BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78660_g1_i1 len=999 path=[977:0-998]

Length=999
                                                                      Score     E

ref|XP_006382338.1|  hypothetical protein POPTR_0005s01170g             207   7e-61   
ref|XP_010666674.1|  PREDICTED: uncharacterized protein LOC104883810    198   5e-57   
ref|XP_010687130.1|  PREDICTED: uncharacterized protein LOC104901276    196   2e-56   
emb|CCA66008.1|  hypothetical protein                                   204   4e-56   
ref|XP_010689461.1|  PREDICTED: uncharacterized protein LOC104903161    196   2e-55   
ref|XP_010689252.1|  PREDICTED: uncharacterized protein LOC104902987    193   3e-54   
gb|KDO38897.1|  hypothetical protein CISIN_1g046520mg                   189   1e-52   
ref|XP_010682307.1|  PREDICTED: uncharacterized protein LOC104897180    186   5e-52   
ref|XP_010680847.1|  PREDICTED: uncharacterized protein LOC104895900    182   2e-51   
ref|XP_010684905.1|  PREDICTED: uncharacterized protein LOC104899417    181   4e-51   
ref|XP_010682321.1|  PREDICTED: uncharacterized protein LOC104897196    182   2e-50   
ref|XP_010693748.1|  PREDICTED: uncharacterized protein LOC104906660    181   2e-50   
ref|XP_007206580.1|  hypothetical protein PRUPE_ppa020297mg             178   8e-49   
emb|CCA65996.1|  hypothetical protein                                   181   7e-48   
ref|XP_011048782.1|  PREDICTED: uncharacterized protein LOC105142718    171   3e-47   
ref|XP_007037791.1|  Uncharacterized protein TCM_014510                 179   3e-47   
gb|KDO38231.1|  hypothetical protein CISIN_1g041269mg                   177   7e-47   
gb|KDO38287.1|  hypothetical protein CISIN_1g044376mg                   176   3e-46   
gb|KHN33899.1|  hypothetical protein glysoja_031761                     167   4e-46   
ref|XP_010520311.1|  PREDICTED: uncharacterized protein LOC104799464    174   6e-46   
ref|XP_010682918.1|  PREDICTED: uncharacterized protein LOC104897680    172   1e-45   
gb|KDO58401.1|  hypothetical protein CISIN_1g046952mg                   171   2e-45   
ref|XP_003604996.1|  hypothetical protein MTR_4g022640                  172   2e-45   
ref|XP_010684563.1|  PREDICTED: uncharacterized protein LOC104899126    165   5e-45   
gb|KDO37843.1|  hypothetical protein CISIN_1g047084mg                   170   6e-45   
ref|XP_003630108.1|  hypothetical protein MTR_8g091870                  169   7e-45   
dbj|BAE79383.1|  unnamed protein product                                171   1e-44   Ipomoea batatas [batate]
ref|XP_010690660.1|  PREDICTED: uncharacterized protein LOC104904165    168   4e-44   
ref|XP_003592894.1|  hypothetical protein MTR_2g005460                  169   5e-44   
gb|KDO70278.1|  hypothetical protein CISIN_1g046866mg                   169   5e-44   
ref|XP_010680872.1|  PREDICTED: uncharacterized protein LOC104895924    161   7e-44   
ref|XP_007208943.1|  hypothetical protein PRUPE_ppb015526mg             169   8e-44   
ref|XP_010667256.1|  PREDICTED: uncharacterized protein LOC104884318    161   1e-43   
ref|XP_010425860.1|  PREDICTED: uncharacterized protein LOC104710904    162   2e-43   
emb|CAB10338.1|  hypothetical protein                                   168   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238489.1|  PREDICTED: uncharacterized protein LOC103337115    171   2e-43   
ref|XP_009786058.1|  PREDICTED: uncharacterized protein LOC104234221    166   2e-43   
ref|XP_009779035.1|  PREDICTED: uncharacterized protein LOC104228289    165   5e-43   
dbj|BAE79381.1|  unnamed protein product                                166   5e-43   Ipomoea batatas [batate]
ref|XP_006299881.1|  hypothetical protein CARUB_v10016088mg             162   7e-43   
ref|XP_006286839.1|  hypothetical protein CARUB_v10003838mg             163   7e-43   
ref|XP_007208970.1|  hypothetical protein PRUPE_ppb020897mg             166   7e-43   
emb|CDX88033.1|  BnaA06g26240D                                          164   2e-42   
ref|XP_009151454.1|  PREDICTED: uncharacterized protein LOC103874766    163   4e-42   
ref|XP_006490008.1|  PREDICTED: uncharacterized protein LOC102624085    168   4e-42   
gb|KDO60122.1|  hypothetical protein CISIN_1g045711mg                   163   4e-42   
ref|XP_003609254.1|  hypothetical protein MTR_4g113700                  162   5e-42   
gb|KDO44000.1|  hypothetical protein CISIN_1g046515mg                   163   5e-42   
gb|KDO47636.1|  hypothetical protein CISIN_1g041417mg                   160   7e-42   
ref|XP_006490301.1|  PREDICTED: uncharacterized protein LOC102612828    163   9e-42   
gb|KHN04954.1|  hypothetical protein glysoja_013861                     156   1e-41   
ref|XP_009621007.1|  PREDICTED: uncharacterized protein LOC104112...    157   2e-41   
dbj|BAE79384.1|  unnamed protein product                                166   2e-41   Ipomoea batatas [batate]
ref|XP_010666462.1|  PREDICTED: uncharacterized protein LOC104883615    157   3e-41   
ref|XP_008232499.1|  PREDICTED: uncharacterized protein LOC103331632    161   4e-41   
ref|XP_006285607.1|  hypothetical protein CARUB_v10007057mg             158   7e-41   
ref|XP_009144746.1|  PREDICTED: uncharacterized protein LOC103868394    160   8e-41   
gb|KDO39032.1|  hypothetical protein CISIN_1g043150mg                   160   1e-40   
ref|XP_010463475.1|  PREDICTED: uncharacterized protein LOC104744160    154   1e-40   
ref|XP_006296651.1|  hypothetical protein CARUB_v10015577mg             159   1e-40   
ref|XP_009139888.1|  PREDICTED: uncharacterized protein LOC103863877    159   1e-40   
ref|XP_009125818.1|  PREDICTED: uncharacterized protein LOC103850783    159   1e-40   
ref|XP_009103803.1|  PREDICTED: uncharacterized protein LOC103829870    158   2e-40   
ref|XP_006296775.1|  hypothetical protein CARUB_v10015820mg             158   2e-40   
ref|XP_010513494.1|  PREDICTED: uncharacterized protein LOC104789504    154   3e-40   
ref|XP_009121310.1|  PREDICTED: uncharacterized protein LOC103846155    157   5e-40   
ref|XP_009780018.1|  PREDICTED: uncharacterized protein LOC104229130    153   6e-40   
ref|XP_007206965.1|  hypothetical protein PRUPE_ppb019035mg             155   6e-40   
ref|XP_006296777.1|  hypothetical protein CARUB_v10015822mg             154   6e-40   
gb|KDO40369.1|  hypothetical protein CISIN_1g048241mg                   154   8e-40   
ref|XP_009101980.1|  PREDICTED: uncharacterized protein LOC103828133    157   8e-40   
ref|XP_006289412.1|  hypothetical protein CARUB_v10002911mg             156   1e-39   
ref|XP_009141433.1|  PREDICTED: uncharacterized protein LOC103865384    155   2e-39   
ref|XP_006292963.1|  hypothetical protein CARUB_v10019240mg             154   2e-39   
ref|XP_007219945.1|  hypothetical protein PRUPE_ppb019389mg             158   2e-39   
ref|XP_006295777.1|  hypothetical protein CARUB_v10024899mg             155   2e-39   
ref|XP_009101806.1|  PREDICTED: uncharacterized protein LOC103827989    155   3e-39   
ref|XP_010445325.1|  PREDICTED: uncharacterized protein LOC104727972    150   4e-39   
ref|XP_006469095.1|  PREDICTED: uncharacterized protein LOC102629728    155   5e-39   
ref|XP_006301940.1|  hypothetical protein CARUB_v10022418mg             154   5e-39   
ref|XP_006304881.1|  hypothetical protein CARUB_v10012644mg             154   5e-39   
gb|KHN07236.1|  hypothetical protein glysoja_045025                     148   5e-39   
ref|XP_007040750.1|  Zinc ion binding,nucleic acid binding-like p...    152   5e-39   
ref|XP_010484910.1|  PREDICTED: uncharacterized protein LOC104763199    150   1e-38   
ref|XP_006295613.1|  hypothetical protein CARUB_v10024726mg             153   1e-38   
ref|XP_006294233.1|  hypothetical protein CARUB_v10023230mg             152   1e-38   
ref|XP_006279197.1|  hypothetical protein CARUB_v10016517mg             152   2e-38   
ref|XP_006286068.1|  hypothetical protein CARUB_v10007601mg             152   2e-38   
ref|XP_009129252.1|  PREDICTED: uncharacterized protein LOC103854088    153   2e-38   
ref|XP_006301503.1|  hypothetical protein CARUB_v10021929mg             152   3e-38   
ref|XP_006295894.1|  hypothetical protein CARUB_v10025024mg             152   3e-38   
ref|XP_010423120.1|  PREDICTED: uncharacterized protein LOC104708268    148   4e-38   
ref|XP_007219550.1|  hypothetical protein PRUPE_ppa025650mg             147   5e-38   
emb|CDY53602.1|  BnaC09g51900D                                          152   5e-38   
ref|XP_006287598.1|  hypothetical protein CARUB_v10000810mg             151   6e-38   
gb|KDO46597.1|  hypothetical protein CISIN_1g041945mg                   148   6e-38   
ref|XP_009787638.1|  PREDICTED: uncharacterized protein LOC104235548    147   9e-38   
ref|XP_009801431.1|  PREDICTED: uncharacterized protein LOC104247173    147   1e-37   
ref|XP_009119466.1|  PREDICTED: uncharacterized protein LOC103844431    155   1e-37   
gb|ABW81177.1|  gag non-LTR retrotransposase                            150   1e-37   Arabidopsis cebennensis
ref|XP_009785180.1|  PREDICTED: uncharacterized protein LOC104233...    147   2e-37   
ref|XP_009795699.1|  PREDICTED: uncharacterized protein LOC104242361    145   2e-37   
ref|XP_009782149.1|  PREDICTED: uncharacterized protein LOC104230937    147   2e-37   
gb|KFK31800.1|  hypothetical protein AALP_AA6G160500                    153   2e-37   
ref|XP_008220882.1|  PREDICTED: uncharacterized protein LOC103320918    151   2e-37   
gb|KCW81645.1|  hypothetical protein EUGRSUZ_C03006                     141   3e-37   
ref|XP_006596845.1|  PREDICTED: uncharacterized protein At4g02000...    150   3e-37   
ref|XP_006375872.1|  hypothetical protein POPTR_0013s04890g             142   3e-37   
gb|AAD37019.2|  putative non-LTR retrolelement reverse transcriptase    152   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286623.1|  hypothetical protein CARUB_v10002432mg             149   4e-37   
ref|XP_006293025.1|  hypothetical protein CARUB_v10019305mg             147   5e-37   
ref|XP_006282338.1|  hypothetical protein CARUB_v10028633mg             148   5e-37   
ref|XP_006282222.1|  hypothetical protein CARUB_v10028495mg             147   7e-37   
dbj|BAB01940.1|  non-LTR retrolelement reverse transcriptase-like...    148   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009764541.1|  PREDICTED: uncharacterized protein LOC104216228    143   2e-36   
ref|XP_009126860.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    150   3e-36   
ref|XP_007213231.1|  hypothetical protein PRUPE_ppb017383mg             148   3e-36   
ref|NP_178215.1|  zinc ion binding / nucleic acid binding protein       146   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301986.1|  hypothetical protein CARUB_v10022467mg             145   5e-36   
ref|XP_009794210.1|  PREDICTED: uncharacterized protein LOC104241008    142   5e-36   
ref|XP_010463327.1|  PREDICTED: uncharacterized protein LOC104743994    148   7e-36   
ref|XP_010681547.1|  PREDICTED: uncharacterized protein LOC104896496    140   8e-36   
ref|XP_007213212.1|  hypothetical protein PRUPE_ppb013620mg             148   1e-35   
ref|XP_010481113.1|  PREDICTED: uncharacterized protein LOC104759949    141   2e-35   
ref|XP_009765340.1|  PREDICTED: uncharacterized protein LOC104216902    140   4e-35   
ref|XP_010659263.1|  PREDICTED: uncharacterized protein LOC104881299    145   8e-35   
emb|CAN60544.1|  hypothetical protein VITISV_006250                     145   8e-35   Vitis vinifera
ref|XP_009796013.1|  PREDICTED: uncharacterized protein LOC104242638    140   9e-35   
ref|XP_003593078.1|  hypothetical protein MTR_2g007560                  142   2e-34   
ref|XP_006601654.1|  PREDICTED: uncharacterized protein LOC100791212    141   3e-34   
ref|XP_010681595.1|  PREDICTED: uncharacterized protein LOC104896537    137   5e-34   
ref|XP_009757725.1|  PREDICTED: uncharacterized protein LOC104210511    137   6e-34   
gb|KHN09077.1|  hypothetical protein glysoja_034262                     135   9e-34   
gb|KDO39120.1|  hypothetical protein CISIN_1g048696mg                   135   1e-33   
ref|XP_010692742.1|  PREDICTED: uncharacterized protein LOC104905804    131   2e-33   
ref|XP_010418769.1|  PREDICTED: uncharacterized protein LOC104704363    137   2e-33   
gb|AAC26675.1|  putative Ta11-like non-LTR retroelement protein         137   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009804250.1|  PREDICTED: uncharacterized protein LOC104249509    137   3e-33   
ref|XP_006282176.1|  hypothetical protein CARUB_v10028438mg             137   4e-33   
gb|AEL30359.1|  RNA-directed DNA polymerase                             141   5e-33   
gb|KHN24218.1|  hypothetical protein glysoja_037052                     129   1e-32   
ref|XP_009778425.1|  PREDICTED: uncharacterized protein LOC104227795    130   1e-32   
ref|XP_006295736.1|  hypothetical protein CARUB_v10024855mg             136   1e-32   
ref|XP_006285413.1|  hypothetical protein CARUB_v10006824mg             136   1e-32   
ref|XP_004309385.1|  PREDICTED: uncharacterized protein LOC101293944    134   1e-32   
ref|XP_009774449.1|  PREDICTED: uncharacterized protein LOC104224474    134   2e-32   
ref|XP_006305928.1|  hypothetical protein CARUB_v10011149mg             131   2e-32   
ref|XP_006289364.1|  hypothetical protein CARUB_v10002859mg             134   3e-32   
ref|XP_009792247.1|  PREDICTED: uncharacterized protein LOC104239331    133   5e-32   
ref|XP_006299187.1|  hypothetical protein CARUB_v10015332mg             133   5e-32   
ref|XP_010467353.1|  PREDICTED: uncharacterized protein LOC104747...    132   8e-32   
ref|XP_009790993.1|  PREDICTED: uncharacterized protein LOC104238354    130   8e-32   
gb|KHN27519.1|  hypothetical protein glysoja_018631                     127   9e-32   
ref|XP_003623584.1|  hypothetical protein MTR_7g072780                  128   1e-31   
ref|XP_010467351.1|  PREDICTED: uncharacterized protein LOC104747...    132   2e-31   
ref|XP_008391272.1|  PREDICTED: uncharacterized protein LOC103453511    128   5e-31   
ref|XP_007227335.1|  hypothetical protein PRUPE_ppa015712mg             127   6e-31   
ref|XP_008227226.1|  PREDICTED: uncharacterized protein LOC103326763    132   6e-31   
gb|KHN46281.1|  hypothetical protein glysoja_047459                     124   9e-31   
ref|XP_010490183.1|  PREDICTED: uncharacterized protein LOC104767918    127   1e-30   
ref|XP_002534404.1|  conserved hypothetical protein                     125   1e-30   Ricinus communis
ref|XP_010424626.1|  PREDICTED: uncharacterized protein LOC104709762    125   3e-30   
ref|XP_002317857.1|  hypothetical protein POPTR_0012s00280g             126   4e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006387180.1|  hypothetical protein POPTR_1595s00200g             129   4e-30   
ref|XP_009802092.1|  PREDICTED: uncharacterized protein At4g02000...    124   4e-30   
ref|XP_009795271.1|  PREDICTED: uncharacterized protein LOC104241995    124   7e-30   
ref|XP_006606936.1|  PREDICTED: uncharacterized protein LOC102668273    125   1e-29   
ref|XP_009788839.1|  PREDICTED: uncharacterized protein LOC104236581    124   1e-29   
ref|XP_009785842.1|  PREDICTED: uncharacterized protein LOC104234049    123   1e-29   
gb|KHN06230.1|  hypothetical protein glysoja_030296                     121   2e-29   
ref|XP_007220807.1|  hypothetical protein PRUPE_ppb020060mg             125   3e-29   
gb|KHN35462.1|  hypothetical protein glysoja_032217                     119   5e-29   
gb|KDO36602.1|  hypothetical protein CISIN_1g037725mg                   123   6e-29   
ref|XP_006428819.1|  hypothetical protein CICLE_v10013460mg             124   8e-29   
ref|XP_010263702.1|  PREDICTED: uncharacterized protein LOC104601894    123   1e-28   
gb|KHN04719.1|  hypothetical protein glysoja_041220                     119   1e-28   
ref|XP_010693413.1|  PREDICTED: uncharacterized protein LOC104906370    119   3e-28   
ref|XP_010684971.1|  PREDICTED: uncharacterized protein LOC104899471    119   5e-28   
ref|XP_010474076.1|  PREDICTED: uncharacterized protein LOC104753532    120   7e-28   
ref|XP_008345657.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    125   8e-28   
ref|XP_010412659.1|  PREDICTED: uncharacterized protein At4g02000...    116   8e-28   
ref|XP_010480590.1|  PREDICTED: uncharacterized protein LOC104759346    119   8e-28   
ref|XP_009781293.1|  PREDICTED: uncharacterized protein LOC104230235    115   3e-27   
ref|XP_009140418.1|  PREDICTED: uncharacterized protein LOC103864421    116   6e-27   
ref|XP_010424323.1|  PREDICTED: uncharacterized protein LOC104709398    116   9e-27   
gb|KHN25996.1|  hypothetical protein glysoja_046925                     112   2e-26   
ref|XP_010694032.1|  PREDICTED: uncharacterized protein LOC104906902    114   3e-26   
gb|KDO74197.1|  hypothetical protein CISIN_1g037882mg                   116   4e-26   
ref|XP_006285575.1|  hypothetical protein CARUB_v10007019mg             115   6e-26   
ref|XP_010673145.1|  PREDICTED: uncharacterized protein LOC104889585    114   3e-25   
ref|XP_009772651.1|  PREDICTED: uncharacterized protein LOC104222998    111   3e-25   
ref|XP_008370578.1|  PREDICTED: uncharacterized protein LOC103434047    114   4e-25   
ref|XP_006285939.1|  hypothetical protein CARUB_v10007452mg             112   9e-25   
gb|KDO35980.1|  hypothetical protein CISIN_1g037800mg                   112   9e-25   
gb|KHN14868.1|  hypothetical protein glysoja_045073                     107   1e-24   
ref|XP_009792816.1|  PREDICTED: uncharacterized protein LOC104239798    109   1e-24   
ref|XP_008381949.1|  PREDICTED: uncharacterized protein LOC103444784    107   2e-24   
ref|XP_009758586.1|  PREDICTED: uncharacterized protein LOC104211257    109   3e-24   
ref|XP_009789326.1|  PREDICTED: uncharacterized protein LOC104236971    109   5e-24   
gb|KEH41789.1|  endonuclease/exonuclease/phosphatase family protein     114   5e-24   
gb|KHN47225.1|  hypothetical protein glysoja_035016                     106   8e-24   
ref|XP_006388296.1|  hypothetical protein POPTR_0241s00200g             107   1e-23   
gb|KHN30016.1|  hypothetical protein glysoja_049086                     105   2e-23   
ref|XP_010689853.1|  PREDICTED: uncharacterized protein LOC104903510    105   3e-23   
ref|XP_006279401.1|  hypothetical protein CARUB_v10007980mg             108   3e-23   
ref|XP_010463487.1|  PREDICTED: uncharacterized protein LOC104744173    106   4e-23   
ref|XP_007216733.1|  hypothetical protein PRUPE_ppa025421mg             106   7e-23   
ref|XP_006580860.1|  PREDICTED: uncharacterized protein LOC102664004    105   2e-22   
ref|XP_009759687.1|  PREDICTED: uncharacterized protein LOC104212176    105   2e-22   
ref|XP_006385277.1|  hypothetical protein POPTR_0003s02390g             104   3e-22   
ref|XP_009770244.1|  PREDICTED: uncharacterized protein LOC104220969    104   3e-22   
ref|XP_007224188.1|  hypothetical protein PRUPE_ppa016658mg             106   3e-22   
ref|XP_008795223.1|  PREDICTED: uncharacterized protein LOC103711032    104   3e-22   
gb|KCW60820.1|  hypothetical protein EUGRSUZ_H03558                     100   3e-22   
ref|XP_006382318.1|  hypothetical protein POPTR_0005s00970g             101   3e-22   
gb|KHN29850.1|  hypothetical protein glysoja_034094                   99.4    4e-22   
ref|XP_009607026.1|  PREDICTED: uncharacterized protein LOC104101282    100   5e-22   
gb|KHN04242.1|  hypothetical protein glysoja_041006                     100   5e-22   
ref|XP_009770156.1|  PREDICTED: uncharacterized protein LOC104220886    103   6e-22   
ref|XP_009759323.1|  PREDICTED: uncharacterized protein LOC104211883    101   7e-22   
ref|XP_010690458.1|  PREDICTED: uncharacterized protein LOC104903992    106   8e-22   
ref|XP_006599769.1|  PREDICTED: uncharacterized protein LOC102668549    103   1e-21   
ref|XP_008779513.1|  PREDICTED: uncharacterized protein LOC103699249    102   1e-21   
ref|XP_010687419.1|  PREDICTED: uncharacterized protein LOC104901529    103   2e-21   
ref|XP_008806373.1|  PREDICTED: uncharacterized protein LOC103719081    105   3e-21   
ref|XP_009758585.1|  PREDICTED: uncharacterized protein LOC104211255  99.8    4e-21   
ref|XP_010671910.1|  PREDICTED: uncharacterized protein LOC104888586    103   5e-21   
ref|XP_010695483.1|  PREDICTED: uncharacterized protein LOC104908105    101   5e-21   
ref|XP_007204051.1|  hypothetical protein PRUPE_ppa026737mg           97.4    6e-21   
ref|XP_006577696.1|  PREDICTED: uncharacterized protein LOC102664242    102   6e-21   
ref|XP_009794040.1|  PREDICTED: uncharacterized protein LOC104240845  98.6    6e-21   
ref|XP_002516014.1|  conserved hypothetical protein                     103   6e-21   Ricinus communis
ref|XP_006605232.1|  PREDICTED: uncharacterized protein LOC102667279    100   7e-21   
ref|XP_010672383.1|  PREDICTED: uncharacterized protein LOC104888966    104   7e-21   
ref|XP_010695085.1|  PREDICTED: uncharacterized protein LOC104907793    101   8e-21   
gb|KDO54331.1|  hypothetical protein CISIN_1g037263mg                 97.1    9e-21   
ref|XP_010694057.1|  PREDICTED: uncharacterized protein LOC104906925    100   1e-20   
ref|XP_008807073.1|  PREDICTED: uncharacterized protein LOC103719554  98.6    2e-20   
ref|XP_008780218.1|  PREDICTED: uncharacterized protein LOC103700017    100   2e-20   
ref|XP_010670298.1|  PREDICTED: uncharacterized protein LOC104887379    100   2e-20   
ref|XP_008245053.1|  PREDICTED: uncharacterized protein LOC103343160  96.7    3e-20   
gb|KDO48120.1|  hypothetical protein CISIN_1g045413mg                 97.1    3e-20   
ref|XP_010681517.1|  PREDICTED: uncharacterized protein LOC104896467  99.4    4e-20   
ref|XP_008782110.1|  PREDICTED: uncharacterized protein LOC103701725  98.2    4e-20   
ref|XP_008779654.1|  PREDICTED: uncharacterized protein LOC103699413  97.4    4e-20   
ref|XP_010474089.1|  PREDICTED: uncharacterized protein LOC104753550  97.1    4e-20   
ref|XP_006380429.1|  hypothetical protein POPTR_0007s05790g           99.0    4e-20   
gb|KGN50455.1|  hypothetical protein Csa_5G175790                       101   4e-20   
gb|KDO69928.1|  hypothetical protein CISIN_1g039478mg                 94.7    5e-20   
ref|XP_008795215.1|  PREDICTED: uncharacterized protein LOC103711023  97.8    5e-20   
ref|XP_009798240.1|  PREDICTED: uncharacterized protein LOC104244502  95.5    6e-20   
gb|KHN42237.1|  hypothetical protein glysoja_044118                   96.3    7e-20   
ref|XP_007204767.1|  hypothetical protein PRUPE_ppa015222mg           96.7    7e-20   
ref|XP_008780032.1|  PREDICTED: uncharacterized protein LOC103699804  96.7    1e-19   
emb|CAB78007.1|  putative protein                                     97.8    1e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KDO50220.1|  hypothetical protein CISIN_1g0394272mg                91.7    2e-19   
ref|XP_007013807.1|  Uncharacterized protein TCM_038365               99.0    2e-19   
ref|XP_008782044.1|  PREDICTED: uncharacterized protein LOC103701669  95.5    2e-19   
ref|XP_008782095.1|  PREDICTED: uncharacterized protein At4g02000...  95.5    2e-19   
gb|KGN50456.1|  hypothetical protein Csa_5G175800                     99.0    2e-19   
gb|KHN26207.1|  hypothetical protein glysoja_035500                   98.2    3e-19   
ref|XP_009797671.1|  PREDICTED: uncharacterized protein LOC104244065  94.7    3e-19   
emb|CCA65978.1|  hypothetical protein                                 97.1    3e-19   
ref|XP_008780390.1|  PREDICTED: uncharacterized protein LOC103700206  95.5    3e-19   
ref|XP_009596743.1|  PREDICTED: uncharacterized protein LOC104092781  95.5    4e-19   
ref|XP_010683803.1|  PREDICTED: uncharacterized protein LOC104898415  95.5    4e-19   
ref|XP_008807968.1|  PREDICTED: uncharacterized protein LOC103720159  95.5    5e-19   
ref|XP_009631586.1|  PREDICTED: uncharacterized protein LOC104121326  92.8    6e-19   
ref|XP_008780092.1|  PREDICTED: uncharacterized protein LOC103699874  97.4    6e-19   
ref|XP_008779956.1|  PREDICTED: uncharacterized protein LOC103699731  97.1    6e-19   
ref|XP_002309389.2|  hypothetical protein POPTR_0006s18930g           92.8    7e-19   Populus trichocarpa [western balsam poplar]
gb|KHN11080.1|  hypothetical protein glysoja_041916                   89.7    9e-19   
ref|XP_007048220.1|  Uncharacterized protein TCM_001333               94.4    1e-18   
ref|XP_010678903.1|  PREDICTED: uncharacterized protein LOC104894379  94.7    1e-18   
ref|XP_008780080.1|  PREDICTED: uncharacterized protein LOC103699861  93.6    1e-18   
gb|KDO59838.1|  hypothetical protein CISIN_1g037799mg                 90.1    1e-18   
ref|XP_010668455.1|  PREDICTED: uncharacterized protein LOC104885464  94.4    2e-18   
gb|KGN50454.1|  hypothetical protein Csa_5G175780                     96.3    2e-18   
ref|XP_008800940.1|  PREDICTED: uncharacterized protein LOC103715176  92.8    2e-18   
ref|XP_006591625.1|  PREDICTED: uncharacterized protein LOC102667520  94.4    2e-18   
gb|KDO43811.1|  hypothetical protein CISIN_1g044430mg                 92.8    2e-18   
ref|XP_008778450.1|  PREDICTED: uncharacterized protein LOC103698238  93.2    3e-18   
ref|XP_008780422.1|  PREDICTED: uncharacterized protein LOC103700244  92.8    3e-18   
ref|XP_010684746.1|  PREDICTED: uncharacterized protein LOC104899282  91.3    4e-18   
ref|XP_010314397.1|  PREDICTED: uncharacterized protein LOC104645079  95.1    4e-18   
ref|XP_009617980.1|  PREDICTED: uncharacterized protein LOC104110235  92.0    4e-18   
gb|KDO36419.1|  hypothetical protein CISIN_1g044040mg                 89.4    4e-18   
ref|XP_008780208.1|  PREDICTED: uncharacterized protein LOC103700005  93.2    5e-18   
gb|KHN17248.1|  hypothetical protein glysoja_010707                   94.4    6e-18   
ref|XP_009795169.1|  PREDICTED: uncharacterized protein LOC104241907  91.3    6e-18   
ref|XP_010677503.1|  PREDICTED: uncharacterized protein LOC104893120  93.2    7e-18   
ref|XP_008780160.1|  PREDICTED: uncharacterized protein LOC103699951  91.3    7e-18   
ref|XP_009771927.1|  PREDICTED: uncharacterized protein LOC104222393  90.5    7e-18   
ref|XP_008780225.1|  PREDICTED: uncharacterized protein LOC103700022  93.2    7e-18   
ref|XP_008779623.1|  PREDICTED: uncharacterized protein LOC103699378  93.6    8e-18   
gb|KHN21001.1|  hypothetical protein glysoja_009309                   93.6    9e-18   
ref|XP_009783588.1|  PREDICTED: uncharacterized protein LOC104232162  91.3    9e-18   
ref|XP_009762889.1|  PREDICTED: uncharacterized protein LOC104214865  90.9    1e-17   
ref|XP_009758696.1|  PREDICTED: uncharacterized protein LOC104211352  92.0    1e-17   
gb|KDO50386.1|  hypothetical protein CISIN_1g046148mg                 90.5    1e-17   
ref|XP_008775599.1|  PREDICTED: uncharacterized protein LOC103695927  89.4    1e-17   
ref|XP_010689805.1|  PREDICTED: uncharacterized protein LOC104903466  93.2    1e-17   
ref|XP_007019346.1|  Uncharacterized protein TCM_035367               93.2    1e-17   
ref|XP_010668397.1|  PREDICTED: uncharacterized protein LOC104885398  88.6    2e-17   
ref|XP_008778888.1|  PREDICTED: uncharacterized protein LOC103698628  89.0    2e-17   
ref|XP_003604531.1|  hypothetical protein MTR_4g014190                91.3    2e-17   
ref|XP_009761814.1|  PREDICTED: uncharacterized protein LOC104213944  92.4    2e-17   
ref|XP_009612723.1|  PREDICTED: uncharacterized protein LOC104105983  88.6    3e-17   
ref|XP_010943369.1|  PREDICTED: uncharacterized protein LOC105061108  89.7    3e-17   
ref|XP_002515743.1|  hypothetical protein RCOM_1551240                87.4    3e-17   
gb|KHN35434.1|  hypothetical protein glysoja_038360                   85.9    3e-17   
ref|XP_009768155.1|  PREDICTED: uncharacterized protein LOC104219214  89.4    4e-17   
ref|XP_008800194.1|  PREDICTED: uncharacterized protein LOC103714647  92.8    4e-17   
gb|KDO39313.1|  hypothetical protein CISIN_1g037277mg                 87.8    4e-17   
ref|XP_009624495.1|  PREDICTED: uncharacterized protein LOC104115535  87.8    4e-17   
ref|XP_008780476.1|  PREDICTED: uncharacterized protein LOC103700307  89.0    4e-17   
ref|XP_009793419.1|  PREDICTED: uncharacterized protein LOC104240289  86.7    5e-17   
ref|XP_010690181.1|  PREDICTED: uncharacterized protein LOC104903768  89.0    5e-17   
ref|XP_010322029.1|  PREDICTED: uncharacterized protein LOC104647883  90.9    5e-17   
ref|XP_008796020.1|  PREDICTED: uncharacterized protein LOC103711587  89.4    6e-17   
ref|XP_010314948.1|  PREDICTED: uncharacterized protein LOC104645283  91.7    7e-17   
ref|XP_008780220.1|  PREDICTED: uncharacterized protein LOC103700018  88.2    8e-17   
ref|XP_008782106.1|  PREDICTED: uncharacterized protein LOC103701720  88.2    8e-17   
ref|XP_008780119.1|  PREDICTED: uncharacterized protein LOC103699903  88.6    8e-17   
ref|XP_008788747.1|  PREDICTED: uncharacterized protein LOC103706430  90.9    1e-16   
ref|XP_003603988.1|  hypothetical protein MTR_3g117300                84.0    1e-16   
ref|XP_009586783.1|  PREDICTED: uncharacterized protein LOC104084588  87.4    1e-16   
ref|XP_009759259.1|  PREDICTED: uncharacterized protein LOC104211833  86.3    1e-16   
ref|XP_010669528.1|  PREDICTED: uncharacterized protein LOC104886739  85.9    2e-16   
ref|XP_009594501.1|  PREDICTED: uncharacterized protein LOC104090981  87.8    2e-16   
ref|XP_009766307.1|  PREDICTED: uncharacterized protein LOC104217698  88.2    2e-16   
ref|XP_008780471.1|  PREDICTED: uncharacterized protein LOC103700301  87.0    2e-16   
ref|XP_008799663.1|  PREDICTED: uncharacterized protein LOC103714254  89.0    2e-16   
ref|XP_007050537.1|  Uncharacterized protein TCM_004306               89.4    3e-16   
ref|XP_008797324.1|  PREDICTED: uncharacterized protein LOC103712551  88.6    3e-16   
ref|XP_006378903.1|  hypothetical protein POPTR_0009s00420g           88.6    3e-16   
ref|XP_009597033.1|  PREDICTED: uncharacterized protein LOC104093030  84.7    3e-16   
ref|XP_002534774.1|  hypothetical protein RCOM_2138330                83.2    5e-16   
ref|XP_006385484.1|  hypothetical protein POPTR_0003s05680g           86.7    5e-16   
ref|XP_007044224.1|  Uncharacterized protein TCM_009467               87.8    6e-16   
ref|XP_008798238.1|  PREDICTED: uncharacterized protein LOC103713186  87.4    6e-16   
ref|XP_008779814.1|  PREDICTED: uncharacterized protein LOC103699569  86.7    6e-16   
ref|XP_010917814.1|  PREDICTED: uncharacterized protein LOC105042341  85.5    7e-16   
ref|XP_010690648.1|  PREDICTED: uncharacterized protein LOC104904155  86.7    9e-16   
ref|XP_009794445.1|  PREDICTED: uncharacterized protein LOC104241223  85.1    9e-16   
ref|XP_010317841.1|  PREDICTED: uncharacterized protein LOC104646245  88.2    1e-15   
ref|XP_009767593.1|  PREDICTED: uncharacterized protein LOC104218728  87.0    1e-15   
gb|KDO47161.1|  hypothetical protein CISIN_1g035718mg                 82.4    2e-15   
ref|XP_010693979.1|  PREDICTED: uncharacterized protein LOC104906849  86.3    2e-15   
ref|XP_009586956.1|  PREDICTED: uncharacterized protein LOC104084721  85.5    2e-15   
ref|XP_009600598.1|  PREDICTED: uncharacterized protein LOC104096022  83.2    2e-15   
ref|XP_008780611.1|  PREDICTED: uncharacterized protein LOC103700446  84.3    2e-15   
ref|XP_010692777.1|  PREDICTED: uncharacterized protein LOC104905839  85.9    2e-15   
ref|XP_008779478.1|  PREDICTED: uncharacterized protein LOC103699206  84.0    2e-15   
gb|KDO37533.1|  hypothetical protein CISIN_1g048335mg                 82.8    2e-15   
ref|XP_009757454.1|  PREDICTED: uncharacterized protein LOC104210289  82.4    2e-15   
ref|XP_008779341.1|  PREDICTED: uncharacterized protein LOC103699074  85.1    2e-15   
ref|XP_008776414.1|  PREDICTED: uncharacterized protein LOC103696532  83.2    2e-15   
ref|XP_009779969.1|  PREDICTED: uncharacterized protein LOC104229091  85.1    2e-15   
ref|XP_010682177.1|  PREDICTED: uncharacterized protein LOC104897068  85.9    2e-15   
gb|KDO40160.1|  hypothetical protein CISIN_1g046738mg                 84.0    3e-15   
ref|XP_006289985.1|  hypothetical protein CARUB_v10003615mg           85.5    3e-15   
ref|XP_008780283.1|  PREDICTED: uncharacterized protein LOC103700090  83.2    3e-15   
gb|KDO40094.1|  hypothetical protein CISIN_1g043661mg                 82.0    3e-15   
ref|XP_008804803.1|  PREDICTED: uncharacterized protein LOC103717984  83.6    5e-15   
ref|XP_004243802.1|  PREDICTED: uncharacterized protein LOC101261248  84.7    6e-15   
ref|XP_008811730.1|  PREDICTED: uncharacterized protein LOC103722817  82.8    6e-15   
ref|XP_006387324.1|  hypothetical protein POPTR_1250s00200g           85.1    6e-15   
ref|XP_010667206.1|  PREDICTED: uncharacterized protein LOC104884282  81.6    7e-15   
ref|XP_006376651.1|  hypothetical protein POPTR_0012s02065g           80.1    7e-15   
ref|XP_009800896.1|  PREDICTED: uncharacterized protein LOC104246718  84.0    7e-15   
ref|XP_010412562.1|  PREDICTED: uncharacterized protein LOC104698872  80.9    9e-15   
ref|XP_008810302.1|  PREDICTED: uncharacterized protein LOC103721754  81.3    1e-14   
ref|XP_009591529.1|  PREDICTED: uncharacterized protein LOC104088537  83.6    1e-14   
ref|XP_008780257.1|  PREDICTED: uncharacterized protein LOC103700060  80.9    1e-14   
ref|XP_010694816.1|  PREDICTED: uncharacterized protein LOC104907572  80.5    1e-14   
ref|XP_010474044.1|  PREDICTED: uncharacterized protein LOC104753498  81.3    2e-14   
ref|XP_010694031.1|  PREDICTED: uncharacterized protein LOC104906900  81.3    2e-14   
ref|XP_007039835.1|  Uncharacterized protein TCM_015964               80.1    2e-14   
ref|XP_009798363.1|  PREDICTED: uncharacterized protein LOC104244604  79.7    2e-14   
ref|XP_010670315.1|  PREDICTED: uncharacterized protein LOC104887397  83.2    2e-14   
gb|KEH25877.1|  DUF4283 domain protein                                82.8    2e-14   
ref|XP_006380103.1|  hypothetical protein POPTR_0008s21940g           83.6    3e-14   
ref|XP_006387291.1|  hypothetical protein POPTR_1325s00020g           80.1    3e-14   
ref|XP_002534463.1|  conserved hypothetical protein                   80.9    4e-14   
ref|XP_008810124.1|  PREDICTED: LOW QUALITY PROTEIN: coatomer sub...  83.6    4e-14   
ref|XP_006379378.1|  hypothetical protein POPTR_0008s00200g           82.8    4e-14   
ref|XP_007203452.1|  hypothetical protein PRUPE_ppa022115mg           83.2    4e-14   
ref|XP_010485066.1|  PREDICTED: uncharacterized protein LOC104763387  79.3    4e-14   
ref|XP_003554892.1|  PREDICTED: probable receptor-like protein ki...  82.8    4e-14   
ref|XP_008805281.1|  PREDICTED: uncharacterized protein LOC103718305  82.4    4e-14   
ref|XP_010689623.1|  PREDICTED: uncharacterized protein LOC104903305  81.3    5e-14   
ref|XP_006388049.1|  hypothetical protein POPTR_0380s00210g           82.0    5e-14   
ref|XP_009800509.1|  PREDICTED: uncharacterized protein LOC104246396  79.0    5e-14   
ref|XP_010314925.1|  PREDICTED: uncharacterized protein LOC104645270  79.7    5e-14   
ref|XP_009770224.1|  PREDICTED: uncharacterized protein LOC104220956  82.0    6e-14   
ref|XP_009759342.1|  PREDICTED: uncharacterized protein LOC104211900  79.0    7e-14   
ref|XP_009798866.1|  PREDICTED: uncharacterized protein LOC104245019  80.1    7e-14   
ref|XP_008780457.1|  PREDICTED: uncharacterized protein LOC103700283  78.2    8e-14   
ref|XP_008809959.1|  PREDICTED: uncharacterized protein LOC103721498  78.2    8e-14   
ref|XP_009759333.1|  PREDICTED: uncharacterized protein LOC104211895  79.3    8e-14   
ref|XP_009593244.1|  PREDICTED: uncharacterized protein LOC104089929  80.9    9e-14   
ref|XP_009768291.1|  PREDICTED: uncharacterized protein LOC104219326  79.0    9e-14   
ref|XP_009763858.1|  PREDICTED: uncharacterized protein LOC104215701  77.4    1e-13   
ref|XP_008797692.1|  PREDICTED: uncharacterized protein LOC103712830  77.8    1e-13   
ref|XP_010686465.1|  PREDICTED: uncharacterized protein LOC104900672  80.9    1e-13   
ref|XP_010682612.1|  PREDICTED: uncharacterized protein LOC104897432  79.7    1e-13   
ref|XP_009603757.1|  PREDICTED: uncharacterized protein LOC104098665  78.2    2e-13   
ref|XP_006380098.1|  hypothetical protein POPTR_0008s218701g          78.2    2e-13   
gb|KDP31715.1|  hypothetical protein JCGZ_14928                       77.4    2e-13   
ref|XP_006378894.1|  hypothetical protein POPTR_0009s00280g           80.5    2e-13   
ref|XP_010685587.1|  PREDICTED: uncharacterized protein LOC104899978  80.5    2e-13   
ref|XP_009765500.1|  PREDICTED: uncharacterized protein LOC104217044  78.6    2e-13   
gb|KDO40022.1|  hypothetical protein CISIN_1g048317mg                 75.9    2e-13   
ref|XP_010058340.1|  PREDICTED: uncharacterized protein LOC104446132  80.5    2e-13   
ref|XP_007048710.1|  LINE-type retrotransposon LIb DNA, Insertion...  80.5    2e-13   
ref|XP_009800242.1|  PREDICTED: uncharacterized protein LOC104246176  78.2    2e-13   
ref|XP_003625200.1|  hypothetical protein MTR_7g092550                80.1    2e-13   
ref|XP_011069437.1|  PREDICTED: uncharacterized protein LOC105155263  77.8    3e-13   
ref|XP_007029761.1|  Uncharacterized protein TCM_025636               79.7    3e-13   
ref|XP_009617694.1|  PREDICTED: uncharacterized protein LOC104109986  77.4    3e-13   
gb|KDO37786.1|  hypothetical protein CISIN_1g043098mg                 77.0    3e-13   
ref|XP_010928992.1|  PREDICTED: uncharacterized protein LOC105050610  77.0    3e-13   
ref|XP_010243263.1|  PREDICTED: uncharacterized protein LOC104587376  79.0    3e-13   
ref|XP_006378909.1|  hypothetical protein POPTR_0009s00490g           79.7    3e-13   
ref|XP_009792300.1|  PREDICTED: uncharacterized protein LOC104239367  78.2    3e-13   
ref|XP_009802415.1|  PREDICTED: uncharacterized protein At4g02000...  75.5    4e-13   
gb|KHN48369.1|  hypothetical protein glysoja_049216                   73.9    4e-13   
ref|XP_006295690.1|  hypothetical protein CARUB_v10024806mg           76.3    4e-13   
ref|XP_008780555.1|  PREDICTED: uncharacterized protein LOC103700387  76.3    4e-13   
ref|XP_008780634.1|  PREDICTED: uncharacterized protein LOC103700471  77.4    4e-13   
ref|XP_011092915.1|  PREDICTED: uncharacterized protein LOC105172985  79.3    5e-13   
emb|CAB96840.1|  putative protein                                     75.9    5e-13   
ref|XP_006385516.1|  hypothetical protein POPTR_0003s06430g           77.4    5e-13   
ref|XP_007206481.1|  hypothetical protein PRUPE_ppa018770mg           79.3    6e-13   
ref|XP_010677657.1|  PREDICTED: uncharacterized protein LOC104893250  78.2    6e-13   
ref|XP_006375693.1|  hypothetical protein POPTR_0014s19700g           78.2    7e-13   
gb|KHN28554.1|  hypothetical protein glysoja_021375                   73.2    8e-13   
ref|XP_006380110.1|  hypothetical protein POPTR_0008s22010g           79.0    8e-13   
ref|XP_010684013.1|  PREDICTED: uncharacterized protein LOC104898615  75.1    8e-13   
ref|XP_002307101.1|  hypothetical protein POPTR_0005s07960g           75.9    8e-13   
ref|XP_006387777.1|  hypothetical protein POPTR_0590s00210g           78.2    1e-12   
ref|XP_009612471.1|  PREDICTED: uncharacterized protein LOC104105787  77.0    1e-12   
ref|XP_008813723.1|  PREDICTED: uncharacterized protein LOC103724288  74.3    1e-12   
ref|XP_007224595.1|  hypothetical protein PRUPE_ppa027186mg           76.6    1e-12   
ref|XP_008804044.1|  PREDICTED: uncharacterized protein LOC103717441  74.7    1e-12   
ref|XP_007162543.1|  hypothetical protein PHAVU_001G160900g           76.3    1e-12   
ref|XP_010666816.1|  PREDICTED: uncharacterized protein LOC104883939  77.0    1e-12   
ref|XP_006374361.1|  hypothetical protein POPTR_0015s06420g           77.8    1e-12   
ref|XP_008811777.1|  PREDICTED: uncharacterized protein LOC103722858  75.1    2e-12   
ref|XP_008812102.1|  PREDICTED: uncharacterized protein LOC103723073  75.1    2e-12   
ref|XP_010046167.1|  PREDICTED: uncharacterized protein LOC104435035  78.2    2e-12   
ref|XP_006378919.1|  hypothetical protein POPTR_0009s00560g           77.8    2e-12   
ref|XP_009610911.1|  PREDICTED: uncharacterized protein LOC104104509  74.3    2e-12   
ref|XP_006376160.1|  hypothetical protein POPTR_0013s10355g           77.8    2e-12   
ref|XP_007217435.1|  hypothetical protein PRUPE_ppb014370mg           72.4    2e-12   
ref|XP_006589932.1|  PREDICTED: uncharacterized protein LOC102669251  75.1    2e-12   
ref|XP_006375665.1|  hypothetical protein POPTR_0014s19090g           77.0    2e-12   
ref|XP_009771646.1|  PREDICTED: uncharacterized protein LOC104222152  75.5    2e-12   
ref|XP_008391159.1|  PREDICTED: uncharacterized protein LOC103453396  77.8    2e-12   
ref|XP_006382571.1|  hypothetical protein POPTR_0005s034102g          76.6    3e-12   
ref|XP_009771374.1|  PREDICTED: uncharacterized protein LOC104221920  75.9    3e-12   
ref|XP_007011041.1|  Zinc finger, CCHC-type-like protein              74.3    3e-12   
ref|XP_002519021.1|  hypothetical protein RCOM_0935160                71.6    4e-12   
ref|XP_009782929.1|  PREDICTED: uncharacterized protein LOC104231611  74.3    4e-12   
ref|XP_009602967.1|  PREDICTED: uncharacterized protein LOC104098024  75.1    4e-12   
ref|XP_006371236.1|  hypothetical protein POPTR_0019s07150g           76.6    4e-12   
ref|XP_009765529.1|  PREDICTED: uncharacterized protein LOC104217071  73.9    4e-12   
ref|XP_006369230.1|  hypothetical protein POPTR_0001s19740g           76.6    5e-12   
ref|XP_009768740.1|  PREDICTED: uncharacterized protein LOC104219715  73.9    5e-12   
ref|XP_006376818.1|  hypothetical protein POPTR_0012s07200g           75.9    5e-12   
ref|XP_008779819.1|  PREDICTED: uncharacterized protein LOC103699577  73.6    5e-12   
ref|XP_008775395.1|  PREDICTED: uncharacterized protein LOC103695764  73.6    5e-12   
ref|XP_007163445.1|  hypothetical protein PHAVU_001G235200g           72.4    5e-12   
ref|XP_006375696.1|  hypothetical protein POPTR_0014s19730g           76.3    5e-12   
ref|XP_009590443.1|  PREDICTED: uncharacterized protein LOC104087618  73.9    5e-12   
ref|XP_008779875.1|  PREDICTED: uncharacterized protein LOC103699640  73.9    5e-12   
ref|XP_008780485.1|  PREDICTED: uncharacterized protein LOC103700314  73.6    5e-12   
ref|XP_009625578.1|  PREDICTED: uncharacterized protein LOC104116432  74.3    5e-12   
gb|KHN18973.1|  hypothetical protein glysoja_039897                   70.9    6e-12   
ref|XP_009788258.1|  PREDICTED: uncharacterized protein LOC104236092  73.2    6e-12   
ref|XP_006366516.1|  PREDICTED: uncharacterized protein LOC102585702  73.2    6e-12   
gb|KHN27042.1|  hypothetical protein glysoja_049797                   70.9    6e-12   
ref|XP_006376733.1|  hypothetical protein POPTR_0012s04950g           75.9    7e-12   
ref|XP_004490404.1|  PREDICTED: uncharacterized protein LOC101515175  72.4    7e-12   
ref|XP_009779359.1|  PREDICTED: uncharacterized protein LOC104228581  75.5    7e-12   
ref|XP_007199017.1|  hypothetical protein PRUPE_ppa017647mg           72.0    7e-12   
ref|XP_002526692.1|  conserved hypothetical protein                   73.2    7e-12   
ref|XP_004252199.1|  PREDICTED: uncharacterized protein LOC101262390  75.9    7e-12   
ref|XP_009603376.1|  PREDICTED: uncharacterized protein LOC104098367  75.1    1e-11   
ref|XP_009774916.1|  PREDICTED: uncharacterized protein LOC104224896  72.4    1e-11   
ref|XP_010693316.1|  PREDICTED: uncharacterized protein LOC104906278  75.1    1e-11   
ref|XP_006381742.1|  hypothetical protein POPTR_0006s16970g           71.6    1e-11   
ref|XP_010040885.1|  PREDICTED: uncharacterized protein LOC104429756  74.7    2e-11   
ref|XP_006375692.1|  hypothetical protein POPTR_0014s19680g           74.7    2e-11   
ref|XP_007207609.1|  hypothetical protein PRUPE_ppa018907mg           75.5    2e-11   
ref|XP_010696466.1|  PREDICTED: uncharacterized protein LOC104908989  72.8    2e-11   
ref|XP_010937343.1|  PREDICTED: uncharacterized protein LOC105056733  71.6    3e-11   
ref|XP_007027799.1|  Uncharacterized protein TCM_022639               74.3    3e-11   
ref|XP_010681228.1|  PREDICTED: uncharacterized protein LOC104896209  74.7    3e-11   



