64.7    2e-08   
gb|AAP44626.1|  putative low molecular mass early light-inducible...  63.2    3e-08   
ref|XP_001760998.1|  early light-induced protein 11                   61.2    4e-08   
ref|NP_001172891.1|  Os02g0265550                                     61.6    4e-08   
gb|EEE60635.1|  hypothetical protein OsJ_14071                        62.0    4e-08   
gb|AFD61607.1|  putative early light-inducible protein 1              62.0    5e-08   
ref|XP_007034869.1|  Uncharacterized protein TCM_020705               60.5    5e-08   
emb|CAA79273.1|  early light-inducible protein                        62.4    6e-08   
gb|AAB70536.1|  low molecular early light-inducible protein           60.5    1e-07   
ref|XP_007513716.1|  early light induced protein-like 6, chloropl...  60.5    2e-07   
gb|KFM24459.1|  Oxidoreductase HTATIP2                                61.6    3e-07   
ref|XP_001694681.1|  early light-inducible protein                    59.7    3e-07   
ref|XP_003060970.1|  early light induced protein-like 5, chloropl...  60.8    3e-07   
ref|XP_001695978.1|  early light-inducible protein                    58.2    7e-07   
gb|ACM50885.1|  carotene biosynthesis-related protein                 58.2    8e-07   
ref|XP_005645007.1|  hypothetical protein COCSUDRAFT_18438            57.4    1e-06   
ref|XP_001692700.1|  predicted protein                                57.0    3e-06   
gb|ACR36257.1|  unknown                                               55.8    7e-06   
ref|XP_002952327.1|  hypothetical protein VOLCADRAFT_105462           53.1    5e-05   
ref|XP_002505780.1|  early light induced protein-like 6, chloropl...  52.0    1e-04   
ref|XP_003060335.1|  early light induced protein-like 3, chloropl...  52.4    1e-04   
ref|XP_005644575.1|  hypothetical protein COCSUDRAFT_58256            50.8    1e-04   
ref|XP_003057986.1|  early light induced protein-like protein, wi...  53.1    2e-04   
gb|ABF96631.1|  hypothetical protein LOC_Os03g30400                   50.8    2e-04   
ref|XP_002505283.1|  early light induced protein-like 3, chloropl...  51.6    2e-04   
ref|YP_004061927.1|  hypothetical protein MpV1_044c                   50.4    2e-04   
gb|AHZ44785.1|  early light inducible protein                         50.1    3e-04   
gb|AFD61609.1|  putative early light-inducible protein 3              50.4    3e-04   
ref|XP_001693779.1|  predicted protein                                50.4    3e-04   
ref|XP_003060180.1|  carotene biosynthesis related or early light...  50.8    4e-04   
ref|XP_005850326.1|  hypothetical protein CHLNCDRAFT_142108           50.8    4e-04   
ref|YP_007676103.1|  hypothetical protein MPVG_00035                  49.7    5e-04   
gb|AAX63394.1|  carotene biosynthesis-related protein                 50.1    5e-04   
ref|XP_001765544.1|  early light-induced protein 14                   50.4    6e-04   
ref|XP_005850202.1|  hypothetical protein CHLNCDRAFT_142423           50.1    6e-04   
ref|XP_002501517.1|  early light induced protein-like with fascic...  51.2    7e-04   
gb|ABA01114.1|  chloroplast carotenoid-binding protein                49.3    7e-04   
ref|XP_001420982.1|  possible early light inducible or carotene b...  50.1    9e-04   



>ref|XP_009766381.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=195

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 154/202 (76%), Gaps = 9/202 (4%)
 Frame = -1

Query  810  MASTVVMQSIL--GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  637
            M ++  MQS++   SP TSF  RNG++QFVP  YLPR Q++    V+ MSED   KEQ +
Sbjct  1    MTTSFAMQSMIVGSSPPTSFSKRNGLNQFVPGCYLPRFQKSSRLRVKCMSEDGEKKEQSS  60

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
            +P+T ++ T+    PPP+ A         N  DVFSFSG GPERINGRLAMIGF AA+G+
Sbjct  61   SPLTNTAATSKPTPPPPAKAST-------NFSDVFSFSGAGPERINGRLAMIGFVAALGV  113

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            ELANGGDL AQ+SNGG +WFLG++ALLTLAS+IPLFQG++AESKS G+M+ADAEIWNGRF
Sbjct  114  ELANGGDLSAQLSNGGFSWFLGTSALLTLASLIPLFQGISAESKSGGIMSADAEIWNGRF  173

Query  276  AMLGLVALAFTEYVQNGPLLHV  211
            AMLGLVALAFTEYV+ G +  V
Sbjct  174  AMLGLVALAFTEYVKGGGIFQV  195



>ref|XP_004247604.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Solanum lycopersicum]
Length=192

 Score =   231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 152/201 (76%), Gaps = 10/201 (5%)
 Frame = -1

Query  810  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            M ++  MQSI LGSPV   +++NG++QFVPS YLPRL+R     V+ M+E+  G+++ +T
Sbjct  1    MITSFAMQSIILGSPVKLSQSKNGLNQFVPSCYLPRLRRTSRVRVKCMAEE--GEKESST  58

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            P T+ S T PKPTP              N  D+FSFSGP PERINGRLAMIGF AA+GME
Sbjct  59   PSTDYSATVPKPTPAKPKPST-------NFIDIFSFSGPAPERINGRLAMIGFVAAIGME  111

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            LANG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT ESKS G+MTADAEIWNGRFA
Sbjct  112  LANGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVTVESKSDGIMTADAEIWNGRFA  171

Query  273  MLGLVALAFTEYVQNGPLLHV  211
            MLGLVALAFTEYV+   L  V
Sbjct  172  MLGLVALAFTEYVKGAGLFQV  192



>ref|XP_004247605.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Solanum lycopersicum]
 gb|AAS92268.1| early light inducible protein [Solanum lycopersicum]
Length=191

 Score =   230 bits (587),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 150/199 (75%), Gaps = 10/199 (5%)
 Frame = -1

Query  804  STVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            ++  MQSI LGSP+   +N+NG++QFVPS YLPRL R     V+ M+E+  G+++ +TP 
Sbjct  2    TSFAMQSIILGSPLKLSQNKNGLNQFVPSCYLPRLHRTSRVSVKCMAEE--GEKESSTPS  59

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
            T+ S T PKPTP              N  D+FSFSGP PERINGRLAMIGF AA+GMELA
Sbjct  60   TDYSATVPKPTPAKPKPST-------NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELA  112

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
            NG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT ESKS G+MTADAEIWNGRFAML
Sbjct  113  NGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVTVESKSDGIMTADAEIWNGRFAML  172

Query  267  GLVALAFTEYVQNGPLLHV  211
            GLVALAFTEYV+   L  V
Sbjct  173  GLVALAFTEYVKGAGLFQV  191



>ref|XP_006363471.1| PREDICTED: early light-induced protein, chloroplastic-like [Solanum 
tuberosum]
Length=197

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 155/201 (77%), Gaps = 5/201 (2%)
 Frame = -1

Query  810  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            M+++  MQSI LGSPV   ++RNG++QFVPS YLPRL R     V+ M+E+    ++ +T
Sbjct  1    MSTSFAMQSIILGSPVKLSQSRNGLNQFVPSCYLPRLHRRSPLRVKCMAEEGEKLDKAST  60

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            P+T+S+ T PKPTP P    K +     N  D+FSFSGP PERINGRLAMIGF AA+G+E
Sbjct  61   PLTDSAATVPKPTPAPFAKAKPST----NFSDIFSFSGPAPERINGRLAMIGFVAAIGVE  116

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            LANG DL AQ+SNGG+ WFLGS+ALLTLAS+IPLFQGVT ESKS G+M+ADAEIWNGRFA
Sbjct  117  LANGADLSAQLSNGGLLWFLGSSALLTLASLIPLFQGVTVESKSDGIMSADAEIWNGRFA  176

Query  273  MLGLVALAFTEYVQNGPLLHV  211
            MLGLVALAFTEYV+   L  V
Sbjct  177  MLGLVALAFTEYVKGAGLFQV  197



>ref|XP_009616081.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=199

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 147/203 (72%), Gaps = 7/203 (3%)
 Frame = -1

Query  810  MASTVVMQS-ILGSPVTS-FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  637
            MA+ V MQ+ ILGSP+ S    RNGV+QFVPS Y+PRLQRN +  V+ MSED   K Q +
Sbjct  1    MATCVGMQTMILGSPIVSNISKRNGVNQFVPSCYIPRLQRNSTLSVKCMSEDGE-KGQTS  59

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
              + + + T      P  P     +       D+F+FSGP PERINGRLAMIGF AA+G 
Sbjct  60   NSLNDITATPTPTPTPTPPPVAKTST---KFGDLFAFSGPAPERINGRLAMIGFVAALGA  116

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESK-SKGLMTADAEIWNGR  280
            E ANGGD+FAQ+S+GG +WFLG++ALLTLAS+IPLFQG+ AE K + G+M+ADAEIWNGR
Sbjct  117  EFANGGDIFAQLSSGGFSWFLGTSALLTLASLIPLFQGIRAEKKYTSGIMSADAEIWNGR  176

Query  279  FAMLGLVALAFTEYVQNGPLLHV  211
            FAMLGLVALAFTEYV+ G  L V
Sbjct  177  FAMLGLVALAFTEYVKGGAFLQV  199



>gb|ADM72804.1| early light-inducible protein [Capsicum annuum]
Length=160

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 135/192 (70%), Gaps = 34/192 (18%)
 Frame = -1

Query  783  ILGSPVTSF-KNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstta  607
            ILGSPVTS  ++RNG++QFVPSSYLPRL RN    V+ MSE  +  +             
Sbjct  2    ILGSPVTSLSQSRNGLNQFVPSSYLPRLHRNTRLRVKCMSEPKSSTD-------------  48

Query  606  pkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFA  427
                                 +D+FSFSGP PERINGRLAMIGF AA+G+ELANGGDL A
Sbjct  49   --------------------FFDLFSFSGPAPERINGRLAMIGFVAAIGVELANGGDLSA  88

Query  426  QISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAF  247
            Q+S+GG+ WFLGS+ LLTLAS+IPLFQGVTAESKS G M+ADAEIWNGRFAMLGLVALAF
Sbjct  89   QLSSGGLLWFLGSSVLLTLASIIPLFQGVTAESKSGGFMSADAEIWNGRFAMLGLVALAF  148

Query  246  TEYVQNGPLLHV  211
            TEYV+ G L  V
Sbjct  149  TEYVKGGGLFQV  160



>ref|XP_009778398.1| PREDICTED: early light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=200

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = -1

Query  810  MASTVVMQS-ILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA    MQS ILGSP+ S   RNGV+QFVP  Y+PR QRN +  V+ MSED    +   +
Sbjct  1    MAICGGMQSMILGSPIVS--KRNGVNQFVPCCYIPRPQRNSTLSVKCMSEDGEKGQTSNS  58

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
                ++T  P PTP P P P+  AK+ST   D+F+FSGP PERINGRLAMIGF AA+G E
Sbjct  59   LNDIATTPTPTPTPTPIPTPRPVAKTSTKFGDLFAFSGPAPERINGRLAMIGFVAALGAE  118

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESK-SKGLMTADAEIWNGRF  277
             ANGGD+FAQ+S+GG +WFLG++ALLTLAS+IPLFQG+ AE K + G+M+ADAEIWNGRF
Sbjct  119  FANGGDIFAQLSSGGFSWFLGTSALLTLASLIPLFQGIRAEKKYTSGIMSADAEIWNGRF  178

Query  276  AMLGLVALAFTEYVQNGPLLHV  211
            AMLGLVALAFTEYV+ G  L V
Sbjct  179  AMLGLVALAFTEYVKGGAFLQV  200



>gb|AFK41568.1| unknown [Lotus japonicus]
Length=194

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 144/198 (73%), Gaps = 7/198 (4%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            +ST  MQSIL +P+     R+ V+QF +PS Y+P  +RN S  VRSM+E+   K+QP  P
Sbjct  3    SSTSAMQSILANPMIRMTTRSRVNQFTIPSVYMPSQRRNSSLRVRSMAEEP--KKQPIEP  60

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
             T +S   P   PP   APKV+        DV +F GP PERINGRLAMIGFAAAM +E+
Sbjct  61   ATSASPVTPSAPPPKPRAPKVST----KFSDVMAFGGPAPERINGRLAMIGFAAAMAVEV  116

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +F QIS+GGV WFLG++ +LTLAS++PLFQGV+ ESKSKG+MT+DAE+WNGR AM
Sbjct  117  ARGQGVFEQISDGGVPWFLGTSVVLTLASLVPLFQGVSVESKSKGVMTSDAELWNGRLAM  176

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+ G L+
Sbjct  177  LGLIALAFTEYVKGGILV  194



>ref|XP_007034868.1| Early light-induced protein, putative [Theobroma cacao]
 gb|EOY05794.1| Early light-induced protein, putative [Theobroma cacao]
Length=193

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 139/199 (70%), Gaps = 7/199 (4%)
 Frame = -1

Query  810  MASTVVMQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++  MQS+L   PVT   NR  V QF P   +PR QRN +  VR ++E++   EQPT 
Sbjct  1    MAASSAMQSLLLAGPVTGLANRGRVIQFFPVKSVPRFQRNANLHVRCLAEEEP-TEQPTK  59

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            PVT +    PKP P P+              DV +FSGP PERINGRLAM+GF AA+ ME
Sbjct  60   PVTSAPPQVPKPNPSPAAPKVST-----KFSDVLAFSGPAPERINGRLAMVGFVAALAME  114

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L+ G D+F QIS+GG+  FLG++ L++LAS+IPLF+GVT ESKS G MT+DAE+WNGRFA
Sbjct  115  LSKGQDVFTQISDGGIPLFLGTSILVSLASLIPLFRGVTVESKSGGFMTSDAELWNGRFA  174

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALAFTEYV+ G L+
Sbjct  175  MLGLVALAFTEYVKGGTLV  193



>gb|AAO33591.1|AF479309_1 putative early light induced protein [Arachis hypogaea]
Length=189

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 144/194 (74%), Gaps = 9/194 (5%)
 Frame = -1

Query  804  STVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            S+  MQSIL SP+T   +R+ V+QF VP+ Y+P ++RN S  VRSM+E++  KEQ T P 
Sbjct  4    SSYAMQSILASPMTRTPSRSRVNQFGVPALYMPNMRRNASLSVRSMAEEEQ-KEQSTEPT  62

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
            +         TPPP      + K ST   DV +FSGP PERINGRLAMIGF AA+ +EL+
Sbjct  63   S-------PVTPPPPKPQPRSPKMSTKFSDVLAFSGPAPERINGRLAMIGFVAALAVELS  115

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
            NG DL +QISNGG+ WFLG++ +L+LAS+IPLFQGV+ ESKS G M++DAE+WNGRFAML
Sbjct  116  NGQDLLSQISNGGIPWFLGTSVVLSLASLIPLFQGVSVESKSGGFMSSDAELWNGRFAML  175

Query  267  GLVALAFTEYVQNG  226
            GL+ALAFTEYV+ G
Sbjct  176  GLIALAFTEYVKGG  189



>ref|XP_002517068.1| early light-induced protein, putative [Ricinus communis]
 gb|EEF45231.1| early light-induced protein, putative [Ricinus communis]
Length=191

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 141/199 (71%), Gaps = 15/199 (8%)
 Frame = -1

Query  804  STVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKE-QPTTP  631
            +TV+  +IL SPV    NR  V+QF+P+ Y PRL+R  +   VR M+E+   +E +PT P
Sbjct  5    ATVMQAAILASPVLR-PNRARVTQFLPAPYTPRLRRMATATPVRCMAEEKENQEMKPTEP  63

Query  630  VTEssttapkptpppspapkvaakssTNLW-DVFSFSGPGPERINGRLAMIGFAAAMGME  454
            V+ +    P P P  S             W D+ +FSGP PERINGRLAMIGF AAM +E
Sbjct  64   VSATPKPQPAPKPKVSTK-----------WSDLLAFSGPAPERINGRLAMIGFVAAMAVE  112

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            LA G DLF Q+S+GG+TWF+G++ +L+LAS+IPLF+GV  ESKSKGLMT+DAE+WNGRFA
Sbjct  113  LAKGQDLFTQVSSGGITWFVGTSVVLSLASLIPLFKGVNVESKSKGLMTSDAELWNGRFA  172

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALAFTEYV  G L+
Sbjct  173  MLGLVALAFTEYVIGGALV  191



>gb|ACV89760.1| putative early light induced protein 2 [Camellia sinensis]
 gb|ACV89763.1| putative early light induced protein 2 [Camellia sinensis]
Length=175

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 132/198 (67%), Gaps = 23/198 (12%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++  MQS+L  PVTS   R    QF P SY+P LQ+N S  VR M++    ++    P
Sbjct  1    MATSATMQSVLARPVTSVTTRARFGQFTPCSYVPYLQKNASMQVRCMAKYGQKEDVTQKP  60

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
                                   K ST   DV +FSGP PERINGRLAMIGF AAM +EL
Sbjct  61   -----------------------KVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVEL  97

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            +NG D+  QISNGGV WF+G++ +LTLAS++PLF+GV+ ES+S+ +M++DAE+WNGRFAM
Sbjct  98   SNGEDVLVQISNGGVPWFVGTSIVLTLASLVPLFKGVSVESRSERIMSSDAELWNGRFAM  157

Query  270  LGLVALAFTEYVQNGPLL  217
            LGLVALAFTE+V+ G L+
Sbjct  158  LGLVALAFTEFVKGGALV  175



>gb|AFK38527.1| unknown [Lotus japonicus]
Length=193

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 139/193 (72%), Gaps = 4/193 (2%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            MQSI+ SP+     R+ V+QF  P+ Y+P L+RN +  VRSM+E +  KEQP  PVT +S
Sbjct  4    MQSIISSPMIRMTTRSRVNQFTTPAVYMPSLRRNATLRVRSMAEGEP-KEQPIEPVTSAS  62

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
               P P PPP         +  +  DV +F GP PERINGRLAMIGF AAM +E+A G  
Sbjct  63   PVTPSPPPPPPKPRAPKVSTKFS--DVMAFGGPAPERINGRLAMIGFVAAMAVEVARGQG  120

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            +F QIS+GGV WFLG++ + TLAS++PLFQGV+ ESKSKGLMT+DAE+WNG+ AMLGL+A
Sbjct  121  VFEQISDGGVPWFLGASVVFTLASLVPLFQGVSVESKSKGLMTSDAELWNGKLAMLGLIA  180

Query  255  LAFTEYVQNGPLL  217
            LAFTEYV+ G L+
Sbjct  181  LAFTEYVKGGTLV  193



>ref|XP_011027193.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 141/203 (69%), Gaps = 26/203 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-  640
            MA++ VMQ++L SPV S   KNR+GVS    ++Y+PRL+ + S  V+  ++ D  K+   
Sbjct  1    MATSTVMQTVLASPVPSSLVKNRSGVSNLFSATYVPRLRGSASKRVQCQAKLDDQKKSAG  60

Query  639  --TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
              +TP  + ST                        D+ +FSGP PERINGRLAMIGF AA
Sbjct  61   LSSTPKPKVST---------------------KFADLLAFSGPAPERINGRLAMIGFVAA  99

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            M +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++AESKS+G+MT+DAE+WN
Sbjct  100  MAVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGISAESKSEGVMTSDAEMWN  159

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAMLGLVALA TEYV  G LL
Sbjct  160  GRFAMLGLVALACTEYVSGGTLL  182



>gb|ACB20694.1| putative cold-inducible protein [Camellia sinensis]
 gb|ACV89762.1| putative light-inducible protein [Camellia sinensis]
Length=190

 Score =   196 bits (499),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -1

Query  804  STVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVT  625
            +T  MQSIL  PV+    R   SQF P SY+PRLQRN    VR M+EDD  K+       
Sbjct  2    ATPAMQSILARPVSGVTARARFSQFTPCSYVPRLQRNAGMQVRCMAEDDQNKDV------  55

Query  624  EssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  445
             +  T P PT  P   P    K ST   DV +FSGP PERINGRLAMIGF AAM +EL+ 
Sbjct  56   -TPITTPPPTSQPISFPPPKPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVELSK  114

Query  444  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLG  265
            G D+ AQISNGGV WF G++ +LTLAS+IPLF+G + ES+S+G+M++DAE+WNGRFAMLG
Sbjct  115  GEDVLAQISNGGVPWFGGTSIVLTLASLIPLFKGGSVESRSEGIMSSDAELWNGRFAMLG  174

Query  264  LVALAFTEYVQNGPLL  217
            LVALAFTE+V+ G L+
Sbjct  175  LVALAFTEFVKGGALV  190



>ref|XP_002312551.2| hypothetical protein POPTR_0008s15770g [Populus trichocarpa]
 gb|EEE89918.2| hypothetical protein POPTR_0008s15770g [Populus trichocarpa]
Length=182

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 138/203 (68%), Gaps = 26/203 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---E  646
            MA++ VMQ++L +PV S   KNR+ VS    ++Y+PRL+ + S  V+    DD  K   E
Sbjct  1    MATSTVMQTVLATPVPSGLVKNRSRVSNLFSATYVPRLRGSASKRVQCSKLDDQIKKLAE  60

Query  645  QPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
              +TP  + S                         D+F+FSGP PERINGRLAMIGF AA
Sbjct  61   PSSTPKPKVSP---------------------KFLDLFAFSGPAPERINGRLAMIGFVAA  99

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            M +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV+AESKS G+MT+DAE+WN
Sbjct  100  MAVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSDGVMTSDAEMWN  159

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAMLGLVALA TEYV  G LL
Sbjct  160  GRFAMLGLVALACTEYVSGGTLL  182



>ref|XP_011027158.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 141/203 (69%), Gaps = 26/203 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-  640
            MA++ VMQ++L +PV S   KNR+GVS    ++Y+PRL+ + S  V+  ++ D  K+   
Sbjct  1    MATSTVMQTVLATPVPSSLVKNRSGVSNLFSATYVPRLRGSASKRVQCQAKLDDQKKSAG  60

Query  639  --TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
              +TP  + ST                        D+ +FSGP PERINGRLAMIGF AA
Sbjct  61   LSSTPKPKVST---------------------KFADLLAFSGPAPERINGRLAMIGFVAA  99

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            M +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+G++AESKS+G+MT+DAE+WN
Sbjct  100  MAVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGISAESKSEGVMTSDAEMWN  159

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAMLGLVALA TEYV  G LL
Sbjct  160  GRFAMLGLVALACTEYVSGGTLL  182



>gb|AFK48277.1| unknown [Lotus japonicus]
Length=188

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 140/198 (71%), Gaps = 13/198 (7%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            +ST  +QSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ  + 
Sbjct  3    SSTSAIQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQSAS-  59

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
                       TP P P    A K ST   DV +F GP PERINGRLAMIGF AAM +E+
Sbjct  60   ---------PVTPSPPPPKPRAPKVSTKFSDVMAFGGPAPERINGRLAMIGFVAAMAVEV  110

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +F QIS+GGV WFLG++ +LTLAS++PLFQGV+ ESKSKG+MT+DAE+WNGR AM
Sbjct  111  ARGQGVFEQISDGGVPWFLGTSVVLTLASLVPLFQGVSVESKSKGVMTSDAELWNGRLAM  170

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+ G L+
Sbjct  171  LGLIALAFTEYVKGGTLV  188



>ref|XP_010279261.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Nelumbo nucifera]
Length=195

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 146/202 (72%), Gaps = 11/202 (5%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT--SFKNRNGVSQFV-PSSYLPRLQRNPSFL-VRSMSEDDAGKEQ  643
            MAS+V MQSIL +PV      +R   S  V PS+Y PR Q+N   L VR M+E+   KEQ
Sbjct  1    MASSVSMQSILVNPVAVGRLGHRCRPSSMVFPSTYFPRQQKNGCTLQVRCMAEESQ-KEQ  59

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
                  +SS  +  P+PP   +P  + K ST   DV +FSGP PERINGRLAMIGF AAM
Sbjct  60   ------KSSPVSAPPSPPQPTSPSASPKVSTKFTDVLAFSGPAPERINGRLAMIGFVAAM  113

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV  +SKSKGLMT+DAE+WNG
Sbjct  114  AVELAKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGVDVQSKSKGLMTSDAELWNG  173

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            RFAMLGLVAL FTEYV+ G L+
Sbjct  174  RFAMLGLVALVFTEYVKGGALI  195



>ref|XP_010279259.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=195

 Score =   192 bits (489),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 145/202 (72%), Gaps = 11/202 (5%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT--SFKNRNGVSQFV-PSSYLPRLQRNPSFL-VRSMSEDDAGKEQ  643
            MAS+V MQSIL +PV      +R   S  V PS+Y PR Q+N   L VR M+E+   KEQ
Sbjct  1    MASSVSMQSILVNPVAVGRLGHRGRPSSMVFPSTYFPRQQKNGCTLQVRCMAEESQ-KEQ  59

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
                  +SS  +  P+PP    P  + K ST   DV +FSGP PERINGRLAMIGF AAM
Sbjct  60   ------KSSPVSAPPSPPQHTTPSGSPKVSTKFTDVLAFSGPAPERINGRLAMIGFVAAM  113

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+IPLF+GV  +SKSKGLMT+DAE+WNG
Sbjct  114  AVELAKGDDVAAQLANGGLTWFLGTTAVLSLASLIPLFKGVDVQSKSKGLMTSDAELWNG  173