>ref|XP_006382338.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa]
 gb|ERP60135.1| hypothetical protein POPTR_0005s01170g, partial [Populus trichocarpa]
Length=270

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 144/222 (65%), Gaps = 9/222 (4%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +  EEK+R+R PWR++LII+V+G  V Y +LL+RL  +W+ + ++ L+DL  D++
Sbjct  56   CPVIRLFMEEKKRIREPWRQTLIIKVLGCRVSYTFLLKRLQIIWKIQGDLNLVDLGNDFF  115

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF ++ D + A   GPW + DHY+ ++ W PNF+       K+  W+R P L ++Y+D
Sbjct  116  LARFSNKEDRESAMSGGPWMVADHYLTMRSWHPNFDPNVATIEKVAVWIRLPDLAMEYYD  175

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
               LWKIG ++G+ +KVD+TTS+  RG +ARICV++D+TKPL SKF +      I Y GL
Sbjct  176  NTVLWKIGNHIGKTLKVDRTTSVHIRGNYARICVEVDLTKPLLSKFKLRRRIRHISYEGL  235

Query  841  HLVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIPAQE  966
            H++C  CG YG K EQ         ++  E G D  T+PA++
Sbjct  236  HMICFGCGQYGHKHEQV--------SSNNEKGRD-PTVPAED  268



>ref|XP_010666674.1| PREDICTED: uncharacterized protein LOC104883810 [Beta vulgaris 
subsp. vulgaris]
Length=298

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 169/295 (57%), Gaps = 13/295 (4%)
 Frame = +1

Query  19   MEPEVQDPLERTSKKTKRSE--ALLDQSVGAMGQDTIQTSSKPAEPVF--QASEGSLGGR  186
            +  E  D L+R++KK KR E  +  + +  +M  DT+ T+    + +   QA+ G  G R
Sbjct  12   LSSEENDLLQRSNKKFKRLECDSPTEGNDVSMVPDTMDTTLNLNKTISYSQAARGFGGSR  71

Query  187  LEYKQILKGQTCAKAAVWNYdeeevsddeddymqeddLCPRIPVTKEEKRRLRAPWRRSL  366
                 + +G+      +         + E D    D  CP I +T+EEKRR+R PW+ SL
Sbjct  72   ---NPLFEGEVPDSEII------SEDEQESDDDSGDLACPTIRLTREEKRRIRVPWKNSL  122

Query  367  IIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIF  546
            II++  + +GY+ L++RL + W  +  + LID+ + YYV RF +  DYDF   +GPW I 
Sbjct  123  IIKLFDKKLGYDVLMRRLKAKWTLKGEIALIDVGHAYYVVRFSNLEDYDFVLTQGPWMIG  182

Query  547  DHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTS  726
            + Y+ +++WVPNF         + AWVR P L V+YFD++ L KIG  +G  +K+D+ T+
Sbjct  183  ESYLTIKKWVPNFIADEAPIKTLTAWVRIPHLSVEYFDKQILHKIGSKIGNVIKIDRNTA  242

Query  727  LSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
               RG++ R C+++D++KPL SKF +    + I+Y GL ++C KCG  G K + C
Sbjct  243  SMDRGQYVRFCIEVDLSKPLLSKFKLNKRTWIIQYEGLKMICFKCGHLGHKEDNC  297



>ref|XP_010687130.1| PREDICTED: uncharacterized protein LOC104901276 [Beta vulgaris 
subsp. vulgaris]
Length=296

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 166/293 (57%), Gaps = 11/293 (4%)
 Frame = +1