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            RFAMLGLVAL FTEYV+ G L+
Sbjct  174  RFAMLGLVALVFTEYVKGGALI  195



>gb|AFK38098.1| unknown [Lotus japonicus]
Length=188

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 140/198 (71%), Gaps = 13/198 (7%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            +ST  MQSIL +P+     R+ V+QF +PS Y+P L+RN S  VRSM+E+   KEQ  + 
Sbjct  3    SSTSAMQSILANPMIRMTTRSRVNQFTIPSVYMPSLRRNSSLRVRSMAEEP--KEQSAS-  59

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
                       TP P P    A K ST   DV +F GP PERINGRLAMIGF AAM +E+
Sbjct  60   ---------PVTPSPPPPKPRAPKVSTKFSDVMAFGGPAPERINGRLAMIGFVAAMAVEV  110

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +F QIS+GGV WFLG++ +LTLAS++PLFQGV+ ESKSKG+MT+DAE+WNG+ A+
Sbjct  111  ARGQGVFEQISDGGVPWFLGTSVVLTLASLVPLFQGVSVESKSKGVMTSDAELWNGKLAV  170

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+ G L+
Sbjct  171  LGLIALAFTEYVKGGTLV  188



>ref|XP_010043033.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85048.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=199

 Score =   192 bits (489),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M SI  SP T+    +R  V++   P+++ PRL       VR M+E+   +   
Sbjct  1    MASTILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEEIKPEGST  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
             TP ++  +++P PTP PSP PK    +  N  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   ETPASDVPSSSPTPTPSPSPKPKRKVST--NFTDVFAFSGPAPERINGRLAMIGFVAAIA  118

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT ESKS GLMT+DAE+WNGR
Sbjct  119  VELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVTVESKSDGLMTSDAELWNGR  178

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  179  LAMLGLVALAFTEYVKGGTLV  199



>ref|XP_002312552.2| early light-induced protein precursor [Populus trichocarpa]
 gb|ABK94838.1| unknown [Populus trichocarpa]
 gb|EEE89919.2| early light-induced protein precursor [Populus trichocarpa]
Length=182

 Score =   192 bits (487),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 140/200 (70%), Gaps = 20/200 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  637
            MA++ VMQ++L SPV S   KNR+ VS    ++Y+PRL+ +    ++  +E D   EQ  
Sbjct  1    MATSTVMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGSAGKRLQCKAELD---EQNM  57

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
            +                 P+P    K ST   DV +FSGP PERINGRLAMIGF AAM +
Sbjct  58   SA---------------EPSPPPKPKVSTKFADVLAFSGPAPERINGRLAMIGFVAAMAV  102

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV+AESKS+G+MT+DAE+WNGRF
Sbjct  103  ELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSEGVMTSDAEMWNGRF  162

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALA TEYV  G LL
Sbjct  163  AMLGLVALACTEYVSGGTLL  182



>ref|XP_006379854.1| early light-induced protein precursor [Populus trichocarpa]
 gb|ABK95874.1| unknown [Populus trichocarpa]
 gb|ERP57651.1| early light-induced protein precursor [Populus trichocarpa]
Length=182

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 133/200 (67%), Gaps = 20/200 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  637
            MA++ VMQ++L SPV S   KNR+ VS    ++Y+PRL+ + S  ++  +E D  K    
Sbjct  1    MATSTVMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGSASKRLQCKAELDEQKMSAE  60

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
                     +                      DV +FSGP PERINGRLAMIGF AAM +
Sbjct  61   PSPPPKPKVST------------------KFADVLAFSGPAPERINGRLAMIGFVAAMAV  102

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            EL+ G DLF+QISNGGV+WF+G++ LL++AS++PLF+GV+AESKS G+MT+DAE+WNGRF
Sbjct  103  ELSKGQDLFSQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMTSDAEMWNGRF  162

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALAFTE+V    LL
Sbjct  163  AMLGLVALAFTEFVSGRTLL  182



>ref|XP_010107710.1| hypothetical protein L484_013325 [Morus notabilis]
 gb|EXC16745.1| hypothetical protein L484_013325 [Morus notabilis]
Length=195

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 137/202 (68%), Gaps = 11/202 (5%)
 Frame = -1

Query  810  MASTVVMQ-SILGSPVTSFKN--RNGVSQFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQ  643
            MA   VMQ S++ S      N  +    QF+PS  LPRL+R N    VR M++D   KEQ
Sbjct  1    MAGPAVMQYSVVTSSFVCAANGIKKANKQFLPSLNLPRLRRINTPLRVRCMTQDGEQKEQ  60

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
            PT PV  S          P+P             D+ +FSGP PERINGRLAM+GF AAM
Sbjct  61   PT-PVPNSPPQPTPAPSRPTPKVST------KFSDILAFSGPAPERINGRLAMVGFVAAM  113

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +EL+ G D+FAQISNGG++WF+G++ +LTLAS++PLF+GV+ ESKS G+MT+DAE+WNG
Sbjct  114  AVELSKGQDVFAQISNGGISWFVGTSIVLTLASLVPLFKGVSVESKSSGVMTSDAELWNG  173

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            RFAMLGLVALAFTEYV+ G L+
Sbjct  174  RFAMLGLVALAFTEYVKGGTLV  195



>ref|XP_002312550.2| hypothetical protein POPTR_0008s15760g [Populus trichocarpa]
 gb|EEE89917.2| hypothetical protein POPTR_0008s15760g [Populus trichocarpa]
Length=182

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 137/203 (67%), Gaps = 26/203 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---E  646
            MA++ VMQ++L +PV S   KNR+ VS    ++++PRL+ + S  V+    DD  K   E
Sbjct  1    MATSTVMQTVLATPVPSGLVKNRSRVSNLFSATFVPRLRGSASKRVQCSKLDDQIKKLAE  60

Query  645  QPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
              +TP  + S                         D+F+FSGP PERINGRLAMIGF AA
Sbjct  61   PSSTPKPKVSP---------------------KFLDLFAFSGPAPERINGRLAMIGFVAA  99

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            M +EL+ G DL  QISNGGV+WF+G++ LL++AS+IPLF+GV+AESKS G+MT+DAE+WN
Sbjct  100  MAVELSKGQDLSYQISNGGVSWFVGTSILLSVASLIPLFKGVSAESKSDGVMTSDAEMWN  159

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAMLGLVALA+TEYV  G LL
Sbjct  160  GRFAMLGLVALAYTEYVSGGTLL  182



>ref|XP_010107713.1| hypothetical protein L484_013328 [Morus notabilis]
 gb|EXC16748.1| hypothetical protein L484_013328 [Morus notabilis]
Length=195

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 139/202 (69%), Gaps = 11/202 (5%)
 Frame = -1

Query  810  MASTVVMQ-SILGSPVTSFKN--RNGVSQFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQ  643
            MA + VMQ S++ S      N  +    Q +PS  LPRL+R N    VR M++D   K+Q
Sbjct  1    MAGSAVMQYSVVTSCFVCAANGIKKANKQLLPSLNLPRLRRINTPLRVRCMTKDREQKKQ  60

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
            PT PV  S      P  PP+P             DV +FSGP PERINGRLAM+GF AAM
Sbjct  61   PT-PVRNSPPQPTLPPSPPTPKVST------KFSDVLAFSGPAPERINGRLAMVGFVAAM  113

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +EL+ G D+FAQISNGG++WF+G++ +LTLAS++PLF+GV+ ESKS G+MT+DAE+WNG
Sbjct  114  AVELSKGQDVFAQISNGGISWFVGTSLVLTLASLVPLFKGVSVESKSSGVMTSDAELWNG  173

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            RFAMLGLVALAFTEYV+ G L+
Sbjct  174  RFAMLGLVALAFTEYVKGGTLV  195



>ref|XP_010043034.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X3 [Eucalyptus grandis]
 gb|KCW85049.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=181

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 136/201 (68%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M SI  SP T+    +R  V++   P+++ PRL       VR M+E++     P
Sbjct  1    MASTILMHSIPVSPTTTIDLSSRKSVARGLFPANHSPRLAPRGGLRVRCMTEENKRDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +                     K  +K STN  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SP--------------------KSKSKVSTNFRDVFAFSGPAPERINGRLAMIGFVAAIS  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+WNGR
Sbjct  101  VELSKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVTAESKSDGLMTSDAELWNGR  160

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  161  LAMLGLVALAFTEYVKGGTLV  181



>ref|XP_006420038.1| hypothetical protein CICLE_v10006006mg [Citrus clementina]
 ref|XP_006489464.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR33278.1| hypothetical protein CICLE_v10006006mg [Citrus clementina]
 gb|KDO74446.1| hypothetical protein CISIN_1g029976mg [Citrus sinensis]
Length=184

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 137/203 (67%), Gaps = 24/203 (12%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFK----NRNGVSQFVPSSYLP-RLQRNPSFLVRSMSEDDAGKE  646
            MA+++  QS+LGS V + +     ++GV QF    YLP  LQRN S  VR M++++  K+
Sbjct  1    MAASLATQSMLGSSVVAARVTGIRKSGVYQFSSVKYLPGTLQRNVSLSVRCMAKNEQQKD  60

Query  645  QPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
            Q T P                       + ST   DVF+FSGP PERINGRLAMIGF AA
Sbjct  61   QSTQP-------------------PKLPRISTKFSDVFAFSGPAPERINGRLAMIGFVAA  101

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            + +EL+ G D+FAQ+S+GGV WFLG++ LL++AS++PLF+GV+ ESKS G MT+DAE+WN
Sbjct  102  LAVELSKGQDVFAQLSDGGVAWFLGTSVLLSVASLVPLFKGVSVESKSDGFMTSDAELWN  161

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAM+GLVALA TE+V+   L+
Sbjct  162  GRFAMMGLVALAVTEFVKGSTLV  184



>ref|XP_007143316.1| hypothetical protein PHAVU_007G062000g [Phaseolus vulgaris]
 gb|ESW15310.1| hypothetical protein PHAVU_007G062000g [Phaseolus vulgaris]
Length=192

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 140/198 (71%), Gaps = 9/198 (5%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            AS+  MQSIL +P+     R+ V+ F +P+ Y+   +RN S  VRS++E++  + +P  P
Sbjct  3    ASSSAMQSILANPMIGMSTRSRVNHFGLPAVYM---RRNVSLRVRSLAEEEQ-QSEPAAP  58

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            VT      P   P   PA   + K ST   DV +FSGP PERINGRLAMIGF AAM +E+
Sbjct  59   VTP----PPSVKPVQQPATTASPKVSTKFSDVLAFSGPAPERINGRLAMIGFVAAMAVEV  114

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +F QISNGGV WFLG++ +LTLAS+IPLFQGV+ ESKS G M++DAE+WNGRFAM
Sbjct  115  AKGQGVFEQISNGGVPWFLGTSVVLTLASLIPLFQGVSVESKSGGFMSSDAELWNGRFAM  174

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+ G L+
Sbjct  175  LGLIALAFTEYVKGGTLV  192



>ref|XP_008224239.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=198

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 148/201 (74%), Gaps = 6/201 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MA++  MQS+L + V     ++    V+  +P+ Y P L R P+  VRSM+E+   +EQP
Sbjct  1    MAASASMQSLLANSVAFGAGKSKSLRVNHLLPAKYAPTLHRYPNMRVRSMAEN-GQEEQP  59

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +T     ++  P P P P+P PK + K STN  DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  60   ST--APEASKIPPPPPTPTPPPKRSPKISTNFSDVFAFSGPAPERINGRLAMVGFVSALA  117

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +ELA G DLFAQIS+GGV+ FLG++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+WNGR
Sbjct  118  VELAKGQDLFAQISDGGVSLFLGTSILLSVASLIPLFRGVSVESKSDGIMTSDAELWNGR  177

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  178  MAMLGLVALAFTEYVKGGTLV  198



>ref|XP_007225862.1| hypothetical protein PRUPE_ppa011739mg [Prunus persica]
 gb|EMJ27061.1| hypothetical protein PRUPE_ppa011739mg [Prunus persica]
Length=198

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 146/201 (73%), Gaps = 6/201 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MA++  MQSIL + V     ++G   VS  VP+ Y     R P   VRSM+E+   +EQP
Sbjct  1    MAASASMQSILANSVVYGAGKSGSVRVSHLVPAKYATTSHRYPQLRVRSMAENGQ-EEQP  59

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +T  T  ++  P P P P+P+PK + K ST   DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  60   ST--TPEASRIPPPPPTPTPSPKRSPKVSTKFSDVFAFSGPAPERINGRLAMVGFVSALA  117

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G D+FAQIS+GGV+ FL ++ LL++ASVIPLF+GV+ ESKS G+MT+DAE+WNGR
Sbjct  118  VELSKGQDVFAQISDGGVSLFLATSILLSVASVIPLFKGVSVESKSDGIMTSDAELWNGR  177

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  178  LAMLGLVALAFTEYVKGGTLV  198



>ref|XP_011027181.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Populus euphratica]
Length=181

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 138/203 (68%), Gaps = 27/203 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK---E  646
            MA++ VMQ++L +P  S   KNR+ VS F  ++Y+P L+ + S  V+  +E D  K   E
Sbjct  1    MATSTVMQTVLATPAASSLVKNRSRVSNFFSATYVP-LRGSASKRVQCKAELDDQKMSAE  59

Query  645  QPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
              +TP  + ST                        D+ +FSGP PERINGRLAMIGF AA
Sbjct  60   PSSTPKPKVST---------------------KFADLLAFSGPAPERINGRLAMIGFVAA  98

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            M +EL+ G DLF+QISNGGV+WF+G++ LL++AS+IPLF+GV AESKS+G+MT+DAE+WN
Sbjct  99   MAVELSKGQDLFSQISNGGVSWFVGTSILLSVASLIPLFKGVRAESKSEGVMTSDAEMWN  158

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAMLGLVALA TEYV  G LL
Sbjct  159  GRFAMLGLVALACTEYVSGGTLL  181



>ref|NP_001267842.1| uncharacterized protein LOC100263179 [Vitis vinifera]
 gb|ADG21226.1| chloroplast ELIP early light-induced protein [Vitis vinifera]
Length=199

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 136/200 (68%), Gaps = 3/200 (2%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP--T  637
            MA    MQS L + +T   NR    Q VP   + RLQR+ +  VR   ED   +  P  T
Sbjct  1    MAMATTMQSTLATAMTRVANRTRDLQVVPPRSVLRLQRS-AVQVRCTKEDGQIERPPPVT  59

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
            T   +  + +    P P P P  A K ST   DVF+FSGP PERINGRLAM+GF AAMG 
Sbjct  60   TNPQQPPSLSQSRQPIPPPPPPPAPKVSTKFGDVFAFSGPAPERINGRLAMVGFVAAMGA  119

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            E+  G D+FAQISNGG+ WFLG+  +L+LAS+IPLF+GV+ ESKSKGLMT+DAE+WNGRF
Sbjct  120  EIWKGEDVFAQISNGGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRF  179

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALAFTEY++ G L+
Sbjct  180  AMLGLVALAFTEYLKGGALV  199



>ref|XP_007225864.1| hypothetical protein PRUPE_ppa011747mg [Prunus persica]
 gb|EMJ27063.1| hypothetical protein PRUPE_ppa011747mg [Prunus persica]
Length=198

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MA++  +QS+L + V     ++    V+  +P+ Y P L R P+  VRSM+E+   +EQP
Sbjct  1    MAASASVQSLLANSVAYGAGKSKSLRVNHLLPAKYAPTLHRYPNMRVRSMAENGQ-EEQP  59

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +T     ++  P P P P+P PK + K ST   DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  60   ST--APEASKIPPPPPTPTPPPKRSPKISTKFSDVFAFSGPAPERINGRLAMVGFVSALA  117

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +ELA G DLFAQIS+GGV+ FLG++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+WNGR
Sbjct  118  VELAKGQDLFAQISDGGVSLFLGTSILLSVASLIPLFRGVSVESKSDGIMTSDAELWNGR  177

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  178  LAMLGLVALAFTEYVKGGTLV  198



>ref|XP_004496671.1| PREDICTED: early light-induced protein, chloroplastic-like [Cicer 
arietinum]
Length=197

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 133/186 (72%), Gaps = 4/186 (2%)
 Frame = -1

Query  768  VTSFKNRNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkpt  595
            +T   +R+ VSQF  +PS Y+P  +R+ S  VRSM+E++  K+QP  PV   +  +  P 
Sbjct  14   MTGISSRSRVSQFSSIPSVYIPNTRRSASLKVRSMAEEEQ-KQQPKVPVNPVTPVSQPPP  72

Query  594  pppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISN  415
            PP     + +  S+    D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS 
Sbjct  73   PPQPAYTRPSKMST-KFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFEQISG  131

Query  414  GGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYV  235
            GGV WFLG++ LLTLAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV
Sbjct  132  GGVPWFLGTSVLLTLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYV  191

Query  234  QNGPLL  217
            +   L+
Sbjct  192  KGTSLV  197



>ref|XP_004134120.1| PREDICTED: early light-induced protein, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004162267.1| PREDICTED: early light-induced protein, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56941.1| hypothetical protein Csa_3G145780 [Cucumis sativus]
Length=192

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 138/198 (70%), Gaps = 6/198 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++ VMQSIL +  T    R   ++ +P++  P  +   +F VR M+E+D  +EQ    
Sbjct  1    MAASAVMQSILSTTATRGVYRTTTNRLLPAALRPCSRSTAAFRVRCMAEEDQ-REQAIPS  59

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
                    P P  P       +  +ST L D+ +FSGPGPERINGRLAMIGF AA+ +E+
Sbjct  60   SI-----PPSPPKPEPSPSPPSKVTSTKLTDILAFSGPGPERINGRLAMIGFVAALAVEV  114

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            + G D+F QI+NGG+ WF+G++ +LTLAS+IPLF+GV+AES SKG+M+++AE+WNGRFAM
Sbjct  115  SKGQDVFEQIANGGIPWFVGTSVVLTLASLIPLFKGVSAESNSKGIMSSNAELWNGRFAM  174

Query  270  LGLVALAFTEYVQNGPLL  217
            LGLVALAFTEYV+ G L+
Sbjct  175  LGLVALAFTEYVKGGSLV  192



>ref|XP_010043032.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85050.1| hypothetical protein EUGRSUZ_B01895 [Eucalyptus grandis]
Length=199

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAS ++++SI  SP  + +    R+ V    P+ ++PR        VR M+E+   +   
Sbjct  1    MASAILLRSIPASPSAAIEINSRRSVVRGRFPAYHVPRTAPRGGLRVRCMTEEIKPEGST  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
             TP ++  +++P PTP PSP PK    +  N  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   ETPASDVPSSSPTPTPSPSPKPKRKVST--NFTDVFAFSGPAPERINGRLAMIGFVAAIA  118

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT ESKS GLMT+DAE+WNGR
Sbjct  119  VELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVTVESKSDGLMTSDAELWNGR  178

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  179  LAMLGLVALAFTEYVKGGTLV  199



>ref|XP_011027169.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Populus euphratica]
Length=182

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 132/201 (66%), Gaps = 22/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTS--FKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSE-DDAGKEQP  640
            MA++ VMQ++L SPV S   KNR+ VS    ++Y+PRL+   S  V+  +E DD      
Sbjct  1    MATSTVMQTVLASPVASSLVKNRSRVSNLFSATYVPRLRGGASKRVQCKAELDDQKMSAE  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
             +P  +   +                       DV +FSGP PERINGRLAMIGF AAM 
Sbjct  61   PSPAPKPKVST-------------------KFADVLAFSGPAPERINGRLAMIGFVAAMA  101

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DLF+QISNGG +WF+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+WNGR
Sbjct  102  VELSKGPDLFSQISNGGGSWFVGTSILLSVASLIPLFKGVSVESKSDGVMTSDAEMWNGR  161

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALA TE+V    LL
Sbjct  162  FAMLGLVALALTEFVSGRTLL  182



>gb|ABU98940.1| early light-induced protein 3 [Rhododendron catawbiense]
Length=181

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 136/199 (68%), Gaps = 19/199 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++ VMQSIL SPVT      G+S+ +P SSYLPR  R+   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRSSYLPRQGRDSGMLVRCMAKDGK-KEEVES  59

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            PV                     AK+  + +D+ +FSGPGPERINGRLAM+GF AA+ +E
Sbjct  60   PVK-----------------ATVAKARIDFFDLLAFSGPGPERINGRLAMVGFVAAIAVE  102

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFA
Sbjct  103  LSKGEDVFAQISNGGIPWFLLTTGVLSIASLIPLSSGVSVESRSKPFWSSDAEMLNGRFA  162

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALA TEYV+ G L+
Sbjct  163  MLGLVALALTEYVKGGTLV  181



>gb|ACU13898.1| unknown [Glycine max]
Length=192

 Score =   186 bits (471),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            AS+  MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM++++   E P TP
Sbjct  3    ASSYAMQSILANPLIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAKEEQPSE-PATP  58

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            VT   +  PKP P  +P+ KV+        DV +FSGP PERINGRLAMIGF AAM +E+
Sbjct  59   VTPPPSVEPKPQPVSAPSSKVST----KFSDVLAFSGPAPERINGRLAMIGFVAAMAVEV  114

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+ ESKSKG M++DAE+WNGRFAM
Sbjct  115  AKGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAM  174

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+   L+
Sbjct  175  LGLIALAFTEYVKGSTLV  192



>ref|XP_010326693.1| PREDICTED: early light-induced protein 1, chloroplastic-like, 
partial [Solanum lycopersicum]
Length=122

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  370
            N  D+FSFSGP PERINGRLAMIGF AA+GMELANG DL AQ+SNGG+ WFLGS+ALLTL
Sbjct  7    NFIDIFSFSGPAPERINGRLAMIGFVAAIGMELANGADLSAQLSNGGLLWFLGSSALLTL  66

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS+IPLFQGVT ESKS G+MTADAEIWNGRFAMLGLVALA TEYV+   L  V
Sbjct  67   ASLIPLFQGVTVESKSDGIMTADAEIWNGRFAMLGLVALALTEYVKGAGLFQV  119



>emb|CDO99111.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 136/203 (67%), Gaps = 17/203 (8%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKE-----  646
            MA++V MQS LGSPV    +R G++Q V  S    L +  +F VRSM+E++  +      
Sbjct  1    MAASVAMQSFLGSPVAGVSSRRGLNQVVRLSCGLHLPKRANFRVRSMAEENDKETADAAP  60

Query  645  QPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAA  466
            QPT P                P P    K ST   DV +FSGPGPERINGRLAMIGF AA
Sbjct  61   QPTQP------------NVAQPNPAPKPKVSTKFEDVLAFSGPGPERINGRLAMIGFVAA  108

Query  465  MGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
            +G+EL  G DLF QI++GG+ WF+G++ LL++AS+IPLF+GV AE++  G M +DAE+WN
Sbjct  109  IGVELGRGQDLFTQINDGGLQWFIGTSVLLSIASLIPLFRGVRAEAEGGGFMNSDAELWN  168

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GRFAMLGL+ALAFTEY++ G L+
Sbjct  169  GRFAMLGLIALAFTEYLKGGALV  191



>gb|KCW84128.1| hypothetical protein EUGRSUZ_B01004 [Eucalyptus grandis]
Length=181

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 134/202 (66%), Gaps = 25/202 (12%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT----SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  643
            MAST++M S+  SP T    SF+ ++ V  F P ++ PRL       V+ M+++      
Sbjct  1    MASTILMHSVPASPRTVIDISFR-KSIVRGFFPVNHSPRLAPQVGLCVKCMTKEGKPDLN  59

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
            P+                     K  +K ST   DVF+FSGP PERINGRLAMIGF AA+
Sbjct  60   PSQ--------------------KSKSKVSTGFTDVFAFSGPAPERINGRLAMIGFVAAI  99

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+WNG
Sbjct  100  AVELSKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVTAESKSDGLMTSDAELWNG  159

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            R AMLGLVALAFTEYV+ G L+
Sbjct  160  RLAMLGLVALAFTEYVKGGTLV  181



>gb|KEH43786.1| early light-induced-like protein [Medicago truncatula]
Length=197

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 133/180 (74%), Gaps = 4/180 (2%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  577
            R+ V+Q   +PS Y+P  +RN SF VRSM+E+   KEQP  PV +S T    PTPPP  A
Sbjct  20   RSRVNQISNIPSVYMPSFRRNASFKVRSMAEEGQ-KEQPKVPV-DSITPTSAPTPPPQSA  77

Query  576  pkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWF  397
               A K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WF
Sbjct  78   YTRAPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWF  137

Query  396  LGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            LG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L+
Sbjct  138  LGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSLV  197



>ref|XP_004296581.1| PREDICTED: early light-induced protein, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=197

 Score =   185 bits (469),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -1

Query  714  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDV  535
            LP L R P+  VRSM+ED   +E+P+T    S   A  PTP P P P    K ST   DV
Sbjct  32   LPTLHRYPNMRVRSMAEDGLPEEKPSTVSEPSKIPAAAPTPTPFPPPPRTPKVSTKFGDV  91

Query  534  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  355
            F+FSGP PERINGRLAM+GF +A+ +EL  G D+F+QIS+GGV+ FLG++ LL++ASVIP
Sbjct  92   FAFSGPAPERINGRLAMVGFVSALAVELLKGQDVFSQISDGGVSVFLGTSILLSVASVIP  151

Query  354  LFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            LFQGV+ ESKSKGLMT+DAE+WNGR AMLGLVALAFTEYV+ G L+
Sbjct  152  LFQGVSVESKSKGLMTSDAELWNGRLAMLGLVALAFTEYVKGGTLI  197