Query  19   MEPEVQDPLERTSKKTKRSEALLDQSVGAMGQDTIQTSSKPAEPVF--QASEGSLGGRLE  192
            +  E  D L+R++KK KR E+  D    +M  +T++  +   + +   QA+ G  G R  
Sbjct  12   LSSEENDLLQRSNKKFKRVESPRDSLDVSMVPNTMEEENNLNKTISYSQATRGFGGLR--  69

Query  193  YKQILKGQTCAKAAVWNYdeeevsddeddymqeddLCPRIPVTKEEKRRLRAPWRRSLII  372
               + +G       + + +++   D  D        CP I +TKEEKRR+R PW+ SLII
Sbjct  70   -NPLFEGDATEVEHISDDEQDSKEDMGDSS------CPIIKLTKEEKRRIRVPWKNSLII  122

Query  373  RVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDH  552
            ++  + +GY  L++RL   W  +  + L D+ + YYV RF +  DYDF   +GPW I + 
Sbjct  123  KLFDKKLGYEVLMRRLREKWTLKGEITLTDVGHAYYVVRFSNMEDYDFVLTQGPWMIGES  182

Query  553  YIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLS  732
            Y+ +++WVPNF         + AWVR P L V+YFD++ L KIG  +G+ +K+D+ T+  
Sbjct  183  YLTIRKWVPNFIADEAPIKTLTAWVRIPHLSVEYFDKQILHKIGSKIGKVIKIDRNTASM  242

Query  733  KRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
             RG++ R C+++D++KPL SKF +    + I+Y GL ++C  CG  G K + C
Sbjct  243  DRGQYVRFCIEVDLSKPLLSKFKLNKRTWIIQYEGLKMICFSCGHLGHKEDNC  295



>emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=678

 Score =   204 bits (519),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 135/209 (65%), Gaps = 0/209 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +TKEEKRR+R PWR SLII++  R + Y+ L++RL   W  + ++ L D+ + YY
Sbjct  119  CPTIYLTKEEKRRIRHPWRNSLIIKLFDRRLSYDILVRRLKYKWNLKGDIALTDVGHAYY  178

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V RF +  DYDF   +GPW I D Y+ +++WVPNF        K+ AWVR P L V+YFD
Sbjct  179  VVRFNNMEDYDFVLTQGPWLIGDSYLTIRKWVPNFVSDQEPIKKLTAWVRIPHLSVEYFD  238

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            ++FL  IG  +G+ +K+D+ T    RG++ R C+++D++KPL SKF +  + + ++Y GL
Sbjct  239  KQFLHSIGSKIGKVIKIDRNTESMDRGQYVRFCIEVDLSKPLLSKFRLNGKVWIVQYEGL  298

Query  841  HLVCSKCGLYGQKREQCGLGRKEQKATGE  927
             L+C KCG  G K + C + + +QK   E
Sbjct  299  RLICFKCGHLGHKEDTCNVFKAQQKDNTE  327



>ref|XP_010689461.1| PREDICTED: uncharacterized protein LOC104903161 [Beta vulgaris 
subsp. vulgaris]
Length=353

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/204 (43%), Positives = 129/204 (63%), Gaps = 0/204 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +T+EEKRR+R+PWR +LII++  + +GY  L++RL+  W  +  + L D+ Y YY
Sbjct  104  CPTIHLTREEKRRIRSPWRNALIIKLFDKRLGYEVLMRRLNQKWSLKGQIALTDVGYAYY  163

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V RF +  DY+F   +GPW I D Y+ +++W PNF         + AWVR P L V+YFD
Sbjct  164  VVRFSNNEDYNFVLTQGPWMIGDSYLTIRKWTPNFVSDEAPIKTLTAWVRIPHLSVEYFD  223

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            +  L KIG  +G  +K+D+ T    RG++ R CV++D+TKPL SKF +    + I+Y GL
Sbjct  224  KHVLHKIGSKIGRVIKIDRNTESMDRGQYVRFCVEVDLTKPLLSKFKLNKRVWMIQYEGL  283

Query  841  HLVCSKCGLYGQKREQCGLGRKEQ  912
             ++C KCG  G K + C + R+ Q
Sbjct  284  KMICFKCGHLGHKEDGCPVFREPQ  307



>ref|XP_010689252.1| PREDICTED: uncharacterized protein LOC104902987 [Beta vulgaris 
subsp. vulgaris]
Length=370

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 130/198 (66%), Gaps = 2/198 (1%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +TKEEKRR+R PW+ SLII++  + +GY  L++RL + W  +  + L D+ + YY
Sbjct  101  CPIIRLTKEEKRRIRVPWKNSLIIKLFDKKLGYGVLMRRLKAKWTIKGEIALTDVGHAYY  160

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KIL-AWVRFPTLPVKYF  657
            V RF +  DYDF   +GPW I + Y+ +++WVPNF +A +   K L  WVR P L V+YF
Sbjct  161  VVRFSNLEDYDFVLTQGPWMIGESYLTIRKWVPNF-IADDAPIKTLTVWVRIPHLSVEYF  219

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            D++ L KIG  +G+ +K+D+ T+   RG++ R C+++D++KPL SKF +    + I Y G
Sbjct  220  DKQILHKIGSKIGKVIKIDRNTTSMDRGQYVRFCIEVDLSKPLLSKFKLNKRTWIIRYEG  279

Query  838  LHLVCSKCGLYGQKREQC  891
            L ++C KCG  G K + C
Sbjct  280  LKMICFKCGHLGNKEDSC  297



>gb|KDO38897.1| hypothetical protein CISIN_1g046520mg [Citrus sinensis]
Length=369

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/236 (38%), Positives = 144/236 (61%), Gaps = 15/236 (6%)
 Frame = +1

Query  331  KRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDY  510
            + +L  PW+ ++I++++GR++GY  L  +L SLWR E    +IDLE DYY+ RF ++ D 
Sbjct  2    QEQLVRPWKNTVIVKLLGRSIGYRSLCTKLESLWRVERGFTVIDLENDYYLVRFGTEEDV  61

Query  511  DFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKN  690
            +FA  +GPWTIF HY+ VQ+W P+F+  S++   ++AW+R P +P+ Y+ +  L  +G+ 
Sbjct  62   EFALTQGPWTIFGHYLTVQKWSPSFDCLSDKIETVVAWIRLPGMPLHYYHKRVLRILGEV  121

Query  691  VGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLY  870
            VG  +++D  T  +KRGKFAR+ V+I + KPL S+F +  +   IEY GL  +C +CG Y
Sbjct  122  VGRVIRIDYNTEAAKRGKFARVAVEICLNKPLVSQFQLNGKIQRIEYEGLPTICFECGKY  181

Query  871  GQKREQC-------------GLGRKEQKATGEEVGVDISTIPAQEDQLLGPQLIAT  999
            G   + C             G+ + E + TG  V VD +T+   ++ L GP +I  
Sbjct  182  GHTVDTCQWQQEVPRGQGCDGVQQPEGEGTG--VTVDPATVENPKNSLFGPWMIVA  235



>ref|XP_010682307.1| PREDICTED: uncharacterized protein LOC104897180 [Beta vulgaris 
subsp. vulgaris]
Length=322

 Score =   186 bits (471),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 129/203 (64%), Gaps = 0/203 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +++EEK+RLR PWR +LII++    +GY  L++RL   W  +  + L D+ ++Y+
Sbjct  24   CPVIQLSREEKQRLRKPWRHALIIKMFDAKIGYMSLMKRLKRKWELKGGLILTDIGHEYF  83

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF    DY+    +GPW + D+Y+ +++W+PNF   +     + AWVR P L V+YFD
Sbjct  84   IARFSDLSDYNHVLTQGPWVLDDNYLTIRKWIPNFIPDNTPMRFLTAWVRIPHLAVEYFD  143

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            +EFL K+G  +G+  ++D  T+L+ RG+F R+ V++D++KPL SKF +    + I+Y GL
Sbjct  144  QEFLKKVGNLIGKVARIDNNTALAHRGQFTRLSVELDLSKPLLSKFWLKGPIWKIQYEGL  203

Query  841  HLVCSKCGLYGQKREQCGLGRKE  909
             ++C  CG +G   E C     E
Sbjct  204  KMICFHCGKFGHSEENCSTNSME  226



>ref|XP_010680847.1| PREDICTED: uncharacterized protein LOC104895900 [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 126/199 (63%), Gaps = 0/199 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            C  I +TKEEK R+R PWR SL+I++    +GY  L++RL   W  +    L D+   YY
Sbjct  75   CLVILLTKEEKARMRKPWRNSLVIKMFDGKIGYMGLMRRLKKKWNIKGEFVLTDIACHYY  134

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            VARF ++ DY F   +GPW I D+Y+  ++WVPN     N    + AW+R P L V+YFD
Sbjct  135  VARFTNEADYQFFLTQGPWLIDDNYLTFRKWVPNLIPDENPIKVLTAWIRIPNLSVEYFD  194

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
              FL KIG   G+ ++VD+TT+ ++RG+F RI V+IDI+KPL SKF +  + + ++Y G+
Sbjct  195  VNFLNKIGSKFGKVLRVDKTTAQAERGQFTRISVEIDISKPLLSKFLLKGKVWKVQYEGI  254

Query  841  HLVCSKCGLYGQKREQCGL  897
            +++C KCG  G +   C +
Sbjct  255  NMICFKCGKMGHQNSNCHI  273



>ref|XP_010684905.1| PREDICTED: uncharacterized protein LOC104899417 [Beta vulgaris 
subsp. vulgaris]
Length=254

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 121/192 (63%), Gaps = 0/192 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I ++K+EKRR+R PW+ SLII++  + +GY  L++RL + W  +  + L D+ + YY
Sbjct  63   CPTIKLSKDEKRRIRIPWKNSLIIKLFDKKLGYEVLMRRLKAKWSLKGEIALTDVSHAYY  122

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V RF +  DYDF   +GPW I + Y+ + +WVPNF         +  WVR P + V+YFD
Sbjct  123  VVRFSNLDDYDFVLTQGPWMIGESYLTITRWVPNFISDEAPIKTLTVWVRIPHMSVEYFD  182

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            ++ L KIG  +G  +K+D+ T    RG++ R C+++D+TKPL SKF +    + I+Y GL
Sbjct  183  KQVLHKIGSKIGRVIKIDRNTKSMDRGQYVRFCIEVDLTKPLLSKFKLNKRAWIIQYEGL  242

Query  841  HLVCSKCGLYGQ  876
             ++C +CG  G 
Sbjct  243  KMICFECGHLGH  254



>ref|XP_010682321.1| PREDICTED: uncharacterized protein LOC104897196 [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/335 (33%), Positives = 180/335 (54%), Gaps = 20/335 (6%)
 Frame = +1

Query  7    DTSQMEPEVQDPLERTSKKTKRS--EALLDQSVGAMGQDTIQTSSKPAEPVFQASEGSL-  177
            + + + PE  D + R++KK KR     + D ++ A   + ++ S   A P  Q S+  L 
Sbjct  13   NDTDISPEESDQITRSNKKFKRKIMNWIFDNNL-ATDANMVEASPLVAPPGPQPSDAPLI  71

Query  178  --GGRLEYKQILKGQTCAK------AAVWNYdeeevsddeddymqeddLCPRIPVTKEEK  333
                   +K +LK +  +       +     DE    D   +  +++ LCP I ++K EK
Sbjct  72   QNAPPTSFKDMLKHRNFSNHVNPLHSFPEEEDEASDDDCAPEEFRDNPLCPAILLSKAEK  131

Query  334  RRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYD  513
             ++R PW+ +LI+++    +GY  L++RL   W  + +M + D+   +Y+ARF +Q DY 
Sbjct  132  VQMRRPWKFALILKMFNGKLGYMALMRRLKKKWSLKGDMTMTDIGCKFYIARFTNQDDYR  191

Query  514  FARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNV  693
                +GPW I D+Y+  ++WVPNF         ++AWVR P L V+YFD  FL KIG  +
Sbjct  192  HVLTQGPWMIEDNYLTNRKWVPNFIPDEAPIKVLIAWVRIPNLSVEYFDGNFLHKIGSKI  251

Query  694  GEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYG  873
            G+ +++D+TTS ++RG+F R+ V+ID TKPL SKF +    + ++Y GL L+C  CG +G
Sbjct  252  GKVLRIDKTTSNAERGQFTRLSVEIDPTKPLLSKFWLKGRIWKVQYEGLQLICFNCGCWG  311

Query  874  QKREQCGLGRKEQKATGEEVGVDISTIP--AQEDQ  972
                +C      Q     E  +D   IP  AQ D+
Sbjct  312  HSAHEC------QSHLNAEANMDQDAIPNNAQPDE  340



>ref|XP_010693748.1| PREDICTED: uncharacterized protein LOC104906660 [Beta vulgaris 
subsp. vulgaris]
Length=332

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 127/197 (64%), Gaps = 0/197 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +T+ EKRR+R PW+++LII++    VGY  L+++L   W  + ++ L D+ + Y+
Sbjct  130  CPCILLTRAEKRRMRHPWKQALIIKMFSGNVGYMGLMRKLKRKWSLKGDLSLTDIGHKYF  189

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF +  DY F   +GPW I D+Y+ +++WVPNF    +    +  WVR P L V+YFD
Sbjct  190  IARFTNPADYHFVLTQGPWMIDDNYLTIRKWVPNFIPDDSPMRFLTTWVRIPNLAVEYFD  249

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
              FL KIG  +G  +++D+TT+ ++RG+F R+ V+ID+ KPL SKF +    + I+Y G+
Sbjct  250  TNFLTKIGNKIGRVMRIDKTTAQAERGQFTRLSVEIDLAKPLLSKFWLRGRIWRIQYEGI  309

Query  841  HLVCSKCGLYGQKREQC  891
             LVC +CG  G +   C
Sbjct  310  RLVCYQCGKIGHQEADC  326



>ref|XP_007206580.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
 gb|EMJ07779.1| hypothetical protein PRUPE_ppa020297mg, partial [Prunus persica]
Length=346

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 129/226 (57%), Gaps = 2/226 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  ++  K  L  PWR S+II+++GR + YN+L  RL   W  +  M LIDLE +Y++
Sbjct  6    PSIIFSESIKDCLYRPWRTSVIIKLMGRPLTYNFLHARLLQRWALKGPMSLIDLENNYFI  65

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F  + D  +    GPW I   Y++ QQW P FNL   R   + AWVR   L V+YF  
Sbjct  66   VKFLLEEDMQYVLTGGPWQIAGQYLVTQQWKPGFNLKEERVTHMTAWVRINGLNVEYFRP  125

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + + KIG  +G  VKVD  T    RGKFARICV++D++KPL     +    Y + Y G+ 
Sbjct  126  DVMGKIGNLIGHTVKVDALTMSQARGKFARICVELDLSKPLVPFIKVEGRSYGVVYEGIK  185

Query  844  LVCSKCGLYGQKREQCGLGRKEQ-KATGEEVGVDIS-TIPAQEDQL  975
            LVC +CG YG  R+ C +  K + +A  +E+  D+    PA+ED L
Sbjct  186  LVCFECGCYGHGRDNCPVILKAKAQAAEDEIAKDMEVNTPAKEDDL  231



>emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=744

 Score =   181 bits (460),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 131/206 (64%), Gaps = 0/206 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            +  TKE   +LR PWR +L+ +V+G ++  N+L++R++ +W+    +E+IDL +D ++ +
Sbjct  108  VSFTKETLWKLREPWRNTLMGKVLGMSISRNFLVERVNRIWKTNDKVEVIDLGHDVFLFK  167

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F +  D + A F GPW I +HY+++ +W P+F  + +   KI+ W+RFP LP++Y+D+E 
Sbjct  168  FNNGNDMEKALFGGPWFILNHYLMLTRWKPDFRPSQSVFDKIMVWIRFPELPLEYYDKEA  227

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L+ I   VG+P+KVD  T    RG++AR+C+++D+ K L SK  +A     +EY  L LV
Sbjct  228  LFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAKALVSKVWVARAWQNVEYENLSLV  287

Query  850  CSKCGLYGQKREQCGLGRKEQKATGE  927
            C  CG  G +R+QC  G  EQ    E
Sbjct  288  CFLCGKIGHRRDQCSHGLGEQNRKNE  313



>ref|XP_011048782.1| PREDICTED: uncharacterized protein LOC105142718 [Populus euphratica]
Length=229

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 134/231 (58%), Gaps = 39/231 (17%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I ++ + K+R+R PWR++LII+V+G+ +GYNYLL+RL +L R + ++ L+DL  D++
Sbjct  23   CPLIKLSLDGKQRIRKPWRQTLIIKVMGKRIGYNYLLKRLQTLCRIQGDINLVDLGNDFF  82

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +A F +  D D+A F GPW +                              P L ++Y+D
Sbjct  83   LAMFSNSDDRDYALFGGPWIL------------------------------PDLAMEYYD  112

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
               LW+IG ++G+ +KVD+T+S+  RG  ARICV++D+TKP+ SKF +      + Y GL
Sbjct  113  TSVLWRIGDHIGKTLKVDRTSSVGTRGNCARICVEVDLTKPVLSKFKLRRTVRRVVYEGL  172

Query  841  HLVCSKCGLYGQKREQC---------GLGRKEQKATGEEVGVDISTIPAQE  966
            HL+CS+CG Y  K+E C         G  +++   + E   +++  +P +E
Sbjct  173  HLICSQCGTYTHKKEICPHVQHHNEDGRDKQQSGCSNEPEEMNLEVVPHEE  223



>ref|XP_007037791.1| Uncharacterized protein TCM_014510 [Theobroma cacao]
 gb|EOY22292.1| Uncharacterized protein TCM_014510 [Theobroma cacao]
Length=593

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 126/215 (59%), Gaps = 0/215 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  T+EEK R+  PW+ +LI++++GR + Y YL  R+  +W    + + +DLE   Y 
Sbjct  150  PYIQFTREEKLRIWKPWKNTLIVKLLGRNISYTYLCTRVKQMWALLGDFQAVDLENGLYC  209

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+++ DY     +GPW I DHY+ V++W   F         +  WV  P +P++Y+D 
Sbjct  210  FRFDNKSDYLQVLTDGPWIIADHYLTVRRWCLGFRSDEASVESVATWVCLPGMPLEYYDR  269

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            E L KIG  +G+ VK+D+TTS   +GKFAR+CV+ID+ KPL  K  I      IEY GL 
Sbjct  270  EILDKIGDRIGKSVKIDRTTSSQSKGKFARLCVEIDLKKPLIPKIFIGGRWQKIEYEGLK  329

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDIS  948
            ++C  C  +G   E C + ++E+K   EE  + +S
Sbjct  330  MLCFHCEKFGHSEEGCVMKQQEKKGLSEEQALKLS  364



>gb|KDO38231.1| hypothetical protein CISIN_1g041269mg [Citrus sinensis]
Length=578

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 124/199 (62%), Gaps = 0/199 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  ++    RL  PW  S++++ +GR +GY  + +RL  LW  +    +IDL  DYY+
Sbjct  75   PYIAFSQRVHDRLAKPWANSVVVKTLGRNLGYRVISERLKKLWGSKMGFSIIDLANDYYL  134

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+++ D ++A  EGPWTI  HY+ VQQW P+F+  +N+  +I+AW+R  ++ + ++ +
Sbjct  135  VRFQNEGDVEYALTEGPWTIMGHYLFVQQWTPDFDATTNKVDRIVAWIRLSSMNIHFYHK  194

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              + ++G+ VG  +K+D  T+ ++RGKFARI VQ+D+ KPL S+F        +EY  L 
Sbjct  195  TIIRRLGQIVGPVIKIDYLTAAAQRGKFARIAVQLDLEKPLVSQFNFEGRVQKVEYENLP  254

Query  844  LVCSKCGLYGQKREQCGLG  900
            ++C  CG +G  ++ C  G
Sbjct  255  MICFSCGKFGHYQDACPDG  273



>gb|KDO38287.1| hypothetical protein CISIN_1g044376mg [Citrus sinensis]
Length=578

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 121/199 (61%), Gaps = 0/199 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  ++    RL  PW  S++++ +GR +GY  + +RL  LW       +IDL  DYY+
Sbjct  75   PYIAFSQRVHDRLAKPWANSVVVKTLGRNLGYRVISERLKRLWSSTMGFSIIDLANDYYL  134

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+++ D ++A  EGPWTI  HY+ VQQW P F+  +NR  +I+AW+R   + + ++ +
Sbjct  135  VRFQNEGDVEYALTEGPWTIMGHYLFVQQWTPEFDATTNRVDRIVAWIRLSGMNIHFYHK  194

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              + ++G+ VG  +K+D  T+ ++RGKFARI VQ+D+ KPL S+F        +EY  L 
Sbjct  195  TIIRRLGQIVGPVIKIDYLTAAAQRGKFARIAVQLDLDKPLVSQFNFEGRIQKVEYENLP  254

Query  844  LVCSKCGLYGQKREQCGLG  900
            ++C  CG +G  ++ C  G
Sbjct  255  MICFCCGKFGHYQDACPDG  273



>gb|KHN33899.1| hypothetical protein glysoja_031761, partial [Glycine soja]
Length=212

 Score =   167 bits (422),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 116/198 (59%), Gaps = 0/198 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P + +       L APW+ +L+++++G+ +G+  +   L  +W+  A  +++D+   +
Sbjct  3    LKPIVHIDDSIFNGLCAPWQDALVVKLLGKNIGFQAMKDHLTRIWKLVAGFDILDIGNHF  62

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+ +F++  D       GPW IFDHY+ +Q W P+F   + +  K + WVRFP+L + Y+
Sbjct  63   YMVKFDTTEDRQKVIEGGPWMIFDHYLTIQTWTPDFISPTAKIDKTMVWVRFPSLNLIYY  122

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            DE  L  + + +G P+KVD  T   +RG FARICVQID+ KP+  K  +    Y +EY G
Sbjct  123  DENILLALARAIGTPIKVDSNTLDVRRGHFARICVQIDLNKPVVGKVGLKGYWYKVEYEG  182

Query  838  LHLVCSKCGLYGQKREQC  891
            LH +CS CG YG    +C
Sbjct  183  LHRICSSCGCYGHLAREC  200



>ref|XP_010520311.1| PREDICTED: uncharacterized protein LOC104799464 [Tarenaya hassleriana]
Length=548

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 124/201 (62%), Gaps = 4/201 (2%)
 Frame = +1

Query  337  RLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDF  516
            R+  PW+++L+++++G+T+ Y  +  RL +LW+P   + +IDLE ++++ RF+ + DY  
Sbjct  91   RITQPWKKALVVKLLGKTLSYKTMSSRLETLWKPMGRLTVIDLENEFFLVRFQKEEDYQR  150

Query  517  ARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVG  696
            A  EGPW I   Y+ VQ W P+F  +  +   ++AW+RFP +P++Y+    L  I  N+G
Sbjct  151  ALCEGPWVILGAYLTVQCWSPDFVPSQAKPSHVVAWIRFPAMPIQYYHAALLEIIAGNIG  210

Query  697  EPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQ  876
              ++VD  T  + RG+FAR+ V++D++KPL S F I      +EY  L  +C  CG+ G 
Sbjct  211  RVIRVDYNTVSASRGRFARVAVELDLSKPLISSFEIEGLTQLVEYENLPTICFSCGVIGH  270

Query  877  KREQCGLGRKEQKATGEEVGV  939
             +EQC     +Q+ +GE  G+
Sbjct  271  LKEQCS----KQRTSGEPEGI  287



>ref|XP_010682918.1| PREDICTED: uncharacterized protein LOC104897680 [Beta vulgaris 
subsp. vulgaris]
Length=452

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 121/194 (62%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            +  +KE+  +LR PW  +L+ + +G +V  +++ QR+ S+W+P   +E+IDL  D Y+ R
Sbjct  81   VQFSKEKLSQLRKPWGLTLMGKCLGISVRPSFITQRVRSMWKPRGTLEVIDLGKDTYLFR  140

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  Q DY+ A F GPW + DHY++V QW PNF    N    +  W+  P LPV+Y+D+E 
Sbjct  141  FSLQDDYERALFGGPWYVLDHYLMVTQWQPNFRPTHNPFGSMAVWIHLPELPVEYYDKEA  200

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L+ I   +G+P++VD  T+   R ++ARIC++I+++KP+ SK  I  +   I Y  LH +
Sbjct  201  LFAIASKLGKPIRVDYATNHITRARYARICIEINLSKPIISKIWIGNQWQVILYENLHSL  260

Query  850  CSKCGLYGQKREQC  891
            C  CG  G ++ QC
Sbjct  261  CFVCGGIGHQKNQC  274



>gb|KDO58401.1| hypothetical protein CISIN_1g046952mg, partial [Citrus sinensis]
Length=428

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 121/196 (62%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +     RL  PW  S++++++G  +GY  L  RL+ +W   +  ++IDL  DY++
Sbjct  28   PYIAFSSRVHDRLAEPWVNSVVVKILGHNLGYRVLCSRLNKIWSSTSGFDIIDLANDYFL  87

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF + +D ++A  EGPWT+  HY+ VQQW P F++ +N+  +I+AW+R   + + ++ +
Sbjct  88   IRFSNAQDVEYALTEGPWTVLGHYLSVQQWTPKFDVVNNKIDRIVAWIRLSEMNIHFYHK  147

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              + ++G+ +G  +K+D  T  ++RGKFAR+ V++D+ KPL S+F +      +EY  L 
Sbjct  148  NIIRRLGQIIGPVIKIDSNTVAAQRGKFARLAVELDLQKPLVSQFNLEGRIQKVEYENLP  207

Query  844  LVCSKCGLYGQKREQC  891
            ++C  CG +G  ++ C
Sbjct  208  MICFGCGKFGHYKDAC  223



>ref|XP_003604996.1| hypothetical protein MTR_4g022640 [Medicago truncatula]
Length=513

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 117/199 (59%), Gaps = 0/199 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P+I +     + L  PW+ +L+++++G+ +GYN +  RL  +W+ ++  E++D +  +
Sbjct  66   LLPKIYLEPTTFQELCTPWKDALVVKLLGKNLGYNTMKDRLQRIWKLQSGFEIMDNDNGF  125

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+ +F+ + D +     GPW IFDH + V  W P F     R  + + WVRFP L + Y+
Sbjct  126  YMVKFDQEADKEKVVTGGPWMIFDHCLAVTHWSPEFASPEARVERTVVWVRFPGLNLVYY  185

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            DE FL  +   +G P+KVD  T   +RGKFAR+CV+ID+T P+  K  +    Y I+Y G
Sbjct  186  DESFLLAMASAIGRPIKVDTNTLKVERGKFARVCVEIDLTVPVVGKIWVNGHWYKIQYEG  245

Query  838  LHLVCSKCGLYGQKREQCG  894
            LHL+C+ CG YG     C 
Sbjct  246  LHLICTNCGCYGHLGRNCN  264



>ref|XP_010684563.1| PREDICTED: uncharacterized protein LOC104899126 [Beta vulgaris 
subsp. vulgaris]
Length=242

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 123/198 (62%), Gaps = 1/198 (1%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            C  I ++KEEK ++R P R S+II++    VGY  L+++L   W  + ++ L D+  +++
Sbjct  40   CLIILLSKEEKIQMRKPSRHSMIIKMFNGKVGYMGLMRKLKKKWSLKGDLVLTDIGCNFF  99

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF +  DY      GPW I D+Y+ +++W PNF +A      + AWVR   L V+YFD
Sbjct  100  IARFTNAIDYHHVLTRGPWMIDDNYLTIRKWTPNF-VAEAPIKVLTAWVRILNLSVEYFD  158

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
              FL K+G  + + +++D+TT+ ++RG+F R+ ++ID+TKPL SKF +    + I+Y GL
Sbjct  159  RNFLHKVGSKISKVLRIDKTTAQAERGQFTRLSIEIDLTKPLLSKFWLKGRVWKIQYEGL  218

Query  841  HLVCSKCGLYGQKREQCG  894
            H +C  CG +G   + C 
Sbjct  219  HAICFNCGCWGHNAKDCA  236



>gb|KDO37843.1| hypothetical protein CISIN_1g047084mg, partial [Citrus sinensis]
Length=437

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 125/220 (57%), Gaps = 3/220 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +K  + +L  PW+ S++++++GR +GY  L  RL  +W    +  +IDLE +Y++
Sbjct  195  PTIKFSKRIQDKLIKPWQNSVVVKLLGRNIGYKVLCNRLKVMWHQIHDFSVIDLENNYFL  254

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             R +S  D  +A  EGPW IF HY+ VQ W P F+  +      + W+R P +    +D+
Sbjct  255  IRLKSPEDAVYALTEGPWVIFGHYLTVQPWTPQFDSTTTDLDSAIVWIRLPGMAFHLYDK  314

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L KIG+ VG  +K+D  T+L +RGKFARI V+I +++PL S+F I  +   +EY GL 
Sbjct  315  RILRKIGQLVGNVIKIDYHTALRERGKFARIAVRISLSQPLLSRFNIDGKIQKVEYEGLP  374

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIPAQ  963
            ++C +CG YG     C   + +QK      G   + IP  
Sbjct  375  IICYQCGKYGHNSIVC---QSKQKMNEANNGYSENIIPTN  411



>ref|XP_003630108.1| hypothetical protein MTR_8g091870 [Medicago truncatula]
Length=423

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 118/199 (59%), Gaps = 0/199 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P++ +  +  + L  PW+ +L+++++ + +GYN + +RLH +W+ +   E++D +  +
Sbjct  17   LLPKVYLEPQIFQELCTPWKDALVVKLLRKNLGYNTMKERLHKVWKTQGGFEIMDNDNGF  76

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+ +F+   D +     GPW IFDH ++V  W P F   + +  + + WVRFP L + Y+
Sbjct  77   YMVKFDQTSDKEKVITGGPWMIFDHCMVVAHWSPEFASPNAKVERTVVWVRFPGLNLVYY  136

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            DE FL  +   +G P+KVD  T   +RGKFAR+CV+ID+T P+  K  +    Y I+Y  
Sbjct  137  DENFLLAMASAIGRPIKVDTNTLNVERGKFARVCVEIDLTAPVVGKIWVNGHWYKIQYEW  196

Query  838  LHLVCSKCGLYGQKREQCG  894
            LHL+C+ CG  G  R  C 
Sbjct  197  LHLICTNCGCCGHLRRNCS  215



>dbj|BAE79383.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/249 (36%), Positives = 144/249 (58%), Gaps = 18/249 (7%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P +  +K  ++ L   WR +LI++ +G+ +  N L QR  SLW+ +  +++ID+ +  +V
Sbjct  84   PVVKFSKALRQELCREWRMALIVKYLGKNLTANVLNQRAPSLWQLKGRVQIIDIGFGCFV  143

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ ++DY     +GPW IFD+Y+I Q+WVPNF   + +  K+  WVR P L ++YF +
Sbjct  144  MRFDDKKDYLHVLLDGPWKIFDNYLITQRWVPNFEPRTAKFQKMAVWVRLPELSMEYFRD  203

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + +  I +N+G+P+++D+TT   ++G+FAR  V+ID+ KPL S+  +  +   +EY GLH
Sbjct  204  DTIKAILENIGKPLRLDRTTMAREKGRFARAAVEIDLGKPLVSEIWVMGDVQKVEYEGLH  263

Query  844  LVCSKCGLYGQKREQCGLGR---KEQKATGE--------------EVGVDISTIPAQEDQ  972
            +VC  CG+ G + + C L R    E  ATG               E   D  T PA E +
Sbjct  264  VVCFGCGVVGHREQACPLARPTAPETMATGSNTETAADTAEPQPAEGPADAVTQPA-ERR  322

Query  973  LLGPQLIAT  999
              GP +I T
Sbjct  323  RYGPWMIVT  331



>ref|XP_010690660.1| PREDICTED: uncharacterized protein LOC104904165 [Beta vulgaris 
subsp. vulgaris]
Length=442

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/204 (34%), Positives = 132/204 (65%), Gaps = 0/204 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            +  +KE+ + LR PWR +L+ +V+G  +  N+L+ R++ +W+ +  +E+IDL    ++ +
Sbjct  112  VSFSKEKLQSLREPWRNTLMAKVLGMPINRNFLVDRVNRMWKTKDRLEVIDLGQGIFLLK  171

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F +  D + A +  PW I +HY+++ +W P+F  +S+   KI+ W+RFP LP++Y++++ 
Sbjct  172  FHNSDDMERALYGSPWFILNHYLMLTKWKPDFRPSSSSFDKIMVWIRFPELPLEYYEKDA  231

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L+ I + VG+P+KVD  T    RG++AR+C++++++K L ++  +A     +EY  L LV
Sbjct  232  LFAIAEKVGKPIKVDYATDTVVRGRYARVCIELELSKALVTRVWVAKAWQTVEYENLDLV  291

Query  850  CSKCGLYGQKREQCGLGRKEQKAT  921
            C KCG  G +++QC +  ++ K  
Sbjct  292  CFKCGRIGHRQDQCLMKTEKNKGV  315



>ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula]
 gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula]
Length=504

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 118/198 (60%), Gaps = 0/198 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P+I +  +  + L  PW+ +L+++++G+++GYN +  RL  +W+ +   +++D +  +
Sbjct  69   LLPKIYIEPQTFQELCTPWKDALVVKLLGKSLGYNTMKDRLQKIWKLQGGFDIMDNDNGF  128

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++ +F+   D +     GPW IFDH + V  W P F   + +  + + WVRFP L + Y+
Sbjct  129  FMVKFDQAADKEKVITGGPWLIFDHCLAVTHWTPEFASPNAKVDRTVVWVRFPGLNLVYY  188

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            DE FL  +   +G P+KVD  T   +RGKFAR+CV+ID+T P+  K  +    Y ++Y G
Sbjct  189  DESFLLAMASALGRPIKVDTNTLKVERGKFARVCVEIDLTVPVVGKIWVNGHWYKVQYEG  248

Query  838  LHLVCSKCGLYGQKREQC  891
            LHL+C+ CG YG     C
Sbjct  249  LHLICTNCGCYGHLGRNC  266



>gb|KDO70278.1| hypothetical protein CISIN_1g046866mg, partial [Citrus sinensis]
Length=583

 Score =   169 bits (429),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 121/196 (62%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  + +   RL  PW  S++++ +GR +GY  L  RL+ +W      E+IDL  DY++
Sbjct  78   PFIAFSSKVHERLVEPWENSVVVKTLGRNLGYRVLSSRLNMIWSSTTGFEIIDLANDYFL  137

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF +++D ++A  EGPWT+  HY+ VQ+W P+F++ +N+   I+AW+R   + ++++ +
Sbjct  138  IRFNNKKDVEYALTEGPWTVMGHYLSVQKWSPDFDVVNNKINHIVAWIRLSQMNIQFYHK  197

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              + ++G  +G  +K+D  T  ++RGKFAR+ V++D+ KPL S+F +      +EY  L 
Sbjct  198  SIIRRLGHIIGPVIKIDNNTITAQRGKFARLAVELDLQKPLVSQFNLEGRIQKVEYENLP  257

Query  844  LVCSKCGLYGQKREQC  891
             +C  CG +G  ++ C
Sbjct  258  TICFGCGKFGHFKDTC  273



>ref|XP_010680872.1| PREDICTED: uncharacterized protein LOC104895924 [Beta vulgaris 
subsp. vulgaris]
Length=225

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 107/168 (64%), Gaps = 0/168 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I ++K EKRR+R+PW+ ++II++  R +GY  L+ RL    + + N+ L  + + +Y
Sbjct  56   CPNIVLSKAEKRRIRSPWKNAIIIKLFDRKMGYEVLMHRLRFKCQLKGNIALTVVGHSFY  115

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V RF S  DYDF   +GPW I D Y+ +++W+PNF         + AWVR P L V+YFD
Sbjct  116  VVRFTSVEDYDFVMTQGPWMIGDTYLTIRKWIPNFTADKAPMRHLTAWVRIPNLSVEYFD  175

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTI  804
            +  L KIG  +G+ +K+D+ T    RG++ R C+++DI KPL SKF +
Sbjct  176  KLILHKIGSKIGKVIKIDRNTESMDRGQYVRFCIEVDIAKPLLSKFKL  223



>ref|XP_007208943.1| hypothetical protein PRUPE_ppb015526mg, partial [Prunus persica]
 gb|EMJ10142.1| hypothetical protein PRUPE_ppb015526mg, partial [Prunus persica]
Length=594

 Score =   169 bits (428),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 126/217 (58%), Gaps = 0/217 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  + +   RL  PW+ +LII+++GR+  YNYL  RL+  W      +LIDL  DYYV
Sbjct  157  PSIQFSDKAMDRLCRPWKNALIIKLLGRSHTYNYLRDRLNQKWSLRGEWKLIDLVNDYYV  216

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +FE + D +F    GPW I   Y+++Q+W P F  A+ +  ++  W+R   + ++ FD 
Sbjct  217  VKFELEEDLNFVLTGGPWIIAGQYLVMQKWRPGFCPATAQITRMAVWLRVSAIQLECFDV  276

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L ++G  +G+ +K+D  T+   RGKFAR+CV++D+TKPL +   I    Y IEY GL 
Sbjct  277  WSLKRVGNLLGKLLKIDSLTTAQNRGKFARLCVELDLTKPLDAFVQINQNWYNIEYEGLP  336

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTI  954
             +C  CG YG KRE+C L  K+ +    E     ST+
Sbjct  337  DICYLCGRYGHKREKCELNVKDVETVNGETTTTRSTV  373



>ref|XP_010667256.1| PREDICTED: uncharacterized protein LOC104884318 [Beta vulgaris 
subsp. vulgaris]
Length=236

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I ++KEEK ++R PWR +LI+++    +GY  L++RL   W  +  M L D+   +Y
Sbjct  71   CPAILLSKEEKIQMRKPWRSALILKMFNGKLGYMALMRRLKKKWNLKGGMVLTDIGCKFY  130

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF +  DY +   +GPW I DHY+ +++W+PNF         + AWVR P L V+YFD
Sbjct  131  IARFTNMEDYQYVLTQGPWMIEDHYLTIRKWIPNFIPDEAPIKVLTAWVRIPNLSVEYFD  190

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKF  798
              FL KIG  +G+ +++D+TTS +++G+F R+ V+ID++KPL SKF
Sbjct  191  SNFLHKIGAKIGKVLRIDKTTSNAEQGQFTRLSVEIDLSKPLLSKF  236



>ref|XP_010425860.1| PREDICTED: uncharacterized protein LOC104710904 [Camelina sativa]
Length=274

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 114/191 (60%), Gaps = 0/191 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + + ++    +   W++ +I++V+GR+V    L +RL  LW+P   M ++DL + +++
Sbjct  84   PVVTIGEDVLEAMNGLWKQCMIVKVLGRSVPVAVLHRRLRELWKPSREMFVMDLPHQFFM  143

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              FES+ DY  A   GPWTIF  Y++VQ W P+F+   ++      WVR   +P+ ++  
Sbjct  144  VWFESEEDYMAALTGGPWTIFGSYLLVQAWSPDFDPLRDKITTTPVWVRLSNIPLNFYHR  203

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P+KVD  TS  +R +FARICV++D+  PL+    I  E+Y + Y GL 
Sbjct  204  SILMAIAKGLGKPLKVDLITSNLERARFARICVEVDLKNPLKGTVLINGERYYVSYEGLS  263

Query  844  LVCSKCGLYGQ  876
             +CS CGLYG 
Sbjct  264  TICSSCGLYGH  274



>emb|CAB10338.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78602.1| hypothetical protein [Arabidopsis thaliana]
Length=655

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 123/223 (55%), Gaps = 0/223 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + KE    +   +++ ++++++GR      L ++L  LWRP   M ++DL   +++
Sbjct  76   PVITIEKEVLDAMNGLYKQCMLVKILGRHTTIEVLSRKLRDLWRPTGGMSVLDLPRQFFM  135

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + DY  A   GPW +    ++VQ W P FN   +       WVR   LPV ++  
Sbjct  136  VRFEVEEDYMMALTGGPWRVLGSILMVQAWSPEFNPLRDVIETTPVWVRVANLPVTFYHN  195

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            E L  I   +G+P+KVD TT   +RG+FAR+CV++++  PL+    +  E+Y + Y GL 
Sbjct  196  EILLGIAAGLGKPIKVDLTTLRKERGRFARVCVEVNLKNPLKGTLVVNGERYFVSYEGLQ  255

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIPAQEDQ  972
             +CS CG+YG     C +GR  Q +   E G++I +  + ++Q
Sbjct  256  TICSLCGIYGHTVNNCPMGRTTQGSQRSEQGMEIVSSASTQNQ  298



>ref|XP_008238489.1| PREDICTED: uncharacterized protein LOC103337115 [Prunus mume]
Length=1198

 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 122/210 (58%), Gaps = 0/210 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +     RL  PW+ +LII+++GR+  YNYL  RLH  W  +   +LIDL  DY+V
Sbjct  104  PSIQFSDRAMDRLCRPWKNALIIKLLGRSHTYNYLRDRLHQKWSLKGEWKLIDLVNDYFV  163

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +FE + D +F    GPW I   Y+++Q+W P F  A+    ++  W+R   + ++ FD 
Sbjct  164  VKFELEEDLNFVLTGGPWIIAGQYLVMQKWRPGFCPATAHITRMAVWLRVSAIQLECFDV  223

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L ++G  +G+ +K+D  T+   RGKFAR+CV++D+TKPL +   I    Y IEY GL 
Sbjct  224  WSLKRVGNLLGKLLKIDSLTTAQNRGKFARLCVELDLTKPLDAFVQINQNWYNIEYEGLP  283

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEV  933
             +C  CG YG KRE+C L  K+ +    E 
Sbjct  284  DICYLCGRYGHKREKCDLNTKDAETVNGET  313



>ref|XP_009786058.1| PREDICTED: uncharacterized protein LOC104234221 [Nicotiana sylvestris]
Length=447

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 120/206 (58%), Gaps = 2/206 (1%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP+T E+K RL   W  +LI++V GR V Y +L ++L ++W+P   + LIDL YDYY+ +
Sbjct  101  IPITSEDKERLYRNWETTLIVKVFGRRVRYQFLQRKLQAIWKPNETIFLIDLGYDYYLIK  160

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILA-WVRFPTLPVKYFDEE  666
            F  Q +Y+ A  EGPW I + +  +++W P F +AS  +    A W R P LP +++D E
Sbjct  161  FNKQENYNKAFHEGPWFIGNQFFTIRKWEPRF-VASEASLTYSAIWARLPELPTEFYDYE  219

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHL  846
             L KIG  +GE +++D  TS + RGK+ R+C+ + I KPL++   +      I Y G ++
Sbjct  220  ILQKIGNKLGELIRIDACTSSALRGKYVRLCILVPIEKPLKTHIILGKHNQKITYEGFNV  279

Query  847  VCSKCGLYGQKREQCGLGRKEQKATG  924
            +C+ CG  G     C   R E +   
Sbjct  280  LCTNCGRLGHNLISCPNKRIETQNNN  305



>ref|XP_009779035.1| PREDICTED: uncharacterized protein LOC104228289 [Nicotiana sylvestris]
Length=444

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 131/223 (59%), Gaps = 3/223 (1%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++ EEK RL  PW  ++II+V GR V +  L Q++++LW+P  N+ LIDL  D+++ +
Sbjct  59   IPISVEEKYRLYKPWENAVIIKVYGRKVEHQLLRQKVYALWKPTENLPLIDLGSDFFLLK  118

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+ + +   A   GPW + +H++ V+QW P F  +  +      W+R P LP +++D   
Sbjct  119  FQKEENKVHALRGGPWFVLNHFLSVRQWEPKFKASETQLTSSAIWLRLPELPTEFYDYHI  178

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G+ VG+ + +D  TS + RG++AR+CV++ + +PL++   I   K  I Y GL+L+
Sbjct  179  LKKLGQKVGKFLSMDVCTSNTTRGQYARLCVEVLLNQPLKTHLYIGDHKQTILYEGLNLL  238

Query  850  CSKCGLYGQKREQCGLGRKEQKATG---EEVGVDISTIPAQED  969
            C  CG  G  +  C    K   +T    +E  + ++   AQE+
Sbjct  239  CITCGCMGHNQRTCPSTGKITPSTDNAKQEQNMSVTRANAQEE  281



>dbj|BAE79381.1| unnamed protein product [Ipomoea batatas]
Length=532

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/223 (36%), Positives = 133/223 (60%), Gaps = 3/223 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P +  +K  ++ L   WR +LI++ +G+ +  N L QR  SL + +  +++ID+ +  +V
Sbjct  84   PVVKFSKALRQELCREWRMALIVKYLGKNLTANVLNQRAPSLRQLKGRVQIIDIGFGCFV  143

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ ++DY     +GPW IFD+Y+I Q+WVPNF   + +  K+  WVR P L ++YF +
Sbjct  144  MRFDDKKDYLHVLLDGPWKIFDNYLITQRWVPNFKPRTAKFQKMAVWVRLPELSMEYFRD  203

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + +  I +N+G+P+++D+TT   ++G+FAR  V+ID+ KPL S+  +  +   +EY GLH
Sbjct  204  DTIKAILENIGKPLRLDRTTMAREKGRFARAAVEIDLDKPLVSEIWVMGDVQKVEYEGLH  263

Query  844  LVCSKCGLYGQKREQCGLGR---KEQKATGEEVGVDISTIPAQ  963
            +VC  CG+ G + + C L R    E  ATG        T   Q
Sbjct  264  VVCFGCGVVGHREQACPLARPTAPETMATGSNTETAADTAEPQ  306



>ref|XP_006299881.1| hypothetical protein CARUB_v10016088mg, partial [Capsella rubella]
 gb|EOA32779.1| hypothetical protein CARUB_v10016088mg, partial [Capsella rubella]
Length=340

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 114/203 (56%), Gaps = 0/203 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + V  E    +   WRR +I++V+GR+V  + L +RL  LW+P   M ++DL   +++
Sbjct  61   PVVTVGAEVLEVMNGLWRRCMIVKVLGRSVSVSVLSRRLRDLWKPAGAMHVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F   ++ Q W P+F+   +       W+R   LPV ++ +
Sbjct  121  IRFEKEEEYMAALTGGPWRVFGSCLLTQAWSPSFDPLRDEITTTPVWIRLSNLPVNFYHQ  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G P+KVD TT   +R +FARICV++D+  PL+    I  E+Y + Y GL 
Sbjct  181  FILMGIAEGLGTPIKVDLTTLQFERARFARICVEVDLKNPLKGTILINGERYFVSYEGLT  240

Query  844  LVCSKCGLYGQKREQCGLGRKEQ  912
             +CSKCG+YG     C L  KE 
Sbjct  241  TICSKCGMYGHLVHACPLVVKEN  263



>ref|XP_006286839.1| hypothetical protein CARUB_v10003838mg, partial [Capsella rubella]
 gb|EOA19737.1| hypothetical protein CARUB_v10003838mg, partial [Capsella rubella]
Length=391

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 115/207 (56%), Gaps = 0/207 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W+R +I++V+GR V    L +RL  LWRP  +M ++DL   +++
Sbjct  61   PVITIGAEVIEAMHGLWKRCMIVKVLGRNVPVAVLSRRLKELWRPSRDMVVVDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFES  +Y  A   GPW +F  Y++VQ W P+F+   +       WVR   +PV ++  
Sbjct  121  VRFESDDEYLAALTGGPWKVFGSYLMVQAWSPDFDPVRDELEMTPVWVRLSNIPVSFYHT  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G+P+KVD TT+   R +FAR+CV++++  PL+    I  E+Y + Y GL 
Sbjct  181  TILMGIAEGLGKPIKVDLTTTNFSRARFARVCVEVNLKMPLKGSVMINGERYYVSYEGLS  240

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATG  924
             +CS CGLYG     C    KE+   G
Sbjct  241  TICSCCGLYGHLVHTCPSAVKERAPEG  267



>ref|XP_007208970.1| hypothetical protein PRUPE_ppb020897mg [Prunus persica]
 gb|EMJ10169.1| hypothetical protein PRUPE_ppb020897mg [Prunus persica]
Length=575

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 116/198 (59%), Gaps = 0/198 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +     R   PWR +LII+++G++  YNY+  RL   W  +   +LIDL  DYYV
Sbjct  105  PSIQFSNRAMDRFCKPWRNALIIKLLGKSHTYNYIHARLQQKWSLKGAWKLIDLVNDYYV  164

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F+ + D +F    GPW +   Y+++Q+W P F  A+    ++ AW+R   + ++ FD 
Sbjct  165  VKFDLEEDLNFVLTSGPWIVAGQYLVMQKWRPGFCPATAHITRMAAWLRVSAIQLECFDV  224

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L +IG  +G+ +K+D  T+   RGKFAR+CV++D+TKPL +   I    Y IEY GL 
Sbjct  225  WSLKRIGNMLGKLLKIDSLTTAQNRGKFARLCVELDLTKPLEAFVQINQNWYNIEYEGLP  284

Query  844  LVCSKCGLYGQKREQCGL  897
             +C  CG YG KRE C L
Sbjct  285  DICYHCGRYGHKRENCEL  302



>emb|CDX88033.1| BnaA06g26240D [Brassica napus]
Length=508

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 115/196 (59%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    + + W+R +I+RV+GR V    L ++L  LW+P  +M ++DL  ++++
Sbjct  61   PVITIGEEVLTAMNSLWKRCMIVRVLGRNVPLLSLTRKLKELWKPNGSMFVMDLPRNFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFES+ +Y  A   GPW  F  Y++VQ W P+F+   +       WVR   +PV ++ +
Sbjct  121  VRFESEEEYMNALSGGPWRAFGSYLMVQAWTPDFDPLRDEIVTTPVWVRLSHIPVNFYHK  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G P+KVD TT   +R +FARICV++++ KPL+    I  E+Y + Y G+ 
Sbjct  181  TILMGIAKGLGRPIKVDLTTLKFERARFARICVEVNLNKPLKGTVMINGERYCVSYEGIS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG+YG     C
Sbjct  241  TICSTCGMYGHLAHAC  256



>ref|XP_009151454.1| PREDICTED: uncharacterized protein LOC103874766 [Brassica rapa]
Length=510

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 115/196 (59%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    + + W+R +I+RV+GR V    L ++L  LW+P+ +M ++DL   +++
Sbjct  61   PEITIGEEVLTTMNSLWKRCVIVRVLGRNVPILSLTRKLKELWKPKGSMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A  +GPW  F  Y++VQ W P F+   +       WVR   +PV ++ +
Sbjct  121  VRFEKEEEYMTALADGPWRAFGSYLMVQAWTPEFDPLKDEIDTTPVWVRLSHIPVNFYHK  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G P+KVD TT   +R +FARICV++++ KPL+    I  E+Y + Y G+ 
Sbjct  181  TILMGIAKGLGRPIKVDLTTLKFERARFARICVEVNLNKPLKGSVLINGERYFVSYEGIS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CSKCG+YG     C
Sbjct  241  AICSKCGMYGHLVYTC  256



>ref|XP_006490008.1| PREDICTED: uncharacterized protein LOC102624085 [Citrus sinensis]
Length=1635

 Score =   168 bits (425),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 121/212 (57%), Gaps = 0/212 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            + P I  +   + +L  PW+ S++++++GR +GY  L  RL S+W+P     +IDLE +Y
Sbjct  86   VMPSIKFSARIQEKLIQPWKNSVVVKLLGRNIGYKALCARLASMWKPSMGYSVIDLENNY  145

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++ RF +  D   A   GPW I  HY+ VQQW P F+        +  W+R P L +  +
Sbjct  146  FLVRFRNAGDALDALTRGPWIILGHYLTVQQWTPEFDSKVTDFDYVNVWIRLPGLGLHLY  205

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
             ++ L +IGK VGE +K+D +T  S RGKFAR+ V+I + KPL S+  +      IEY G
Sbjct  206  HQKTLNRIGKLVGEVIKLDDSTESSTRGKFARVAVRISLAKPLVSQVELNGRIQKIEYEG  265

Query  838  LHLVCSKCGLYGQKREQCGLGRKEQKATGEEV  933
            L ++C KCG YG    +C    +  +  GEE+
Sbjct  266  LPVICFKCGRYGHNSGECSANMQNGQPGGEEI  297



>gb|KDO60122.1| hypothetical protein CISIN_1g045711mg [Citrus sinensis]
Length=504

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 117/210 (56%), Gaps = 0/210 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            + P I  +   + +L  PW+ S++++++G+ +GY  L  RL S+W+P     +IDLE +Y
Sbjct  52   VMPYITFSARIQEKLIQPWKNSVVVKLLGKNIGYRALCARLASMWKPSMGFSVIDLENNY  111

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+ RF +  D   A  +G W I  HY+ VQ W  +F+  +      + W+R P L +  +
Sbjct  112  YLIRFRAAGDAIDALTKGSWIILGHYLTVQPWTLDFDSKTTDLIHAVVWIRLPGLAMHLY  171

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
             ++ L KIG  VGE +K D  T LS RGKFARI V+I + +PL S+  I      IEY G
Sbjct  172  HQKTLQKIGHLVGEVIKFDDNTKLSTRGKFARIAVRISLVQPLVSQVKINGRVQKIEYEG  231

Query  838  LHLVCSKCGLYGQKREQCGLGRKEQKATGE  927
            L ++C KCG YG   + C     +   TG+
Sbjct  232  LPVICFKCGRYGHHSDTCSSNTNDGNPTGD  261



>ref|XP_003609254.1| hypothetical protein MTR_4g113700 [Medicago truncatula]
Length=484

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 116/198 (59%), Gaps = 0/198 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P+I +  +  + L   W+ +L+++++G+++GY  + +RL   W+ +   +++D +  +
Sbjct  69   LLPKIYIEPQVFQELCTTWKDALVVKLLGKSLGYTTMKERLQKTWKLQGGFDIMDNDNGF  128

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+ +F+   D +     GPW IFDH + V  W P F   + +  + + WVRFP L + Y+
Sbjct  129  YMVKFDQAADKEKVITGGPWLIFDHCLAVTHWSPEFASPNAKVDRTVVWVRFPGLNLVYY  188

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            DE  L  +   +G+P+KVD  T   +RGKFAR+CV+ID+T P+  K  +    Y ++Y G
Sbjct  189  DESLLLAMATTLGQPIKVDTNTLKVERGKFARVCVEIDLTVPVVGKIWVNGHWYKVQYKG  248

Query  838  LHLVCSKCGLYGQKREQC  891
            LHL+C+ CG YG     C
Sbjct  249  LHLICTNCGCYGHLGRNC  266



>gb|KDO44000.1| hypothetical protein CISIN_1g046515mg, partial [Citrus sinensis]
Length=495