>ref|XP_011090668.1| PREDICTED: early light-induced protein 2, chloroplastic isoform 
X2 [Sesamum indicum]
Length=188

 Score =   184 bits (466),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 132/191 (69%), Gaps = 19/191 (10%)
 Frame = -1

Query  780  LGSPVTSFKNRNGVSQFV-PSSY--LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstt  610
             GSPVT  +   G+++F  P++Y  LP  +R   F VRSM+E+D   ++P     + +T 
Sbjct  14   CGSPVT--RRAAGLNKFFGPTNYAMLPA-KRVAKFRVRSMAEEDDQIKEPAVVPPKPTTP  70

Query  609  apkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLF  430
                                   DV +FSGPGPERINGRLAMIGF AA+GME+ANG D+F
Sbjct  71   PKPKVST-------------GFSDVLAFSGPGPERINGRLAMIGFVAAIGMEIANGQDIF  117

Query  429  AQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALA  250
            AQ+ NGG+ WFLG++ LL+LAS+IP+F+GVTAESKS  LMT+DAE+WNGRFAMLGLVALA
Sbjct  118  AQVQNGGIPWFLGTSVLLSLASLIPMFRGVTAESKSGDLMTSDAELWNGRFAMLGLVALA  177

Query  249  FTEYVQNGPLL  217
            FTEYV+ G L+
Sbjct  178  FTEYVKGGALV  188



>ref|XP_008364578.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=195

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 144/200 (72%), Gaps = 7/200 (4%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLP-RLQRNPSFLVRSMSEDDAGKEQPTT  634
            M + V MQSI  S V     ++ V+Q + S+  P  L+++    V SM++DD  KEQPTT
Sbjct  1    MYAIVSMQSIFTSSVAYGVGKSRVNQLIVSANYPVSLRKHAHMRVISMAKDDQ-KEQPTT  59

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
              +E+S  AP    PP P+PKV       + DV +FSGP PERINGRLAM+GF AA+ +E
Sbjct  60   YASENSEPAPSSPLPPRPSPKVTP----KISDVLAFSGPAPERINGRLAMVGFVAALAVE  115

Query  453  LANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            L+ G D+FAQISNG G+  FLG++ LLT+AS++PL +GV+AESKSKGLMT+DAE+WNGR 
Sbjct  116  LSKGQDVFAQISNGAGIPLFLGTSILLTVASLVPLLKGVSAESKSKGLMTSDAELWNGRL  175

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALAFTEYV+ G L+
Sbjct  176  AMLGLVALAFTEYVKGGTLV  195



>gb|AAQ21120.1| early light inducible protein [Trifolium pratense]
Length=198

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = -1

Query  741  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  568
            V+QF  +PS Y+P ++RN SF VRSM+E++  KEQP  PV   + T    TPPP P    
Sbjct  23   VNQFSNIPSVYMPNMRRNASFKVRSMAEEEQ-KEQPKVPVDPITPTPTPVTPPPKPTYTR  81

Query  567  aakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGS  388
            + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GGV WFLG+
Sbjct  82   SPKISTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFEQISGGGVPWFLGT  141

Query  387  TALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            + +L+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L+
Sbjct  142  SVVLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSLV  198



>gb|ABU98938.1| early light-induced protein 1 [Rhododendron catawbiense]
Length=181

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 134/199 (67%), Gaps = 19/199 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++ VMQSIL SPVT      G+S+ +P S YLPR  RN   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVES  59

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            P+                     AK  T+ +D+ +FSGPGPERINGRLAM+GF AA+ +E
Sbjct  60   PIE-----------------ANVAKVRTDFFDLLAFSGPGPERINGRLAMVGFVAAIAVE  102

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L  G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFA
Sbjct  103  LYKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVSVESRSKPFWSSDAEMLNGRFA  162

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALA TEYV+ G L+
Sbjct  163  MLGLVALALTEYVKGGTLV  181



>gb|ABU98939.1| early light-induced protein 2 [Rhododendron catawbiense]
Length=181

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 134/199 (67%), Gaps = 19/199 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++ VMQSIL SPVT      G+++ +P S YLPR  RN   LVR M++D   KE+  +
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLNRTIPRSCYLPRQGRNSGMLVRCMAKDGR-KEEVES  59

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            P+                     AK  T+ +D+ +FSGPGPERINGRLAM+GF AA+ +E
Sbjct  60   PIE-----------------ANVAKVKTDFFDLLAFSGPGPERINGRLAMVGFVAAIAVE  102

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L  G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFA
Sbjct  103  LYKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVSVESRSKPFWSSDAEMLNGRFA  162

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALA TEYV+ G L+
Sbjct  163  MLGLVALALTEYVKGGTLV  181



>gb|AAK63815.1|AF383622_1 early light inducible protein [Medicago sativa]
Length=199

 Score =   182 bits (462),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  577
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   +  +    PP    
Sbjct  20   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPPSAPTPPPQPQP  78

Query  576  pkvaa-kssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  400
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+ANG  LF QIS GG+ W
Sbjct  79   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIANGQGLFDQISGGGIPW  138

Query  399  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L
Sbjct  139  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTAL  198

Query  219  L  217
            +
Sbjct  199  V  199



>ref|XP_006420039.1| hypothetical protein CICLE_v10005974mg [Citrus clementina]
 ref|XP_006489465.1| PREDICTED: early light-induced protein 1, chloroplastic [Citrus 
sinensis]
 gb|ESR33279.1| hypothetical protein CICLE_v10005974mg [Citrus clementina]
 gb|KDO74445.1| hypothetical protein CISIN_1g029497mg [Citrus sinensis]
Length=192

 Score =   182 bits (461),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 136/205 (66%), Gaps = 20/205 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ-  643
            MA+++  QS+L SPV +      R+G +Q     YLP L+RN +  VR  +ED+  ++Q 
Sbjct  1    MAASLATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQK  60

Query  642  ---PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFA  472
               PT P  E                           +VF+FSGP PERINGRLAMIGF 
Sbjct  61   DDQPTIPKAEPQPPKKPRMST-------------GFSEVFAFSGPAPERINGRLAMIGFV  107

Query  471  AAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  292
            AA+G+E++ G D+FAQ+S+GGV WFLG++ LLT+AS++PLF+GV+ ESKS G MT+DAE+
Sbjct  108  AALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAEL  167

Query  291  WNGRFAMLGLVALAFTEYVQNGPLL  217
            WNGRFAMLGLVALAFTE+V+ G L+
Sbjct  168  WNGRFAMLGLVALAFTEFVKGGTLV  192



>ref|XP_010045776.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=166

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 127/202 (63%), Gaps = 40/202 (20%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT----SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ  643
            MAST++M S+  SP T    SF+ ++ V  F P ++ PRL       V+ M++   G   
Sbjct  1    MASTILMHSVPASPRTVIDISFR-KSIVRGFFPVNHSPRLAPQVGLCVKCMTKVSTG---  56

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
                                              DVF+FSGP PERINGRLAMIGF AA+
Sbjct  57   --------------------------------FTDVFAFSGPAPERINGRLAMIGFVAAI  84

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+WNG
Sbjct  85   AVELSKGQDLFAQISEGGIPWFIGTSVLLSVASLVPLFQGVTAESKSDGLMTSDAELWNG  144

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            R AMLGLVALAFTEYV+ G L+
Sbjct  145  RLAMLGLVALAFTEYVKGGTLV  166



>emb|CDY10676.1| BnaA05g16860D [Brassica napus]
Length=196

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 144/193 (75%), Gaps = 5/193 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            MQS+    +T+ K N N +  F   ++ P L+RN    VR M+E +  K++ +TP+T ++
Sbjct  8    MQSVFAGGLTTRKINTNNL--FFAGNF-PNLKRNFPVGVRCMAEGEPMKDE-STPLTSAA  63

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
               PK + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  64   QPLPKSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  123

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            +FAQIS+GGV+WFLG+TA+LTLAS++PLFQG+TAESKSKG MT++AE+WNGRFAMLGLVA
Sbjct  124  VFAQISDGGVSWFLGTTAILTLASLVPLFQGITAESKSKGFMTSNAELWNGRFAMLGLVA  183

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+ G L+
Sbjct  184  LAFTEFVKGGTLI  196



>ref|NP_001235754.1| early light-induced protein [Glycine max]
 gb|AAC16403.1| early light-induced protein [Glycine max]
Length=192

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 142/198 (72%), Gaps = 9/198 (5%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            AS+  MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM++++   E P  P
Sbjct  3    ASSYAMQSILANPLIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAKEEQPSE-PAIP  58

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            VT   +  PKP P  +P+PKV+        DV +FSGP PERINGRLAMIGF AAM +E+
Sbjct  59   VTPPPSVEPKPQPVSAPSPKVST----KFSDVLAFSGPAPERINGRLAMIGFVAAMAVEV  114

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+ ESKSKG M++DAE+WNGRFAM
Sbjct  115  AIGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAM  174

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+   L+
Sbjct  175  LGLIALAFTEYVKGSTLV  192



>gb|KCW84134.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=240

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P
Sbjct  60   MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  119

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ +    +T                    +  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  120  SSKLKSKVST--------------------DFTDVFAFSGPAPERINGRLAMIGFVAAIA  159

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  160  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  219

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGL+ALAFTEYV+ G L+
Sbjct  220  FAMLGLIALAFTEYVKGGILV  240



>ref|XP_009145258.1| PREDICTED: early light-induced protein 1, chloroplastic [Brassica 
rapa]
Length=196

 Score =   181 bits (460),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 144/193 (75%), Gaps = 5/193 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            MQS+    +T+ K N N +  F   ++ P L+RN    VR M+E +  K++ +TP+T ++
Sbjct  8    MQSVFAGGLTTRKINTNNL--FFAGNF-PNLKRNFPVGVRCMAEGEPMKDE-STPLTSAA  63

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
               PK + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  64   QPLPKSSSPPPPPPPTKPKVSTKFNDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  123

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            +FAQIS+GGV+WFLG+TA+LTLAS++PLFQG+TAESKSKG MT++AE+WNGRFAMLGLVA
Sbjct  124  VFAQISDGGVSWFLGTTAILTLASLVPLFQGITAESKSKGFMTSNAELWNGRFAMLGLVA  183

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+ G L+
Sbjct  184  LAFTEFVKGGTLI  196



>ref|XP_010034506.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=181

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIA  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  101  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  160

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALAFTEYV+ G L+
Sbjct  161  FAMLGLVALAFTEYVKGGILV  181



>gb|ABQ01425.1| early light inducible protein [Medicago falcata]
Length=199

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  577
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   +  +    PP    
Sbjct  20   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKGPVDPITPPSAPTPPPQPQP  78

Query  576  pkvaa-kssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  400
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+ANG  LF QIS GG+ W
Sbjct  79   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIANGQGLFDQISGGGIPW  138

Query  399  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L
Sbjct  139  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSL  198

Query  219  L  217
            +
Sbjct  199  V  199



>ref|XP_010043035.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW85052.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 131/201 (65%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP  V    +R  V +   P+++ PRL       VR M+E+      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIA  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  101  VELSKGQDLSAQISGGGIPWFVGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  160

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALAFTEYV+ G L+
Sbjct  161  FAMLGLVALAFTEYVKGGILV  181



>ref|XP_010043036.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW85051.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP  V    +R  V +   P+++ PRL       VR M+E+      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ +    +T                    +  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SSKLKSKVST--------------------DFTDVFAFSGPAPERINGRLAMIGFVAAIA  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL  QIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  101  VELSKGQDLSDQISGGGIPWFVGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  160

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALAFTEYV+ G L+
Sbjct  161  FAMLGLVALAFTEYVKGGILV  181



>ref|XP_006414662.1| hypothetical protein EUTSA_v10026335mg [Eutrema salsugineum]
 gb|ESQ56115.1| hypothetical protein EUTSA_v10026335mg [Eutrema salsugineum]
Length=185

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 127/194 (65%), Gaps = 18/194 (9%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRN--GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  619
            MQS+  +P     +RN    +QF         +RNPS  VR M+++D  KE  + P T +
Sbjct  8    MQSVFAAPSGGLSSRNIRNTNQFF-------FKRNPSVGVRCMAQNDPIKEDSSLPSTSA  60

Query  618  sttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  439
            +      + P                D+ +FSGP PERINGRLAM+GF AA+ +EL+ G 
Sbjct  61   TQPQEPASKPKVST---------KFRDLLAFSGPAPERINGRLAMVGFVAALAVELSKGE  111

Query  438  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLV  259
            ++ AQIS+GG  WFLG+TALLTLAS++PLF+G+ AESKSKG MT+DAE+WNGRFAMLGLV
Sbjct  112  NVLAQISDGGAGWFLGTTALLTLASMVPLFKGIRAESKSKGFMTSDAELWNGRFAMLGLV  171

Query  258  ALAFTEYVQNGPLL  217
            ALAFTEYV  G L+
Sbjct  172  ALAFTEYVTGGTLV  185



>ref|XP_010488320.1| PREDICTED: early light-induced protein 1, chloroplastic [Camelina 
sativa]
Length=193

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 134/193 (69%), Gaps = 8/193 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  616
            MQS+    +T+ +  N    F   S+ P L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINSNKLFSAGSF-PNLKRNYPVGVRCMAEGEPKKEDSTATPATSAL  66

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  67   PKSPSPPPPMKPKVST------KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  120

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            + +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T ESKSKG+MT+DAE+WNGRFAMLGLVA
Sbjct  121  VLSQISDGGVSWFLGTTAILTLASLVPLFKGITVESKSKGIMTSDAELWNGRFAMLGLVA  180

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+ G L+
Sbjct  181  LAFTEFVKGGTLV  193



>sp|P11432.1|ELI_PEA RecName: Full=Early light-induced protein, chloroplastic; Short=ELIP; 
Flags: Precursor [Pisum sativum]
 emb|CAA29399.1| ELI protein [Pisum sativum]
Length=196

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 137/193 (71%), Gaps = 5/193 (3%)
 Frame = -1

Query  789  QSILGSPVTSFKNRNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            QSI+ + +T+  +R+ V+QF  +PS Y+P L+RN S  VRSM+E +  KEQ    V  ++
Sbjct  7    QSIMSNSMTNISSRSRVNQFTNIPSVYIPTLRRNVSLKVRSMAEGEP-KEQSKVAVDPTT  65

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
             TA  PTP P+        +  +  D+ +FSGP PERINGRLAMIGF AAMG+E+A G  
Sbjct  66   PTASTPTPQPAYTRPPKMSTKFS--DLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQG  123

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            L  Q+S GGV WFLG++ LL+LAS+IP FQGV+ ESKSK +M++DAE WNGR AMLGLVA
Sbjct  124  LSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVA  183

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+   L+
Sbjct  184  LAFTEFVKGTSLV  196



>ref|XP_011090667.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Sesamum indicum]
Length=189

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 131/191 (69%), Gaps = 18/191 (9%)
 Frame = -1

Query  780  LGSPVTSFKNRNGVSQFV-PSSY--LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsstt  610
             GSPVT  +   G+++F  P++Y  LP  +R   F VRSM+E +   +Q   P       
Sbjct  14   CGSPVT--RRAAGLNKFFGPTNYAMLPA-KRVAKFRVRSMAEQE--DDQIKEPAVVPPKP  68

Query  609  apkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLF  430
               P P  S              DV +FSGPGPERINGRLAMIGF AA+GME+ANG D+F
Sbjct  69   TTPPKPKVST----------GFSDVLAFSGPGPERINGRLAMIGFVAAIGMEIANGQDIF  118

Query  429  AQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALA  250
            AQ+ NGG+ WFLG++ LL+LAS+IP+F+GVTAESKS  LMT+DAE+WNGRFAMLGLVALA
Sbjct  119  AQVQNGGIPWFLGTSVLLSLASLIPMFRGVTAESKSGDLMTSDAELWNGRFAMLGLVALA  178

Query  249  FTEYVQNGPLL  217
            FTEYV+ G L+
Sbjct  179  FTEYVKGGALV  189



>ref|XP_010034436.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
Length=203

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 135/204 (66%), Gaps = 7/204 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSED---DAGK  649
            MAS V+++ I  SP  + +    R+ V    P+ Y+PR        VR M+E+   +   
Sbjct  1    MASAVLLRWIPASPSAAIEINFRRSVVRGHFPAYYVPRTAPRGGLRVRCMTEEIKPEGST  60

Query  648  EQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAA  469
            E P + V  +S T      P          S+ +  DVF+FSGP PERINGRLAMIGF A
Sbjct  61   EIPASDVPSTSPTPTPTPTPIPTPKPKRKVST-SFTDVFAFSGPAPERINGRLAMIGFVA  119

Query  468  AMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIW  289
            A+ +EL+ G DLFAQIS+GG+ WFLG++ LL++AS++PLFQGVT ESKS GLMT+DAE+W
Sbjct  120  AIAVELSKGQDLFAQISDGGIPWFLGTSVLLSVASLVPLFQGVTVESKSGGLMTSDAELW  179

Query  288  NGRFAMLGLVALAFTEYVQNGPLL  217
            NGR AMLGLVALAFTEYV+ G L+
Sbjct  180  NGRLAMLGLVALAFTEYVKGGTLV  203



>gb|AFD62760.1| ELIP, partial [Citrus sinensis]
Length=208

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 134/202 (66%), Gaps = 20/202 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFK---NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ-  643
            MA+++  QS+L SPV +      R+G +Q     YLP L+RN +  VR  +ED+  ++Q 
Sbjct  19   MAASLATQSMLASPVAARVTGIRRSGANQLSSVKYLPSLRRNVNLSVRCTAEDEQQQQQK  78

Query  642  ---PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFA  472
               PT P  E                           +VF+FSGP PERINGRLAMIGF 
Sbjct  79   DDQPTIPKAEPQPPKKPRMST-------------GFSEVFAFSGPAPERINGRLAMIGFV  125

Query  471  AAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  292
            AA+G+E++ G D+FAQ+S+GGV WFLG++ LLT+AS++PLF+GV+ ESKS G MT+DAE+
Sbjct  126  AALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFMTSDAEL  185

Query  291  WNGRFAMLGLVALAFTEYVQNG  226
            WNGRFAMLGLVALAFTE+V+ G
Sbjct  186  WNGRFAMLGLVALAFTEFVKGG  207



>gb|KEH43785.1| early light-induced-like protein [Medicago truncatula]
Length=200

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  577
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP    
Sbjct  21   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQP  79

Query  576  pkvaa-kssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  400
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ W
Sbjct  80   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPW  139

Query  399  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L
Sbjct  140  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSL  199

Query  219  L  217
            +
Sbjct  200  V  200



>ref|XP_010440414.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=193

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 135/192 (70%), Gaps = 6/192 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+L +P     +RN     + ++     +RN    V+ M++ D  KE P+ P+T +S 
Sbjct  8    MQSVLAAPSGGLISRN-----IRNTNQLFFKRNAPVGVKCMAQGDPIKEDPSVPLTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
              P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG+MT+DAE+WNGRFAMLGLVAL
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGIMTSDAELWNGRFAMLGLVAL  181

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  182  AFTEYVTGGTLV  193



>gb|AFK35794.1| unknown [Medicago truncatula]
Length=191

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  577
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP    
Sbjct  12   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQP  70

Query  576  pkvaa-kssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  400
                + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ W
Sbjct  71   TYTRSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPW  130

Query  399  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            FLG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L
Sbjct  131  FLGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSL  190

Query  219  L  217
            +
Sbjct  191  V  191



>ref|XP_010440411.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=192

 Score =   180 bits (456),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
              P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPVSKPKVST--KFRDLLAFSGPAPERINGRLAMVGFVAAIALELSKGENV  120

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAMLGLVAL
Sbjct  121  FAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAMLGLVAL  180

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  181  AFTEYVAGGTLV  192



>ref|XP_006298609.1| hypothetical protein CARUB_v10014694mg [Capsella rubella]
 gb|EOA31507.1| hypothetical protein CARUB_v10014694mg [Capsella rubella]
Length=196

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+    +T+ +  N    F   S+ P L+RN    VR M+E D  K Q +TP T S++
Sbjct  8    MQSVFAGGLTTTRKINTNKLFSAGSF-PNLKRNFPVGVRCMAEGDPTK-QDSTP-TPSTS  64

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
             +      PSP P +  K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  65   ASQPLPKSPSPPPPMKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENV  124

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
             AQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKS G+MT+DAE+WNGRFAMLGLVAL
Sbjct  125  LAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSDGIMTSDAELWNGRFAMLGLVAL  184

Query  252  AFTEYVQNGPLL  217
            AFTE+V+ G L+
Sbjct  185  AFTEFVKGGTLV  196



>gb|KCW84135.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
 gb|KCW84136.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=240

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 130/201 (65%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E+      P
Sbjct  60   MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAEESKPDLNP  119

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+ 
Sbjct  120  SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIA  159

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  160  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  219

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALAFTEYV+ G L+
Sbjct  220  FAMLGLVALAFTEYVKGGILV  240



>gb|AFK46043.1| unknown [Medicago truncatula]
Length=200

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -1

Query  741  VSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkv  568
            V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  PV   + T+    PP       
Sbjct  24   VNQFNNIPSVYMPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYT  82

Query  567  aa-kssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLG  391
             + K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WFLG
Sbjct  83   RSPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWFLG  142

Query  390  STALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            ++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L+
Sbjct  143  TSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSLV  200



>ref|XP_010435090.1| PREDICTED: early light-induced protein 2, chloroplastic [Camelina 
sativa]
Length=193

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 133/192 (69%), Gaps = 6/192 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+L +P     +RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVLAAPSGGLISRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
              P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  181

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  182  AFTEYVTGGTLV  193



>gb|KEH43766.1| early light-induced-like protein [Medicago truncatula]
Length=198

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 132/180 (73%), Gaps = 4/180 (2%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspa  577
            R  V+QF  +PS Y+P  +RN S  VRSM+E++  KEQ   P+ +  TT   PTPPP  A
Sbjct  21   RPRVNQFNNIPSVYMPSFRRNASLKVRSMAEEEQ-KEQSEVPL-DPITTPSAPTPPPQSA  78

Query  576  pkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWF  397
               A K ST   D+ +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WF
Sbjct  79   YTRAPKMSTKFSDLMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWF  138

Query  396  LGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            LG++ LL+LAS+IP FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAFTEYV+   L+
Sbjct  139  LGTSVLLSLASLIPFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAFTEYVKGTSLV  198



>ref|XP_010034491.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 ref|XP_010034497.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84140.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=178

 Score =   179 bits (453),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 130/201 (65%), Gaps = 26/201 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP  V    +R  V +   P+S  PRL       VR M+++      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPASNSPRLSPRGGLHVRCMAKESKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +                        +K ST+  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SK-----------------------SKVSTDFTDVFAFSGPAPERINGRLAMIGFVAAIA  97

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  98   VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  157

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGL+ALAFTEYV+ G L+
Sbjct  158  FAMLGLIALAFTEYVKGGILV  178



>ref|XP_010511764.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Camelina sativa]
Length=192

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 133/193 (69%), Gaps = 9/193 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  616
            MQS+    +T+ +  N    F  S     L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINTNKHFAGS--FSNLKRNYPVGVRCMAEGEPKKEDSTATPSTSAL  65

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  66   PKSPSPPPPMKPKVST------KFTDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  119

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            + +QIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKSKG+MT+DAE+WNGRFAMLGLVA
Sbjct  120  VLSQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSKGIMTSDAELWNGRFAMLGLVA  179

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+ G L+
Sbjct  180  LAFTEFVKGGTLV  192



>ref|XP_010450010.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
 ref|XP_010450012.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 134/192 (70%), Gaps = 9/192 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+L +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVLAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  118

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAMLGLVAL
Sbjct  119  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAMLGLVAL  178

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  179  AFTEYVTGGTLV  190



>gb|KFK23555.1| hypothetical protein AALP_AAs41881U000100 [Arabis alpina]
Length=193

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 135/192 (70%), Gaps = 6/192 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P    ++RN     + +S     +RN S +V+ M++DD  KE  ++P + ++ 
Sbjct  8    MQSVFIAPSGVLRSRN-----IRNSNQLFFKRNASMVVKCMAQDDLIKENSSSPSSSAAQ  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                 +P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQIPSSPLPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLFQG+ AESKSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFQGIRAESKSKGFMTSDAELWNGRFAMLGLVAL  181

Query  252  AFTEYVQNGPLL  217
             FTEYV+ G L+
Sbjct  182  VFTEYVKGGTLV  193



>ref|XP_006414664.1| hypothetical protein EUTSA_v10026318mg [Eutrema salsugineum]
 gb|ESQ56117.1| hypothetical protein EUTSA_v10026318mg [Eutrema salsugineum]
Length=191

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 134/195 (69%), Gaps = 14/195 (7%)
 Frame = -1

Query  792  MQSILGSPV---TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  622
            +QS+  +P     S +N    +QF         +RNPS  VR M+++D  KE  + P T 
Sbjct  8    LQSVFAAPSGHGLSSRNIRNTNQFF-------FKRNPSVGVRCMAQNDPTKEDSSLPSTS  60

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
            ++      +PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  61   ATQPQTPLSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  116

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++ AQIS+GGV WFLG+TALLTLAS++PLF+G+ AESKSKG MT+DAE+WNGRFAMLGL
Sbjct  117  ENVLAQISDGGVGWFLGTTALLTLASMVPLFKGIRAESKSKGFMTSDAELWNGRFAMLGL  176

Query  261  VALAFTEYVQNGPLL  217
            VALAFTEYV  G L+
Sbjct  177  VALAFTEYVTGGTLV  191



>ref|XP_006588384.1| PREDICTED: uncharacterized protein LOC100306375 isoform X1 [Glycine 
max]
Length=191

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 135/197 (69%), Gaps = 8/197 (4%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            AS+  MQSIL +P+    + +  + F   +Y   ++RN    VRSM+E+    EQP+   
Sbjct  3    ASSYAMQSILANPMIRISSGSRENHFGVPAY--HMRRNVGLRVRSMAEE----EQPSQ--  54

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
              +  T P   P P P    + K ST   DV +FSGP PERINGRLAMIGF  AM +E+A
Sbjct  55   PATPVTPPPAEPKPQPVSTPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVGAMAVEVA  114

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
             G  +F QISNGG+ WFLG++ +LTLAS+IPLFQG++ ESKSKG M++DAE+WNGRFAML
Sbjct  115  KGQGVFEQISNGGIPWFLGTSVVLTLASLIPLFQGISVESKSKGFMSSDAELWNGRFAML  174

Query  267  GLVALAFTEYVQNGPLL  217
            GLVALAFTEYV+ G L+
Sbjct  175  GLVALAFTEYVKGGTLV  191



>ref|XP_009108614.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Brassica rapa]
 gb|AAR11456.1| ELIP [Brassica rapa subsp. pekinensis]
 emb|CDY34227.1| BnaA01g24440D [Brassica napus]
Length=194

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 138/197 (70%), Gaps = 7/197 (4%)
 Frame = -1

Query  804  STVVMQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            ++V MQS+    + + K N N   +   +   P L+RN    VR M+E   G +  +TP 
Sbjct  4    ASVNMQSVFACGLATRKINTN---KLFFAGNFPNLKRNYPVGVRCMAE---GMKDESTPS  57

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
            T ++      + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+
Sbjct  58   TSAAQPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELS  117

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
             G ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAML
Sbjct  118  KGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAML  177

Query  267  GLVALAFTEYVQNGPLL  217
            GLVALAFTE+V+ G L+
Sbjct  178  GLVALAFTEFVKGGTLV  194



>emb|CDY29755.1| BnaA01g19110D [Brassica napus]
Length=191

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = -1

Query  699  RNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSG  520
            RNP   VR M++DD  KE+   P T ++        PP  +    +       D+ +FSG
Sbjct  34   RNPLVGVRCMAQDDPIKEESPLPSTSATPPQTPLYSPPPLSKPKVST---KFGDLLAFSG  90

Query  519  PGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGV  340
            P PERINGRLAM+GF AA+ +EL+ G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G+
Sbjct  91   PAPERINGRLAMVGFVAAIAVELSKGENMFAQISDGGVGWFLGTTALLTLASMIPLFKGI  150

Query  339  TAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
             AESKSKG MT+DAE+WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  151  RAESKSKGFMTSDAELWNGRFAMLGLVALAFTEYVKGGTLV  191



>gb|AAM67121.1| light-induced protein-like protein [Arabidopsis thaliana]
Length=193

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 131/192 (68%), Gaps = 6/192 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   TQPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  121

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  181

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  182  AFTEYVTGGTLV  193



>ref|XP_010435089.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 136/195 (70%), Gaps = 15/195 (8%)
 Frame = -1

Query  792  MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  622
            MQS+  +P   ++S   RN    F         +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGGLSSCNIRNTKQLF--------FKRNAPVGVRCMAQGDPIKENPSVPSTS  59

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
            +S +   P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  60   TSQSQMPPSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKG  115

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG+MT+DAE+WNGRFAMLGL
Sbjct  116  ENVFAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGIMTSDAELWNGRFAMLGL  175

Query  261  VALAFTEYVQNGPLL  217
            VALAFTEYV  G L+
Sbjct  176  VALAFTEYVSGGTLV  190



>ref|XP_004289994.1| PREDICTED: early light-induced protein, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=192

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 134/203 (66%), Gaps = 16/203 (8%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT---SFKNRNGVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGKEQ  643
            MA+T VMQSILGS V    + KNR   SQ    S +P      S+L VRSM+ED   K+Q
Sbjct  1    MATTTVMQSILGSSVAYGAAGKNR---SQMKLRSTVPASYAVSSYLRVRSMAEDGQ-KKQ  56

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
            PTT  T           P           ST   DVF+FSGP PERINGRLAM+GF AA+
Sbjct  57   PTTVTT-------ASKNPQPAEAPSPPPPSTKFSDVFAFSGPAPERINGRLAMVGFVAAL  109

Query  462  GMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWN  286
             +EL+ G D+FAQIS+G GV  F+G++ LL++AS++PL +GVT ESKS G+MT+DAE+WN
Sbjct  110  AVELSKGQDVFAQISSGSGVPLFIGTSVLLSVASLVPLLKGVTVESKSNGIMTSDAELWN  169

Query  285  GRFAMLGLVALAFTEYVQNGPLL  217
            GR AMLGLVALAFTEYV    L+
Sbjct  170  GRLAMLGLVALAFTEYVTGTTLV  192



>ref|XP_010045777.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84131.1| hypothetical protein EUGRSUZ_B01006 [Eucalyptus grandis]
Length=181

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 131/200 (66%), Gaps = 23/200 (12%)
 Frame = -1

Query  810  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP  V    +R  + + F P ++ PRL       V+ M+++      P
Sbjct  1    MASTILMHSVPASPRTVIDISSRKYIVRGFFPVNHSPRLAPQVGLCVKCMTKEGKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +                     K  +K ST   DVF+FSGP PERINGRLAMIG+ AA+ 
Sbjct  61   SQ--------------------KSKSKVSTGFTDVFAFSGPAPERINGRLAMIGYVAAIV  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+NG DLFAQIS GG+ WF+G++ LL++AS++PLFQGVTAESKS GLMT+DAE+ NGR
Sbjct  101  VELSNGQDLFAQISEGGIPWFIGTSILLSVASLVPLFQGVTAESKSDGLMTSDAELRNGR  160

Query  279  FAMLGLVALAFTEYVQNGPL  220
             AMLG+VALAFTEYV+ G L
Sbjct  161  LAMLGMVALAFTEYVKGGTL  180



>gb|ABU98944.1| early light-induced protein 7 [Rhododendron catawbiense]
Length=194

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 143/199 (72%), Gaps = 7/199 (4%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPS-SYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++ VMQSIL SPV       G ++  P+  ++P  +R+ S +VR  +E+  G+++   
Sbjct  1    MATSSVMQSILVSPVAGVAKGLGSNRLRPAYRHMPHQRRSSSVVVRCTAEN--GQKEQAV  58

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
            P      T   P+P P P P   AK+ST+ +DVF+FSGP PERINGRLAMIGF AA+ +E
Sbjct  59   PAA----TPSTPSPLPIPPPPPKAKASTDFFDVFAFSGPAPERINGRLAMIGFVAAIAVE  114

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L+ G D+FAQI+NGG+ WF+ +T +L++AS+IPLF GVT ESKS+   ++DAE+WNGRFA
Sbjct  115  LSKGEDVFAQIANGGIPWFVLTTGVLSVASLIPLFSGVTVESKSRPFWSSDAEMWNGRFA  174

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALAFTE+V+ G L+
Sbjct  175  MLGLVALAFTEFVKGGALI  193



>gb|KCW85053.1| hypothetical protein EUGRSUZ_B01896 [Eucalyptus grandis]
Length=181

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 129/201 (64%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQ---FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M SI  SP T+    + +S      P++  PRL       VR M+E+      P
Sbjct  1    MASTILMHSITASPRTAINISSRISVVRGLFPANRSPRLAPRGGLRVRCMAEESKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +  +                      K ST+  DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SPKLK--------------------WKVSTDFTDVFAFSGPAPERINGRLAMIGFVAAIA  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL  QIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  101  VELSKGQDLSDQISGGGIPWFVGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  160

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALAFTEYV+ G L+
Sbjct  161  FAMLGLVALAFTEYVKGGILV  181



>gb|KHN02753.1| Early light-induced protein, chloroplastic [Glycine soja]
Length=191

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 134/197 (68%), Gaps = 8/197 (4%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            AS+  MQSIL +P+    + +  + F   +Y  R  RN    VRSM+E+    EQP+   
Sbjct  3    ASSYAMQSILANPMIRISSGSRENHFGVPAYHRR--RNVGLRVRSMAEE----EQPSQ--  54

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
              +  T P   P P P    + K ST   DV +FSGP PERINGRLAMIGF  AM +E+A
Sbjct  55   PATPVTPPPAEPKPQPVSTPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVGAMAVEVA  114

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
             G  +F QISNGG+ WFLG++ +LTLAS+IPLFQG++ ESKSKG M++DAE+WNGRFAML
Sbjct  115  KGQGVFEQISNGGIPWFLGTSVVLTLASLIPLFQGISVESKSKGFMSSDAELWNGRFAML  174

Query  267  GLVALAFTEYVQNGPLL  217
            GLVALAFTEYV+ G L+
Sbjct  175  GLVALAFTEYVKGGTLV  191



>ref|XP_010450011.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 132/192 (69%), Gaps = 9/192 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                P+PP +  PK++        D+ +FSGP PERINGRLAMIGF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPQASKPKMST----KFRDLLAFSGPAPERINGRLAMIGFVAAIAVELSKGENV  118

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  119  FAQISDGGVGWFLGTTALLTLASLVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  178

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  179  AFTEYVTGGTLV  190



>ref|XP_010440412.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=192

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 133/192 (69%), Gaps = 7/192 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE P  P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDPFMPSTSASA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
            + P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   SQPQMPPSPPPVSKPKVST--KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  120

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAMLGLVAL
Sbjct  121  FAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAMLGLVAL  180

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  181  AFTEYVAGGTLV  192



>ref|XP_010466577.1| PREDICTED: early light-induced protein 1, chloroplastic [Camelina 
sativa]
Length=192

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEss  616
            MQS+    +T+ +  N    F  S     L+RN    VR M+E +  KE  T TP T + 
Sbjct  8    MQSVFAGGLTTTRKINTNEHFAGS--FSNLKRNYPVGVRCMAEGEPKKEDSTATPSTSAL  65

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
              +P P PP  P             D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  66   PKSPSPPPPMKPKVST------KFTDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  119

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            + +QIS+GGV+WFLG+TA+LTLAS++PLF+G+T ESKSKG+MT+DAE+WNGRFAMLGLVA
Sbjct  120  VLSQISDGGVSWFLGTTAILTLASLVPLFKGITVESKSKGIMTSDAELWNGRFAMLGLVA  179

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+ G L+
Sbjct  180  LAFTEFVKGGTLV  192



>ref|NP_567438.1| early light-inducible protein 2 [Arabidopsis thaliana]
 sp|Q94K66.1|ELIP2_ARATH RecName: Full=Early light-induced protein 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK44081.1|AF370266_1 unknown protein [Arabidopsis thaliana]
 gb|AAL34257.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83475.1| early light-inducible protein 2 [Arabidopsis thaliana]
Length=193

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ MEL+ G ++
Sbjct  63   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV  121

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  181

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  182  AFTEYVTGGTLV  193



>gb|ABU98942.1| early light-induced protein 5 [Rhododendron catawbiense]
Length=177

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 128/200 (64%), Gaps = 26/200 (13%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSS--YLPRLQRNPSFLVRSMSEDDAGKEQPT  637
            MA++ VMQSI+ SPVT      G+S+ +P S  YLPR  RN   LVR M++    +E  +
Sbjct  1    MATSSVMQSIMVSPVTGVAKGTGLSRTIPRSCCYLPRQGRNSGMLVRCMAKGGQKEEAGS  60

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
             P  +                         L+D+ +F GP PERINGRLAMIGF AA+ +
Sbjct  61   PPKAKV------------------------LFDLLAFKGPAPERINGRLAMIGFVAAIAV  96

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            EL+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ESKSK   ++DAE+ NGRF
Sbjct  97   ELSKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSNGVSVESKSKPFWSSDAEMLNGRF  156

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALA TE+V+ G L+
Sbjct  157  AMLGLVALALTEFVKGGALI  176



>gb|AAD28779.1|AF134132_1 early light-inducable protein [Arabidopsis thaliana]
Length=186

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 130/192 (68%), Gaps = 6/192 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  1    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  55

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ MEL+ G ++
Sbjct  56   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV  114

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  115  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  174

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  175  AFTEYVTGGTLV  186



>ref|XP_010450014.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=193

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/194 (52%), Positives = 132/194 (68%), Gaps = 10/194 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRN--GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEs  619
            MQS+  +P     +RN    +Q +        +RN    VR M++ D  KE P+ P T +
Sbjct  8    MQSVFAAPSGGLTSRNMRNTNQLL-------FKRNAPVGVRCMAQGDPIKEDPSVPSTST  60

Query  618  sttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  439
            S   P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G 
Sbjct  61   SAAQPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGE  119

Query  438  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLV  259
            ++FAQIS+GGV WFLG++ALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLV
Sbjct  120  NVFAQISDGGVGWFLGTSALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLV  179

Query  258  ALAFTEYVQNGPLL  217
            ALAFTEYV  G L+
Sbjct  180  ALAFTEYVTGGTLV  193



>ref|XP_009148406.1| PREDICTED: early light-induced protein 2, chloroplastic [Brassica 
rapa]
Length=191

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = -1

Query  702  QRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFS  523
             RNP   VR M++DD  KE+   P T ++        PP  +    +       D+ +FS
Sbjct  33   NRNPLVGVRCMAQDDPIKEESPLPSTSATPPQTPLYSPPPLSKPKVST---KFGDLLAFS  89

Query  522  GPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQG  343
            GP PERINGRLAM+GF AA+ +EL  G ++FAQIS+GGV WFLG+TALLTLAS+IPLF+G
Sbjct  90   GPAPERINGRLAMVGFVAAIAVELLKGENVFAQISDGGVGWFLGTTALLTLASMIPLFKG  149

Query  342  VTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            + AESKSKG MT+DAE+WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  150  IRAESKSKGFMTSDAELWNGRFAMLGLVALAFTEYVKGGTLV  191



>emb|CDY46608.1| BnaCnng14300D [Brassica napus]
Length=196

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 139/197 (71%), Gaps = 5/197 (3%)
 Frame = -1

Query  804  STVVMQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            ++V MQS+    + + K N N   +   +   P L+RN    V+ M+E +  K++ + P 
Sbjct  4    ASVNMQSVFACGLATRKINTN---KLFFAGNFPNLKRNYPVGVKCMAEGEPMKDE-SAPS  59

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
            T ++      + PP P P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+
Sbjct  60   TSAAKPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELS  119

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
             G ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAML
Sbjct  120  KGENVLAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAML  179

Query  267  GLVALAFTEYVQNGPLL  217
            GLVALAFTE+V+ G L+
Sbjct  180  GLVALAFTEFVKGGTLV  196



>ref|XP_010440410.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 132/192 (69%), Gaps = 9/192 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P      RN     + ++     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFAAPSGGLSTRN-----IRNTKQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  118

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  119  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  178

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  179  AFTEYVSGGTLV  190



>ref|XP_010450013.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Camelina sativa]
Length=190

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 132/192 (69%), Gaps = 9/192 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  SP     +RN     +  +     +RN    VR M++ D  KE  + P T ++ 
Sbjct  8    MQSVFASPSGGLSSRN-----IRKTSQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSAAQ  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPVSKPKVST----KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  118

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG++ALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  119  FAQISDGGVGWFLGTSALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  178

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  179  AFTEYVTGGTLV  190



>ref|XP_008341015.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=193

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 140/198 (71%), Gaps = 5/198 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++  MQS+L   V+S     G S+ V  S+L    +    +VRSM+E+   +EQP++ 
Sbjct  1    MAASASMQSLL---VSSVVYGAGKSRSVRVSHLVPANKYRHMVVRSMAENGQ-EEQPSST  56

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            + E+S   P P  P    P+    S+     VF+FSGP PERINGRLAM+GF +A+ +EL
Sbjct  57   IPEASKIPPPPPTPXPFPPRPKKVST-KFSSVFAFSGPAPERINGRLAMVGFVSALAVEL  115

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            + G D+F+QIS+GGV+ FLG++ LL++ASVIPLF+GV+ ESKS G+MT+DAE+WNGR AM
Sbjct  116  SKGQDVFSQISDGGVSLFLGTSILLSVASVIPLFKGVSVESKSNGIMTSDAELWNGRLAM  175

Query  270  LGLVALAFTEYVQNGPLL  217
            LGLVALAFTEYV+ G L+
Sbjct  176  LGLVALAFTEYVKGGTLV  193



>ref|XP_002870293.1| hypothetical protein ARALYDRAFT_330043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46552.1| hypothetical protein ARALYDRAFT_330043 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 133/194 (69%), Gaps = 11/194 (6%)
 Frame = -1

Query  792  MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  622
            MQS+  +P   + S +N    +Q +        +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGVLKSSRNIRNTNQLL-------FKRNAPVGVRCMAQGDPIKEDPSVPSTS  60

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
            +S T P+  P P P       S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  61   TSATPPQMPPSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKG  119

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++FAQISNGGV WFLG+TALLTLAS++PLF+G+ AESKSKG MT+DAE+WNGRFAM+GL
Sbjct  120  ENVFAQISNGGVGWFLGTTALLTLASMVPLFKGIRAESKSKGFMTSDAELWNGRFAMIGL  179

Query  261  VALAFTEYVQNGPL  220
            VALAFTEYV  G L
Sbjct  180  VALAFTEYVTGGTL  193



>ref|XP_010435088.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=190

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 136/195 (70%), Gaps = 15/195 (8%)
 Frame = -1

Query  792  MQSILGSP---VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTE  622
            MQS+  +P   ++S   RN    F         +RN    VR M++ D  KE P+ P T 
Sbjct  8    MQSVFAAPSGGLSSCNIRNTKQLF--------FKRNAPVGVRCMAQGDPIKENPSVPSTS  59

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
            +S +   P+PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  60   TSQSQMPPSPPPVSKPKVST----KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKG  115

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAMLGL
Sbjct  116  ENVFAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAMLGL  175

Query  261  VALAFTEYVQNGPLL  217
            VALAFTE+V  G L+
Sbjct  176  VALAFTEFVTGGTLV  190



>emb|CBI26312.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 126/181 (70%), Gaps = 3/181 (2%)
 Frame = -1

Query  768  VTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP--TTPVTEssttapkpt  595
            +T   NR    Q VP   + RLQR+ +  VR   ED   +  P  TT   +  + +    
Sbjct  1    MTRVANRTRDLQVVPPRSVLRLQRS-AVQVRCTKEDGQIERPPPVTTNPQQPPSLSQSRQ  59

Query  594  pppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISN  415
            P P P P  A K ST   DVF+FSGP PERINGRLAM+GF AAMG E+  G D+FAQISN
Sbjct  60   PIPPPPPPPAPKVSTKFGDVFAFSGPAPERINGRLAMVGFVAAMGAEIWKGEDVFAQISN  119

Query  414  GGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYV  235
            GG+ WFLG+  +L+LAS+IPLF+GV+ ESKSKGLMT+DAE+WNGRFAMLGLVALAFTEY+
Sbjct  120  GGIPWFLGTAVVLSLASLIPLFKGVSVESKSKGLMTSDAEMWNGRFAMLGLVALAFTEYL  179

Query  234  Q  232
            +
Sbjct  180  K  180



>ref|XP_006285275.1| hypothetical protein CARUB_v10006649mg [Capsella rubella]
 gb|EOA18173.1| hypothetical protein CARUB_v10006649mg [Capsella rubella]
Length=192

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 131/192 (68%), Gaps = 7/192 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P     +RN     + ++     +RN    VR M++    KE P+ P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQIFFKRNAPVGVRCMAQGGPIKEDPSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
            T P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   TQPQMPPSPPPVSKPKVST--KFRDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  120

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
             AQIS+GGV WFLG+TALLT+AS+IPLFQG+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  121  LAQISDGGVGWFLGTTALLTMASMIPLFQGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  180

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  181  AFTEYVTGGTLV  192



>gb|KCW84137.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=239

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 129/201 (64%), Gaps = 24/201 (12%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNG---VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP T     +G   V    P+++ PRL       VR M+E       P
Sbjct  60   MASTILMHSVPVSPRTVVDISSGKSVVRGLFPANHSPRLAPRGGLHVRCMAESKP-DLNP  118

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ +    +T                    +  +VF+FSGP PERINGRLAMIGF AA+ 
Sbjct  119  SSKLKSKVST--------------------DFTNVFAFSGPAPERINGRLAMIGFVAAIA  158

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DL AQIS GG+ WF+G++ LL++AS++PL QGVTAESKS GLMT+DAE+WNGR
Sbjct  159  VELSKGQDLSAQISGGGIPWFIGTSILLSVASLVPLLQGVTAESKSDGLMTSDAELWNGR  218

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALAFTEYV+ G L+
Sbjct  219  FAMLGLVALAFTEYVKGGILV  239



>ref|XP_004289995.1| PREDICTED: early light-induced protein, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=192

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 136/205 (66%), Gaps = 20/205 (10%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT---SFKNRN--GVSQFVPSSYLPRLQRNPSFL-VRSMSEDDAGK  649
            MA+T VMQSILGS V    + KNR+   +   VP+SY        S+L VRSM+ED   K
Sbjct  1    MATTTVMQSILGSSVAYGAAGKNRSLMKLQGTVPASY-----PVSSYLRVRSMAEDGQ-K  54

Query  648  EQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAA  469
            +QPTT  T           P           ST   DVF+FSGP PERINGRLAM+GF A
Sbjct  55   KQPTTVTT-------ASKNPQPAEAPSPPPPSTKFSDVFAFSGPAPERINGRLAMVGFVA  107

Query  468  AMGMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  292
            A+ +EL+ G D+FAQIS+G GV  F+G++ LL++AS++PL +GVT ESKS G+MT+DAE+
Sbjct  108  ALAVELSKGQDVFAQISSGSGVPLFIGTSVLLSVASLVPLLKGVTVESKSNGIMTSDAEL  167

Query  291  WNGRFAMLGLVALAFTEYVQNGPLL  217
            WNGR AMLGLVALAFTEYV    L+
Sbjct  168  WNGRLAMLGLVALAFTEYVTGTTLV  192



>emb|CDY10312.1| BnaC05g29670D [Brassica napus]
Length=195

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 125/166 (75%), Gaps = 0/166 (0%)
 Frame = -1

Query  714  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDV  535
             P L+RN    VR M+E +  K++ T   + + +     +PPP P P    K +T   D+
Sbjct  30   FPNLKRNFPVGVRCMAEGEPMKDESTPSTSAAQSLPKSSSPPPPPPPPTTPKVNTKFSDL  89

Query  534  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  355
             +FSGP PERINGRLAM+GF AA+ +EL+ G ++FAQIS+ GV+WFLG+TA+LTLAS++P
Sbjct  90   LAFSGPAPERINGRLAMVGFVAALAVELSKGENVFAQISDDGVSWFLGTTAILTLASLVP  149

Query  354  LFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            LFQG+TAESKSKG MT++AE+WNGRFAMLGLVALAFTE+V+ G L+
Sbjct  150  LFQGITAESKSKGFMTSNAELWNGRFAMLGLVALAFTEFVKGGTLI  195



>ref|XP_006285225.1| hypothetical protein CARUB_v10006584mg [Capsella rubella]
 gb|EOA18123.1| hypothetical protein CARUB_v10006584mg [Capsella rubella]
Length=191

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 130/192 (68%), Gaps = 8/192 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P     +RN     + ++     +RN     R M++ D  KE P+ P T ++ 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGFRCMAQGDPIKEDPSVPSTSAAQ  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                P+PPP  +    +       D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   PQMPPSPPPPVSKPKVST---KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  119

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
             AQIS+GGV WFLG+TALLTLAS+IPLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  120  LAQISDGGVGWFLGTTALLTLASMIPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  179

Query  252  AFTEYVQNGPLL  217
            AFTEYV  G L+
Sbjct  180  AFTEYVTGGTLV  191



>ref|XP_010435087.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=192

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 7/192 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P     +RN     + ++     +RN    VR M++ D  KE  + P T +S 
Sbjct  8    MQSVFAAPSGGLSSRN-----IRNTNQLFFKRNAPVGVRCMAQGDPIKEDSSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
              P+  P P P  K    +     D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  63   AQPQMPPSPPPVSKPKVST--KFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV  120

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLT+AS++PLF+G+ AE+KSKGLMT+DAE+WNGRFAMLGLVAL
Sbjct  121  FAQISDGGVGWFLGTTALLTVASMVPLFKGIRAEAKSKGLMTSDAELWNGRFAMLGLVAL  180

Query  252  AFTEYVQNGPLL  217
            AFTE+V  G L+
Sbjct  181  AFTEFVTGGTLV  192



>ref|XP_002885526.1| early light-inducable protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61785.1| early light-inducable protein [Arabidopsis lyrata subsp. lyrata]
Length=183

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 133/192 (69%), Gaps = 16/192 (8%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+    +T+ +  NG   F   ++ P L+RN    VR M+E +  K + + P +    
Sbjct  8    MQSVFAGGLTT-RKINGNKLFFAGTF-PSLKRNYPVGVRCMAEGEP-KNEDSAPTS----  60

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
                     +  P    K ST   D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  61   ---------AAPPPTKPKVSTKFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENV  111

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV+WFLG+TA+LTLAS++PLF+G+TAESKS G+MT+DAE+WNGRFAMLGLVAL
Sbjct  112  FAQISDGGVSWFLGTTAILTLASLVPLFKGITAESKSDGIMTSDAELWNGRFAMLGLVAL  171