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 121/197 (61%), Gaps = 0/197 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
             P I  +     RL  PW  S++++++GR +GY  L  RL+ +W      E+IDL  DY+
Sbjct  28   VPFIAFSSRVHERLVEPWENSVVVKILGRNLGYRVLSSRLNRIWSSTIGFEIIDLGNDYF  87

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            + RF +++D ++A  EGPWT+  HY+ VQ+W P+F++ +N+  +I+AW+R   + ++++ 
Sbjct  88   LIRFNNKKDVEYALTEGPWTLMGHYLSVQKWSPDFDVVNNKIDRIVAWIRLSEMNIQFYH  147

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            +  + ++G  +   +K+   T +++RGKFAR+ V++D+ KPL S+F +      +EY  L
Sbjct  148  KSIIRRLGHIISPVIKIHYNTIMAQRGKFARLAVELDLPKPLVSQFNLEGRIQKVEYENL  207

Query  841  HLVCSKCGLYGQKREQC  891
             ++C  CG +G  +  C
Sbjct  208  PMICFGCGKFGYFKYAC  224



>gb|KDO47636.1| hypothetical protein CISIN_1g041417mg, partial [Citrus sinensis]
Length=381

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 118/196 (60%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +   + RL  PW  S++++ +GR +GY  L  RL+ +W      ++IDL  DY++
Sbjct  88   PYIAFSSRIRDRLVEPWEHSVVVKTLGRNLGYRALSFRLNKVWSSTTGFDIIDLANDYFL  147

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              F + +D +FA  EGPWT+   Y+ VQ+  P+F++ +N+  +I+AW+R   + + ++ +
Sbjct  148  ICFNNAKDVEFALTEGPWTVMGQYLSVQKCTPDFDVINNKIDRIVAWIRLSEMNIHFYHK  207

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              + ++G+ +G  VK+D  T  ++RGKFAR+ V++D+ KPL S+F +      +EY  L 
Sbjct  208  NVIRRLGQIIGPVVKIDSNTITAQRGKFARLAVELDLQKPLVSQFNLEGRIQKVEYENLP  267

Query  844  LVCSKCGLYGQKREQC  891
             +C  CG +G  RE C
Sbjct  268  TICFGCGKFGHYREAC  283



>ref|XP_006490301.1| PREDICTED: uncharacterized protein LOC102612828 [Citrus sinensis]
Length=585

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 117/210 (56%), Gaps = 0/210 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            + P I  +   + +L  PW+ S++++++G+ +GY  L  RL S+W+P     +IDLE +Y
Sbjct  86   VMPYITFSARIQEKLIQPWKNSVVVKLLGKNIGYRALCARLASMWKPSMGFSVIDLENNY  145

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+ RF +  D   A  +G W I  HY+ VQ W  +F+  +      + W+R P L +  +
Sbjct  146  YLIRFRAAGDAIDALTKGSWIILGHYLTVQPWTLDFDSKTTDLIHAVVWIRLPGLAMHLY  205

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
             ++ L KIG  VGE +K D  T LS RGKFARI V+I + +PL S+  I      IEY G
Sbjct  206  HQKTLQKIGHLVGEVIKFDDNTKLSTRGKFARIAVRISLVQPLVSQVKINGRVQKIEYEG  265

Query  838  LHLVCSKCGLYGQKREQCGLGRKEQKATGE  927
            L ++C KCG YG   + C     +   TG+
Sbjct  266  LPVICFKCGRYGHHSDTCSSNTNDGNPTGD  295



>gb|KHN04954.1| hypothetical protein glysoja_013861, partial [Glycine soja]
Length=243

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 118/198 (60%), Gaps = 0/198 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P++ +       L A W+ +L+I+++G+++G++ + +RL  +W+  A  E++D+++ Y
Sbjct  42   LKPKVIIDDSMFEGLYALWQEALVIKLIGKSIGFHVMKERLTRIWKLNAGFEILDIDHGY  101

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            Y+  F+ +        E PW IFD+Y+IV+ W P+F        K + W+RFP L + Y+
Sbjct  102  YMITFDQEAYRVKLIGEEPWMIFDNYLIVELWTPDFISPVASINKTMVWIRFPGLNLVYY  161

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            DE  L  +   +G+PVKVD      +RG+FAR+C+++++TKP+  +  +    Y +EY G
Sbjct  162  DETILLALASAIGKPVKVDINPKDVRRGRFARVCIEVNLTKPVVGRVWLKDLWYHVEYEG  221

Query  838  LHLVCSKCGLYGQKREQC  891
            LH +C  CG YG    +C
Sbjct  222  LHRICGTCGCYGHLMREC  239



>ref|XP_009621007.1| PREDICTED: uncharacterized protein LOC104112712 isoform X1 [Nicotiana 
tomentosiformis]
Length=307

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 119/195 (61%), Gaps = 1/195 (1%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++  +K RL  PW+ S+I++V GR V +  L Q+L ++W+P  ++ LIDL  ++++ +
Sbjct  15   IPISSSDKSRLYQPWQYSIIVKVYGRKVDHLSLKQKLQTMWKPTESLSLIDLGNEFFLIK  74

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            ++ + + + A   GPW I +H++ V+ W P F  ++ +      W R P LP +++D E 
Sbjct  75   YQKEENMNKALHNGPWFILNHFLSVR-WEPKFLASTTKLTYTAIWTRLPELPTEFYDLEI  133

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G  +G+ +K+D  T  + RG++ARIC+++ + +PL+S   I   +  I Y GL+++
Sbjct  134  LQKVGNKIGKLLKIDTCTLATSRGRYARICIEVPLEQPLKSHVFIGTHRQRILYEGLNML  193

Query  850  CSKCGLYGQKREQCG  894
            C+ CG  G  R  C 
Sbjct  194  CTSCGRLGHTRTTCS  208



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 142/249 (57%), Gaps = 18/249 (7%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P +  +K  ++ L   WR +LI++ +G+ +  N L QR  SLW+ +  +++ID+ +  +V
Sbjct  84   PVVKFSKALRQELCREWRMALIVKYLGKNLTANVLNQRAPSLWQLKGRVQIIDIGFGCFV  143

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ ++DY     +GPW IFD+Y+I Q+WVP+F   + +  K+  WVR   L ++YF +
Sbjct  144  MRFDDKKDYLHVLLDGPWRIFDNYLITQRWVPDFKPRTAKFQKMAVWVRLSELSMEYFRD  203

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + +  I +N+G+P+ +D+TT   +RG+FAR  V+ID+ KPL S+  +  +   +EY GLH
Sbjct  204  DTIKAILENIGKPLGLDRTTMARERGRFARAAVEIDLDKPLVSEIWVMGDVQKVEYEGLH  263

Query  844  LVCSKCGLYGQKREQCGLGR---KEQKATGE--------------EVGVDISTIPAQEDQ  972
            +VC  CG+ G + + C L R    E  ATG               E   D  T PA E +
Sbjct  264  VVCFGCGVVGHREQACPLARPTAPETMATGSNTETAADTAEPQPAEGPADAVTQPA-ERR  322

Query  973  LLGPQLIAT  999
              GP +I T
Sbjct  323  RYGPWMIVT  331



>ref|XP_010666462.1| PREDICTED: uncharacterized protein LOC104883615 [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 107/167 (64%), Gaps = 0/167 (0%)
 Frame = +1

Query  391  VGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQ  570
            +GY  L+++L   W  + ++ L D+ + +Y+ARF    DY     +GPW I D+Y+ +++
Sbjct  6    IGYMGLMRKLKKKWSLKGDVTLTDIGFKFYIARFTIVEDYQHVLTQGPWMIDDNYLTIRK  65

Query  571  WVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFA  750
            WVPNF L  N    + AWVR P L V+YFD  FL K+G  +G+ +++DQTT  + RG+F 
Sbjct  66   WVPNFILDDNPPKILTAWVRIPNLAVEYFDSAFLTKVGSKIGKVLRIDQTTVQAVRGQFT  125

Query  751  RICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            R+ V+ID+TKPL +KF +    + I+Y GLH++C  CG +G  + +C
Sbjct  126  RLSVEIDLTKPLIAKFWLKGCVWRIQYEGLHMICFNCGCWGHNQSEC  172



>ref|XP_008232499.1| PREDICTED: uncharacterized protein LOC103331632 [Prunus mume]
Length=546

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 129/233 (55%), Gaps = 6/233 (3%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  ++    RL  PW+ +LII++VGR   YNYL  RL   W      +L+DL  +Y+V
Sbjct  101  PSIQFSERAMNRLCKPWQNALIIKLVGRLHTYNYLHDRLQQKWSLNGGWKLVDLVNEYFV  160

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              FE + D ++   EGPW I   Y+ +Q+W   F  ++    ++  W+R   + ++ FD 
Sbjct  161  VTFEVEEDLNYVLTEGPWIIARQYLTMQKWRSGFCPSTASITRMAVWIRVSAIQLECFDV  220

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L +IG  +G+ +K+D  T+   RGKFAR+CV++D+TKPL +   I    Y IEY GL 
Sbjct  221  WALKRIGNLLGKLLKIDAHTTSQNRGKFARLCVELDLTKPLEAFVQINQVWYNIEYEGLP  280

Query  844  LVCSKCGLYGQKREQCGLG-----RKEQKATGEEVGVDISTIPAQEDQLLGPQ  987
             +C  CGLYG KRE C L       K + +  +EV  D + + ++ED  +  +
Sbjct  281  EICYNCGLYGHKRENCLLNANSNPDKARSSQDDEVSGDDAAM-SKEDNFINKE  332



>ref|XP_006285607.1| hypothetical protein CARUB_v10007057mg, partial [Capsella rubella]
 gb|EOA18505.1| hypothetical protein CARUB_v10007057mg, partial [Capsella rubella]
Length=394

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 112/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W+  ++++V+GR +    L +RL  +W P  +M ++DL   +++
Sbjct  61   PFITIGAEIIEAMHGLWKNCMVVKVLGRNITIAVLSRRLRDMWNPSRDMFVLDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFES+ +Y  A   GPW IF  Y++ Q W P+F+   +       WVR   +PV ++  
Sbjct  121  VRFESEEEYMAALTGGPWKIFGSYLMAQAWSPDFDPIRDEITTTPVWVRLSNIPVTFYHT  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L +I + +G+P+KVD TT+  +R +FAR+CV++++ KPL+    I  E+Y + Y G+ 
Sbjct  181  SILEEIARGLGKPLKVDLTTTKLERARFARVCVEVNLKKPLKGTVMINGERYYVSYEGIS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS CGLYG     C
Sbjct  241  TICSHCGLYGHLVHSC  256



>ref|XP_009144746.1| PREDICTED: uncharacterized protein LOC103868394 [Brassica rapa]
Length=519

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 114/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    +   W+R +I++V+GR++    L +RL  LW+P  +M ++DL  ++++
Sbjct  61   PVITIGEEVLSAMNGLWKRCMIVKVLGRSIPLLSLTRRLKELWKPAGSMFVMDLPKNFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF  + +Y  A   GPW  F  Y++VQ W P F+   +       WVR   +PV ++ +
Sbjct  121  VRFGVEEEYMNALSGGPWRAFGSYLMVQAWTPEFDPLRDEIVTTPVWVRLAHIPVNFYHK  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P+KVD TT   +R +FARICV++++ KPL+    I  E+Y I Y G+ 
Sbjct  181  TILMGIAKGLGKPIKVDCTTLKVERARFARICVEVNLNKPLKGTVMINGERYCISYEGIS  240

Query  844  LVCSKCGLYGQKREQC  891
            ++CS CG+YG     C
Sbjct  241  MICSSCGMYGHLACSC  256



>gb|KDO39032.1| hypothetical protein CISIN_1g043150mg, partial [Citrus sinensis]
Length=588

 Score =   160 bits (405),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 128/224 (57%), Gaps = 13/224 (6%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +   + RL  PW  S++++ +GR +GY  L  RL+ +W      ++IDL  DY++
Sbjct  79   PYIAFSSRIRDRLVEPWEHSVVVKTLGRNLGYRALSFRLNKVWSSTTGFDIIDLANDYFL  138

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              F + ++ +FA  EGPWT+   Y+ VQ+W P+F++ +N+  +I+AW+R   + + ++ +
Sbjct  139  ICFNNAKNVEFALTEGPWTVMGQYLSVQKWTPDFDVVNNKIDRIVAWIRLSEMNIHFYHK  198

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              +  +G+ +G  VK+D  T  ++RGKF+R+ V++D+ KPL S+F +      +EY  L 
Sbjct  199  NIIRWLGQIIGPVVKIDSNTITAQRGKFSRLAVELDLQKPLVSQFNLEGRIQKVEYENLP  258

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIPAQEDQL  975
             +C  CG +G  RE C               VDI T  A+EDQL
Sbjct  259  TICFGCGKFGHYREAC------------PDSVDI-THTAKEDQL  289



>ref|XP_010463475.1| PREDICTED: uncharacterized protein LOC104744160 [Camelina sativa]
Length=264

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 122/223 (55%), Gaps = 1/223 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + + +E    +   W++ +I++V G+ +  + L +RL  +W+P+  M ++DL   +++
Sbjct  29   PLVTIGQEMLDAMHGLWKQCMIVKVFGKHIRLSVLSRRLREMWKPKGAMYVMDLPRQFFM  88

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++VQ W P+F+   +       W+R   +P+ ++ +
Sbjct  89   VRFEQEDEYLAALIGGPWRAFGSYLMVQAWSPDFDPLKDEIVTTPVWLRLSNIPISFYHQ  148

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L    + +G+P+KVD T    +RG+FARICV++D+  PL+    +  ++Y + Y GL 
Sbjct  149  SILMSFARGLGKPIKVDLTMLKFERGRFARICVEVDLRNPLKGTILVNGKRYFVSYKGLS  208

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTI-PAQED  969
             +CS CGLYG     C L  ++Q        V+++   P Q D
Sbjct  209  NICSGCGLYGHMVHACPLRVQDQPVALATPAVEMAVSEPVQRD  251



>ref|XP_006296651.1| hypothetical protein CARUB_v10015577mg, partial [Capsella rubella]
 gb|EOA29549.1| hypothetical protein CARUB_v10015577mg, partial [Capsella rubella]
Length=476

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 114/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    ++  W++ +I++V+GR V  + L ++L  LW+P   M ++DL    ++
Sbjct  61   PVITIGSEVMDVMKGLWKQCIIVKVLGRNVAISALSRKLRELWKPNGGMYVLDLPRQCFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW +F  Y++VQ W P+FN   +       WVR   +PV ++ E
Sbjct  121  IRFDREDEYHAALTGGPWKVFGSYLLVQDWSPDFNPLRDDIVTTPVWVRLSNIPVIFYQE  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + L  I   +G+PVKVD TT   +R +FAR+CV+++++KPL+    I  E+Y + Y G+ 
Sbjct  181  DILLGIASGLGKPVKVDLTTLHIERARFARVCVEVNLSKPLKGSVMINGERYYVAYEGMS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG++G     C
Sbjct  241  NICSGCGVFGHLVHNC  256



>ref|XP_009139888.1| PREDICTED: uncharacterized protein LOC103863877 [Brassica rapa]
Length=516

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 113/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +I+RV+GR V  + L ++L  LW P+ +M ++DL   +++
Sbjct  85   PSITIENEVLEAMNGMWKQCMIVRVLGRNVPISALSRKLRELWSPKGSMYVMDLPRQFFM  144

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++V+ W P F+   +       W+R   +PV ++  
Sbjct  145  VRFEKEDEYLEALTGGPWRAFGSYLMVRAWSPEFDPLRDDIVTTPVWIRLTNIPVNFYHR  204

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P++VDQTT   +R +FARICV++++ KPL+    I  E+Y + Y GL 
Sbjct  205  SILMGIAKGLGKPIRVDQTTLNFERARFARICVEVNLAKPLKGTVLINGERYFVAYEGLS  264

Query  844  LVCSKCGLYGQKREQC  891
             +CSKCG+YG     C
Sbjct  265  EICSKCGIYGHLVHSC  280



>ref|XP_009125818.1| PREDICTED: uncharacterized protein LOC103850783 [Brassica rapa]
Length=503

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 106/180 (59%), Gaps = 0/180 (0%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEG  531
            W++ +I++V+GR V    L +RL  LW+P+  M ++DL   Y++ RF  + DY  A   G
Sbjct  78   WKQCMIVKVLGRNVPLMALHRRLKELWKPKGAMVVMDLPRQYFMIRFGEEEDYMNALTGG  137

Query  532  PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKV  711
            PW  F  Y++VQ W P F+   N       WVR   LPV ++ +  L+ I K VG+P++V
Sbjct  138  PWRAFGSYLMVQAWNPEFDPVKNDITTTPVWVRISDLPVNFYHKAILFGIAKGVGKPIRV  197

Query  712  DQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            D TTS  +R +FAR+CV++++ KPL+    +   ++ + Y GL  +CS CGLYG     C
Sbjct  198  DATTSNLERARFARVCVEVNLKKPLKGSIMVNGARFYVSYEGLSNICSGCGLYGHMIHTC  257



>ref|XP_009103803.1| PREDICTED: uncharacterized protein LOC103829870 [Brassica rapa]
Length=519

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 113/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    + + W+R +I+RV+GR V    L ++L  LW+P  +M ++DL  ++++
Sbjct  61   PVITIGEEVLTAMNSLWKRCMIVRVLGRNVSLLNLTRKLKELWKPNGSMFVMDLPRNFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFES+ +Y  A   GPW  F   ++VQ W P+F+   +       WVR   +PV  + +
Sbjct  121  VRFESEEEYMNALSGGPWRAFGSCLMVQAWNPDFDPLRDEIVTTPVWVRLSHIPVNLYHK  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G P+KVD TT   +R +FARICV++++ KPL+    I  E+Y + Y G+ 
Sbjct  181  TILMGIAKGLGRPIKVDLTTLKFERARFARICVEVNLNKPLKGTVVINGERYWVSYEGIS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG+YG     C
Sbjct  241  TICSTCGMYGHLAHAC  256



>ref|XP_006296775.1| hypothetical protein CARUB_v10015820mg [Capsella rubella]
 gb|EOA29673.1| hypothetical protein CARUB_v10015820mg [Capsella rubella]
Length=503

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 114/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    ++  W++ +I++V+GR V  + L ++L  LW+P   M ++DL    ++
Sbjct  61   PVITIGSEVLDVMKGLWKQCIIVKVLGRNVAISALSRKLRELWKPNGGMYVLDLPRQCFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW +F  Y++VQ W P+FN   +       WVR   +PV ++ E
Sbjct  121  IRFDREDEYHAALTGGPWKVFGSYLLVQDWSPDFNPLRDDIVTTPVWVRLSNIPVIFYQE  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + L  I   +G+PVKVD TT   +R +FAR+CV+++++KPL+    I  E+Y + Y G+ 
Sbjct  181  DILLGIASGLGKPVKVDLTTLHIERARFARVCVEVNLSKPLKGSVMINGERYYVAYEGMS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG++G     C
Sbjct  241  NICSGCGVFGHLVHNC  256



>ref|XP_010513494.1| PREDICTED: uncharacterized protein LOC104789504 [Camelina sativa]
Length=326

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 115/202 (57%), Gaps = 0/202 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +  E    +++ W++ +I++V+GR V    L Q+L  LW+P+  M ++DL   +++
Sbjct  74   PVVTIGDEVLTVMKSLWKQCMIVKVLGRHVSIAVLSQKLRELWKPKGPMFVMDLPRQFFM  133

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++VQ W   FN  ++       WV    +PV ++  
Sbjct  134  VRFEREDEYLAALSGGPWRVFGSYLMVQAWSSEFNPLTDEIVTTPVWVHLTNIPVHFYHR  193

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+PV+VD TT   +R +FARICV++D+ KPL+    +  E++ + Y GL 
Sbjct  194  SILMGIAKGLGKPVRVDLTTLNFERARFARICVEVDLKKPLKGSVMVNGERFYVLYEGLT  253

Query  844  LVCSKCGLYGQKREQCGLGRKE  909
             +CS CGLYG     C   R++
Sbjct  254  NICSLCGLYGHLVHSCPQNRRD  275



>ref|XP_009121310.1| PREDICTED: uncharacterized protein LOC103846155 [Brassica rapa]
Length=515

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 121/223 (54%), Gaps = 3/223 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +I+RV+GR+V  + L ++L  LW P   M ++DL   +++
Sbjct  61   PSITIETEVLEAMNGMWKQCMIVRVLGRSVAISALSRKLRELWNPRGAMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++V+ W P F+   +       WVR   +PV ++  
Sbjct  121  VRFEKEDEYMAALTGGPWRVFGSYLMVRAWSPEFDPLRDDIATTPVWVRLTNIPVNFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+PV+VD TT   +R +FARICV++++ KPL+    I  E+Y + Y GL 
Sbjct  181  SILMGIAKGLGKPVRVDITTLNFERARFARICVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQCG---LGRKEQKATGEEVGVDISTIPAQ  963
             +CSKCG+Y      C      R   KA   E  V  +++P Q
Sbjct  241  EICSKCGIYEHLVHGCPKTIAERVANKALQTETSVLPTSVPKQ  283



>ref|XP_009780018.1| PREDICTED: uncharacterized protein LOC104229130 [Nicotiana sylvestris]
Length=311

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/216 (32%), Positives = 124/216 (57%), Gaps = 1/216 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I ++ EEK R+  PW+ S+I+++VG+ + ++YL +++  LW+P  + +LIDL  DYY+ +
Sbjct  76   ITLSDEEKVRIYEPWKNSIIVKLVGKRMLHHYLKRKIQELWKPTEDFQLIDLGVDYYIIK  135

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+ + + D    +GPW I  H++ + +W PNF     +      W+R P LP +++D + 
Sbjct  136  FKKKENMDKVMHQGPWFINGHFLSITRWKPNFVSTQEKVTNSAVWIRLPQLPTEFYDGKI  195

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KI   +G  +K+D  TS S RG + R+CV++ +  P++    +   K  I Y G + +
Sbjct  196  LEKIVNAIGRLLKIDVCTSTSLRGHYERLCVKLPLKAPVQPFIYVDHHKQAIHYEGENFL  255

Query  850  CSKCGLYGQKREQCG-LGRKEQKATGEEVGVDISTI  954
            C  CG  G   ++C  + +K +    E+   ++STI
Sbjct  256  CENCGQLGYIAQKCSFIIQKNRDRNNEDTSKELSTI  291



>ref|XP_007206965.1| hypothetical protein PRUPE_ppb019035mg [Prunus persica]
 gb|EMJ08164.1| hypothetical protein PRUPE_ppb019035mg [Prunus persica]
Length=409

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 96/294 (33%), Positives = 145/294 (49%), Gaps = 12/294 (4%)
 Frame = +1

Query  13   SQMEPEVQDPLERTSKKTKRSEALLDQSVGAMGQDTIQTSSKPAEPVFQASEGSLGGRLE  192
            S ++PE  + LE    K  R+      S G M  D    S  P    F+ S    GG   
Sbjct  42   SALQPE--NKLESVGTKRIRTTEPDPNSSGDMATDVGFGSPPPVTLNFRDSVLKQGGHGS  99

Query  193  YKQILKGQTCAKAAVWNYdeeevsddeddymqeddLCPRIPVTKEEKRRLRAPWRRSLII  372
             +  L G    K  + + D      ++          P I  +++ K RL  PWR S+II
Sbjct  100  TRTGLGGMADDKFTIEDDDFIVSEGEKG---------PSIRFSEQVKERLYRPWRTSIII  150

Query  373  RVVGRTVGYNYLLQRLHSLW-RPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFD  549
            +++G+   YN++L RL   W   +   +LIDLE  +++ RF  + D       GPW I  
Sbjct  151  KLMGKAHTYNFVLARLQHRWGMIKGPWKLIDLENGFFIVRFVLEEDMKAILCGGPWVIAG  210

Query  550  HYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSL  729
             Y+++Q+W P F+    +  ++  WVR   L V++F  E + +IG  +G   KVD  T  
Sbjct  211  QYLVMQRWKPGFDPLVEQVTRMTVWVRIIGLHVEWFRPEAMLRIGDLLGTTFKVDSNTVA  270

Query  730  SKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
              RGK+AR+CV+ID+T+PL++   +    Y +EY G+HLVC  CG YG  R  C
Sbjct  271  QVRGKYARVCVEIDLTQPLQAFVQVEDNWYGLEYEGIHLVCFACGCYGHNRNVC  324



>ref|XP_006296777.1| hypothetical protein CARUB_v10015822mg, partial [Capsella rubella]
 gb|EOA29675.1| hypothetical protein CARUB_v10015822mg, partial [Capsella rubella]
Length=333

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 113/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +R+ W+  ++++V+ R V    L +RL  LW+P   M ++DL   +++
Sbjct  58   PVITVGQEVVSVMRSLWKNCMLVKVLDRHVPIAALSKRLRELWKPTGGMSVLDLPRQFFM  117

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+++ DY      GPW +F   ++VQ W P+F+   +       WVR   LPV ++ +
Sbjct  118  VRFDNEADYMAVMTGGPWRLFGSVLMVQAWSPSFDPQHDEIRTTPVWVRVSKLPVLFYHK  177

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G+P++VD TT   +R +FARICV++D+T+PL+    +  ++Y + Y GL 
Sbjct  178  AILMGIAEGLGKPLRVDLTTFRFERARFARICVEVDLTQPLKGSVMVNGDRYFVSYEGLS  237

Query  844  LVCSKCGLYGQKREQC  891
             +CS CGLYG     C
Sbjct  238  NICSSCGLYGHLVNTC  253



>gb|KDO40369.1| hypothetical protein CISIN_1g048241mg, partial [Citrus sinensis]
Length=354

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 85/245 (35%), Positives = 136/245 (56%), Gaps = 27/245 (11%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P +  +++ + +L  PW+ ++I++++GR++GY        SLW       +IDLE  YY+
Sbjct  35   PSVVFSQKMQEQLIRPWKNTVIVKLLGRSIGY-------RSLW-----FTVIDLENYYYL  82

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              F ++ D +F   +GPWTIF HY+ VQ+W P F+  S++   I+AW+R P +P+ Y+ +
Sbjct  83   VSFGAEEDGEFVLTQGPWTIFGHYLTVQKWSPTFDCLSDKIETIVAWIRLPGMPLHYYHK  142

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  +G+ VG  +++   T  +KRGKFAR+ V+I + KPL S+F +  +   IEY GL 
Sbjct  143  RVLRILGEVVGRVIRIAYNTLAAKRGKFARVAVEICLNKPLVSQFQLNGKIQRIEYEGLP  202

Query  844  LVCSKCGLYGQKREQC-------------GLGRKEQKATGEEVGVDISTIPAQEDQLLGP  984
             +C + G  G   + C             G  + E +ATG  V VD ST     + L GP
Sbjct  203  TICFEYGKDGHTVDTCQRKKEVSIGHGCDGGPQLEGEATG--VTVDPSTFDNPNNSLFGP  260

Query  985  QLIAT  999
             +I T
Sbjct  261  WMIVT  265



>ref|XP_009101980.1| PREDICTED: uncharacterized protein LOC103828133 [Brassica rapa]
Length=510