Query  252  AFTEYVQNGPLL  217
            AFTE+V+ G L+
Sbjct  172  AFTEFVKGGTLV  183



>emb|CDY67220.1| BnaCnng53960D [Brassica napus]
 emb|CDY61075.1| BnaCnng37300D [Brassica napus]
 emb|CDX79257.1| BnaC06g20460D [Brassica napus]
Length=195

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 138/195 (71%), Gaps = 10/195 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  622
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T V++
Sbjct  8    MQSVFAGGLTTRKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPMKDESAPSTSVSQ  64

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
                +  P PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  65   PLPKSSSPPPPPPTKPKVST----KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  120

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+TAESKSKGLMT+DAE+WNGRFAMLGL
Sbjct  121  ENVLAQISDGGVSWFLGTAAILTLASLVPLFKGITAESKSKGLMTSDAELWNGRFAMLGL  180

Query  261  VALAFTEYVQNGPLL  217
            VALAFTE+V+ G L+
Sbjct  181  VALAFTEFVKGGTLV  195



>ref|XP_009371939.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score =   174 bits (441),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 143/201 (71%), Gaps = 11/201 (5%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT--SFKNRN-GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MA++  MQS+L S V   + K+R+  VS  VP++   R+      +VRS +E+   +E+P
Sbjct  1    MAASPSMQSLLASSVVYGAGKSRSVRVSHLVPANRFRRM------VVRSTAENGQ-EERP  53

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++ + E+S   P P  P    P+    S+    DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  54   SSSIPEASKIPPPPPTPTPFPPRPKKAST-KFSDVFAFSGPAPERINGRLAMVGFVSALA  112

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G D+F+QIS+GGV+ FLG++ LL++AS IPLF+GV+ ESKS GLMT+DAE+WNGR
Sbjct  113  VELSKGQDVFSQISDGGVSLFLGTSILLSVASAIPLFKGVSVESKSNGLMTSDAELWNGR  172

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  173  LAMLGLVALAFTEYVKGGTLV  193



>ref|XP_010034484.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW84139.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
 gb|KCW84142.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=181

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 127/201 (63%), Gaps = 23/201 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSP--VTSFKNRNGVSQ-FVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MAST++M S+  SP  V    +R  V +   P+S  PRL       VR M+++      P
Sbjct  1    MASTILMHSVPVSPRTVVDISSRKSVVRGLFPASNSPRLSPRGGLHVRCMAKESKPDLNP  60

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +  +    +T                       DVF+FSGP PERINGRLAMIGF AA+ 
Sbjct  61   SPNLKSKVST--------------------GFTDVFAFSGPAPERINGRLAMIGFVAAIA  100

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DLFAQIS GG+ WF+G++ LL++AS++PL QGVT ESKS G+MT++AE+WNGR
Sbjct  101  VELSKGQDLFAQISEGGIPWFIGTSILLSVASLVPLLQGVTVESKSDGVMTSNAELWNGR  160

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTE+V+ G L+
Sbjct  161  LAMLGLVALAFTEFVKGGALV  181



>gb|KFK23556.1| hypothetical protein AALP_AAs41881U000200 [Arabis alpina]
Length=194

 Score =   174 bits (440),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -1

Query  705  LQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSF  526
             +RN S +V+ M++DD  KE  ++P + ++      +P P P       S+    D+ +F
Sbjct  33   FKRNASMVVKCMAQDDLIKENSSSPSSSAAQPQIPSSPLPPPPVSKPKVST-KFGDLLAF  91

Query  525  SGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQ  346
            SGP PERINGRLAM+GF AA+ +EL+ G ++FAQIS+GGV WFLG+TALLTLAS++PLF+
Sbjct  92   SGPAPERINGRLAMVGFVAAIAVELSKGENVFAQISDGGVGWFLGTTALLTLASMVPLFK  151

Query  345  GVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            G+ AESKSKG MT+DAE+WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  152  GIRAESKSKGFMTSDAELWNGRFAMLGLVALAFTEYVKGGTLV  194



>gb|EYU41436.1| hypothetical protein MIMGU_mgv1a014191mg [Erythranthe guttata]
Length=198

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 138/201 (69%), Gaps = 10/201 (5%)
 Frame = -1

Query  807  ASTVVMQSI-LGSPVTSFKNRNGVSQ-FVPS--SYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            AS   M ++  GSPV +   +  +SQ F PS  + LP ++RN  F VRSM+E D  KE  
Sbjct  4    ASCCGMSAVTYGSPVAT--RKAALSQGFGPSNLALLP-MKRNMKFSVRSMAEGDEIKE--  58

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
              P    +T A     PP P P    K  T+ +D+F+FSGP PE+INGRLAM+GF AA+G
Sbjct  59   -VPAAAPATAATPKLTPPPPPPPAKPKVGTDFFDIFAFSGPAPEKINGRLAMVGFVAALG  117

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
             ELA+G DLFAQ+S GG  WFLG++ LLT ASVIPLF+GVTAESKS+G  T+D E WNGR
Sbjct  118  AELASGQDLFAQVSEGGFPWFLGTSILLTFASVIPLFKGVTAESKSEGFFTSDVETWNGR  177

Query  279  FAMLGLVALAFTEYVQNGPLL  217
            FAMLGLVALA TE+V+ G L+
Sbjct  178  FAMLGLVALALTEFVKGGALV  198



>ref|XP_010279260.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=145

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DV +FSGP PERINGRLAMIGF AAM +ELA G D+ AQ++NGG+TWFLG+TA+L+LAS+
Sbjct  38   DVLAFSGPAPERINGRLAMIGFVAAMAVELAKGDDVAAQLANGGLTWFLGTTAVLSLASL  97

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF+GV  +SKSKGLMT+DAE+WNGRFAMLGLVAL FTEYV+ G L+
Sbjct  98   IPLFKGVDVQSKSKGLMTSDAELWNGRFAMLGLVALVFTEYVKGGALI  145



>ref|XP_008438620.1| PREDICTED: early light-induced protein 1, chloroplastic [Cucumis 
melo]
Length=192

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 134/198 (68%), Gaps = 6/198 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++ VMQSI  S  +    R   ++ +P++     +   +F VR   E+D  +EQ    
Sbjct  1    MAASAVMQSIPSSTASRGVYRTTTNRLLPAAVRLCSRNTGAFRVRCTGEEDQ-REQAIP-  58

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
                S+  P P          +  +ST   D+ +FSGPGPERINGRLAMIGF AA+ +E+
Sbjct  59   ----SSIPPSPPKLEPAPSSTSKVTSTKFTDILAFSGPGPERINGRLAMIGFVAALAVEV  114

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            + G D+F QI+NGG+ WF+G++ +LTLAS+IPLF+GV+AES SKG+M+++AE+WNGRFAM
Sbjct  115  SKGQDVFEQIANGGIPWFVGTSVVLTLASLIPLFKGVSAESNSKGIMSSNAELWNGRFAM  174

Query  270  LGLVALAFTEYVQNGPLL  217
            LGLVALAFTEYV+ G L+
Sbjct  175  LGLVALAFTEYVKGGSLV  192



>gb|KHG26201.1| Early light-induced, chloroplastic [Gossypium arboreum]
Length=193

 Score =   173 bits (439),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 125/193 (65%), Gaps = 10/193 (5%)
 Frame = -1

Query  792  MQSIL-GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            MQS+L  SP+T   ++  + QF     +PR QR  +  VR ++E+   KE   T  T   
Sbjct  10   MQSLLLASPMTGLASKRQMVQFYNVKRMPRFQRKLNLQVRCLAEEGDQKEPMPTARTPEP  69

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
              +P P  P                DVF+FSGP PERINGRLAM+GF AAM MEL+ G D
Sbjct  70   KPSPPPVSPKLST---------KFSDVFAFSGPAPERINGRLAMVGFVAAMAMELSKGQD  120

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            +  QISNGG+  F+G++ +L+LAS+IPLF+G T ES+S   M++DAE+WNGRFAMLGLVA
Sbjct  121  VLTQISNGGIPLFVGTSIVLSLASLIPLFRGETVESRSGQFMSSDAELWNGRFAMLGLVA  180

Query  255  LAFTEYVQNGPLL  217
            LAFTEYV+ G L+
Sbjct  181  LAFTEYVKGGTLV  193



>gb|ABU98941.1| early light-induced protein 4 [Rhododendron catawbiense]
Length=164

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 36/199 (18%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVP-SSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++ VMQSIL SPVT      G+S+ +P + YLPR  RN   LVR M++          
Sbjct  1    MATSSVMQSILVSPVTGVAKGAGLSRTIPRTCYLPRQGRNSGMLVRCMAK----------  50

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
                                     +  + +D+ +FSGPGPERINGRLAM+GF AA+ +E
Sbjct  51   -------------------------ARIDFFDLLAFSGPGPERINGRLAMVGFVAAIAVE  85

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ES+SK   ++DAE+ NGRFA
Sbjct  86   LSKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSSGVSVESRSKPFWSSDAEMLNGRFA  145

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALA TEYV+ G L+
Sbjct  146  MLGLVALALTEYVKGGTLV  164



>gb|ABU98943.1| early light-induced protein 6 [Rhododendron catawbiense]
Length=182

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 132/202 (65%), Gaps = 25/202 (12%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNR-NGVSQ-FVP--SSYLPRLQRNPSFLVRSMSEDDAGKEQ  643
            MA++ VMQSI+ SP T    +  G+S+  +P  S YLPR  RN   LVR M++    +E 
Sbjct  1    MATSSVMQSIMVSPATGVATKGTGLSRSTIPRSSCYLPRQGRNSGALVRCMAKGGQKEEV  60

Query  642  PTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAM  463
             T+P  +  T                     + +++ +FSGPGPERINGRLAM+GF AA+
Sbjct  61   GTSPKAKVRT---------------------DFFNLLAFSGPGPERINGRLAMVGFVAAI  99

Query  462  GMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNG  283
             +EL+ G D+FAQISNGG+ WFL +T +L++AS+IPL  GV+ ESKSK   ++DAE+WNG
Sbjct  100  AVELSKGEDVFAQISNGGIPWFLLTTGVLSVASLIPLSNGVSVESKSKPFWSSDAEMWNG  159

Query  282  RFAMLGLVALAFTEYVQNGPLL  217
            RFAMLGLVALA TE+ + G L+
Sbjct  160  RFAMLGLVALALTEFAKGGALI  181



>gb|KFK39567.1| hypothetical protein AALP_AA3G261100 [Arabis alpina]
Length=195

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 138/193 (72%), Gaps = 6/193 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            MQS+    +++ K N N   +   +   P L RN    VR M+E++  KE  +TP T ++
Sbjct  8    MQSVFAGGLSTRKINTN---KLFFARNFPNLVRNYPVGVRCMAEEEPIKED-STPSTSAA  63

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
               PK   PP+P P     S+    D+ +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  64   QPLPKSPSPPTPTPTKPKVST-KFRDLLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  122

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            +FAQIS+GGV+WFLG+TA+LTLAS++PLF+G+T ESKS G+MT+DAE+WNGRFAMLGLVA
Sbjct  123  VFAQISDGGVSWFLGTTAILTLASLVPLFKGITVESKSDGIMTSDAELWNGRFAMLGLVA  182

Query  255  LAFTEYVQNGPLL  217
            LAFTE+V+ G L+
Sbjct  183  LAFTEFVKGGTLV  195



>gb|KHN15724.1| Early light-induced protein, chloroplastic [Glycine soja]
Length=178

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 131/198 (66%), Gaps = 23/198 (12%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            AS+  MQSIL +P+    + + V+QF VP+ ++   +RN    VRSM+E++   E P TP
Sbjct  3    ASSYAMQSILANPMIRISSGSRVNQFGVPALHM---RRNVGLRVRSMAEEEQPSE-PATP  58

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            VT  S+   KP                    V + S   PERINGRLAMIGF AAM +E+
Sbjct  59   VTPPSSIEGKPQ------------------PVSTPSAKSPERINGRLAMIGFVAAMAVEV  100

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G  +  QISNGG+ WFLG++ +LTLAS+IPLFQGV+ ESKSKG M++DAE+WNGRFAM
Sbjct  101  AKGQGVLEQISNGGIPWFLGTSVVLTLASLIPLFQGVSVESKSKGFMSSDAELWNGRFAM  160

Query  270  LGLVALAFTEYVQNGPLL  217
            LGL+ALAFTEYV+   L+
Sbjct  161  LGLIALAFTEYVKGSTLV  178



>emb|CAB10248.1| light induced protein like [Arabidopsis thaliana]
 emb|CAB78511.1| light induced protein like [Arabidopsis thaliana]
Length=318

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 129/191 (68%), Gaps = 6/191 (3%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+  +P      RN     + ++     +R     VR M++ D  KE P+ P T +S 
Sbjct  8    MQSVFAAPSGVLTTRN-----IRNTNQLFFKRIAPVGVRCMAQGDPIKEDPSVPSTSTSA  62

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
            T P+    P P       S+    D+ +FSGP PERINGRLAM+GF AA+ MEL+ G ++
Sbjct  63   TPPQMPQSPPPPVSKPKVST-KFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV  121

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
            FAQIS+GGV WFLG+TALLTLAS++PLF+G+ AE+KSKG MT+DAE+WNGRFAMLGLVAL
Sbjct  122  FAQISDGGVGWFLGTTALLTLASMVPLFKGIRAEAKSKGFMTSDAELWNGRFAMLGLVAL  181

Query  252  AFTEYVQNGPL  220
            AFTEYV  G L
Sbjct  182  AFTEYVTGGTL  192



>ref|XP_009375990.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009375991.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 5/198 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++  MQS+L S V       G S+ V  S+L    R    +VRS +E+   +E+P++ 
Sbjct  1    MAASASMQSLLASSVV---YGAGKSRSVRVSHLVPANRFRHMVVRSTAENGQ-EERPSST  56

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            + E+S   P P  P    P+    S+    DVF+FSGP PERINGRLAM+GF +A+ +EL
Sbjct  57   IPEASKIPPPPPTPTPFPPRPKKAST-KFSDVFAFSGPAPERINGRLAMVGFVSALAVEL  115

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            + G D+F+QIS+GGV+ FLG++ LL++AS IPLF+GV+ ESKS G MT+DAE+WNGR AM
Sbjct  116  SKGQDVFSQISDGGVSLFLGTSILLSVASAIPLFKGVSVESKSNGFMTSDAELWNGRLAM  175

Query  270  LGLVALAFTEYVQNGPLL  217
            LGLVALAFTEYV+ G L+
Sbjct  176  LGLVALAFTEYVKGGTLV  193



>ref|XP_009341096.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341098.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009343967.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=193

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 141/201 (70%), Gaps = 11/201 (5%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT--SFKNRNG-VSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MA++  MQS+L + V   + K+R+  V   VP+       R    +VRSM+E+  G+E+ 
Sbjct  1    MAASASMQSLLANSVVYGAGKSRSARVIHLVPA------NRYRHMVVRSMAEN--GQEEQ  52

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            ++     ++  P P P  +P+P    K ST   DVF+FSGP PERINGRLAM+GF +A+ 
Sbjct  53   SSSTIPEASKTPLPPPTATPSPPPPKKVSTKFSDVFAFSGPAPERINGRLAMVGFVSALA  112

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G D+F QIS+GGV+ FL ++ LL++ASVIPLF+GV+ ESKS G+MT+DAE+WNGR
Sbjct  113  VELSKGQDVFTQISDGGVSLFLATSILLSVASVIPLFKGVSVESKSNGIMTSDAELWNGR  172

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV+ G L+
Sbjct  173  LAMLGLVALAFTEYVKGGTLV  193



>ref|XP_009135830.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Brassica rapa]
Length=195

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 10/195 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  622
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T  ++
Sbjct  8    MQSVFAGGLTTCKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPMKDESAPSTSASQ  64

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
                +  P PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  65   PLPKSSSPPPPPPTKPKVST----KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  120

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAMLGL
Sbjct  121  ENILAQISDGGVSWFLGTAAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAMLGL  180

Query  261  VALAFTEYVQNGPLL  217
            VALAFTE+V+ G L+
Sbjct  181  VALAFTEFVKGGTLV  195



>emb|CDX92959.1| BnaA03g36810D [Brassica napus]
Length=195

 Score =   172 bits (435),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 136/195 (70%), Gaps = 10/195 (5%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQ--PTTPVTE  622
            MQS+    +T+ K N N   +   +     L+RN    VR M+E +  K++  P+T  ++
Sbjct  8    MQSVFAGGLTTCKINTN---KLCFAGNFHNLKRNYPVGVRCMAEGEPIKDESAPSTSASQ  64

Query  621  ssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANG  442
                +  P PPP   PKV+        D+ +FSGP PERINGRLAM+GF AA+ +EL+ G
Sbjct  65   PLPKSSSPPPPPPTKPKVST----KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKG  120

Query  441  GDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGL  262
             ++ AQIS+GGV+WFLG+ A+LTLAS++PLF+G+TAESKSKG MT+DAE+WNGRFAMLGL
Sbjct  121  ENILAQISDGGVSWFLGTAAILTLASLVPLFKGITAESKSKGFMTSDAELWNGRFAMLGL  180

Query  261  VALAFTEYVQNGPLL  217
            VALAFTE+V+ G L+
Sbjct  181  VALAFTEFVKGGTLV  195



>gb|KCW84133.1| hypothetical protein EUGRSUZ_B010071, partial [Eucalyptus grandis]
Length=151

 Score =   170 bits (431),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PERINGRLAMIGF AA+ +EL+ G DLFAQIS+GG+ WFLG++ LL++AS+
Sbjct  44   DVFAFSGPAPERINGRLAMIGFVAAIAVELSKGQDLFAQISDGGIPWFLGTSVLLSVASL  103

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PLFQGVT ESKS GLMT+DAE+WNGR AMLGLVALAFTEYV+ G L+
Sbjct  104  VPLFQGVTVESKSGGLMTSDAELWNGRLAMLGLVALAFTEYVKGGTLV  151



>ref|XP_010525221.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010525223.1| PREDICTED: early light-induced protein 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=198

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -1

Query  792  MQSILGSPVT-SFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEss  616
            MQS+   P T S       ++F  +  +P  +RN S +VR M+E +  +E  + P + S 
Sbjct  8    MQSVFTGPATGSVTQGMKSNRFCLAGTVPGFKRNASMVVRCMAEGEPTRED-SAP-SSSP  65

Query  615  ttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGD  436
              A  P     P+P    K ST   DV +FSGP PERINGRLAM+GF AA+ +EL+ G +
Sbjct  66   AGATPPEIKSKPSPPPKPKVSTKFSDVLAFSGPAPERINGRLAMVGFVAALAVELSKGEN  125

Query  435  LFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVA  256
            + AQ+S+GGV WF+G++ALLT+AS++PLF+GV+AESKS GLMT+DAE+WNGR AMLGL+A
Sbjct  126  VLAQLSDGGVGWFVGTSALLTVASLVPLFKGVSAESKSGGLMTSDAELWNGRLAMLGLIA  185

Query  255  LAFTEYVQNGPLL  217
            LAFTEYV+ G L+
Sbjct  186  LAFTEYVKGGTLV  198



>gb|AAL32038.1|AF439279_1 early light-induced protein-like protein [Retama raetam]
Length=141

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 103/145 (71%), Gaps = 5/145 (3%)
 Frame = -1

Query  651  KEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFA  472
            KEQP TPV         P                   DV +FSGP PERINGRLAMIGF 
Sbjct  2    KEQPATPVAPPPLPQSPPPASTRSPKIST-----KFTDVLAFSGPAPERINGRLAMIGFV  56

Query  471  AAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  292
            AA+ +ELA G D+FAQISNGG+ WFLG++ +L+LAS+IPLF+GV+ ESKS G M++DAEI
Sbjct  57   AAIAVELAKGQDVFAQISNGGILWFLGTSVVLSLASLIPLFRGVSVESKSGGFMSSDAEI  116

Query  291  WNGRFAMLGLVALAFTEYVQNGPLL  217
            WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  117  WNGRFAMLGLVALAFTEYVKGGTLV  141



>ref|XP_011028244.1| PREDICTED: early light-induced protein 1, chloroplastic-like, 
partial [Populus euphratica]
Length=132

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+ +FSGP PERINGRLAMIGF AAM +EL+ G DLF+QISNGGV+WF+G++ LL++AS+
Sbjct  25   DLLAFSGPAPERINGRLAMIGFVAAMAVELSKGQDLFSQISNGGVSWFVGTSILLSVASL  84

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF+G++AESKS+G+MT+DAE+WNGRFAMLGLVALA TEYV  G LL
Sbjct  85   IPLFKGISAESKSEGVMTSDAEMWNGRFAMLGLVALACTEYVSGGTLL  132



>ref|XP_006406123.1| hypothetical protein EUTSA_v10021557mg [Eutrema salsugineum]
 gb|ESQ47576.1| hypothetical protein EUTSA_v10021557mg [Eutrema salsugineum]
Length=197

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 132/192 (69%), Gaps = 2/192 (1%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEsst  613
            MQS+    +T+   R   ++   +     L+RN    VR M+E D  K++ TTP T ++ 
Sbjct  8    MQSVFAGGLTT--RRINTNKLSFAGNFSNLKRNYPVGVRCMAEGDPMKDESTTPSTSAAQ  65

Query  612  tapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDL  433
              PK + PP P P    K ST L D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++
Sbjct  66   PMPKASSPPPPPPPTKPKVSTKLGDLLAFSGPAPERINGRLAMVGFVAALAVELSKGENV  125

Query  432  FAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVAL  253
              QIS+GGV+WFL +TA+ T AS +PL +G+TAESKSKGL T+DAE+ NGRFAMLGLVAL
Sbjct  126  LTQISDGGVSWFLVTTAIFTFASFVPLLKGITAESKSKGLFTSDAELLNGRFAMLGLVAL  185

Query  252  AFTEYVQNGPLL  217
            AFTE+V+ G L+
Sbjct  186  AFTEFVKGGTLV  197



>emb|CDY42783.1| BnaC01g22830D [Brassica napus]
Length=189

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++FAQIS+GGV WFLG+TALLTLAS+
Sbjct  82   DLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENVFAQISDGGVGWFLGTTALLTLASM  141

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF+G+ AESKSKG MT+DAE+WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  142  IPLFKGIRAESKSKGFMTSDAELWNGRFAMLGLVALAFTEYVKGGTLV  189



>ref|NP_188923.1| chlorophyll A-B binding, early light-inducible protein [Arabidopsis 
thaliana]
 sp|P93735.1|ELIP1_ARATH RecName: Full=Early light-induced protein 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAB88391.1| early light-induced protein [Arabidopsis thaliana]
 dbj|BAB01259.1| early light-inducable protein-like [Arabidopsis thaliana]
 gb|AAL09799.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAL77679.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAM19939.1| AT3g22840/MWI23_21 [Arabidopsis thaliana]
 gb|AAM62548.1| early light-induced protein [Arabidopsis thaliana]
 gb|AEE76682.1| chlorophyll A-B binding, early light-inducible protein [Arabidopsis 
thaliana]
Length=195

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 132/194 (68%), Gaps = 8/194 (4%)
 Frame = -1

Query  792  MQSILGSPVTSFK-NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPT-TPVTEs  619
            MQS+    +T+ K N N   +   +   P L+RN    VR M+E     E  +  P T +
Sbjct  8    MQSVFAGGLTTRKINTN---KLFSAGSFPNLKRNYPVGVRCMAEGGPTNEDSSPAPSTSA  64

Query  618  sttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  439
            +   PK   PP P     +       D+ +FSGP PERINGRLAM+GF AA+ +EL+ G 
Sbjct  65   AQPLPKSPSPPPPMKPKVST---KFSDLLAFSGPAPERINGRLAMVGFVAALAVELSKGE  121

Query  438  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLV  259
            ++ AQIS+GGV+WFLG+TA+LTLAS++PLF+G++ ESKSKG+MT+DAE+WNGRFAMLGLV
Sbjct  122  NVLAQISDGGVSWFLGTTAILTLASLVPLFKGISVESKSKGIMTSDAELWNGRFAMLGLV  181

Query  258  ALAFTEYVQNGPLL  217
            ALAFTE+V+ G L+
Sbjct  182  ALAFTEFVKGGTLV  195



>ref|XP_008224237.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Prunus mume]
Length=189

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 134/199 (67%), Gaps = 11/199 (6%)
 Frame = -1

Query  810  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++  MQSI L + + ++  RN  S  V    +P L R P+  VRSM++D   KEQP+T
Sbjct  1    MAASSSMQSIFLANNLVAYGARNNKS--VGPFSVPALHRYPNMKVRSMAKD-GKKEQPST  57

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
             VT +S   P    P                D+ +FSGP PERINGRLAM+GF +A+ +E
Sbjct  58   -VTNASKNPPPSNTPVPSKVST------KFSDLLAFSGPAPERINGRLAMVGFVSALAVE  110

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L  G D+FAQIS+GGV+ F+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR A
Sbjct  111  LFKGQDVFAQISDGGVSLFVGTSILLSVASLIPLFKGVSVESKSDGIMTSDAELLNGRLA  170

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALAFTEYV  G L+
Sbjct  171  MLGLVALAFTEYVTGGTLV  189



>ref|XP_004292245.1| PREDICTED: early light-induced protein, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=196

 Score =   168 bits (426),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 137/205 (67%), Gaps = 16/205 (8%)
 Frame = -1