 Score =   157 bits (396),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 123/228 (54%), Gaps = 3/228 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +I++V+GR V    L ++L  LW P+  M ++DL   +++
Sbjct  61   PSITIGSEVLEAMNGMWKQCMIVKVLGRNVAIAALNRKLRELWSPKGAMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW IF  Y++V+ W P F+   +       W+R   +PV ++  
Sbjct  121  VRFEKEEEYLAALSGGPWRIFGSYLMVRAWSPEFDPLRDEIVTTPVWIRLTNIPVNFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P++VD TT   +R +FARICV++++ KPL+    I  E+Y + Y GL 
Sbjct  181  SILMGIAKGLGKPIRVDLTTLNFERARFARICVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGE---EVGVDISTIPAQEDQLL  978
             +CS+CG+YG     C     E+ A  +   E  V    IP Q+D  +
Sbjct  241  EICSRCGIYGHLVHGCPRTVAERIANLQVTTEKTVTKQAIPRQDDGFI  288



>ref|XP_006289412.1| hypothetical protein CARUB_v10002911mg [Capsella rubella]
 gb|EOA22310.1| hypothetical protein CARUB_v10002911mg [Capsella rubella]
Length=474

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 108/185 (58%), Gaps = 0/185 (0%)
 Frame = +1

Query  358  RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPW  537
            R +I++V+GRTV    L +RL  +W+P  +M ++DL   +++ RFES+ +Y  A   GPW
Sbjct  62   RCMIVKVLGRTVPVAVLSRRLKEMWKPSRDMVVVDLPRQFFMVRFESEDEYMAALTGGPW  121

Query  538  TIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQ  717
             +F  Y++VQ W P+F+   +       WVR   LPV ++    L  I + +G+P+KVD 
Sbjct  122  RVFGSYLMVQAWSPDFDPIRDEIETTPVWVRLSNLPVSFYHTTILMGIAEGLGKPIKVDI  181

Query  718  TTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQCGL  897
            TT    R +FAR+CV++++  PL+    I  E+Y + Y GL  +CS CGLYG     C  
Sbjct  182  TTMNLTRARFARVCVEVNLKMPLKGTVMINEERYYVSYEGLSTICSGCGLYGHLVHSCPQ  241

Query  898  GRKEQ  912
              KE+
Sbjct  242  AAKER  246



>ref|XP_009141433.1| PREDICTED: uncharacterized protein LOC103865384 [Brassica rapa]
Length=414

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 112/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    + + W+R +I+RV+GR +    L ++L  LW+P  +M ++DL  ++++
Sbjct  63   PVITIGEEVLTAMNSLWKRCMIVRVLGRNIPITNLNRKLRELWKPRGSMFVMDLPRNFFI  122

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW  F  Y++VQ W P F+   +       WVR   +PV ++ +
Sbjct  123  VRFDLEEEYMAALSGGPWRAFGSYLMVQAWTPEFDPLKDEIVTTPVWVRLSHIPVNFYHK  182

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +  P+KVD TT   +R +FARICV++++ KPL+    I  E+Y + Y G+ 
Sbjct  183  TILIGIAKGLRRPIKVDGTTLNFERVRFARICVEVNLNKPLKGSVMINGERYYVSYEGMS  242

Query  844  LVCSKCGLYGQKREQC  891
             +CS CGLYG     C
Sbjct  243  TICSICGLYGHLAHAC  258



>ref|XP_006292963.1| hypothetical protein CARUB_v10019240mg, partial [Capsella rubella]
 gb|EOA25861.1| hypothetical protein CARUB_v10019240mg, partial [Capsella rubella]
Length=405

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 112/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +  E    +R  W+R +I++V+GR +    + ++L  LW+P+  M + DL   +++
Sbjct  29   PFVTIGSEVLTVMRGLWKRCMIVKVLGRNIPIAAMSRKLRELWKPKGAMHVTDLPRQFFM  88

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW +F  Y++VQ W P+F+   +       WVR   +P+ ++  
Sbjct  89   VRFDMEEEYMEALTGGPWKVFGSYLMVQDWSPDFDPMRDEITTTPVWVRLSNIPMLFYHR  148

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + L  I + +G+P+KVD TT    R +FAR+CV++++ KPL+    +  E++ + Y GL 
Sbjct  149  QILMGIAEGLGKPLKVDLTTQNLDRARFARVCVEVNLKKPLKGTIMVNDERFFVSYEGLS  208

Query  844  LVCSKCGLYGQKREQC  891
             +CS CGLYG     C
Sbjct  209  SICSACGLYGHLVHAC  224



>ref|XP_007219945.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
 gb|EMJ21144.1| hypothetical protein PRUPE_ppb019389mg [Prunus persica]
Length=786

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (56%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  + + K  L  PWR ++II+++GR + Y +L   L   W  +  M LIDLE +Y++
Sbjct  82   PSIQFSDKVKSSLYRPWRSAVIIKLMGRPLAYTFLRSLLLLRWALKGPMSLIDLENNYFI  141

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F  + D  +    GPW I   YI+ Q+W P FN    +   + AWVR   L V+YF  
Sbjct  142  VKFLYEEDMRYVLTGGPWQIAGQYIVAQKWKPGFNAKEEKITHMTAWVRINGLNVEYFRA  201

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + + KIG  VG   KVD  T    RGKFARICV++D+ KPL     I    Y + Y G++
Sbjct  202  DVMEKIGNLVGATDKVDAHTLSQARGKFARICVELDLAKPLTPFIEIEGRTYGVVYEGIN  261

Query  844  LVCSKCGLYGQKREQC  891
            LVC +CG +G  R+ C
Sbjct  262  LVCFECGCFGHGRDSC  277



>ref|XP_006295777.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
 gb|EOA28675.1| hypothetical protein CARUB_v10024899mg, partial [Capsella rubella]
Length=451

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 113/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    +   W+  +I++V+GR +    L ++L  LW+P   M ++DL   +++
Sbjct  61   PEITIGEEVISVMHGLWKNCMIVKVLGRQIPVAVLNRKLKELWKPSGRMYVMDLPRHFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F +Y++VQQW PNF+   +       WVR   +PV Y+ +
Sbjct  121  VRFELEEEYLNALTGGPWRVFGNYLMVQQWSPNFDPLKDDIVTTPVWVRLMNIPVWYYHK  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + VG P++VD TT   +R +FAR+CV++++++PL+    I  E + + Y GL 
Sbjct  181  SILMAIAEGVGTPLRVDLTTLSLERARFARVCVEVNLSEPLKGTLLINGEWFFVAYEGLT  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS CGLYG     C
Sbjct  241  RICSSCGLYGHLVHAC  256



>ref|XP_009101806.1| PREDICTED: uncharacterized protein LOC103827989 [Brassica rapa]
Length=512

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 110/196 (56%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +I++V+GR V    L ++L  LW P+  M ++DL   +++
Sbjct  61   PSITIEPEVLEAMNGMWKQCMIVKVLGRDVAIAALSKKLRELWSPKGAMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW IF  Y++V+ W P F+   +       W+R   +PV ++  
Sbjct  121  VRFEREEEYLAALSGGPWRIFGSYLMVRAWSPVFDPLRDEIVTTPVWIRLSNIPVNFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G P++VD TT   +R +FARICV++++ KPL+    I  E+Y + Y GL 
Sbjct  181  SILMGIAKGLGTPIRVDLTTLNFERARFARICVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CSKCG+YG     C
Sbjct  241  EICSKCGIYGHLVHGC  256



>ref|XP_010445325.1| PREDICTED: uncharacterized protein LOC104727972 [Camelina sativa]
Length=282

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 112/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + + KE    +   W+  +I++V+GRTV    L +RL  +W+P  +M ++DL   +++
Sbjct  51   PVVTIGKEVLDAMNGLWKNCMIVKVLGRTVPIAALSRRLREMWKPSGSMFVVDLPRQFFI  110

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF  + +Y  A   GPW +F  Y++VQ W P F+   +     L W+R   +P+ ++ +
Sbjct  111  IRFGEEEEYMAALTGGPWRMFGSYLLVQAWTPEFDPLRDEISTTLVWIRLTNIPLNFYHK  170

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L+ + + +G P++VD TTS  +R +FA +CV++++ +P++    I  E+  + Y GL+
Sbjct  171  NILFGVTRGLGNPIRVDGTTSNCERTRFAIVCVEVNLKRPMKGTIMINGERNFVAYEGLN  230

Query  844  LVCSKCGLYGQKREQC  891
             +C  CG+YG     C
Sbjct  231  TICLGCGMYGHLIHSC  246



>ref|XP_006469095.1| PREDICTED: uncharacterized protein LOC102629728 [Citrus sinensis]
Length=570

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 114/190 (60%), Gaps = 0/190 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +     +L APW+ S+I+++ GRT+GY  L  RL+++W+   +  +IDL+ +Y++
Sbjct  87   PSIYFSDRVHEKLCAPWKNSVIVKLRGRTIGYRTLCMRLNTMWKTTMSYSVIDLDNNYFL  146

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF S  D   A  +G W I  HY+ VQ W P+F++      ++  W+R   L V ++++
Sbjct  147  VRFRSASDAIDALTKGLWIIMGHYLTVQPWTPSFDVNKTEMDRVNVWIRLHGLAVHFYNQ  206

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + L K+G+ VG  +K+D  T+ S RG+FAR+ V + + KPL S+F +      +EY GL 
Sbjct  207  QILQKLGQLVGTVIKIDSNTASSARGRFARLAVSLSLAKPLVSQFVLDGRIQKVEYEGLP  266

Query  844  LVCSKCGLYG  873
            ++C  CG YG
Sbjct  267  VICFTCGRYG  276



>ref|XP_006301940.1| hypothetical protein CARUB_v10022418mg, partial [Capsella rubella]
 gb|EOA34838.1| hypothetical protein CARUB_v10022418mg, partial [Capsella rubella]
Length=493

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 113/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +   W++ ++++V+GR++    L ++L  +WRP+  M + DL   ++V
Sbjct  74   PVITVGREVMEAMNGLWKKYMVVKVLGRSLSIAVLSRKLKEMWRPQGAMVVTDLPRQFFV  133

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++VQ W P+F+   +    +  W+R   +P+  +  
Sbjct  134  VRFEFEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRHDIVTMPVWIRLSNIPMNLYHS  193

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G+P++VD TT    R +FAR+CV++D+++PL+    I  E+Y + Y GL 
Sbjct  194  SILMIIAEGLGKPIRVDLTTLKFDRARFARVCVEVDLSQPLKGTVLINEERYYVSYEGLT  253

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG+YG     C
Sbjct  254  NICSGCGMYGHLVHTC  269



>ref|XP_006304881.1| hypothetical protein CARUB_v10012644mg, partial [Capsella rubella]
 gb|EOA37779.1| hypothetical protein CARUB_v10012644mg, partial [Capsella rubella]
Length=478

 Score =   154 bits (390),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/210 (35%), Positives = 117/210 (56%), Gaps = 2/210 (1%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            + +  E  R +   W+R +I++V+ RTV    L +RL  +W P+  M +IDL   +++ R
Sbjct  63   VTIGDEVLRVMNTLWQRCIIVKVLSRTVTLPVLSKRLREMWMPKGAMYVIDLPRRFFMIR  122

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            FE + +Y  A   GPW +F   ++VQ W P F+   +       W+R   +PV  + ++ 
Sbjct  123  FELEEEYLAALTGGPWRVFGSILMVQAWTPEFDPLVDEIVTTPFWIRLTNIPVNLYHKDI  182

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L+ I + +G P+KVD TT   +R +FARICV++++ KPL+    I   +Y + Y GL  +
Sbjct  183  LFLIARGLGNPLKVDLTTLNFERARFARICVEVNLAKPLKGTIMINGGRYFVSYEGLTNI  242

Query  850  CSKCGLYGQKREQC--GLGRKEQKATGEEV  933
            CS+CGLYG     C  G+  KE  A   +V
Sbjct  243  CSRCGLYGHPVHACPRGINDKETAANARDV  272



>gb|KHN07236.1| hypothetical protein glysoja_045025, partial [Glycine soja]
Length=212

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 110/196 (56%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +       L APW+ +L+++++G+ +G+  +   L  +W+  A  +++D+   +Y+
Sbjct  5    PIVHIDDSVFNGLYAPWQDALVVKLLGKNIGFQAIKDCLTRIWKLVAGFDILDIGNHFYM  64

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F++  D       GPW IF HY+ VQ W P+F   + +  K + WV FP L + Y+DE
Sbjct  65   VKFDTTEDRQKVIDGGPWMIFYHYLTVQTWTPDFISPTTKIDKTMVWVCFPGLNLIYYDE  124

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  + + +G  +KVD  T   +R +FARI VQID+ KP+  K  +    Y +EY GLH
Sbjct  125  SILLALARAIGTLIKVDSNTLDVRRERFARIYVQIDLNKPVVGKVGLKGYWYKVEYEGLH  184

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG YG    +C
Sbjct  185  RICSSCGCYGHLAREC  200



>ref|XP_007040750.1| Zinc ion binding,nucleic acid binding-like protein [Theobroma 
cacao]
 gb|EOY25251.1| Zinc ion binding,nucleic acid binding-like protein [Theobroma 
cacao]
Length=370

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 106/165 (64%), Gaps = 1/165 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I ++KE+KRR+R PWR + I++++GR + Y YL  R+  LW    + +++DL+  +Y 
Sbjct  65   PYIRLSKEDKRRIRRPWRNAFIVKLLGRNINYTYLCIRVKQLWSLIGDFQVVDLDNGFYC  124

Query  484  ARFESQRDYDFARFEGPWTIFDHYI-IVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
             RF ++ D+D    EGPW I  HY+  +++W   F         I AW+R P +P++Y+D
Sbjct  125  VRFSNKSDFDHVLTEGPWFIAGHYLSTIRRWTLEFCSNEASVDSIAAWIRLPGMPLEYYD  184

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSK  795
               L +IG  +G+ +KVD+TT+ + RGKFA++CV++ + KPL SK
Sbjct  185  SGILSRIGNELGKTLKVDRTTAYASRGKFAKMCVELHLNKPLVSK  229



>ref|XP_010484910.1| PREDICTED: uncharacterized protein LOC104763199 [Camelina sativa]
Length=326

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 107/196 (55%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   WR+ +I++V+GR V    L ++L  LW+P  +M ++DL   +++
Sbjct  73   PVITIQNEVLEAMNGLWRQYMIVKVLGRNVPLPVLSRKLRELWKPRGSMTVLDLPRQFFL  132

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++VQ W P FN  ++       W+R   +P   +  
Sbjct  133  IRFEVEEEYLAAVSGGPWKAFGSYVMVQAWSPKFNPLTDEIVTTPVWIRLSNIPFNLYHR  192

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I  ++G P++VD TT   +R +FARICV++++  PL+    I  E+Y + Y GL 
Sbjct  193  AILMGIAGSLGTPIRVDSTTLNVERARFARICVEVNLRNPLKGSVVINGERYFVAYEGLT  252

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG+YG     C
Sbjct  253  NICSGCGVYGHLVHGC  268



>ref|XP_006295613.1| hypothetical protein CARUB_v10024726mg, partial [Capsella rubella]
 gb|EOA28511.1| hypothetical protein CARUB_v10024726mg, partial [Capsella rubella]
Length=489

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 116/210 (55%), Gaps = 0/210 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +   W++ +I++V+GR++    + ++L  +WRP+  M + DL   ++V
Sbjct  58   PVITVGREVMEAMNGLWKKCMIVKVLGRSMSIAVMSRKLKEMWRPQGAMVVTDLPRQFFV  117

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++VQ W P+F+   N       W+R   +P+  +  
Sbjct  118  VRFELEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRNDIVTTPVWIRLSNIPMNLYHS  177

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G+P++VD  T    R +FAR+CV++++++PL+    +  E+Y + Y GL 
Sbjct  178  SILMIIAEGLGKPLRVDMQTLKFDRARFARVCVEVNLSQPLKGTVLVNEERYYVSYEGLT  237

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEV  933
             +CS CG+YG     C   R E    G ++
Sbjct  238  NICSGCGMYGHLVHSCARTRAEVGREGTQM  267



>ref|XP_006294233.1| hypothetical protein CARUB_v10023230mg, partial [Capsella rubella]
 gb|EOA27131.1| hypothetical protein CARUB_v10023230mg, partial [Capsella rubella]
Length=440

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 116/228 (51%), Gaps = 11/228 (5%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + V KE    +   W+  ++++V+GR +  + L +RL  +W+P   M ++DL   +++
Sbjct  61   PVVTVGKELLEAMNGLWKNCMVVKVLGRNMSISVLSKRLREMWKPRGVMHVVDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE   +Y      GPW  F  Y++VQ W P F+   N       WVR   +PV  +  
Sbjct  121  IRFELVEEYLAVLTGGPWRAFGSYLMVQAWSPEFDPMRNEIVTTPVWVRLSNIPVNMYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L +I   +G+P+KVD  T    R +FARICV++++  PL+    I  E+Y + Y GL 
Sbjct  181  SILMEIATGLGKPIKVDMATLNFDRARFARICVEVNLAYPLKGTIMINAERYYVAYEGLT  240

Query  844  LVCSKCGLYGQKREQCGLGR-------KEQKAT----GEEVGVDISTI  954
             +CS CGLYG     C  G+       KE  AT    G E G   +T+
Sbjct  241  NICSLCGLYGHLVHACPAGKPVMPVTEKETTATVVPGGSEGGDGFTTV  288



>ref|XP_006279197.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
 gb|EOA12095.1| hypothetical protein CARUB_v10016517mg, partial [Capsella rubella]
Length=457

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 115/196 (59%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    ++  W++ +I++V+GR++  + L ++L  LW+P   M ++DL   +++
Sbjct  57   PFITIGSEVLDVMKGLWKQCIIVKVLGRSIVLSALSRKLKELWKPTGEMSVVDLPRQFFM  116

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  +++VQ W  +FN   +       WVR   LPV ++ +
Sbjct  117  IRFEREEEYLAALTGGPWRVFGSHLMVQAWSSDFNPLRDDIVTTPVWVRLSNLPVFFYHQ  176

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + L  I   +G+P+KVD TT   +R +FAR+CV+I+++KP++    I  ++Y + Y GL 
Sbjct  177  DILLGIASGLGKPIKVDVTTLNFERARFARVCVEINLSKPVKGSVMINGDRYYVAYEGLS  236

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG+YG     C
Sbjct  237  NICSGCGVYGHLVHNC  252



>ref|XP_006286068.1| hypothetical protein CARUB_v10007601mg, partial [Capsella rubella]
 gb|EOA18966.1| hypothetical protein CARUB_v10007601mg, partial [Capsella rubella]
Length=459

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 116/210 (55%), Gaps = 0/210 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +   W++ +I++V+GR++    + ++L  +WRP+  M + DL + ++V
Sbjct  58   PVITVGREVMEAMNGLWKKCMIVKVLGRSMSIAVMSRKLKEMWRPQGAMVVTDLPHQFFV  117

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++VQ W P+F+   N       W+R   +P+  +  
Sbjct  118  VRFELEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRNDIVTTPVWIRLSNIPMNLYHS  177

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G+P++ D  T    R +FAR+CV++++++PL+    +  E+Y + Y GL 
Sbjct  178  SILMIIAEGLGKPLREDMQTLKFDRARFARVCVEVNLSQPLKGTVLVNEERYYVSYEGLT  237

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEV  933
             +CS CG+YG     C   R E    G ++
Sbjct  238  NICSGCGMYGHLVHSCARTRAEVGREGTQM  267



>ref|XP_009129252.1| PREDICTED: uncharacterized protein LOC103854088 [Brassica rapa]
Length=515

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 111/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +I+RV+GR+V  + L ++L  LW P+  M ++DL   +++
Sbjct  61   PSITIETEVLEAMNGMWKQCMIVRVLGRSVAISALSRKLRELWNPKGAMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++V+ W P F+   +       WVR   +PV ++  
Sbjct  121  VRFEKEDEYMAALTGGPWRVFGSYLMVRAWSPEFDPLRDDIATTPVWVRLTNIPVNFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+PV+VD TT   +R +FARICV++++ K L+    I  E+Y + Y GL 
Sbjct  181  SILMGIAKGLGKPVRVDITTLNFERARFARICVEVNLAKLLKGTVLINGERYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CSKCG+Y      C
Sbjct  241  EICSKCGIYEHLVHGC  256



>ref|XP_006301503.1| hypothetical protein CARUB_v10021929mg, partial [Capsella rubella]
 gb|EOA34401.1| hypothetical protein CARUB_v10021929mg, partial [Capsella rubella]
Length=477

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 114/197 (58%), Gaps = 1/197 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    ++  W++ +I++V+GR V  + L ++L  LW+P   M ++DL    ++
Sbjct  61   PVITIGSEVLDVMKGLWKQCIIVKVLGRNVAISALSRKLRELWKPNGGMYVLDLPRQCFM  120

Query  484  ARFESQRDYDFA-RFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
             RF+ + +Y  A    G W +F  Y++VQ W P+FN   +       WVR   +PV ++ 
Sbjct  121  IRFDREDEYHAALTGGGAWKVFGSYLLVQDWSPDFNPLRDDIVTTPVWVRLSNIPVIFYQ  180

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            E+ L  I   +G+PVKVD TT   +R +FARICV+++++KPL+    I+ E+Y + Y G+
Sbjct  181  EDILLGIASGLGKPVKVDLTTLHIERARFARICVEVNLSKPLKGSVMISGERYYVAYEGM  240

Query  841  HLVCSKCGLYGQKREQC  891
              +CS CG++G     C
Sbjct  241  SNICSGCGVFGHLVHNC  257



>ref|XP_006295894.1| hypothetical protein CARUB_v10025024mg, partial [Capsella rubella]
 gb|EOA28792.1| hypothetical protein CARUB_v10025024mg, partial [Capsella rubella]
Length=507

 Score =   152 bits (385),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 109/194 (56%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            + + +E    + + W+  +I++V+GR V    LL++L  LW P+  M +IDL   +++ R
Sbjct  81   VTIGQEVISAMTSLWKNCMIVKVLGRNVPLAPLLRKLRELWAPKGGMTVIDLPRQFFLVR  140

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            FE + DY      GPW +F   ++ Q W P+FN   +       WVR   LPV Y+ +  
Sbjct  141  FELEDDYMGVVTGGPWRLFGSLLMFQAWSPSFNPMQDEIETTPVWVRISNLPVHYYHKTI  200

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L  I + +G+P++ D TT   +R +FAR+C+++++ KPL+    +  E+Y   Y GL+ +
Sbjct  201  LMGIAEALGKPLRADLTTLQVERARFARVCIEVNLKKPLKGSVMVNGERYMASYEGLNTI  260

Query  850  CSKCGLYGQKREQC  891
            CS CG+YG     C
Sbjct  261  CSSCGIYGHLASVC  274



>ref|XP_010423120.1| PREDICTED: uncharacterized protein LOC104708268 [Camelina sativa]
Length=301

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 122/241 (51%), Gaps = 12/241 (5%)
 Frame = +1

Query  169  GSLGGRLEYKQILKGQTCAKAAVWNYdeeevsddeddymqeddLCPRIPVTKEEKRRLRA  348
            G+LGGRL  + +L  +   +     +   E  +            P + +  E  + +  
Sbjct  40   GNLGGRLTPEAVLDDEFVEQKVRLEFPSGEDGE------------PVVTIEPEVLKAMNG  87

Query  349  PWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFE  528
             WR  +I++V+GR+V  + L +RL  LW+    + ++DL   +++ RF S+ +Y  A   
Sbjct  88   LWRHCMIVKVLGRSVNISVLSKRLRELWKLSGELHVMDLPRQFFLVRFGSEVEYLAALTG  147

Query  529  GPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVK  708
            GPW +F  Y++VQ W P F+   +       WVR   L   ++    L  + K +G P+K
Sbjct  148  GPWRVFGSYLMVQAWTPEFDPLVDEIVTTPVWVRVSNLTYNFYHRAILMSLSKGLGRPIK  207

Query  709  VDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQ  888
            VD TT   +RG+FARICV++++ KPL+    I    Y + Y GL  +CS CGL+G     
Sbjct  208  VDLTTLNFERGRFARICVEVNLKKPLKGSILINGGHYFVSYEGLTNICSLCGLFGHVVHN  267

Query  889  C  891
            C
Sbjct  268  C  268



>ref|XP_007219550.1| hypothetical protein PRUPE_ppa025650mg [Prunus persica]
 gb|EMJ20749.1| hypothetical protein PRUPE_ppa025650mg [Prunus persica]
Length=248

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 114/197 (58%), Gaps = 6/197 (3%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRP-EANMELIDLEYDYY  480
            P I    + K RL  PWR ++II+++GRT  Y++LL RL   W   +  M LIDLE ++Y
Sbjct  37   PCIRFCTKVKERLYRPWRNAIIIKLMGRTHTYSFLLARLRQKWSLLKGAMSLIDLENNFY  96

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V RF  + D  +     PW I    +++Q+W   F+  S  T ++  WVR   L V++F+
Sbjct  97   VVRFVLEDDMRYVFSREPWVIAGQSLVMQRWKLGFDHNSTIT-RMAVWVRITGLHVEWFN  155

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
             E + +IG  +G   ++D  T    RGK++RIC+++D+TKPL +   +  +KY     GL
Sbjct  156  PEAIKRIGDLIGVTYRIDTLTVAQARGKYSRICIELDLTKPLIANVQVEVKKYE----GL  211

Query  841  HLVCSKCGLYGQKREQC  891
            HLVC  CG+YG  R QC
Sbjct  212  HLVCFGCGIYGHNRNQC  228



>emb|CDY53602.1| BnaC09g51900D [Brassica napus]
Length=638

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 105/180 (58%), Gaps = 0/180 (0%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEG  531
            W++ +I++V+GR V    L +RL  LW+P+  M ++DL   Y++ RF  + DY  A   G
Sbjct  93   WKQCMIVKVLGRNVPLMPLHRRLKELWKPKGAMVVMDLPRQYFMIRFGEEEDYMNALTGG  152

Query  532  PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKV  711
            PW  F  Y++VQ W P F+   +       WVR   LPV ++ +  L+ I K VG+P++V
Sbjct  153  PWRAFGSYLMVQAWNPEFDPVKDDITTTPVWVRISDLPVNFYHKAILFGIAKGVGKPIRV  212

Query  712  DQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            D TTS  +R +FAR+C ++++ KPL+    +   ++ + Y GL  +CS CGLYG     C
Sbjct  213  DATTSNLERARFARVCGEVNLKKPLKGSIMVNGARFYVSYEGLSNICSGCGLYGHMIHTC  272



>ref|XP_006287598.1| hypothetical protein CARUB_v10000810mg, partial [Capsella rubella]
 gb|EOA20496.1| hypothetical protein CARUB_v10000810mg, partial [Capsella rubella]
Length=493

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 112/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +   W++ ++++V+GR++    L ++L  +WRP+  M + DL   ++V
Sbjct  74   PVITVGREVMEAMNGLWKKCMVVKVLGRSLSIAVLSRKLKEMWRPQGAMVVTDLPRQFFV  133

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++VQ W P+F+   +    +  W+R   +P+  +  
Sbjct  134  VRFEFEEEYMAALTGGPWKMFGSYLMVQAWSPDFDPLRHDIVTMPVWIRLLNIPMNLYHS  193

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G+P++ D TT    R +FAR+CV++D+++PL+    I  E+Y + Y GL 
Sbjct  194  SILMIIAEGLGKPIREDLTTLKFDRARFARVCVEVDLSQPLKGMVLINEERYYVSYEGLT  253

Query  844  LVCSKCGLYGQKREQC  891
             +CS CG+YG     C
Sbjct  254  NICSGCGMYGHLVHTC  269



>gb|KDO46597.1| hypothetical protein CISIN_1g041945mg [Citrus sinensis]
Length=324

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/245 (31%), Positives = 126/245 (51%), Gaps = 23/245 (9%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  + +   +L  PW+ +++++++GR +GY  L+ RL +LW       +IDL+  YY+
Sbjct  85   PSIAFSPKVHEQLIKPWQTTVVVKLLGRMIGYKALVSRLETLWPNIGGFSVIDLDNGYYL  144

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF S    +F   +GPW I  HY+ VQQW P+F+           W+R P +P+ Y+ +
Sbjct  145  VRFRSDNAAEFVLTQGPWVILGHYLTVQQWTPHFD----------CWIRLPGMPLHYYHK  194

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + +  +G   G+ +K+D  T L+ RGKFARI V++ + + L S+F +  +   +EY  L 
Sbjct  195  KIIRLLGHISGKVIKIDYNTELATRGKFARIAVEVHLDRLLISQFLLDRKVERVEYESLP  254

Query  844  LVCSKCGLYGQKREQCGLGRK--------EQKATGEEVGVDISTIPAQE-----DQLLGP  984
             +C  CG YG     C   R         E+  + E    ++S+ P  E     +   GP
Sbjct  255  SICFGCGRYGHTNSSCPEKRNIEPQNTNAEKPNSNEPTNGNLSSAPTAEKAGSDNPRYGP  314

Query  985  QLIAT  999
             ++ T
Sbjct  315  WMVVT  319



>ref|XP_009787638.1| PREDICTED: uncharacterized protein LOC104235548 [Nicotiana sylvestris]
Length=284

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 112/200 (56%), Gaps = 0/200 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +T+EEK+R+  PW+ SLI+++ G+ + ++YL + +  LWRP     LIDL  DYY+ +
Sbjct  85   ITLTEEEKQRIYEPWKFSLIVKLFGKRMLHHYLKKNIQELWRPTKFFSLIDLGDDYYIIK  144

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  + + + A   GPW I  HY+ + +W PNF     +    + W+R P LP +++D + 
Sbjct  145  FTKRENMEKAFTHGPWFINGHYLSITKWRPNFVANKEKLTVSVVWIRLPQLPTEFYDGKL  204

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KIG  +G  +K+D  TS + RG +AR+CV++ +   ++    I   K  I   G   +
Sbjct  205  LEKIGNAIGRLLKIDVCTSTTVRGHYARLCVELPLETLVQPYIYIGQHKQYIHCKGEKFL  264

Query  850  CSKCGLYGQKREQCGLGRKE  909
            C  CG  G  + QC    K+
Sbjct  265  CKNCGRLGHIQTQCNFIHKK  284



>ref|XP_009801431.1| PREDICTED: uncharacterized protein LOC104247173 [Nicotiana sylvestris]
Length=297

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 112/194 (58%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +T+E+K R+  PWR SLII+++G+ + + YL ++L  +W+P  N  LIDL  DY++ +
Sbjct  92   IHLTEEDKNRMYLPWRYSLIIKLLGKRIQHQYLKKKLQKMWKPSDNFPLIDLGSDYFIVK  151

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  + +   A   GP  I   ++ +++W PNF  +     +   W+R P LP +++D   
Sbjct  152  FNKEENMVSALQNGPRFINGFFLSLKKWEPNFVASHATQERSAIWIRLPQLPTEFYDAII  211

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KIG  +G  +K+D  TS + RG++AR+C+++ + +P++S   I   K  I Y G H++
Sbjct  212  LKKIGNTIGNLLKIDACTSAALRGRYARLCIEMKLEEPVQSCILIGNYKQEIIYEGEHIL  271

Query  850  CSKCGLYGQKREQC  891
            C  CG        C
Sbjct  272  CKACGRLEHTIHHC  285



>ref|XP_009119466.1| PREDICTED: uncharacterized protein LOC103844431 [Brassica rapa]
Length=1834

 Score =   155 bits (391),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 112/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +++RV+GR V    L ++L  LW P+ +M ++DL   +++
Sbjct  61   PSITIENEVLEAMNGMWKQCMVVRVLGRNVPITALSRKLRELWNPKGSMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++V+ W P F+   +       W+R   +PV ++  
Sbjct  121  VRFEKEDEYLEALTGGPWRAFGSYLMVRAWSPEFDPLRDDIVTTPVWIRLTNIPVNFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P++VDQTT   +R ++ARICV++++ KPL+    I  E+Y + Y GL 
Sbjct  181  SILMGIAKGLGKPIRVDQTTLKFERARYARICVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CSKCG+YG     C
Sbjct  241  EICSKCGIYGHLVHGC  256



>gb|ABW81177.1| gag non-LTR retrotransposase [Arabidopsis cebennensis]
Length=496

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 112/196 (57%), Gaps = 1/196 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +   W++ +I++V+GR V  + L ++L  LW+P   M ++DL   +++
Sbjct  55   PVITVGREVLDAMSGLWKKCIIVKVLGRNVSVSVLSRKLRELWKPVGEMSVMDLPRQFFM  114

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF S+ +Y  A   GP  +F  Y+++Q W P+F+   +       W+R   LPV ++ +
Sbjct  115  IRFASE-EYMGALTGGPQRVFGSYLLLQAWDPDFDPLRDEITTTPVWIRLSNLPVTFYHK  173

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G PVKVD  T    RG+FAR+CV++++ +PL+    +   +Y + Y GL+
Sbjct  174  TILMGIAKGLGHPVKVDLITIRFDRGRFARVCVEVNLKRPLKGTVMVNGRRYYVSYEGLN  233

Query  844  LVCSKCGLYGQKREQC  891
             +CSKCG+YG     C
Sbjct  234  AICSKCGMYGHLVHTC  249



>ref|XP_009785180.1| PREDICTED: uncharacterized protein LOC104233481 isoform X2 [Nicotiana 
sylvestris]
Length=299

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 118/195 (61%), Gaps = 0/195 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +++++K R+  PW+ SLII+++G+ + + YL +++  +W+P  N  LIDL  DY++A+
Sbjct  37   IQLSEKDKNRMYLPWKHSLIIKLLGKRIQHQYLEKKIQKIWKPSENFPLIDLGSDYFIAK  96

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +++   A   GPW I   ++ +++  PNF  ++    + + W++ P LP +++D   
Sbjct  97   FSKEKNMISALQNGPWFINGFFLSIKKSEPNFKASNATQERSVIWLQLPQLPTEFYDAII  156

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KIG  +G+ +K+D  TS + R ++AR+C+++ + +P++   +I   K  I Y G H++
Sbjct  157  LKKIGNTIGKLLKIDACTSAALRERYARLCIEMQLEEPVQPCISIGNYKQQIIYEGEHIL  216

Query  850  CSKCGLYGQKREQCG  894
            C  CG  G   + C 
Sbjct  217  CKACGRLGHTTQHCS  231



>ref|XP_009795699.1| PREDICTED: uncharacterized protein LOC104242361 [Nicotiana sylvestris]
Length=235

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 107/166 (64%), Gaps = 0/166 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++ EEK R+  PW  ++I++V GR V +  L Q+++++W+P  N+ LIDL  D+++ +
Sbjct  60   IPISLEEKNRIYQPWTHAIIVKVYGRKVAHQVLRQKIYTIWQPTENLPLIDLGSDFFLLK  119

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+ + + + A  +GPW IF+H++ V+QW P F  +  +      W+R P LP +++D + 
Sbjct  120  FQKEENKNHALHDGPWFIFNHFLSVRQWEPKFMASETKINFSAIWLRLPKLPTEFYDFQI  179

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA  807
            L K+G N+G+ + VD  TS + RG+ AR+ V+I + +PLR+   + 
Sbjct  180  LQKVGNNIGKLLTVDTCTSSTTRGRCARLYVEIPVDQPLRTHIYLG  225



>ref|XP_009782149.1| PREDICTED: uncharacterized protein LOC104230937 [Nicotiana sylvestris]
 ref|XP_009782150.1| PREDICTED: uncharacterized protein LOC104230937 [Nicotiana sylvestris]
Length=330

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 114/194 (59%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++ ++K RL + W+ S+II++ G+++G+  L  +L SLW+P   + LIDL   +++ +
Sbjct  76   IPLSADDKARLYSSWKFSIIIKLFGKSIGHQLLKAKLQSLWKPTELLHLIDLGSAFFLIK  135

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  + +   A  +GPW I  H++ V++W P F  ++ +      W R P LP +Y+D   
Sbjct  136  FTQKNNMLHALHDGPWFILGHFLSVRRWEPKFVASTAQLTYSAIWARLPELPTEYYDLTI  195

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G  + + +K+D  TS   RG++ARI +++ + KPL+    I   K  I Y GL+++
Sbjct  196  LQKVGNKLEQLLKIDTCTSSVVRGRYARISIEVPLEKPLKIHIYIDSHKRVILYEGLNIL  255

Query  850  CSKCGLYGQKREQC  891
            C KCG +G     C
Sbjct  256  CIKCGCFGHNARVC  269



>gb|KFK31800.1| hypothetical protein AALP_AA6G160500 [Arabis alpina]
Length=1096

 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 114/196 (58%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    +   W+R +I++V+GR +    L ++L  LW+P+ +M ++DL   +++
Sbjct  24   PEITIGEEVLTAMNGLWKRCMIVKVLGRNIPVAVLSKKLRELWKPQVSMFVMDLPRQFFM  83

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF  + +Y  A   GPW  F  Y++ + W P+F+   +       W+R   +PVK++ +
Sbjct  84   VRFGEEEEYLKALTGGPWKAFGSYLMARTWSPDFDPMKDEIATTPVWIRLSNIPVKFYHK  143

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P+KVD TT   +R +FAR+CV++D+++P +    I  E+Y + Y GL 
Sbjct  144  TVLMGIAKGLGKPLKVDATTLNLERARFARVCVEVDLSRPRKGYVLINKERYYVSYEGLT  203

Query  844  LVCSKCGLYGQKREQC  891
             +CS+CG+YG     C
Sbjct  204  NICSQCGIYGHTVHSC  219



>ref|XP_008220882.1| PREDICTED: uncharacterized protein LOC103320918 [Prunus mume]
Length=687

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 112/197 (57%), Gaps = 1/197 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRP-EANMELIDLEYDYY  480
            P I    +  +RL  PWR ++II+++GRT  Y++LL RL   W   +  M LIDLE ++Y
Sbjct  44   PCIRFCTKVNKRLYRPWRNAIIIKLMGRTHTYSFLLARLRKKWSLLKGAMSLIDLENNFY  103

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V RF  + D  +     PW I    +++Q+W P F+       ++  WVR   L V++F+
Sbjct  104  VVRFVLEEDMRYIFSGEPWVIAGKSLVMQRWKPGFDPNEATITRMAVWVRITGLHVEWFN  163

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
             + +  IG  +G   ++D  T    RGK+ARIC+++D+TKPL +   +    Y IE  GL
Sbjct  164  PKAIKHIGDLIGVTYRIDTHTVAQARGKYARICIELDLTKPLSANVQVENNWYAIEDEGL  223

Query  841  HLVCSKCGLYGQKREQC  891
            HLVC  CG+YG  R QC
Sbjct  224  HLVCFGCGIYGHNRNQC  240


 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 67/114 (59%), Gaps = 0/114 (0%)
 Frame = +1

Query  448  MELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWV  627
            + LIDLE ++YV RF  + D  +    GPW I    +++Q+W P F+       ++  W+
Sbjct  293  ISLIDLENNFYVVRFVLEEDMRYVFSGGPWVIAGQSLVMQRWKPGFDPNEATITRMAVWM  352

Query  628  RFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLR  789
            R   L V++F+ E +  IG  +G   ++D  T    RGK+ARIC+++D+TKPL+
Sbjct  353  RITGLHVEWFNPEAIKSIGDLIGVTYRIDTYTVAQARGKYARICIELDLTKPLK  406



>gb|KCW81645.1| hypothetical protein EUGRSUZ_C03006 [Eucalyptus grandis]
 gb|KCW82547.1| hypothetical protein EUGRSUZ_C03949 [Eucalyptus grandis]
Length=139

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 99/148 (67%), Gaps = 11/148 (7%)
 Frame = +1

Query  325  EEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQR  504
            EEK RLR PWRRSLII+V          L+ L +L+ P+  + +IDL  D+++A+F    
Sbjct  2    EEKERLRQPWRRSLIIKV----------LEALATLF-PKRELVMIDLANDFFIAKFSLLE  50

Query  505  DYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIG  684
            DY F   EGPW IFDHY+ +++W PNF+    +  ++ AWVRFP + ++YFDE FL ++G
Sbjct  51   DYHFVLREGPWMIFDHYLAIRKWEPNFDPTEAKIDRVTAWVRFPNISIEYFDEAFLMRLG  110

Query  685  KNVGEPVKVDQTTSLSKRGKFARICVQI  768
              +G+P++VD T  L+ RGKF+R+ V++
Sbjct  111  LLIGKPLRVDSTIVLATRGKFSRLVVKL  138



>ref|XP_006596845.1| PREDICTED: uncharacterized protein At4g02000-like [Glycine max]
Length=546

 Score =   150 bits (379),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 107/184 (58%), Gaps = 0/184 (0%)
 Frame = +1

Query  340  LRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFA  519
            L APW+ +L+++++G+ +G+  +   L  +W+  A  +++D+   +Y+ +F++  D    
Sbjct  106  LYAPWQDALVVKLLGKNIGFQAIKDCLTRIWKLVAGFDILDIGNHFYMVKFDTTEDRQKV  165

Query  520  RFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGE  699
               GPW IF HY+ VQ W P+F   + +  K + WV FP L + Y+DE  L  + + +G 
Sbjct  166  IDGGPWMIFYHYLTVQTWTPDFISPTTKIDKTMVWVCFPGLNLIYYDESILLALARAIGT  225

Query  700  PVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQK  879
             +KVD  T   +R +FARI VQID+ KP+  K  +    Y +EY GLH +CS CG YG  
Sbjct  226  LIKVDSNTLDVRRERFARIYVQIDLNKPVVGKVGLKGYWYKVEYEGLHRICSSCGCYGHL  285

Query  880  REQC  891
              +C
Sbjct  286  AREC  289



>ref|XP_006375872.1| hypothetical protein POPTR_0013s04890g, partial [Populus trichocarpa]
 gb|ERP53669.1| hypothetical protein POPTR_0013s04890g, partial [Populus trichocarpa]
Length=171

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 93/140 (66%), Gaps = 0/140 (0%)
 Frame = +1

Query  472  DYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVK  651
            D+++A F +  D+++A F  PW + DHY+ V+QW PNFN       K+  W+R P L ++
Sbjct  3    DFFLAMFSNSDDWEYALFGSPWMVADHYLTVRQWHPNFNPDEATIDKVALWMRLPDLAME  62

Query  652  YFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEY  831
             +D++ LW+IG+ +G+ +KVD+TTS+  RG +ARI +++D+TKPL +KF +      I Y
Sbjct  63   SYDKKILWRIGEKIGKTLKVDRTTSIGSRGNYARISMEVDLTKPLLAKFQLRRRVRKIVY  122

Query  832  GGLHLVCSKCGLYGQKREQC  891
             G HL+C  CG YG ++E C
Sbjct  123  EGPHLICFHCGQYGHRKEAC  142



>gb|AAD37019.2| putative non-LTR retrolelement reverse transcriptase [Arabidopsis 
thaliana]
Length=855

 Score =   152 bits (384),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 121/222 (55%), Gaps = 2/222 (1%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I + +E    + + W++ ++++V+GR +    L +RL  +W+P+  M ++DL   +++ R
Sbjct  38   ITIGREVLDVMNSMWKQCMVVKVLGRNISIANLNRRLREMWKPQGAMFVVDLPCQFFMIR  97

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            FE + +Y  A   GPW  F  Y++VQ W P F+   +       WVR   +P+  +    
Sbjct  98   FEREDEYLSALTGGPWRAFGSYLLVQAWSPEFDPLRDEITTTPIWVRLMNIPLSLYHTSI  157

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L  I  ++G+PVKVD TT   +R +FAR+C+++D+ KPL+    +  E+Y + Y GL  +
Sbjct  158  LMGIAGSLGKPVKVDMTTLHVERARFARMCIEVDLAKPLKGTLLLNGERYFVSYEGLANI  217

Query  850  CSKCGLYGQKREQC--GLGRKEQKATGEEVGVDISTIPAQED  969
            CS+CG+YG     C   +  KE  A  +   V +S    + D
Sbjct  218  CSRCGMYGHLIHTCPQTIAEKEVNAASQSAPVVVSGAVPEND  259



>ref|XP_006286623.1| hypothetical protein CARUB_v10002432mg, partial [Capsella rubella]
 gb|EOA19521.1| hypothetical protein CARUB_v10002432mg, partial [Capsella rubella]
Length=450

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 104/180 (58%), Gaps = 0/180 (0%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEG  531
            W+  LI++V+GR V    L+++L  L +P   M ++DL   +++ RF+++ DY  A   G
Sbjct  74   WKHCLIVKVLGRHVPIAALVRKLRELLKPSGGMYVVDLPKQFFLVRFDNKADYLAAVTGG  133

Query  532  PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKV  711
            PW +F   ++VQ W P F+   +       WVR  +LPV  + +  L K+   +G+P++V
Sbjct  134  PWRLFGSILMVQAWTPEFDPLKDEIVTTPVWVRISSLPVNLYHKVILSKVSGALGKPLRV  193

Query  712  DQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            D TT    R +FAR+CV++++ KPL+    +  E+Y + Y GL  +CS CG+YG     C
Sbjct  194  DMTTLQLNRARFARVCVEVNLKKPLKGSVLVNGERYAVAYEGLSTICSSCGIYGHLVNNC  253



>ref|XP_006293025.1| hypothetical protein CARUB_v10019305mg, partial [Capsella rubella]
 gb|EOA25923.1| hypothetical protein CARUB_v10019305mg, partial [Capsella rubella]
Length=361

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 108/181 (60%), Gaps = 0/181 (0%)
 Frame = +1

Query  340  LRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFA  519
            +   W++ +I++V+GR V    LL++L  +WRP+  M ++DL   +++ RFE + +Y  A
Sbjct  73   MNGLWKQCMIVKVLGRHVSIAVLLKKLREMWRPKGAMYVVDLPRQFFMVRFELEDEYLEA  132

Query  520  RFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGE  699
               GPW IF  Y++V+ W P F+  ++       W+R   +PV ++ +  L ++ + +G+
Sbjct  133  LTGGPWRIFGSYLMVKAWEPEFDPMTDEIVTTPVWIRLSNIPVNFYHKRLLMRLARGLGK  192

Query  700  PVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQK  879
            PVKVD TT   +RG+FARICV +++ KPL+    I   +Y + Y G+  +C  C  +G K
Sbjct  193  PVKVDLTTMNFERGRFARICVDVNLKKPLKGSILINGSRYFVSYEGMTNICPVCENHGDK  252

Query  880  R  882
            +
Sbjct  253  Q  253



>ref|XP_006282338.1| hypothetical protein CARUB_v10028633mg, partial [Capsella rubella]
 gb|EOA15236.1| hypothetical protein CARUB_v10028633mg, partial [Capsella rubella]
Length=463

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 118/217 (54%), Gaps = 4/217 (2%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P   + +E    +   W++ ++++V+GR V    L ++L  LW+P+  M + DL   +++
Sbjct  59   PVFTIAEEVIEAMHGLWKQCMVVKVLGRNVPIPVLTRKLKELWKPQGAMYVTDLPRQFFM  118

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++V+ W P F  + +       WVRF  LPV  + +
Sbjct  119  VRFEVEDEYLTALTGGPWKAFGSYLMVRAWSPEFEPSRDDIVTTPVWVRFSNLPVALYHQ  178

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  + + +G+P++VD  T   +R +F R+CV++D+++PL+  F +  E+Y + Y GL 
Sbjct  179  TILLGLAQALGKPLRVDTNTLNFERARFPRVCVEVDLSQPLKGSFMLNGERYFVFYEGLT  238

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTI  954
             +CS CG++G     C     + K   E VG  +S +
Sbjct  239  SICSGCGIFGHMVHAC----PKLKGVAENVGGSLSPV  271



>ref|XP_006282222.1| hypothetical protein CARUB_v10028495mg, partial [Capsella rubella]
 gb|EOA15120.1| hypothetical protein CARUB_v10028495mg, partial [Capsella rubella]
Length=409

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 111/196 (57%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + KE    +   +R  +I++V+GR +  + L ++L  +W+P   M ++DL   +++
Sbjct  76   PVITIGKEVLEVMYGLYRNCMIVKVLGRHITIDALNRKLKEMWKPRGGMAVLDLPRQFFM  135

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + DY  A   GPW +F   ++V+ W P+F+   +       WVR   LPV Y+  
Sbjct  136  IRFDLEEDYMAAVTGGPWRVFGSILMVKAWSPDFDPVRDDIVTTPVWVRISNLPVFYYHR  195

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + L  I + VG+P++VD TT   +RG+FARICV++++ + L+    I  E+Y + Y GL 
Sbjct  196  KILMGIAEGVGKPLRVDLTTLKMERGRFARICVEVNLRESLKGTVLINDERYYVSYEGLT  255

Query  844  LVCSKCGLYGQKREQC  891
             +C  CG+YG     C
Sbjct  256  NICPTCGVYGHNASSC  271



>dbj|BAB01940.1| non-LTR retrolelement reverse transcriptase-like protein [Arabidopsis 
thaliana]
Length=591

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 111/206 (54%), Gaps = 0/206 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    +   W++ + ++V+GR V    +  RL  +W+P   M ++DL   +++
Sbjct  61   PVITIGQEVIDAMNGLWKQCMFVKVLGRKVSLAAVSHRLREMWKPSGAMYVLDLPRHFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + ++  A   GPW  F   ++V+ W P FN   +       WVR   +PV ++ +
Sbjct  121  VRFEKEEEFLTALTGGPWRAFGSCLLVKAWSPEFNPLKDEIVTTPIWVRIADMPVSFYHK  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  + + +G P+KVD T    +RG+FAR+CV++D+ +PL+    +  ++Y + Y GL 
Sbjct  181  SILMSVAQGLGRPLKVDLTMLHFERGRFARVCVEVDLKRPLQGALLVNGDRYYVAYEGLT  240

Query  844  LVCSKCGLYGQKREQCGLGRKEQKAT  921
             +CSKCG+YG     C     EQ A 
Sbjct  241  NICSKCGIYGHLVHNCPKELSEQAAA  266



>ref|XP_009764541.1| PREDICTED: uncharacterized protein LOC104216228 [Nicotiana sylvestris]
Length=271

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/197 (34%), Positives = 113/197 (57%), Gaps = 0/197 (0%)
 Frame = +1

Query  307  RIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            ++PV+ ++K R+  PWR S+II+++G+ + +  L  +L  LW+P     LI++   YY+ 
Sbjct  22   KVPVSGKDKLRIYYPWRFSIIIKLLGKKILHQVLKCKLIDLWKPTKAFSLINVGEQYYIV  81

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            +F  + + +    + PW +F H++ VQ   PNF   + +      W+R P LP K++DEE
Sbjct  82   KFNKEENLENILQKEPWFVFGHFLSVQCSEPNFVPVTAKQIFTAIWIRLPHLPTKFYDEE  141

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHL  846
             L K+G  VG  +K D  TS + RG++A++CV++ + KP++S   I   +  I Y G +L
Sbjct  142  ILKKVGNTVGRLLKADACTSAALRGRYAKLCVELSLDKPVKSNVWIGTHQQQILYEGENL  201

Query  847  VCSKCGLYGQKREQCGL  897
            +   CG  G    QC +
Sbjct  202  LYKSCGHLGHTARQCNI  218



>ref|XP_009126860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103851737 
[Brassica rapa]
Length=1638

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 121/229 (53%), Gaps = 2/229 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +   W++ +I+RV+GR V    L ++L  LW P+  M ++DL   +++
Sbjct  61   PSITIENEVLEAMNGMWKQCMIVRVLGRNVPIVALNRKLRELWNPKGAMYVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++V+ W P F+   +       W+R   +PV ++  
Sbjct  121  VRFEKEEEYLAALTGGPWRAFGSYLMVRAWSPEFDPLRDDIVTTPVWIRLTNIPVNFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K +G+P++VD TT   +R +FAR+CV++++ KPL+    I  E+Y + Y GL 
Sbjct  181  SILMGIAKGLGKPIRVDSTTLNFERARFARVCVEVNLAKPLKGTVLINGERYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIPAQEDQLLGPQL  990
             +C +CG+YG     C     E+ A+       ++T   +   L  PQL
Sbjct  241  EICPRCGIYGHLIHGCPRTLAERAAS--PTTQTVATRKVETANLQAPQL  287



>ref|XP_007213231.1| hypothetical protein PRUPE_ppb017383mg [Prunus persica]
 gb|EMJ14430.1| hypothetical protein PRUPE_ppb017383mg [Prunus persica]
Length=661

 Score =   148 bits (373),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 125/242 (52%), Gaps = 26/242 (11%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I        RL  PW+ +LII+++GR+  YNYL  RL   W      +L+DL  DY+V
Sbjct  165  PCIQFLDRAMDRLCRPWQNALIIKLLGRSHTYNYLHARLQQKWSLIGGWKLVDLVNDYFV  224

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + D +F    GPW I   Y+++Q+W P F  A+ +  ++ AW+R   + ++ FD 
Sbjct  225  VRFELEEDINFVFTRGPWIIAGQYLVMQKWRPGFCPATAKITRMAAWIRVSAIQLECFD-  283

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
                         +K+D  T+   RGKFAR+CV++D+++PL +   I    Y +EY G  
Sbjct  284  ------------LLKIDALTTSQNRGKFARLCVELDLSRPLEAFVQINNVWYNVEYEGFP  331

Query  844  LVCSKCGLYGQKREQCGL---GRKEQKATGEEVG----VDISTIPAQE------DQLLGP  984
             +C  CG YG KRE C +      E+   G  +G    V+  T+  +E      + LLGP
Sbjct  332  DICYMCGRYGHKREHCDVPDAATVEKTGDGSTLGDDGLVEGDTVMGKEGINAFTENLLGP  391

Query  985  QL  990
             +
Sbjct  392  WM  393



>ref|NP_178215.1| zinc ion binding / nucleic acid binding protein [Arabidopsis 
thaliana]
 gb|AAF18653.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05391.1| zinc ion binding / nucleic acid binding protein [Arabidopsis 
thaliana]
Length=515

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 116/218 (53%), Gaps = 0/218 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    +   W++ +I++V+G  +  + L ++L  LW+P   M ++DL   +++
Sbjct  61   PVITIGEEVLEAMNGLWKKCMIVKVLGSQIPISVLNRKLRELWKPSGVMTVMDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +  +Y++VQ W   F+   +       WVR   +P  Y+  
Sbjct  121  IRFELEEEYMAALTGGPWRVLGNYLLVQDWSSRFDPLRDDIVTTPVWVRLSNIPYNYYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L +I + +G P+KVD  T    +G+FAR+C+++++ KPL+    I  ++Y + Y GL 
Sbjct  181  CLLMEIARGLGRPLKVDMNTINFDKGRFARVCIEVNLAKPLKGTVLINGDRYFVAYEGLS  240