Query  810  MASTVVMQSILGSPVT----SFKNRNGVSQF-VPSSYLPRLQRNPSFL-VRSMSEDDAGK  649
            MA+T  MQSILGS +       KNR+   QF VP+S   +     S+L VRSM+ED   K
Sbjct  1    MAATSAMQSILGSSIAYGAAGNKNRSVNLQFTVPASSAVQ-----SYLRVRSMTEDGQ-K  54

Query  648  EQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAA  469
            +QPTT VT++S   P    P              L DV +FSGP PERINGRLAM+GF A
Sbjct  55   KQPTT-VTKASKNPPPAAAPSPSPSPPPPSP--KLSDVLAFSGPAPERINGRLAMVGFVA  111

Query  468  AMGMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  292
            A+ +EL+ G D+FAQISNG GV  F+G++ LL++AS++PL +GV+ ESKS G+MT+DAE+
Sbjct  112  ALVVELSKGQDVFAQISNGPGVPLFIGTSVLLSVASLVPLLKGVSVESKSDGIMTSDAEL  171

Query  291  WNGRFAMLGLVALAFTEYVQNGPLL  217
            WNGR AMLGLVAL FTEYV    L+
Sbjct  172  WNGRLAMLGLVALVFTEYVTGSTLV  196



>gb|KCW84141.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=129

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PERINGRLAMIGF AA+ +EL+ G DL AQIS GG+ WF+G++ LL++AS+
Sbjct  22   DVFAFSGPAPERINGRLAMIGFVAAIAVELSKGQDLSAQISGGGIPWFIGTSILLSVASL  81

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PL QGVTAESKS GLMT+DAE+WNGRFAMLGL+ALAFTEYV+ G L+
Sbjct  82   VPLLQGVTAESKSDGLMTSDAELWNGRFAMLGLIALAFTEYVKGGILV  129



>ref|XP_006286322.1| hypothetical protein CARUB_v100071911mg, partial [Capsella rubella]
 gb|EOA19220.1| hypothetical protein CARUB_v100071911mg, partial [Capsella rubella]
Length=114

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+ +FSGP PERINGRLAM+GF AA+ +EL+ G ++ AQIS+GGV WF+G+TALLTLAS+
Sbjct  7    DLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENVLAQISDGGVGWFIGTTALLTLASM  66

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PLFQG+ AE+KSKG MT+DAE+WNGRFAMLGLVALAFTEYV  G L+
Sbjct  67   VPLFQGIRAEAKSKGFMTSDAELWNGRFAMLGLVALAFTEYVTGGTLV  114



>ref|XP_007225903.1| hypothetical protein PRUPE_ppa011907mg [Prunus persica]
 gb|EMJ27102.1| hypothetical protein PRUPE_ppa011907mg [Prunus persica]
Length=191

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 128/198 (65%), Gaps = 7/198 (4%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++  MQSI  +   ++  R   S  V     P L+  P  +  S    D  K+QP+T 
Sbjct  1    MAASSSMQSIFLASSVAYGARKNKSVGVSHLVAPTLRSYPHMMRVSSMAKDGQKKQPST-  59

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            VT +S   P     P P             D+F+FSGP PERINGRLAM+GF +A+ +EL
Sbjct  60   VTNASKVPPPSPSSPPPKVST------KFSDLFAFSGPAPERINGRLAMVGFVSALAVEL  113

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            +NG D+FAQISNGGV+ F+ ++ LL++AS++PLF+GV+ ESKS G+MT+DAE+ NGR AM
Sbjct  114  SNGQDVFAQISNGGVSLFVATSILLSVASLVPLFKGVSVESKSDGIMTSDAELLNGRLAM  173

Query  270  LGLVALAFTEYVQNGPLL  217
            LGLVAL FTEYV+ G L+
Sbjct  174  LGLVALVFTEYVKGGTLV  191



>gb|KEH43789.1| early light-induced-like protein [Medicago truncatula]
Length=186

 Score =   167 bits (422),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 122/181 (67%), Gaps = 18/181 (10%)
 Frame = -1

Query  750  RNGVSQF--VPSSYLPRLQRNPSFLVRSMSEDDAGKEQP-TTPVTEssttapkptpppsp  580
            R  V+QF  +PS Y+P  +RN S  VRSM+E+   KEQP  TP                 
Sbjct  21   RPRVNQFNNIPSVYMPSFKRNASLKVRSMAEEGQ-KEQPKVTP--------------QPA  65

Query  579  apkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  400
            +   + K ST   D+ +F G  PERINGRLAMIGF +AMG+ELA G  LF QIS GG+ W
Sbjct  66   STTRSPKISTKFSDLMAFGGAAPERINGRLAMIGFVSAMGVELAKGQGLFDQISGGGIPW  125

Query  399  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            FL ++ LLT+AS++PLF+GV+ ESKSKG+M+++AE+WNGR AMLGL+ALA TEYV+   L
Sbjct  126  FLYTSVLLTVASLVPLFEGVSVESKSKGIMSSNAELWNGRIAMLGLIALAVTEYVKGTAL  185

Query  219  L  217
            +
Sbjct  186  V  186



>ref|XP_007224626.1| hypothetical protein PRUPE_ppa026587mg [Prunus persica]
 gb|EMJ25825.1| hypothetical protein PRUPE_ppa026587mg [Prunus persica]
Length=189

 Score =   166 bits (421),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 137/200 (69%), Gaps = 13/200 (7%)
 Frame = -1

Query  810  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQR-NPSFLVRSMSEDDAGKEQPT  637
            MA++  MQSI L + V     +N   + V    +P L R +P   VRSM++D   KEQP+
Sbjct  1    MAASSSMQSIFLANSVAYGAGKN---KCVGVISVPALHRYSPPMRVRSMAKDGQ-KEQPS  56

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
            T VT +S + P P  P      +         D+F+FSGP PERINGRLAM+GF +A+ +
Sbjct  57   T-VTNASKSPPPPLTPLPSKASI------KFSDLFAFSGPAPERINGRLAMVGFVSALAV  109

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            EL NG D+FAQISNGGV+ F+ ++ LL++AS++PLF+GV+ ESKS+G+MT+DAE+ NGR 
Sbjct  110  ELYNGQDVFAQISNGGVSLFVATSILLSVASLVPLFKGVSVESKSEGIMTSDAELLNGRL  169

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVAL FTEYV+ G L+
Sbjct  170  AMLGLVALVFTEYVKGGTLV  189



>gb|KDP40234.1| hypothetical protein JCGZ_02232 [Jatropha curcas]
Length=194

 Score =   166 bits (420),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 18/205 (9%)
 Frame = -1

Query  810  MASTVVMQ-SILGSPVTSFKNRNGVS-QFVPSSYLPRLQRNPSFLVRSMSE-----DDAG  652
            MA    MQ ++   P      R  VS +F+ + Y+PR  R     V+ M+E      +  
Sbjct  1    MAGATAMQGAVFAGPALRVSTRARVSGRFLATPYVPRPGRVAYTPVKCMAEGYQKEQEVE  60

Query  651  KEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFA  472
            K QPT PV             P P P    K ST   DV +F+GP PERINGRLAM+GF 
Sbjct  61   KIQPTEPV-----------GAPKPKPTPPPKFSTKFSDVLAFAGPAPERINGRLAMVGFV  109

Query  471  AAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEI  292
            AA+ +E+A G D FAQ+S+GG+  F+G++ +L+LAS+IPLF+GV+ ESKS G MT++AE+
Sbjct  110  AAIAVEVAKGQDFFAQLSDGGIPLFVGTSIVLSLASLIPLFKGVSVESKSDGFMTSNAEL  169

Query  291  WNGRFAMLGLVALAFTEYVQNGPLL  217
            WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  170  WNGRFAMLGLVALAFTEYVKGGALI  194



>ref|XP_009337531.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=197

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 130/200 (65%), Gaps = 5/200 (3%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA+T+ MQSI  S V     ++ V+Q  VP++Y P   R  + +    +  D  KEQPTT
Sbjct  1    MAATISMQSICTSSVAYGVGKSIVNQLIVPANYAPINLRKLAHMRVIATAKDEQKEQPTT  60

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
             +T++S  +      P P P           DV +FSGP PERIN RLAM+GF AA+  E
Sbjct  61   -ITDASENSEPAPSSPLPPPPPKVSP--KFSDVLAFSGPAPERINNRLAMVGFVAALAAE  117

Query  453  LANGGDLFAQISNGG-VTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            L+ G D+FAQIS G  +  FL ++ LL++AS++PLF+GV+ ESKS+GLMT DAE+WNGR 
Sbjct  118  LSKGQDVFAQISKGSRIPLFLCTSILLSVASLVPLFKGVSVESKSEGLMTLDAELWNGRL  177

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGL+ALAFTEY + G LL
Sbjct  178  AMLGLIALAFTEYAKGGTLL  197



>gb|KEH43787.1| early light-induced-like protein [Medicago truncatula]
Length=182

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 14/171 (8%)
 Frame = -1

Query  729  VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssT  550
            +PS Y+P  +RN +  VRSM+E+   ++   TP                 +   + K ST
Sbjct  26   IPSVYMPSFRRNANLKVRSMAEEAQKEQSKVTP--------------QPASTTRSPKIST  71

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  370
               D+ +F G  PERINGRLAMIGF +AMG+ELA G  LF QIS GG+ WFL ++ LLT+
Sbjct  72   KFSDLMAFGGAAPERINGRLAMIGFVSAMGVELAKGQGLFDQISGGGIPWFLYTSVLLTV  131

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            AS++PLF+GV+ ESKSKG+M+++AE+WNGR AMLGL+ALA TEYV+   L+
Sbjct  132  ASLVPLFEGVSVESKSKGIMSSNAELWNGRIAMLGLIALAVTEYVKGTALV  182



>ref|XP_010676775.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=197

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 136/201 (68%), Gaps = 17/201 (8%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSED--------DAGKEQP  640
            MQS+L +PV SF N + ++  V P  + PR+    +F V+ M+E+        D+G  + 
Sbjct  5    MQSLLANPVGSFANGSRMTSMVSPLGFYPRMSNRVNFAVKCMAEEGGQGEPKLDSGLPKT  64

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            T P+          +P P+P PK   K ST+  D+F+FSGP PERINGRLAMIGF AA+ 
Sbjct  65   TPPMA--------ASPTPTPTPKPQPKVSTSFADLFAFSGPAPERINGRLAMIGFVAAIA  116

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL+ G DLF+QIS+GG   FL ++ LL++AS++PLF+G  AE+K+ GLM A+AE+WNGR
Sbjct  117  VELSKGTDLFSQISDGGAQSFLATSILLSVASLVPLFKGKRAEAKTDGLMNANAELWNGR  176

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALA TE+V+ G L+
Sbjct  177  VAMLGLVALALTEFVKGGALI  197



>ref|XP_008224234.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=149

 Score =   163 bits (412),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PERINGRLAM+GF +AM +EL+ G D+FAQIS+GGV+ FL ++ LL++ASV
Sbjct  42   DVFAFSGPAPERINGRLAMVGFVSAMAVELSKGQDVFAQISDGGVSVFLATSILLSVASV  101

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF+GV+ ESKS G+MT+DAE+WNGR AMLGLVALAFTE+V+ G L+
Sbjct  102  IPLFKGVSVESKSDGIMTSDAELWNGRLAMLGLVALAFTEFVKGGTLV  149



>ref|XP_010676773.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=175

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 132/200 (66%), Gaps = 27/200 (14%)
 Frame = -1

Query  810  MASTVVMQS-ILGSPVTSFKNRNGVSQFV-PSSYLPRLQRNPSFLVRSMSEDDAGKEQPT  637
            M+ ++ MQS +L +PV +  N + ++  V P  + PR+ +  +F V+ M+ D+  K +P 
Sbjct  1    MSMSMQMQSGLLVNPVGALSNGSRMTYMVSPLGFNPRMTKRVNFEVKCMAGDEP-KPKPQ  59

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
              V+                        T+  D+F+FSGP PERINGRLAMIGF AA+ +
Sbjct  60   PKVS------------------------TSFGDLFAFSGPAPERINGRLAMIGFVAAVAV  95

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            EL+ G DLF+QISNGG  +F+G++ LL++AS++PLFQG  AE+K+ GLM A+AE+WNGR 
Sbjct  96   ELSKGTDLFSQISNGGAEYFIGTSILLSVASLVPLFQGQRAEAKTDGLMNANAELWNGRI  155

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALAFTE+V+ G L+
Sbjct  156  AMLGLVALAFTEFVKGGALV  175



>gb|EPS65382.1| early light inducible protein [Genlisea aurea]
Length=166

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTL  370
             L  +F+F GPGPERINGRLAMIGF AA+G E A+G DL  Q+ NGGV+WFL ++A+LTL
Sbjct  56   TLSRIFAFGGPGPERINGRLAMIGFVAAIGAEFASGQDLSEQLQNGGVSWFLATSAVLTL  115

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            AS++PLFQGVTAES S  LM++DAE+WNGRFAMLGLVALAFTEYV+ G L+
Sbjct  116  ASLVPLFQGVTAESTSGALMSSDAELWNGRFAMLGLVALAFTEYVKGGALV  166



>gb|KCW84143.1| hypothetical protein EUGRSUZ_B01008 [Eucalyptus grandis]
Length=132

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PERINGRLAMIGF AA+ +EL+ G DLFAQIS GG+ WF+G++ LL++AS+
Sbjct  25   DVFAFSGPAPERINGRLAMIGFVAAIAVELSKGQDLFAQISEGGIPWFIGTSILLSVASL  84

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PL QGVT ESKS G+MT++AE+WNGR AMLGLVALAFTE+V+ G L+
Sbjct  85   VPLLQGVTVESKSDGVMTSNAELWNGRLAMLGLVALAFTEFVKGGALV  132



>ref|XP_010935701.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=160

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+ +FSGP PERINGRLAM+GF +A+ +ELA G DL AQ+ NGG+ WF G+ ALL++AS+
Sbjct  53   DMLAFSGPAPERINGRLAMVGFVSALAVELAKGDDLAAQLMNGGLPWFAGTAALLSVASL  112

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PLF+GV+A+S+S GLMTADAE+WNGRFAMLGLVALAFTEY++ GPL+
Sbjct  113  VPLFKGVSAQSQSGGLMTADAELWNGRFAMLGLVALAFTEYLKGGPLV  160



>ref|XP_010935694.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=187

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+ +FSGP PERINGRLAM+GF +A+ +ELA G DL AQ+ NGG+ WF G+ ALL++AS+
Sbjct  80   DMLAFSGPAPERINGRLAMVGFVSALAVELAKGDDLAAQLMNGGLPWFAGTAALLSVASL  139

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PLF+GV+A+S+S GLMTADAE+WNGRFAMLGLVALAFTEY++ GPL+
Sbjct  140  VPLFKGVSAQSQSGGLMTADAELWNGRFAMLGLVALAFTEYLKGGPLV  187



>ref|XP_008224236.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Prunus mume]
Length=192

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 121/181 (67%), Gaps = 12/181 (7%)
 Frame = -1

Query  756  KNRN-GVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppsp  580
            KN++ GVS  V     P L   P  +  S    D  K+QP+T VT +S   P     P P
Sbjct  23   KNKSVGVSHLVA----PTLHSYPHMMRVSSMARDGQKKQPST-VTNASKVPPPSPSSPPP  77

Query  579  apkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTW  400
                       L D+F+FSGP PERINGRLAM+GF +A+ +EL NG D+FAQISNGGV+ 
Sbjct  78   KVSA------KLSDLFAFSGPAPERINGRLAMVGFVSALAVELYNGQDVFAQISNGGVSL  131

Query  399  FLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            F+ ++ LL++AS+IPLF+GV+ ES+S G+MT+DAE+ NGR AMLGLVAL FTEYV+ G L
Sbjct  132  FVATSILLSVASLIPLFKGVSVESRSDGIMTSDAELLNGRLAMLGLVALVFTEYVKGGTL  191

Query  219  L  217
            +
Sbjct  192  V  192



>gb|ADV19257.1| putative cold-inducible protein-like protein [Helleborus orientalis]
Length=148

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 108/166 (65%), Gaps = 18/166 (11%)
 Frame = -1

Query  714  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDV  535
            +PR QR+    VR M+E+    EQ T P                       K  T   DV
Sbjct  1    MPRQQRSGCMQVRCMAEEKL-PEQSTPP-----------------PAPKVNKVITRFSDV  42

Query  534  FSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIP  355
             +FSGP PERINGRLAMIGF AA+  ELA G D+ AQI+NGG+ WF+G++ +LT AS+IP
Sbjct  43   LAFSGPAPERINGRLAMIGFVAAIAAELAKGDDVVAQIANGGLPWFVGTSVVLTFASLIP  102

Query  354  LFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            LF+GV+ ESKSKG MTADAE+ NGRFAMLGLVAL FTE+V  G L+
Sbjct  103  LFKGVSVESKSKGPMTADAEMLNGRFAMLGLVALVFTEFVTGGALV  148



>ref|XP_009413904.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413905.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=184

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+ +FSGP PERINGRLAMIGF +A+ +EL  G DL AQ++NGG+ WF G+ ALL+ AS+
Sbjct  77   DILAFSGPAPERINGRLAMIGFVSAIAVELTRGDDLVAQLANGGLPWFAGTAALLSAASL  136

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PLF+GV+ +SKS G+MTADAE+WNGRFAMLGLVALAFTEY++ GPL+
Sbjct  137  VPLFKGVSVQSKSSGVMTADAELWNGRFAMLGLVALAFTEYLKGGPLV  184



>ref|XP_003637637.1| Early light inducible protein [Medicago truncatula]
Length=160

 Score =   160 bits (406),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  714  LPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaa-kssTNLWD  538
            +P  +RN S  VRSM+E+   KEQP  PV   + T+    PP        + K ST   D
Sbjct  1    MPSFRRNASLKVRSMAEEGQ-KEQPKVPVDPITPTSAPTPPPQPQPTYTRSPKMSTKFSD  59

Query  537  VFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVI  358
            + +F GP PERINGRLAMIGF AAMG+E+A G  LF QIS GG+ WFLG++ LL+LAS+I
Sbjct  60   LMAFGGPAPERINGRLAMIGFVAAMGVEIAKGQGLFDQISGGGIPWFLGTSVLLSLASLI  119

Query  357  PLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAF  247
            P FQGV+ ESKSKG+M++DAE+WNGR AMLGL+ALAF
Sbjct  120  PFFQGVSVESKSKGVMSSDAELWNGRIAMLGLIALAF  156



>sp|Q01931.1|DS22_CRAPL RecName: Full=Desiccation stress protein DSP-22, chloroplastic; 
Flags: Precursor [Craterostigma plantagineum]
 emb|CAA47164.1| dsp-22 [Craterostigma plantagineum]
Length=199

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 135/208 (65%), Gaps = 17/208 (8%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPS-------SY-LPRLQRNPSFLVRSMSEDDA  655
            MAS+    +I   P  S + ++ +++F P+       SY LP ++RN  F VRSM ED+ 
Sbjct  1    MASSTCYATI---PAMSCRGQSTITRFGPNNLFLGKQSYELPLMRRNAKFTVRSMREDNE  57

Query  654  GKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGF  475
             +EQ      ++    P  TP  +              D+FSF G  PERINGR AMIGF
Sbjct  58   KEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTV------DLFSFDGLAPERINGRSAMIGF  111

Query  474  AAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAE  295
             AA+G+ELA G D+F+Q+ NGGV WFL ++A+L LA++IP+++G++ E+K+ G   +DAE
Sbjct  112  VAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAE  171

Query  294  IWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            IWNGRFAM+GLVALAFTEYV+ GPL++V
Sbjct  172  IWNGRFAMIGLVALAFTEYVKGGPLINV  199



>ref|XP_007226151.1| hypothetical protein PRUPE_ppa014920mg [Prunus persica]
 gb|EMJ27350.1| hypothetical protein PRUPE_ppa014920mg [Prunus persica]
Length=189

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 128/201 (64%), Gaps = 15/201 (7%)
 Frame = -1

Query  810  MASTVVMQSIL---GSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQP  640
            MA++  MQSI     S      N   V  F     +P L R P+  VRSM +D   KEQP
Sbjct  1    MAASSSMQSIFLANNSVAYGAGNNKSVGPF----SVPALHRYPNMRVRSMVKD-GKKEQP  55

Query  639  TTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMG  460
            +T VT +S   P    P              + D+ +FSGP PERINGRLAM+GF +A+ 
Sbjct  56   ST-VTNASKNPPPSNTPFPSKVST------KISDLLAFSGPAPERINGRLAMVGFVSALA  108

Query  459  MELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            +EL  G D+FAQIS+GG + F+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR
Sbjct  109  VELFKGQDVFAQISDGGFSLFVGTSILLSVASLIPLFKGVSVESKSDGIMTSDAELLNGR  168

Query  279  FAMLGLVALAFTEYVQNGPLL  217
             AMLGLVALAFTEYV  G L+
Sbjct  169  LAMLGLVALAFTEYVTGGTLV  189



>emb|CAA63338.1| unnamed protein product [Helianthus annuus]
Length=174

 Score =   160 bits (405),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 117/163 (72%), Gaps = 13/163 (8%)
 Frame = -1

Query  702  QRNPSF-LVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSF  526
            +RN +F +VR MS+D    +QP+T  +++ +  P P P P  +            DV +F
Sbjct  24   RRNINFAVVRCMSQD----QQPSTDASKTPSAPPPPPPAPKVST--------KFSDVLAF  71

Query  525  SGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQ  346
             GP PERINGRLAMIGF +AM +EL+NG D+FAQIS+GGV  F+ +  +L++AS++PLF+
Sbjct  72   GGPAPERINGRLAMIGFVSAMTVELSNGQDVFAQISHGGVPAFVATRLVLSVASLVPLFK  131

Query  345  GVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            GV AESKS GLMT+DAE+WNGR AMLGLVALAFTEYV   PL+
Sbjct  132  GVRAESKSNGLMTSDAELWNGRAAMLGLVALAFTEYVTGSPLV  174



>ref|XP_010923519.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Elaeis guineensis]
Length=189

 Score =   160 bits (406),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DV +FSGP PERINGRLAMIGF +A+ +ELA G DL  Q+ NGG+ WF G+ ALL++AS+
Sbjct  82   DVLAFSGPAPERINGRLAMIGFVSALAVELARGDDLATQLMNGGLPWFAGTAALLSVASL  141

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +PLF+GV+A+SKS  LMTADAE+WNGRFAM+GLVALAFTEY++ GPL+
Sbjct  142  VPLFKGVSAQSKSGRLMTADAELWNGRFAMVGLVALAFTEYLKGGPLV  189



>ref|XP_008786056.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=193

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 126/200 (63%), Gaps = 9/200 (5%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDD--AGKEQPT  637
            MA++  + S +   +    +R+  +    +  LP  +   +  +R  +ED     +E+ T
Sbjct  1    MATSATLNSCMTGLMPLAGSRSHSTGLRSTYLLPHQRAAGAMRIRCQAEDQPQVQREEQT  60

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
             PVT S   A  P  P +              D+ +FSGP PERINGRLAM+GF +A+ +
Sbjct  61   IPVTPSQQPAQTPPKPKAKEST-------KFSDMLAFSGPAPERINGRLAMVGFVSALAV  113

Query  456  ELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
            ELA G  L  Q+ NGG+ WF G+ ALL++AS++PLF+GV+A+SKS GLMTADAE+WNGRF
Sbjct  114  ELARGDGLATQLMNGGLPWFAGTAALLSVASLVPLFKGVSAQSKSGGLMTADAELWNGRF  173

Query  276  AMLGLVALAFTEYVQNGPLL  217
            AMLGLVALAFTEY + GPL+
Sbjct  174  AMLGLVALAFTEYFKGGPLV  193



>gb|ABK22971.1| unknown [Picea sitchensis]
Length=193

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 115/156 (74%), Gaps = 6/156 (4%)
 Frame = -1

Query  681  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERI  502
            V+ M+E D   ++  TP T+S+T  P P PP                D+F+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDIFAFSGPAPETI  97

Query  501  NGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKS  322
            NGRLAM+GF +A+G+ELA+G DLF+Q++ GGV+ F+GS  +L+LAS+IP+F+GV+ ESKS
Sbjct  98   NGRLAMLGFVSAVGVELASGKDLFSQLATGGVSLFVGSAVVLSLASLIPMFKGVSTESKS  157

Query  321  KGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            + +M++ AE+WNGRFAMLGL+ALAFTEY++ GPL+ 
Sbjct  158  QAIMSSRAEMWNGRFAMLGLIALAFTEYLKGGPLIS  193



>ref|XP_008392721.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=188

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQF-VPSSYLPR-LQRNPSFLVRSMSEDDAGKEQPT  637
            MA+TV MQSI  S V     ++ V+Q  VP++Y P  L+++    V +M++D+  KEQPT
Sbjct  1    MAATVSMQSIFTSSVAYGVGKSRVNQLIVPANYAPSSLRKHAHMRVIAMAKDEQ-KEQPT  59

Query  636  TPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGM  457
            T    S  + P P+ P  P P    K S    DV +FSGP PERINGRLAM+GF AA+ +
Sbjct  60   TVTDASENSEPAPSSPLPPPPPPPPKVSPKFSDVLAFSGPAPERINGRLAMVGFVAALAV  119

Query  456  ELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGR  280
            EL+ G D+FAQISNG G+  FLG++ LL++AS++PLF+GV+ ESKS+GLMT+DAE+WNGR
Sbjct  120  ELSKGQDVFAQISNGLGIPLFLGTSILLSVASLVPLFKGVSVESKSEGLMTSDAELWNGR  179

Query  279  FAML  268
             AML
Sbjct  180  LAML  183



>ref|XP_008777102.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=176

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 120/198 (61%), Gaps = 22/198 (11%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA++  + S +G  +    +R+G S  + S+YL  L R     +R  +ED   + QP   
Sbjct  1    MAASATLHSYMGGLMPRVGSRSG-STGLRSTYL--LPRQHPMRIRCQAED---QRQPAQI  54

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
             T                            DV +FSGP PERINGRLAM+GF +A+ +EL
Sbjct  55   PTSKPKAKEST----------------KFSDVLAFSGPAPERINGRLAMVGFVSALAVEL  98

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
              G DL AQ+ NGG+ WF  +  L ++AS++PLF+GV+ +SKS GLMTADAE+WNGRFAM
Sbjct  99   VRGDDLAAQLMNGGLLWFAATAVLWSVASLVPLFKGVSVQSKSDGLMTADAELWNGRFAM  158

Query  270  LGLVALAFTEYVQNGPLL  217
            +GLVALAFTEY++ GPL+
Sbjct  159  MGLVALAFTEYLKGGPLV  176



>ref|XP_008391008.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Malus domestica]
Length=192

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 128/178 (72%), Gaps = 9/178 (5%)
 Frame = -1

Query  744  GVSQFVPSSYL--PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapk  571
            G ++ V  S+L  P +   P   + SM++D   K+QP+T +TE+S ++ + TP PSP   
Sbjct  22   GKNKSVRMSHLVAPTVHSYPQIRICSMAKDGQ-KKQPST-ITEASKSSSRXTPSPSPGKV  79

Query  570  vaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLG  391
                      ++F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGG++ FLG
Sbjct  80   ST-----KFSELFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGISLFLG  134

Query  390  STALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            ++ LL++AS+IPL +GV+ ESKS G+MT+DAE+ NGR AMLGLVALAFTEYV  G L+
Sbjct  135  TSILLSVASLIPLLKGVSVESKSDGIMTSDAELINGRLAMLGLVALAFTEYVTGGALV  192



>gb|AGH13354.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13355.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13357.1| early light-inducible protein, partial [Helianthus annuus]
 gb|AGH13358.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score =   155 bits (393),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DV +F GP PERINGRLAMIGF +AM +EL+NG D+FAQIS+GGV  F+ ++ +L++AS+
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSAMAVELSNGQDVFAQISHGGVPAFVATSLVLSVASL  66

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            +PLF+GV AESKS GLMT+DAE+WNGR AMLGLVALAFTEYV   PL
Sbjct  67   VPLFKGVRAESKSNGLMTSDAELWNGRAAMLGLVALAFTEYVTGSPL  113



>gb|AGH13359.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score =   155 bits (392),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DV +F GP PERINGRLAMIGF +AM +EL+NG D+FAQIS+GGV  F+ ++ +L++AS+
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSAMAVELSNGQDVFAQISHGGVPAFVATSLVLSVASL  66

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            +PLF+GV AESKS GLMT+DAE+WNGR AMLGLVALAFTEYV   PL
Sbjct  67   VPLFKGVRAESKSSGLMTSDAELWNGRAAMLGLVALAFTEYVTGTPL  113



>ref|XP_008224238.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Prunus mume]
Length=183

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 128/199 (64%), Gaps = 17/199 (9%)
 Frame = -1

Query  810  MASTVVMQSI-LGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA++  MQSI L + + ++  RN  S  V    +P L R P+         D  KEQP+T
Sbjct  1    MAASSSMQSIFLANNLVAYGARNNKS--VGPFSVPALHRYPNM-------KDGKKEQPST  51

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
             VT +S   P    P                D+ +FSGP PERINGRLAM+GF +A+ +E
Sbjct  52   -VTNASKNPPPSNTPVPSKVST------KFSDLLAFSGPAPERINGRLAMVGFVSALAVE  104

Query  453  LANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFA  274
            L  G D+FAQIS+GGV+ F+G++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR A
Sbjct  105  LFKGQDVFAQISDGGVSLFVGTSILLSVASLIPLFKGVSVESKSDGIMTSDAELLNGRLA  164

Query  273  MLGLVALAFTEYVQNGPLL  217
            MLGLVALAFTEYV  G L+
Sbjct  165  MLGLVALAFTEYVTGGTLV  183



>gb|ABK24316.1| unknown [Picea sitchensis]
Length=193

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -1

Query  681  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERI  502
            V+ M+E D   ++  TP T+S+T  P P PP                DVF+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDVFAFSGPAPETI  97

Query  501  NGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKS  322
            NGRLAM+GF +A+G+ELA+G DLF+Q++ GGV  F+GS  +L+ AS+IP+F+GV+ ESKS
Sbjct  98   NGRLAMLGFVSAVGVELASGKDLFSQLATGGVPLFVGSAVVLSFASLIPMFKGVSTESKS  157

Query  321  KGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            + +M++ AE+WNGRFAMLGL+ALAFTEY++ GPL+ 
Sbjct  158  QAIMSSRAEMWNGRFAMLGLIALAFTEYLKGGPLIS  193



>gb|ABR16737.1| unknown [Picea sitchensis]
Length=155

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PE INGRLAM+GF +A+G+E+A+G DLF+Q++ GGV+ F+GS  +L+LAS+
Sbjct  47   DIFAFSGPAPETINGRLAMLGFVSAVGVEVASGKDLFSQLATGGVSLFVGSAVVLSLASL  106

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            IP+F+GV+ ESKS+ +M++ AE+WNGRFAMLGL+ALAFTEY++ GPL+ 
Sbjct  107  IPMFKGVSTESKSQAIMSSRAEMWNGRFAMLGLIALAFTEYLKGGPLIS  155



>ref|XP_008360363.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=192

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 117/165 (71%), Gaps = 7/165 (4%)
 Frame = -1

Query  711  PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVF  532
            P +   P   + SM++D   K+QP+T VT +S   P P P PSP             D+F
Sbjct  35   PTVHSYPPIRICSMAKDGQ-KKQPST-VTNASKYPPPPPPTPSPGKAST-----KFSDLF  87

Query  531  SFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPL  352
            +FSGP PERINGRLAM+GF +A+  EL  G D+FAQISNGGV+ FLG++ LLT+AS+IPL
Sbjct  88   AFSGPVPERINGRLAMVGFVSAIATELYKGQDVFAQISNGGVSLFLGTSILLTVASLIPL  147

Query  351  FQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            F+G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  148  FKGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  192



>ref|XP_008360362.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=193

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = -1

Query  711  PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVF  532
            P +   P   + SM++D   K+QP+T VT +S   P P P PSP  + +        D+F
Sbjct  35   PTVHSYPPIRICSMAKDGQ-KKQPST-VTNASKYPPPPPPTPSPGKQAST----KFSDLF  88

Query  531  SFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPL  352
            +FSGP PERINGRLAM+GF +A+  EL  G D+FAQISNGGV+ FLG++ LLT+AS+IPL
Sbjct  89   AFSGPVPERINGRLAMVGFVSAIATELYKGQDVFAQISNGGVSLFLGTSILLTVASLIPL  148

Query  351  FQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            F+G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  149  FKGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  193



>ref|NP_001237842.1| uncharacterized protein LOC100306375 [Glycine max]
 gb|ACU14515.1| unknown [Glycine max]
Length=182

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 122/187 (65%), Gaps = 8/187 (4%)
 Frame = -1

Query  807  ASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPV  628
            AS+  MQSIL +P+    + +  + F   +Y   ++RN    VRSM+E+    EQP+   
Sbjct  3    ASSYAMQSILANPLIRISSGSRENHFGVPAY--HMRRNVGLRVRSMAEE----EQPSQ--  54

Query  627  TEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELA  448
              +  T P   P P P    + K ST   DV +FSGP PERINGRLAMIGF  AM +E+A
Sbjct  55   PATPVTPPPAEPKPQPVSTPSPKVSTKFSDVLAFSGPAPERINGRLAMIGFVGAMAVEVA  114

Query  447  NGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAML  268
             G  +F QISNGG+ WFLG++ +LTLAS+IPLFQG++ ESKSKG M++DAE+WNGRFAML
Sbjct  115  KGQGVFEQISNGGIPWFLGTSVVLTLASLIPLFQGISVESKSKGFMSSDAELWNGRFAML  174

Query  267  GLVALAF  247
            G     F
Sbjct  175  GFGCSGF  181



>gb|ACN39996.1| unknown [Picea sitchensis]
 gb|ACN40868.1| unknown [Picea sitchensis]
Length=193

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 113/156 (72%), Gaps = 6/156 (4%)
 Frame = -1

Query  681  VRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERI  502
            V+ M+E D   ++  TP T+S+T  P P PP                DVF+FSGP PE I
Sbjct  44   VKCMAEADPQPKESVTPSTQSTTRIPPPPPPAPKKVST------KFGDVFAFSGPAPETI  97

Query  501  NGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKS  322
            NGRLAM+GF +A+G+E+A+G DLF+Q++ GGV  F+GS  +L+ AS+IP+F+GV+ ESKS
Sbjct  98   NGRLAMLGFVSAVGVEVASGKDLFSQLATGGVPLFVGSAVVLSFASLIPMFKGVSTESKS  157

Query  321  KGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            + +M++ AE+WNGRFAMLGL+ALAFTEY++ GPL+ 
Sbjct  158  QAIMSSRAEMWNGRFAMLGLIALAFTEYLKGGPLIS  193



>ref|XP_006838940.1| hypothetical protein AMTR_s00002p00270470 [Amborella trichopoda]
 gb|ERN01509.1| hypothetical protein AMTR_s00002p00270470 [Amborella trichopoda]
Length=192

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 127/200 (64%), Gaps = 8/200 (4%)
 Frame = -1

Query  810  MASTVVMQSILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTP  631
            MA+   + SI+    T            PS+     +R  S +VR  +E D   ++ + P
Sbjct  1    MAAASALHSIVACSATGGVGSR--RSLYPSATCLASRRARSLMVRCSAESD--NQEQSAP  56

Query  630  VTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMEL  451
            V     T   P   PSP P    K S N  D+ +FSGPGPERINGRLAM+GF +A+G+EL
Sbjct  57   VD----TPSTPKNNPSPPPPPPKKVSPNFTDILAFSGPGPERINGRLAMVGFVSALGVEL  112

Query  450  ANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAM  271
            A G D+ +Q+++GG+ WF+GS+A+LTLAS+IPL +GV  ESK  G+M  +AEIWNGRFAM
Sbjct  113  ARGNDVASQLASGGLWWFVGSSAVLTLASLIPLLKGVDVESKKNGIMNPEAEIWNGRFAM  172

Query  270  LGLVALAFTEYVQNGPLLHV  211
            LGLVAL FTEY++ G L+ +
Sbjct  173  LGLVALVFTEYLKGGALVQM  192



>ref|XP_009343965.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  146

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  147  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  194



>ref|XP_009343966.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=193

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  145

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  146  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  193



>ref|XP_009341095.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009341100.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=193

 Score =   155 bits (393),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  86   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  145

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  146  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  193



>ref|XP_009341094.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009341099.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score =   155 bits (393),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  146

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  147  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  194



>ref|XP_010676774.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=198

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = -1

Query  792  MQSILGSPVTSFKNRNGVSQFVPS-SYLPRLQRNPSFLVRSMSEDDA-GKEQPTTPVTEs  619
            MQS+L +PV +  N + +++   +  + PR+ +  +F V+ M+++   G+ +  + + ++
Sbjct  5    MQSLLVNPVGAVANGSRMTRVTYALGFNPRMSKRVNFGVKCMADEKVEGEPKLDSGLPKT  64

Query  618  sttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGG  439
            + T   PTP P+P PK   K ST+  D+F+FSGP PERINGRLAMIGF AA+ +E + G 
Sbjct  65   NPTTVSPTPTPTPTPKPQPKVSTSFGDLFAFSGPAPERINGRLAMIGFVAAVAVEASKGT  124

Query  438  DLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLV  259
            DLF QIS+GG  WFL ++ LL++AS++PLF+G  AE+K+ GLM A+AE+WNGR AMLGLV
Sbjct  125  DLFTQISDGGAQWFLATSILLSVASLVPLFKGKRAEAKTDGLMNANAELWNGRVAMLGLV  184

Query  258  ALAFTEYVQNGPLL  217
            ALA TE+V+ G L+
Sbjct  185  ALALTEFVKGGALV  198



>ref|XP_009343974.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=174

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  67   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  126

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGLVALAFTEYV+ G L+
Sbjct  127  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLVALAFTEYVKGGTLV  174



>gb|AGH13356.1| early light-inducible protein, partial [Helianthus annuus]
Length=113

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DV +F GP PERINGRLAMIGF + M +EL+NG D+FA IS+GGV  F+ ++ +L++AS+
Sbjct  7    DVLAFGGPAPERINGRLAMIGFVSTMAVELSNGLDVFAHISHGGVPAFVATSLVLSVASL  66

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPL  220
            +PLF+GV AESKS GLMT+DAE+WNGR AMLGLVALAFTEYV   PL
Sbjct  67   VPLFKGVRAESKSSGLMTSDAELWNGRAAMLGLVALAFTEYVTGTPL  113



>ref|XP_009343962.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=199

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 121/178 (68%), Gaps = 2/178 (1%)
 Frame = -1

Query  744  GVSQFVPSSYL--PRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapk  571
            G ++ V  S+L  P +   P   + SM++D   K+  T      ++  P P PPPS    
Sbjct  22   GKNKSVRMSHLVAPTVHSYPQIRICSMAKDSQKKQPSTVTQASKNSPPPPPPPPPSTPSP  81

Query  570  vaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLG  391
               K ST   D+F FSGP  ERINGRLAM+GF +A+ +EL+ G D+FAQISNGG++ FLG
Sbjct  82   SPGKVSTKFSDLFGFSGPVLERINGRLAMVGFVSALAVELSMGQDVFAQISNGGISLFLG  141

Query  390  STALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            ++ LL++AS+IPLF+GV+ ESKS G+MT+DAE+ NGR AMLGLVALAFTE V  G L+
Sbjct  142  TSILLSVASLIPLFKGVSVESKSDGIMTSDAELINGRLAMLGLVALAFTECVTGGALV  199



>gb|AEW08119.1| hypothetical protein 2_114_01, partial [Pinus radiata]
 gb|AFG63030.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63031.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63032.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63033.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63034.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63035.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63036.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63037.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63038.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63039.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63040.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63041.1| hypothetical protein 2_114_01, partial [Pinus taeda]
 gb|AFG63042.1| hypothetical protein 2_114_01, partial [Pinus taeda]
Length=126

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+F GP PE INGRLAM+GF +A+G+E+A+G DLF+Q+++GGV  FLGS  LL++AS+
Sbjct  18   DVFAFGGPAPETINGRLAMLGFVSALGVEIASGRDLFSQLASGGVPLFLGSAILLSVASL  77

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            IP+F+GV+ ESKS+ +M+A AE+WNGRFAM+GL+ALA TEY++ GPL+ 
Sbjct  78   IPMFKGVSTESKSQAIMSAGAEMWNGRFAMIGLIALALTEYLKGGPLIS  126



>gb|AFG63029.1| hypothetical protein 2_114_01, partial [Pinus taeda]
Length=126

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+F GP PE INGRLAM+GF +A+G+E+A+G DLF+Q+++GGV  FLGS  LL++AS+
Sbjct  18   DVFAFGGPAPETINGRLAMLGFVSALGVEIASGRDLFSQLASGGVPLFLGSAILLSVASL  77

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            IP+F+GV+ ESKS+ +M+A AE+WNGRFAM+GL+ALA TEY++ GPL+ 
Sbjct  78   IPMFKGVSTESKSQAIMSAGAEMWNGRFAMIGLIALALTEYLKGGPLIS  126



>gb|ACN40010.1| unknown [Picea sitchensis]
Length=167

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PE INGRLAM+GF +A+G+E+A+G DLF+Q++  GV  F+GS  +L+ AS+
Sbjct  59   DVFAFSGPAPETINGRLAMLGFVSAVGVEVASGKDLFSQLATVGVPLFVGSAVVLSFASL  118

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            IP+F+GV+ ESKS+ +M++ AE+WNGRFAMLGL+ALAFTEY++ GPL+ 
Sbjct  119  IPMFKGVSTESKSQAIMSSRAEMWNGRFAMLGLIALAFTEYLKGGPLIS  167



>ref|XP_009341105.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341108.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=151

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGG++ FLG++ LL++AS+
Sbjct  44   DWFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGISLFLGTSILLSVASL  103

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNG  226
            IPLF+ V+ ESKS G+MT+DAE+ NGR AMLGLVALAFTEYV  G
Sbjct  104  IPLFKRVSVESKSDGIMTSDAELINGRLAMLGLVALAFTEYVTGG  148



>gb|ABR16462.1| unknown [Picea sitchensis]
Length=158

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PE INGRLAM+GF +A+G+ELA+G DLF+Q+ +GGV  F+GS  L T+AS+
Sbjct  50   DVFAFSGPAPETINGRLAMLGFVSAVGVELASGKDLFSQLGSGGVPLFVGSAVLFTVASL  109

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            IP+F+GV+ ESKS+ +M+ +AE+ NGRFAMLGL+A+A TEY++ GPL+ 
Sbjct  110  IPMFKGVSKESKSEAIMSVEAEMLNGRFAMLGLIAMALTEYLKGGPLIS  158



>gb|ABK24238.1| unknown [Picea sitchensis]
Length=193

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PE INGRLAM+GF +A+G+ELA+G DL +Q+ +GGV  F+GS  L ++AS+
Sbjct  85   DVFAFSGPAPETINGRLAMLGFVSAVGVELASGKDLLSQLGSGGVPLFVGSAVLFSVASL  144

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            IP+F+GV+ ESKSK +M+ +AE+ NGRFAMLGL+ALA TEY++ GPL+ 
Sbjct  145  IPMFKGVSKESKSKAIMSVEAEMLNGRFAMLGLIALALTEYLKGGPLIS  193



>gb|ACJ09655.1| putative cold-inducible protein [Cupressus sempervirens]
Length=165

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 113/190 (59%), Gaps = 36/190 (19%)
 Frame = -1

Query  774  SPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK----------EQPTTPVT  625
            SPV+    R   SQ  P SY+PRLQRN    VR M+EDD              QP +P  
Sbjct  2    SPVSGVTARARFSQ-TPCSYVPRLQRNAGMQVRCMAEDDHKDVTPITTPPPTSQPISPPP  60

Query  624  EssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELAN  445
            +   +                       DV +FSG  PERINGRLAMIGF AAM +EL+N
Sbjct  61   KPKVSTKS--------------------DVLAFSGCAPERINGRLAMIGFVAAMAVELSN  100

Query  444  GGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLG  265
              D+ AQISNGGV W+  S  +LTLAS+IPLF+G + ES+S+ +M++DAE+WNGRFAM  
Sbjct  101  -EDVLAQISNGGVPWYRTSI-VLTLASLIPLFKGGSVESRSE-IMSSDAELWNGRFAM--  155

Query  264  LVALAFTEYV  235
            LVALA TE+V
Sbjct  156  LVALAVTEFV  165



>gb|EMT18433.1| High molecular mass early light-inducible protein HV58, chloroplastic 
[Aegilops tauschii]
Length=184

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 110/175 (63%), Gaps = 9/175 (5%)
 Frame = -1

Query  726  PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTN  547
            P+S+ P L R  + LVR+ +E D        P  E+++ +     P         K   N
Sbjct  16   PASWSPALTRQRALLVRAQTEPD------IEPTKETTSASTSSPTPTPSPVAPKPKPKAN  69

Query  546  --LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALL  376
              +WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL + A+ 
Sbjct  70   PSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLTTAAVF  129

Query  375  TLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            ++AS++PL QG + ESKS G+ +ADAE+WNGRFAMLGLVALA TE++   P ++V
Sbjct  130  SVASLVPLLQGQSVESKSSGVWSADAELWNGRFAMLGLVALAITEFITGTPFVNV  184



>ref|XP_004955632.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=181

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 111/173 (64%), Gaps = 23/173 (13%)
 Frame = -1

Query  729  VPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssT  550
            VP+S L   +R  + +VR+ +ED     +PTT   +++     P                
Sbjct  30   VPASALAPRRR--ALVVRAQAED----AEPTTEEPKAAKKPASP----------------  67

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
             LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L+
Sbjct  68   GLWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLS  127

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            +AS++PL +G +AE++S G M+ADAE+WNGRFAMLGLVALAFTEY+   P ++
Sbjct  128  VASLVPLLKGDSAEARSGGFMSADAELWNGRFAMLGLVALAFTEYLTGAPFIN  180



>ref|XP_003557495.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Brachypodium distachyon]
Length=188

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            +WD  +FSGP PERINGRLAM+GF AA+ +E A GG L +Q  +G G+ WFL +TALL++
Sbjct  76   VWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLSQAGSGAGLGWFLTTTALLSV  135

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL QG + ESKS G  TADAE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  136  ASLVPLLQGQSVESKSSGFWTADAELWNGRFAMLGLVALAATEVITGAPFVNV  188



>dbj|BAJ97969.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=210

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 135/208 (65%), Gaps = 9/208 (4%)
 Frame = -1

Query  822  SADSMASTVVMQSILGSPV--TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK  649
            S   +A+T ++  ++ + V  +SF     V +  P+SY P L R  + LVR+ +E D   
Sbjct  8    SKCDLATTCILLLVMTTMVALSSFAGAAAVGR--PASYSPALPRRRALLVRAQTEPDI--  63

Query  648  EQPTTPVTEssttapkptpppspapkvaakssT-NLWDVFSFSGPGPERINGRLAMIGFA  472
             +PT   T +ST++P P+P PSP        +  ++WD  +F+GP PERINGRLAM+GF 
Sbjct  64   -EPTKETTSASTSSPSPSPTPSPVAPKPKPKANPSVWDALAFTGPAPERINGRLAMVGFV  122

Query  471  AAMGMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAE  295
            AA+ +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG + ESK+ G+ +ADAE
Sbjct  123  AALSVEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQGQSVESKNSGVWSADAE  182

Query  294  IWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +WNGRFAMLGLVALA TE++   P ++V
Sbjct  183  LWNGRFAMLGLVALAVTEFITGTPFVNV  210



>dbj|BAJ86766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 135/208 (65%), Gaps = 9/208 (4%)
 Frame = -1

Query  822  SADSMASTVVMQSILGSPV--TSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGK  649
            S   +A+T ++  ++ + V  +SF     V +  P+SY P L R  + LVR+ +E D   
Sbjct  9    SKCDLATTCILLLVMTTMVALSSFAGAAAVGR--PASYSPALPRRRALLVRAQTEPDI--  64

Query  648  EQPTTPVTEssttapkptpppspapkvaakssT-NLWDVFSFSGPGPERINGRLAMIGFA  472
             +PT   T +ST++P P+P PSP        +  ++WD  +F+GP PERINGRLAM+GF 
Sbjct  65   -EPTKETTSASTSSPSPSPTPSPVAPKPKPKANPSVWDALAFTGPAPERINGRLAMVGFV  123

Query  471  AAMGMELANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAE  295
            AA+ +E A GG L  Q  +G G+ WFL + A+ ++AS++PL QG + ESK+ G+ +ADAE
Sbjct  124  AALSVEAARGGGLLDQAGSGAGLGWFLTTAAVFSVASLVPLLQGQSVESKNSGVWSADAE  183

Query  294  IWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +WNGRFAMLGLVALA TE++   P ++V
Sbjct  184  LWNGRFAMLGLVALAVTEFITGTPFVNV  211



>ref|XP_002461536.1| hypothetical protein SORBIDRAFT_02g004380 [Sorghum bicolor]
 gb|EER98057.1| hypothetical protein SORBIDRAFT_02g004380 [Sorghum bicolor]
Length=244

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+TWF  + A+L++
Sbjct  132  LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLTWFAATAAVLSV  191

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL +G +AE++S  +M+ADAE+WNGRFAMLGLVALAFTEY+   P ++ 
Sbjct  192  ASLVPLLKGDSAEARSGAVMSADAELWNGRFAMLGLVALAFTEYLTGAPFINA  244



>ref|XP_004955631.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Setaria italica]
Length=200

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 89/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  88   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  147

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            AS++PL +G +AE++S G+M+ADAE+WNGRFAMLGLVALAFTEY+   P ++
Sbjct  148  ASLVPLLKGDSAEARSGGVMSADAELWNGRFAMLGLVALAFTEYLTGAPFIN  199



>gb|EMS57269.1| hypothetical protein TRIUR3_20794 [Triticum urartu]
Length=186

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 3/173 (2%)
 Frame = -1

Query  726  PSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspapkvaakssTN  547
            P+S+ P L R  + L+R+ +E D   E      + S+++      P    PK   K++ +
Sbjct  16   PASWSPALPRRRALLIRAQTEPDI--ESTKETTSASTSSPTPTPTPSPVVPKPKPKANPS  73

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            +WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL + A+ ++
Sbjct  74   VWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLTTAAVFSV  133

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL QG + ESKS G+ +ADAE+WNGRFAMLGLVALA TE++   P ++V
Sbjct  134  ASLVPLLQGQSVESKSSGVWSADAELWNGRFAMLGLVALAITEFITGTPFVNV  186



>dbj|BAJ86949.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q+ +G G+ WFL + A+ +
Sbjct  79   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGSGAGLGWFLTTAAVFS  138

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS G+ TADAE+WNGRFAMLGLVALA TE++   P ++V
Sbjct  139  VASLVPLVQGQSVESKSSGVWTADAELWNGRFAMLGLVALAVTEFITGTPFVNV  192



>ref|NP_001152703.1| early light-induced protein [Zea mays]
 gb|ACG49056.1| early light-induced protein [Zea mays]
Length=192

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            AS++PL +G +AE++S  +M+ADAE+WNGRFAMLGLVALAFTEY+   P ++
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAMLGLVALAFTEYLTGAPFIN  191



>ref|NP_001152683.1| early light-induced protein [Zea mays]
 gb|ACG48904.1| early light-induced protein [Zea mays]
Length=192

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/201 (44%), Positives = 129/201 (64%), Gaps = 12/201 (6%)
 Frame = -1

Query  810  MASTVVMQ-SILGSPVTSFKNRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTT  634
            MA+TV+   S L S     +    V     S+  PR +   +  VR+ S+D   KE    
Sbjct  1    MAATVMTSMSPLASATPGARRAFPVRLLQASTLAPRRR---ALAVRAQSDDAEPKE----  53

Query  633  PVTEssttapkptpppspapkvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGME  454
               E ++++P P+  P+P  K AA +S  LWD  +FSGP PERINGRLAM+GF +A+ +E
Sbjct  54   ---EVASSSPSPSATPAPKSKAAATASPGLWDALAFSGPAPERINGRLAMVGFVSALAVE  110

Query  453  LANGGDLFAQISNG-GVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMTADAEIWNGRF  277
             + GG L +Q  +G G+ WF  + A+L++AS++PL +G +AE++S  +M+ADAE+WNGRF
Sbjct  111  ASRGGGLLSQAGSGSGLAWFAATAAVLSVASLVPLLRGDSAEARSGAVMSADAELWNGRF  170

Query  276  AMLGLVALAFTEYVQNGPLLH  214
            AMLGLVALAFTEY+   P ++
Sbjct  171  AMLGLVALAFTEYLTGAPFIN  191



>ref|NP_001152927.1| early light-induced protein [Zea mays]
 gb|ACG25950.1| early light-induced protein [Zea mays]
Length=192

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            AS++PL +G +AE++S  +M+ADAE+WNGRFAMLGLVALAFTEY+   P ++
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAMLGLVALAFTEYLTGAPFIN  191



>gb|ACG24515.1| early light-induced protein [Zea mays]
Length=192

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            AS++PL +G +AE++S  +M+ADAE+WNGRFAMLGLVALAFTEY+   P ++
Sbjct  140  ASLVPLLRGDSAEARSGAVMSADAELWNGRFAMLGLVALAFTEYLTGAPFIN  191



>ref|XP_004955633.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=183

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF +A+ +E A G  L AQ+ NG G+TWF  +  +L+
Sbjct  70   SIWDTLAFSGPAPERINGRLAMVGFVSALAVEAARGDGLLAQVGNGAGLTWFAYTAVVLS  129

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
             AS+ PL QG + E +S G MTADAE+WNGR AMLGLVALA TEY+   P +HV
Sbjct  130  AASLAPLLQGESVEGRSGGFMTADAELWNGRLAMLGLVALAATEYLTGTPFVHV  183



>dbj|BAJ90265.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGG-VTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q+ +G  + WFL + A+ +
Sbjct  79   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGSGARLGWFLTTAAVFS  138

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS G+ TADAE+WNGRFAMLGLVALA TE++   P ++V
Sbjct  139  VASLVPLLQGQSVESKSSGVWTADAELWNGRFAMLGLVALAVTEFITGTPFVNV  192



>ref|XP_010228291.1| PREDICTED: high molecular mass early light-inducible protein 
HV58, chloroplastic-like [Brachypodium distachyon]
Length=193

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L +Q  +G G+ WFL +TALL+
Sbjct  80   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLSQAGSGAGLGWFLTTTALLS  139

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS    ++DAE+WNGRFAMLGLVALA TE++   P ++V
Sbjct  140  VASLVPLLQGQSVESKSTSFWSSDAELWNGRFAMLGLVALAVTEFITGTPFVNV  193



>gb|EMT24337.1| High molecular mass early light-inducible protein HV58, chloroplastic 
[Aegilops tauschii]
Length=189

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL + A+ +
Sbjct  76   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLTTAAVFS  135

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS G+ TADAE+WNGRFAMLGLVALA TE++   P ++V
Sbjct  136  VASLVPLLQGQSVESKSSGVWTADAELWNGRFAMLGLVALAVTEFITGTPFVNV  189



>dbj|BAD30330.1| putative low molecular mass early light-induced protein,chloroplast 
precursor (ELIP) [Oryza sativa Japonica Group]
 gb|EAZ38893.1| hypothetical protein OsJ_23312 [Oryza sativa Japonica Group]
Length=187

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  +  +L+ 
Sbjct  75   LWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGDGLAWFAATATVLSA  134

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL +G +AE++S G+M+ADAE+WNGRFAMLGLVALAFTE++   P ++V
Sbjct  135  ASLVPLLRGESAEARSGGVMSADAELWNGRFAMLGLVALAFTEFLTGSPFVNV  187



>ref|NP_001059030.1| Os07g0178800 [Oryza sativa Japonica Group]
 dbj|BAF20944.1| Os07g0178800 [Oryza sativa Japonica Group]
Length=192

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  +  +L+ 
Sbjct  80   LWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGDGLAWFAATATVLSA  139

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL +G +AE++S G+M+ADAE+WNGRFAMLGLVALAFTE++   P ++V
Sbjct  140  ASLVPLLRGESAEARSGGVMSADAELWNGRFAMLGLVALAFTEFLTGSPFVNV  192



>dbj|BAJ89047.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  + +
Sbjct  80   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLATAGVFS  139

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            LAS++PL QG + ESKS G+ +ADAE+WNGRFAMLGLVALA TE++   P +++
Sbjct  140  LASLVPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFVNI  193



>tpg|DAA42559.1| TPA: early light-induced protein [Zea mays]
Length=192

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            AS++PL +G +AE++S  +M+A+AE+WNGRFAMLGLVALAFTEY+   P ++
Sbjct  140  ASLVPLLRGDSAEARSGAVMSANAELWNGRFAMLGLVALAFTEYLTGAPFIN  191



>ref|XP_004955634.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Setaria italica]
Length=178

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISN-GGVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E A G  L AQ  N  G+TWF  +  +L+ 
Sbjct  66   LWDALAFSGPAPERINGRLAMVGFVSALAVEAARGDGLLAQAGNSAGLTWFAYTAIVLSA  125

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS+ PL QG + E +S G MTADAE+WNGR AMLGLVALA TEY+   P +HV
Sbjct  126  ASLAPLLQGESVEGRSGGFMTADAELWNGRLAMLGLVALAATEYLTGTPFVHV  178



>ref|XP_006379855.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 ref|XP_006379856.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 gb|ERP57652.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
 gb|ERP57653.1| hypothetical protein POPTR_0008s15800g [Populus trichocarpa]
Length=90

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -1

Query  486  MIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASVIPLFQGVTAESKSKGLMT  307
            MIGF AAM +EL+ G DLF+QISNGGV+WF+G++ LL++AS++PLF+GV+AESKS G+MT
Sbjct  1    MIGFVAAMAVELSKGQDLFSQISNGGVSWFVGTSILLSVASLVPLFKGVSAESKSDGVMT  60

Query  306  ADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            +DAE+WNGRFAMLGLVALAFTE+V    LL
Sbjct  61   SDAEMWNGRFAMLGLVALAFTEFVSGRTLL  90



>dbj|BAJ90110.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91617.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  LL+
Sbjct  77   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLVTAGLLS  136

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS G  +ADAE+WNGRFAMLGLVALA TE++   P +++
Sbjct  137  VASLVPLLQGQSVESKSSGFWSADAELWNGRFAMLGLVALATTEFITGTPFVNI  190



>gb|AFP90212.1| early light-induced protein, partial [Pinus armandii]
Length=120

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVF+FSGP PE INGRLAM+GF +A+G+E+A+G DLF+Q++ GGV  FLGS  LL++ASV
Sbjct  21   DVFAFSGPAPETINGRLAMLGFVSAVGVEIASGRDLFSQLATGGVPLFLGSAILLSVASV  80

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTE  241
            IP+F+GV+ ESKS+ + ++ AE+ NGRFAMLGLVALA TE
Sbjct  81   IPMFKGVSKESKSQEIWSSGAEMLNGRFAMLGLVALALTE  120



>ref|XP_009341102.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=187

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  80   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  139

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGL+ALAFTEYV+ G L+
Sbjct  140  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLLALAFTEYVKGGTLV  187



>ref|XP_003557497.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Brachypodium distachyon]
Length=172

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD+ SFSGP PERINGRLAM+GF AA+ +E A GG L +Q  +G G+ WFL +TALL+
Sbjct  59   SVWDILSFSGPAPERINGRLAMVGFVAALSVEAARGGGLLSQAGSGAGMGWFLTTTALLS  118

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS    ++DAE+WNGR AMLGLVALA TE +   P +++
Sbjct  119  VASLVPLLQGQSVESKSSAFWSSDAELWNGRAAMLGLVALAATEVLTGAPFVNL  172



>ref|XP_009341101.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=194

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  87   DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  146

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGL+ALAFTEYV+ G L+
Sbjct  147  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLLALAFTEYVKGGTLV  194



>sp|P14895.1|ELI5_HORVU RecName: Full=High molecular mass early light-inducible protein 
HV58, chloroplastic; Short=ELIP; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA33728.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=231

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 86/115 (75%), Gaps = 2/115 (2%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQIS--NGGVTWFLGSTALL  376
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q+   + G+ WFL +  + 
Sbjct  117  SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVF  176

Query  375  TLASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            ++AS++PL QG + ESKS G+ +ADAE+WNGRFAMLGLVALA TE++   P +++
Sbjct  177  SVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFVNI  231



>ref|XP_009341107.1| PREDICTED: early light-induced protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=215

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP PERINGRLAM+GF +A+ +EL+ G D+FAQISNGGV+ FLG++ L+T+AS+
Sbjct  108  DLFAFSGPVPERINGRLAMVGFVSALAVELSKGQDVFAQISNGGVSLFLGTSILITVASL  167

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IPLF G++ ES+S G+MT DAE+ NGR AMLGL+ALAFTEYV+ G L+
Sbjct  168  IPLFNGLSVESESDGIMTPDAELINGRLAMLGLLALAFTEYVKGGTLV  215



>gb|EAY73277.1| hypothetical protein OsI_01151 [Oryza sativa Indica Group]
Length=202

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
             LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  + A+L+
Sbjct  89   KLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLDQAGSGSGLAWFAATAAVLS  148

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
             AS++PL +G TAE++S G+M+ADAE+WNGRFAMLGLVALAFTE++   PL++V
Sbjct  149  AASLVPLLRGETAEARSGGVMSADAELWNGRFAMLGLVALAFTEFLTGSPLVNV  202



>ref|NP_001152179.1| early light-induced protein [Zea mays]
 gb|ACG46269.1| early light-induced protein [Zea mays]
Length=192

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E + GG L +Q  +G G+ WF  + A+L++
Sbjct  80   LWDALAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLSQAGSGSGLAWFAATAAVLSV  139

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLH  214
            AS++PL +G +AE++S  +M+A+AE+WNGR AMLGLVALAFTEY+   P ++
Sbjct  140  ASLVPLLRGDSAEARSGAVMSANAELWNGRXAMLGLVALAFTEYLTGAPFIN  191



>ref|NP_001059029.1| Os07g0178700 [Oryza sativa Japonica Group]
 dbj|BAD30329.1| putative low molecular mass early light-induced protein,chloroplast 
precursor (ELIP) [Oryza sativa Japonica Group]
 dbj|BAF20943.1| Os07g0178700 [Oryza sativa Japonica Group]
 gb|EAZ02968.1| hypothetical protein OsI_25108 [Oryza sativa Indica Group]
 gb|EAZ38892.1| hypothetical protein OsJ_23311 [Oryza sativa Japonica Group]
Length=200

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 90/114 (79%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQI-SNGGVTWFLGSTALLT  373
             LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  S GG+ WF  + A+L+
Sbjct  87   GLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGGGLAWFAATAAVLS  146

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
             AS++PL +G +AE++S G+M+ADAE+WNGRFAMLGLVALAFTE++   PL++V
Sbjct  147  AASLVPLLRGESAEARSGGVMSADAELWNGRFAMLGLVALAFTEFLTGSPLVNV  200



>gb|EMT23518.1| hypothetical protein F775_14184 [Aegilops tauschii]
Length=230

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  + +
Sbjct  117  SVWDALAFSGPAPERINGRLAMVGFVAALTVEAARGGGLLDQAGSGVGLGWFLVTAGVFS  176

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + ESKS G  +ADAE+WNGRFAMLGLVALA TE++   P +++
Sbjct  177  VASLVPLLQGQSVESKSSGFWSADAELWNGRFAMLGLVALAATEFITGAPFVNI  230



>ref|XP_002980561.1| LHC-related protein [Selaginella moellendorffii]
 gb|EFJ18212.1| LHC-related protein [Selaginella moellendorffii]
Length=197

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 114/182 (63%), Gaps = 11/182 (6%)
 Frame = -1

Query  753  NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspap  574
            +R+G S  V  SY    +R    + R+  E D+ +   T+PV +    A   TP  +P  
Sbjct  24   SRHGSSSIV--SY----RRIHPLVCRATKEGDSDQAAATSPVEKKVAAASPVTPIQTPPQ  77

Query  573  kvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFL  394
                ++  +  D+F+FSGP PE +NGRLAM+GF AA+G+ELA+G  L  Q+ NGG ++F+
Sbjct  78   PKKPEA--SFSDLFAFSGPVPEAVNGRLAMLGFTAALGVELASGRGLLGQLDNGGSSYFV  135

Query  393  GSTALLTLASVIPLFQGVTAESKSKGL---MTADAEIWNGRFAMLGLVALAFTEYVQNGP  223
            G+  L TLAS++PLFQGV+ E  S G+    T+ AE WNGR AMLGLVAL  TE+V+  P
Sbjct  136  GAALLFTLASLVPLFQGVSIEKASGGIGGVFTSKAERWNGRAAMLGLVALGITEFVKGSP  195

Query  222  LL  217
            L+
Sbjct  196  LI  197



>ref|NP_001042574.1| Os01g0246400 [Oryza sativa Japonica Group]
 gb|AAD38281.1|AC007789_7 putative low molecular early light-inducible protein [Oryza sativa 
Japonica Group]
 dbj|BAB40069.1| putative early light-induced protein precursor [Oryza sativa 
Japonica Group]
 dbj|BAF04488.1| Os01g0246400 [Oryza sativa Japonica Group]
 gb|EAZ11235.1| hypothetical protein OsJ_01089 [Oryza sativa Japonica Group]
 dbj|BAG88504.1| unnamed protein product [Oryza sativa Japonica Group]
Length=202

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQI-SNGGVTWFLGSTALLT  373
             LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  S  G+ WF  + A+L+
Sbjct  89   KLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLDQAGSWSGLAWFAATAAVLS  148

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
             AS++PL +G TAE++S G+M+ADAE+WNGRFAMLGLVALAFTE++   PL++V
Sbjct  149  AASLVPLLRGETAEARSGGVMSADAELWNGRFAMLGLVALAFTEFLTGSPLVNV  202



>gb|ACG27686.1| early light-induced protein [Zea mays]
 gb|ACG30109.1| early light-induced protein [Zea mays]
 gb|ACR36416.1| unknown [Zea mays]
 tpg|DAA59753.1| TPA: early light-induced protein [Zea mays]
Length=186

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E   G  + +Q  NG G+ WF  + A+L+ 
Sbjct  74   LWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGILSQAGNGAGLAWFAYTAAVLSA  133

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL QG +AE +S   MTADAE+WNGR AMLGLVALA TEY+   P ++V
Sbjct  134  ASLVPLLQGESAEGRSGRFMTADAELWNGRLAMLGLVALAVTEYLTGAPFVNV  186



>gb|ACG24151.1| early light-induced protein [Zea mays]
 gb|ACG26166.1| early light-induced protein [Zea mays]
Length=186

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWD  +FSGP PERINGRLAM+GF +A+ +E   G  + +Q  NG G+ WF  + A+L+ 
Sbjct  74   LWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGILSQAGNGAGLAWFAYTAAVLSA  133

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL QG +AE +S   MTADAE+WNGR AMLGLVALA TEY+   P ++V
Sbjct  134  ASLVPLLQGESAEGRSGRFMTADAELWNGRLAMLGLVALAVTEYLTGAPFVNV  186



>ref|XP_002461537.1| hypothetical protein SORBIDRAFT_02g004390 [Sorghum bicolor]
 gb|EER98058.1| hypothetical protein SORBIDRAFT_02g004390 [Sorghum bicolor]
Length=187

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 81/113 (72%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
             WD  +FSGP PERINGRLAM+GF +A+ +E   G  L +Q  NG G+ WF  +  +L+ 
Sbjct  75   FWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGLLSQAGNGAGLAWFAYTAVVLSA  134

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS+ P+ QG +AES+S G MTADAE+WNGR AMLGLVALA TEY+   P ++V
Sbjct  135  ASLAPVLQGESAESRSGGFMTADAELWNGRLAMLGLVALAVTEYLTGAPFVNV  187



>ref|XP_002976832.1| LHC-related protein [Selaginella moellendorffii]
 gb|EFJ21942.1| LHC-related protein [Selaginella moellendorffii]
Length=197

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 113/182 (62%), Gaps = 11/182 (6%)
 Frame = -1

Query  753  NRNGVSQFVPSSYLPRLQRNPSFLVRSMSEDDAGKEQPTTPVTEssttapkptpppspap  574
            +R+G S  V  SY     R    + R+  E D+ +   T+PV +    A   TP  +P  
Sbjct  24   SRHGSSSIV--SY----SRIHPLVCRATKEGDSDQAAATSPVEKKVEAASPVTPIQTPPQ  77

Query  573  kvaakssTNLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFL  394
                ++  +  D+F+FSGP PE +NGRLAM+GF AA+G+ELA+G  L  Q+ NGG ++F+
Sbjct  78   PKKPET--SFLDLFAFSGPVPEAVNGRLAMLGFTAALGVELASGRGLLGQLDNGGSSYFV  135

Query  393  GSTALLTLASVIPLFQGVTAESKSKGL---MTADAEIWNGRFAMLGLVALAFTEYVQNGP  223
            G+  L TLAS++PLFQGV+ E  S G+    T+ AE WNGR AMLGLVAL  TE+V+  P
Sbjct  136  GAALLFTLASLVPLFQGVSIEKASGGIGGVFTSKAERWNGRAAMLGLVALGITEFVKGSP  195

Query  222  LL  217
            L+
Sbjct  196  LI  197



>gb|EAZ02969.1| hypothetical protein OsI_25109 [Oryza sativa Indica Group]
Length=187

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLTL  370
            LWDV +FSGP PERINGRLAM+GF +A+ +E + GG L  Q  +G G+ WF  + A+L+ 
Sbjct  75   LWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLEQAGSGDGLAWFAATAAVLSA  134

Query  369  ASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            AS++PL +G +AE++S G+M+ADAE+WNGRFAMLGLVALAFTE++   P ++V
Sbjct  135  ASLVPLLRGESAEARSGGVMSADAELWNGRFAMLGLVALAFTEFLTGSPFVNV  187



>ref|NP_001105051.1| early light-inducible protein ELIP [Zea mays]
 gb|AAK52823.1|AF365951_1 early light-inducible protein ELIP [Zea mays]
Length=182

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -1

Query  546  LWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLA  367
            LWD  +FSGP PERINGRLAM+GF +A+ +E   G  + +  +  G+ WF  + A+L+ A
Sbjct  71   LWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGILSPGNGAGLAWFAYTAAVLSAA  130

Query  366  SVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            S++PL QG +AE +S   MTADAE+WNGRFAMLGLVALA TEY+   P ++V
Sbjct  131  SLVPLLQGESAEGRSGRFMTADAELWNGRFAMLGLVALAVTEYLTGAPFVNV  182



>ref|XP_009586916.1| PREDICTED: early light-induced protein 2, chloroplastic-like, 
partial [Nicotiana tomentosiformis]
Length=115

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP  ERIN RLAMIGF AA+G E  +G ++FAQ+S+ G  WFLG++ALLTLAS+
Sbjct  7    DLFAFSGPALERINDRLAMIGFVAALGTEFGDGANIFAQLSSRGFAWFLGTSALLTLASL  66

Query  360  IPLFQGVTAES-KSKGLMTADAEIWNGRFAMLGLVALAF  247
            IPLFQ + A+   +  +M+ DA+IWNGRFAMLGLVALAF
Sbjct  67   IPLFQAIRAQKGYTSVIMSVDAKIWNGRFAMLGLVALAF  105



>gb|EMS65479.1| hypothetical protein TRIUR3_00475 [Triticum urartu]
Length=168

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+S+G G  WF  S A+L+
Sbjct  55   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLSSGTGQAWFAYSVAVLS  114

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  115  VASLVPLLQGESAEGRAGTIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  168



>ref|XP_003557498.1| PREDICTED: low molecular mass early light-inducible protein HV90, 
chloroplastic-like [Brachypodium distachyon]
Length=172

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD+ SFSGP PERINGRLAM+GF  A+G+E   G  L +Q+ +G G  WF  + A+L+
Sbjct  58   SIWDILSFSGPAPERINGRLAMVGFVTALGVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  117

Query  372  LASVIPLFQGVTAESKSKG-LMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE++  G +M+A+AE+WNGRFAMLGLVALA TE +   P +++
Sbjct  118  VASLVPLLQGESAEARGAGKIMSANAELWNGRFAMLGLVALAATEVLTGAPFVNL  172



>gb|EMS68027.1| hypothetical protein TRIUR3_23641 [Triticum urartu]
Length=188

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF AA+ +E A GG L  Q  +G G+ WFL +  + +
Sbjct  75   SVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQAGSGAGLGWFLVTAGVFS  134

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG + E+KS G+ + DAE+WNGRFAMLGLVALA  E++   P +++
Sbjct  135  VASLVPLLQGQSVENKSSGVWSVDAELWNGRFAMLGLVALAAIEFITGVPFVNI  188



>gb|ABR15761.1| early light-inducible protein [Spirogyra varians]
Length=183

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            DVFSFSGP PE INGRLAM+GF  A+ +E A G  L +Q+S  G  WF+ S +L + AS+
Sbjct  76   DVFSFSGPAPETINGRLAMLGFTTALIVEKATGAPLTSQLSGVGFEWFVFSASLFSAASL  135

Query  360  IPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLL  217
            IP+FQGVT ESKS G   + AE  NGR AMLGLVA+A TEYV+  PL+
Sbjct  136  IPMFQGVTVESKSGGFFNSKAETLNGRAAMLGLVAMAITEYVKGSPLI  183



>dbj|BAJ88670.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  118

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  119  MASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  172



>dbj|BAJ86624.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91978.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +F+GP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+L+
Sbjct  60   SIWDALAFAGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLS  119

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  120  VASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  173



>gb|EMS45333.1| hypothetical protein TRIUR3_35028 [Triticum urartu]
Length=232

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+LT
Sbjct  119  SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLT  178

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  179  VASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  232



>dbj|BAJ91644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  118

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  119  MASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  172



>sp|P14897.1|ELI9_HORVU RecName: Full=Low molecular mass early light-inducible protein 
HV90, chloroplastic; Short=ELIP; Flags: Precursor [Hordeum 
vulgare]
 emb|CAA33727.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  59   SIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  118

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  119  MASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  172



>dbj|BAJ84888.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+L+
Sbjct  59   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLS  118

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  119  VASLVPLLQGESAEGRAGTIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  172



>gb|EMS65481.1| hypothetical protein TRIUR3_00477 [Triticum urartu]
Length=170

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  S A+L+
Sbjct  57   SIWDALAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYSVAVLS  116

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  117  VASLVPLLQGESAEGRAGIIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  170



>ref|XP_009615000.1| PREDICTED: early light-induced protein 2, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=200

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -1

Query  540  DVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNGGVTWFLGSTALLTLASV  361
            D+F+FSGP  ERIN RLAMIGF AA G E  +G ++FAQ S+GG  WFLG++ALLTLAS+
Sbjct  92   DLFAFSGPALERINDRLAMIGFVAAFGTEFGDGANIFAQQSSGGFAWFLGTSALLTLASL  151

Query  360  IPLFQGVTAES-KSKGLMTADAEIWNGRFAMLGLVALAFT  244
            IPLFQ + AE   +  +++ DA+IWNGRF MLGLVALAF 
Sbjct  152  IPLFQAIRAEKGYTSVIVSVDAKIWNGRFVMLGLVALAFC  191



>dbj|BAJ98694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=172

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  59   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  118

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  119  MASLVPLLQGESAEGRAGTIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  172



>dbj|BAJ90447.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86402.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91334.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=174

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  549  NLWDVFSFSGPGPERINGRLAMIGFAAAMGMELANGGDLFAQISNG-GVTWFLGSTALLT  373
            ++WD  +FSGP PERINGRLAM+GF  A+ +E   G  L +Q+ +G G  WF  + A+L+
Sbjct  61   SIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLS  120

Query  372  LASVIPLFQGVTAESKSKGLMTADAEIWNGRFAMLGLVALAFTEYVQNGPLLHV  211
            +AS++PL QG +AE ++  +M A+AE+WNGRFAMLGLVALA TE +   P ++V
Sbjct  121  MASLVPLLQGESAEGRAGTIMNANAELWNGRFAMLGLVALAATEIITGAPFINV  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2388345296832