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIP  957
             +CS CG+YG     C      + + G E   D + +P
Sbjct  241  KICSSCGIYGHLVHSCPRNVVVKVSAGAETVTDRAVVP  278



>ref|XP_006301986.1| hypothetical protein CARUB_v10022467mg, partial [Capsella rubella]
 gb|EOA34884.1| hypothetical protein CARUB_v10022467mg, partial [Capsella rubella]
Length=421

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 119/217 (55%), Gaps = 4/217 (2%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P   + +E    +   W++ +I++V+GR V    L ++L  LW+P+  M + +L   +++
Sbjct  48   PVFTIVEEVTEAMHGLWKQCMIVKVLGRNVPILVLSRKLRELWKPKGAMYVTNLPRQFFM  107

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++V+ W P+F  + +    I  WVRF  LPV  + +
Sbjct  108  VRFEVEEEYLTALTGGPWKAFGSYLMVRAWSPHFEPSRDDITTIPVWVRFSNLPVALYHQ  167

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  + + +G+P++VD  T   +R +FAR+CV++D+++PL+  F +  E+Y + Y GL 
Sbjct  168  TILLGLAQALGKPLRVDANTLNFERPRFARVCVEVDLSQPLKRSFMVNGERYFVFYEGLT  227

Query  844  LVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTI  954
             +CS C ++G     C     + K   E VG   S +
Sbjct  228  SICSGCEIFGHMVHAC----PKVKPVAESVGAQGSPV  260



>ref|XP_009794210.1| PREDICTED: uncharacterized protein LOC104241008 [Nicotiana sylvestris]
Length=294

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 110/195 (56%), Gaps = 0/195 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++ EEK RL  PW+ S+II++  R + ++ L  RL +LW+P   + L+DL +D+++ +
Sbjct  46   IPLSPEEKERLYMPWKFSVIIKIFKRKMPHHMLRSRLINLWKPSEQLILVDLGWDFFIVK  105

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +     A   GPW +  H+  V++W P F            W+R P LP +++D+  
Sbjct  106  FSLEESMVKALHLGPWFVSGHFQSVRKWEPKFVPHEATLTSTAIWIRLPQLPTEFYDKVI  165

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G+ +G+ +K+DQ TS + RG++ARIC+Q+    P+     I  +K  + Y G   +
Sbjct  166  LEKVGRKLGKLLKIDQCTSSTLRGRYARICIQVPQETPVEISVIIGDQKQLVVYEGEGTL  225

Query  850  CSKCGLYGQKREQCG  894
            C+ CG  G    +C 
Sbjct  226  CTSCGRIGHTASKCN  240



>ref|XP_010463327.1| PREDICTED: uncharacterized protein LOC104743994 [Camelina sativa]
Length=851

 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 108/196 (55%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  E    +    +  +I++V+G  V  + L +RL  +W+P   M ++DL   Y++
Sbjct  61   PVITIGNEVLEAMYGLQKNYMILKVLGLHVSVSVLTKRLKEMWKPVGAMSVLDLPRQYFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW +F  Y++ Q W PNF+   +       W+R   LPV ++  
Sbjct  121  IRFDVEAEYMVALTGGPWRMFGSYLLTQAWSPNFDPLRDEITTTPVWIRLSNLPVHFYHR  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G P+KVD TT   +R +FAR+CV++++ KPL+    +  ++Y + Y GL 
Sbjct  181  SILMAIAEGLGNPIKVDLTTLNFERARFARVCVEVNLKKPLKETVMVNGDRYFVSYEGLS  240

Query  844  LVCSKCGLYGQKREQC  891
             +CS+CG+YG     C
Sbjct  241  AICSRCGIYGHLVHNC  256



>ref|XP_010681547.1| PREDICTED: uncharacterized protein LOC104896496 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 105/163 (64%), Gaps = 0/163 (0%)
 Frame = +1

Query  319  TKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFES  498
            +K++  +LR PW  +L+ + +G +V  + + QR+ S+ +P  ++E+IDL  D ++ RF  
Sbjct  60   SKDKLTQLRQPWSLTLMGKCLGISVRPSIMTQRVRSMRKPHGSLEVIDLGKDVFLFRFRL  119

Query  499  QRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWK  678
            + D + A F GPW I DHY+++ QW PNF    N   K++ W+  P LPV+Y+D+E L+ 
Sbjct  120  KNDLEKALFGGPWYILDHYLMLNQWQPNFRPNQNPFNKLVVWIHLPELPVEYYDKEALFL  179

Query  679  IGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA  807
            I   +G+P++VD  T+   R ++AR+CV ID++KP+ SK  + 
Sbjct  180  IASKLGKPIRVDYATNHLTRARYARVCVDIDLSKPILSKVWVG  222



>ref|XP_007213212.1| hypothetical protein PRUPE_ppb013620mg [Prunus persica]
 gb|EMJ14411.1| hypothetical protein PRUPE_ppb013620mg [Prunus persica]
Length=993

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/242 (34%), Positives = 125/242 (52%), Gaps = 26/242 (11%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I        RL  PW+ +LII+++GR+  YNYL  RL   W      +L+DL  DY+V
Sbjct  165  PCIQFLDRAMDRLCRPWQNALIIKLLGRSHTYNYLHARLQQKWSLIGGWKLVDLVNDYFV  224

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + D +F    GPW I   Y+++Q+W P F  A+ +  ++ AW+R   + ++ FD 
Sbjct  225  VRFELEEDINFVFTRGPWIIAGQYLVMQKWRPGFCPATAKITRMAAWIRVSAIQLECFD-  283

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
                         +K+D  T+   RGKFAR+CV++D+++PL +   I    Y +EY G  
Sbjct  284  ------------LLKIDALTTSQNRGKFARLCVELDLSRPLEAFVQINNVWYNVEYEGFP  331

Query  844  LVCSKCGLYGQKREQCGL---GRKEQKATGEEVG----VDISTIPAQE------DQLLGP  984
             +C  CG YG KRE C +      E+   G  +G    V+  T+  +E      + LLGP
Sbjct  332  DICYMCGRYGHKREHCDVPDAATVEKTGDGSTLGDDGLVEGDTVMGKEGINAFTENLLGP  391

Query  985  QL  990
             +
Sbjct  392  WM  393



>ref|XP_010481113.1| PREDICTED: uncharacterized protein LOC104759949 [Camelina sativa]
Length=285

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 109/205 (53%), Gaps = 0/205 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +  E    +   W++ +I+ V+GR +    L ++L  +W+P+  M ++DL   +++
Sbjct  76   PVVTIGLEVLEVMNGMWKQCMIVMVLGRNISIAALTRKLREMWKPKGGMYVMDLPRQFFM  135

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y      GPW  F  Y++ + W P+F+   +       WV    +PV ++  
Sbjct  136  IRFDLEEEYLSVLTGGPWIAFGSYLLTKVWSPDFDPLRDEIVTTPVWVHLSNIPVNFYHP  195

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L ++ + +G P++VD TT   +R +F+RICV++D+ +PL+    I  E+Y + Y GL 
Sbjct  196  SILMRVAQGLGSPLRVDVTTLNYERARFSRICVEVDLQRPLKGTIMINGERYFVSYEGLP  255

Query  844  LVCSKCGLYGQKREQCGLGRKEQKA  918
             +C  CGLYG     C  G   +K 
Sbjct  256  NICLLCGLYGHLVHACPSGNTGEKG  280



>ref|XP_009765340.1| PREDICTED: uncharacterized protein LOC104216902 [Nicotiana sylvestris]
Length=305

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 106/191 (55%), Gaps = 0/191 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +T +EK  L  PW+ SLII++ G+ + + YL  ++  LW+P     LIDL YDYY+ +
Sbjct  85   ITLTDQEKEALNYPWKFSLIIKLFGKRIVHYYLKAKIQELWKPTEQFPLIDLGYDYYIVK  144

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  + +        PW +  H++ ++ W PNF +A  +      WVR P LP +++DE  
Sbjct  145  FTQEENMRKVLQNRPWFVNGHFLSIKHWEPNFVVADAQQTISAVWVRLPQLPTEFYDESL  204

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KI  ++G  +K++   S + RG++AR+C+Q+ + +P+ ++  I      I Y G   +
Sbjct  205  LRKIWNSIGSLLKINACMSTTLRGRYARLCIQVPLEEPVTTRKLIGSHLQQIIYEGEGFL  264

Query  850  CSKCGLYGQKR  882
            C  CG  G  R
Sbjct  265  CKLCGRLGHTR  275



>ref|XP_010659263.1| PREDICTED: uncharacterized protein LOC104881299 [Vitis vinifera]
 ref|XP_010659264.1| PREDICTED: uncharacterized protein LOC104881299 [Vitis vinifera]
Length=833

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 103/179 (58%), Gaps = 2/179 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I ++  EK  L APW+ SLI +V+GR VG  Y    LH LW  E  +++IDL Y +++
Sbjct  84   PMIKLSSTEKENLSAPWKYSLIAKVLGRKVGLQYCQAHLHRLWSLEGTVDIIDLGYGFFL  143

Query  484  ARFESQRDYDFARFEG-PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
             +F    DY    F+G PW I  +YI ++ WVPNF  +         WVR P LP++Y+D
Sbjct  144  LKFSLPTDY-IKVFKGVPWLIHGYYISLRPWVPNFKPSEATITHAKVWVRLPELPIEYYD  202

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            +E L +IG  +G  +K+D  T    RG+FAR+CV++D+   L  +  +   +  IEY G
Sbjct  203  KEVLLQIGAAIGRTIKIDPITEKQARGRFARMCVEVDLKHSLLPQIKLGELQQKIEYEG  261



>emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera]
Length=833

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 103/179 (58%), Gaps = 2/179 (1%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I ++  EK  L APW+ SLI +V+GR VG  Y    LH LW  E  +++IDL Y +++
Sbjct  84   PMIKLSSTEKENLSAPWKYSLIAKVLGRKVGLQYCQAHLHRLWSLEGTVDIIDLGYGFFL  143

Query  484  ARFESQRDYDFARFEG-PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
             +F    DY    F+G PW I  +YI ++ WVPNF  +         WVR P LP++Y+D
Sbjct  144  LKFSLPTDY-IKVFKGVPWLIHGYYISLRPWVPNFKPSEATITHAKVWVRLPELPIEYYD  202

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            +E L +IG  +G  +K+D  T    RG+FAR+CV++D+   L  +  +   +  IEY G
Sbjct  203  KEVLLQIGAAIGRTIKIDPITEKQARGRFARMCVEVDLKHSLLPQIKLGELQQKIEYEG  261



>ref|XP_009796013.1| PREDICTED: uncharacterized protein LOC104242638 [Nicotiana sylvestris]
Length=321

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 108/195 (55%), Gaps = 0/195 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++ EEK RL  PWR S+II++  R + ++ L  +L  LW+P   + LIDL +D+++ +
Sbjct  66   IPLSLEEKGRLYTPWRYSVIIKIFKRKMPHHMLRSKLIELWKPSEQLILIDLGWDFFIVK  125

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +         GPW    H++ V++W P F            W+R P L  +++D+  
Sbjct  126  FSLEESMIKTLHLGPWFFSGHFLSVRKWEPKFFPQEATLASTAIWIRLPQLLTEFYDKII  185

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G+ +G+ +K+DQ TS + RG++ARIC+Q+ +  P+ +   I   K  + Y G   +
Sbjct  186  LEKVGRKLGKLLKIDQCTSSTLRGRYARICIQVPLKTPVETTIIIGDHKQSVIYEGEGTL  245

Query  850  CSKCGLYGQKREQCG  894
            C+ CG  G    +C 
Sbjct  246  CTSCGRIGHTAPKCN  260



>ref|XP_003593078.1| hypothetical protein MTR_2g007560 [Medicago truncatula]
Length=578

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 104/196 (53%), Gaps = 15/196 (8%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            PR     +         R   +++++G+ +GY+ + +RL   WR +   E++D +  +Y+
Sbjct  9    PRFISNNQSFNNYVRHGRMQFVVKLLGKNLGYHAMRERLQKTWRTQGGFEIMDNDNGFYM  68

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F+   D +     GPW IFDH ++                K + WVR+P L + Y+DE
Sbjct  69   VKFDEAADKEKVITGGPWLIFDHCLVD---------------KTIVWVRYPGLNLVYYDE  113

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
             FL  +   +G P+KVD+ T   +RGKFAR+CV+ID+T P+  K  +    Y ++Y GLH
Sbjct  114  SFLLAMASALGRPIKVDRNTLKIERGKFARVCVEIDLTMPVVGKIWVNGHWYKVQYEGLH  173

Query  844  LVCSKCGLYGQKREQC  891
            L+C+ CG YG     C
Sbjct  174  LICTSCGCYGHLGRNC  189



>ref|XP_006601654.1| PREDICTED: uncharacterized protein LOC100791212 [Glycine max]
Length=484

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 96/155 (62%), Gaps = 0/155 (0%)
 Frame = +1

Query  340  LRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFA  519
            L APW+ +L+++++G+ +G+  +   L  +W+  A  +++D+   +Y+ +F++  D    
Sbjct  86   LCAPWQDALVVKLLGKNIGFQAMKDHLTRIWKLVAGFDILDIGNHFYMVKFDTTEDRQKV  145

Query  520  RFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGE  699
               GPW IFDHY+ +Q W P+F   + +  K + WVRFP+L + Y+DE  L  + + +G 
Sbjct  146  IEGGPWMIFDHYLTIQTWTPDFISPTAKIDKTMVWVRFPSLNLIYYDENILLALARAIGT  205

Query  700  PVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTI  804
            P+KVD  T   +RG FARICVQID+ KP+  K  +
Sbjct  206  PIKVDSNTLDVRRGHFARICVQIDLNKPVVGKVGL  240



>ref|XP_010681595.1| PREDICTED: uncharacterized protein LOC104896537 [Beta vulgaris 
subsp. vulgaris]
Length=302

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/228 (34%), Positives = 122/228 (54%), Gaps = 30/228 (13%)
 Frame = +1

Query  319  TKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFES  498
            +KE+  +LR PW   L+ + +G TV  +++ Q++ S+W+P   +E+IDL  + Y+ RF  
Sbjct  61   SKEKLTQLRQPWGLKLMGKCLGITVRPSFMTQKVRSMWKPRGTIEVIDLGKETYLFRFSL  120

Query  499  QRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWK  678
              DY+ A F GPW + +HY+++ QW PNF L  N   +++ WV  P LPV+Y+D+E L+ 
Sbjct  121  SDDYEKALFGGPWYVLNHYLMLNQWQPNFRLTQNPFDRLVIWVHIPELPVEYYDKEALFI  180

Query  679  IGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSK  858
            I + +G+P+ VD  T+   R ++ARI                      I Y  LH +C  
Sbjct  181  IARKLGKPIGVDYATNHLTRARYARI----------------------ILYENLHSLCFH  218

Query  859  CGLYGQKREQC-GLGRK---EQKATGEEVGVDISTIPAQEDQLLGPQL  990
             G  G  + QC GL  K   EQ A  +   +D + +    +QL  PQ+
Sbjct  219  YGRIGHLKGQCAGLKGKAPVEQHAHADSNKMDGTDV----NQLGSPQM  262



>ref|XP_009757725.1| PREDICTED: uncharacterized protein LOC104210511 [Nicotiana sylvestris]
Length=312

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 111/194 (57%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +T+E++ R+  PW+ SLII+++G+ + ++ L +++   W+   N  LIDL  DYY+A+
Sbjct  73   IQLTEEDQARIYQPWKYSLIIKLIGKKIQHHILKKKIQEAWKIIDNFPLIDLGADYYIAK  132

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
             E +         GPW IF H++ +Q+W PNF     ++  I  W+R P LP + +D   
Sbjct  133  LECEEHMIKVLNTGPWFIFGHFLSIQRWKPNFVATEIKSSLIAIWIRSPQLPTELYDGII  192

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KI   +G+ +KVD  TS + RG++AR+C+++ +   +     I   K  I+Y G + +
Sbjct  193  LAKIENAIGKLLKVDACTSSTLRGRYARLCIELPLEVLVIPFIKIGHHKQIIQYEGENTL  252

Query  850  CSKCGLYGQKREQC  891
            C +CG  G    +C
Sbjct  253  CKQCGRLGHVALKC  266



>gb|KHN09077.1| hypothetical protein glysoja_034262, partial [Glycine soja]
Length=228

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 103/198 (52%), Gaps = 21/198 (11%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P+  +  +   +L  PW++ L+++++G+++GY  + ++L S W+P+   +LID+ Y Y
Sbjct  4    LLPKFTIDAKVFEQLCIPWKKCLVVKLLGKSIGYLIMKEKLQSTWKPDEGFDLIDVSYGY  63

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++  F+   D + A FE   T  D                    K L WVRF  L + Y+
Sbjct  64   FMVNFDLDADREKA-FEASTTTMD--------------------KTLVWVRFRGLGMVYY  102

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            D   L  I   +G P+KVDQ T    RG+FAR+CVQI++  P+  KF +    Y +EY G
Sbjct  103  DGSMLLTIASAIGAPIKVDQNTLNMNRGRFARVCVQINLNVPIEGKFNLNGSWYKVEYEG  162

Query  838  LHLVCSKCGLYGQKREQC  891
             H++C  C  YG     C
Sbjct  163  PHVLCVACRCYGHVARAC  180



>gb|KDO39120.1| hypothetical protein CISIN_1g048696mg [Citrus sinensis]
Length=248

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 104/182 (57%), Gaps = 4/182 (2%)
 Frame = +1

Query  391  VGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQ  570
            +GY  L  RL SLW       +IDLE D+Y+ +F+++ D   A  +GPWTI  HY+ VQ 
Sbjct  1    MGYRALCNRLESLWGMCKGFSVIDLENDFYLVQFKTKTDAHHALTQGPWTILGHYLTVQP  60

Query  571  WVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFA  750
            W   F  ++     I+AW+R P +P+ Y+ +  L  +G  +G+ +++D  T  + RGKFA
Sbjct  61   WHLRFESSTETIDSIIAWIRLPGMPLHYYHKCILRMLGLIIGKVLRIDYNTESATRGKFA  120

Query  751  RICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQCGLGRKEQKATGEE  930
            RI VQ+ + KPL S+F +  +   +EY  L  +C +CG YG    +C     ++  T ++
Sbjct  121  RIAVQVALNKPLMSQFLLDGKIQKMEYESLPTICFECGKYGHVLSEC----PDKHKTTDQ  176

Query  931  VG  936
            +G
Sbjct  177  IG  178



>ref|XP_010692742.1| PREDICTED: uncharacterized protein LOC104905804 [Beta vulgaris 
subsp. vulgaris]
Length=138

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = +1

Query  454  LIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRF  633
            + D+ Y +Y+ARF +Q DY +   +GPW I D+Y+ +++WVPNF         + AWVR 
Sbjct  1    MTDIGYKFYIARFTNQDDYHYVLTQGPWMIEDNYLTIRKWVPNFIPDEAPIKVLTAWVRI  60

Query  634  PTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*E  813
              L V+YFD  FL KIG  +G+ +++D+TTS +++G+F R+ V+ID+TKPL SKF +   
Sbjct  61   LNLSVEYFDGNFLHKIGSKIGKVLRIDKTTSNAEKGQFTRLIVEIDLTKPLLSKFWLKGR  120

Query  814  KYPIEYGGLHLVCSKCG  864
             + ++Y GL L+C  CG
Sbjct  121  IWKVQYEGLQLICFNCG  137



>ref|XP_010418769.1| PREDICTED: uncharacterized protein LOC104704363 [Camelina sativa]
Length=371

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 99/172 (58%), Gaps = 0/172 (0%)
 Frame = +1

Query  376  VVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHY  555
            ++GR +    L ++L  LW+P+  M ++DL   +++ RF  + +Y  A   GPW +F +Y
Sbjct  64   MLGRPIPIAVLSRKLRELWKPKGEMYVMDLPRQFFMVRFTQEDEYMGALTGGPWRVFGNY  123

Query  556  IIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSK  735
            ++VQ W   F+   +       WVR   +PV ++ +  L  I  ++G+P+KVD TT    
Sbjct  124  LMVQNWTLAFDPLKDEIVTTPVWVRLLNIPVSFYHQSILMGIASSLGKPLKVDTTTLNFS  183

Query  736  RGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            R +FAR+CV++++++PL+    I  E+Y + Y GL  +CS CGLYG     C
Sbjct  184  RARFARVCVEVNLSRPLKGTVLINGEQYFVAYEGLDRICSSCGLYGHFVHSC  235



>gb|AAC26675.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis 
thaliana]
Length=409

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 107/194 (55%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I + +E    +   + + L+++V+GR +    L +RL  LW+P   M +++L   +++ +
Sbjct  15   ITIGQEVLDAMNDLYLQCLVVKVLGRHITIADLNRRLRELWKPNGGMSVLNLPRSFFMVK  74

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+ + DY  A    PW +    ++++ W P+FN   +     L WVR   LPV Y+ E  
Sbjct  75   FDLEEDYLAAAIGDPWRVLGSILMIRAWSPDFNPIRDEIVTTLVWVRISNLPVNYYHETI  134

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L  I + +G+P+KV+ T    +R  FAR+CV++++ +PL+    +  E Y   Y GL+++
Sbjct  135  LTAIVEGLGKPIKVNLTILRKERAHFARVCVKVNLKQPLKGTVVVNGECYYASYEGLNVI  194

Query  850  CSKCGLYGQKREQC  891
            CS CG++G     C
Sbjct  195  CSLCGVFGHLAGAC  208



>ref|XP_009804250.1| PREDICTED: uncharacterized protein LOC104249509 [Nicotiana sylvestris]
Length=455

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/224 (31%), Positives = 119/224 (53%), Gaps = 8/224 (4%)
 Frame = +1

Query  316  VTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFE  495
            ++ +EK RL + W+ SLII++ G+ + ++YL  ++  LW+      LIDL  DY++ +F 
Sbjct  34   LSNDEKDRLYSTWKYSLIIKLFGKRIMHHYLKVKIQELWKSIKQFPLIDLRSDYFIVKFT  93

Query  496  SQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLW  675
             + + +     GPW +  H++ V +W PNF     +    + W+R P LP +Y+D   L 
Sbjct  94   KEENMNNVLRNGPWFVNGHFLSVIKWQPNFVAGKAQQTNTIVWIRLPQLPTEYYDGALLK  153

Query  676  KIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCS  855
            +IG ++G  +K+D  TS + RG++AR+C Q+ + +P+ +   I      I Y G   +C 
Sbjct  154  RIGNSIGTLLKIDACTSSTLRGQYARLCTQVPLEEPVTTCIQIDSHLQQIIYEGEVFLCK  213

Query  856  KCGLYGQKREQCGLGRK-------EQKATGEEVGVDISTIPAQE  966
              G  G    +C L R+       E    G+E+  D ST+  Q+
Sbjct  214  YYGRMGHTAIRC-LHRQRGKRPIPESTQDGQEIAQDSSTLHKQQ  256



>ref|XP_006282176.1| hypothetical protein CARUB_v10028438mg, partial [Capsella rubella]
 gb|EOA15074.1| hypothetical protein CARUB_v10028438mg, partial [Capsella rubella]
Length=454

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 99/176 (56%), Gaps = 2/176 (1%)
 Frame = +1

Query  412  QRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNL  591
            +RL  +W P+  M +IDL   +++ RFE + +Y  A   GPW +F   ++VQ W P F+ 
Sbjct  80   KRLREMWMPKGAMYVIDLPRRFFMVRFELEEEYLAALTGGPWRVFGSILMVQAWTPEFDP  139

Query  592  ASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQID  771
              +       W+R   +PV  + ++ L+ I + +G P+KVD TT   +R +FARICV+++
Sbjct  140  LVDEIVTTPVWIRLTNIPVNLYHKDILFLIARGLGNPLKVDLTTLNFERARFARICVEVN  199

Query  772  ITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC--GLGRKEQKATGEEV  933
            + KPL+    I   +Y + Y GL  +CS+CGLYG     C  G+  KE  A   +V
Sbjct  200  LAKPLKGTIRINGGRYFVSYEGLTNICSRCGLYGHPVHACPRGINDKETAANARDV  255



>gb|AEL30359.1| RNA-directed DNA polymerase [Arachis hypogaea]
Length=1613

 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/196 (33%), Positives = 108/196 (55%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P +  TKE K  L  P++ +++I+V+ +  GY  L+ +L  +WR +   +L+D+ + Y++
Sbjct  74   PSVSFTKEAKSCLAEPYKEAIVIKVLDKHYGYTALMHKLRIVWRIKGGFDLLDVGFGYFL  133

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
            A+F+   D +     GPW I  HY+ V+ W  +F          L W++   LP+  + E
Sbjct  134  AKFDIATDREKVILGGPWLIDGHYVAVKPWDVDFRPCEKSFGSTLVWIQVSGLPIWCYQE  193

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            + + +I   +G PVKVD  T L++RGK+AR CVQI++  P+     +    Y +EY  L 
Sbjct  194  QAMLRIASAIGIPVKVDLATKLAERGKYARACVQINLELPVIKHIIVEGVTYEVEYESLP  253

Query  844  LVCSKCGLYGQKREQC  891
            L+C+ C  YG  +  C
Sbjct  254  LICATCARYGHDKSLC  269



>gb|KHN24218.1| hypothetical protein glysoja_037052, partial [Glycine soja]
Length=141

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 87/133 (65%), Gaps = 0/133 (0%)
 Frame = +1

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F SQ DY+ + +EGPW + DHY++VQ+W P F + +     I+ W+R   LP++ ++  F
Sbjct  1    FSSQDDYNTSLYEGPWMVEDHYLVVQRWYPFFPMNAKALKNIVVWIRIQCLPIELYNNVF  60

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L +IG ++G+ +KVD+ TS+  RGKF +ICV++D+ KPL     +   K  +EY GLH +
Sbjct  61   LQRIGSSLGKFLKVDKLTSVQSRGKFTKICVELDLEKPLVPHIYVRGYKLNLEYKGLHSI  120

Query  850  CSKCGLYGQKREQ  888
            C +CG +G K+ Q
Sbjct  121  CFRCGCFGHKKGQ  133



>ref|XP_009778425.1| PREDICTED: uncharacterized protein LOC104227795, partial [Nicotiana 
sylvestris]
Length=192

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +T EEK R+  PW+ S    +VG+ + ++YL +++  LW+P  + +LIDL  DYY+ +
Sbjct  22   ITLTDEEKVRIYEPWKNS----IVGKRMLHHYLKRKIQELWKPTEDFQLIDLGVDYYIIK  77

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+ + + D    +GPW I  H++ + +W PNF +   +      W+R P LP +++D + 
Sbjct  78   FKKKENMDKVMNQGPWFINGHFLSITRWKPNFVVTQEKVTNSAVWIRLPQLPTEFYDGKI  137

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEY  831
            L KIG  +G  +K+D  TS + RG++AR+CV++ +  P++    +   K  I Y
Sbjct  138  LEKIGNAIGRLLKIDVCTSTTLRGRYARLCVELPLEVPVQPFIYVGHHKQAIHY  191



>ref|XP_006295736.1| hypothetical protein CARUB_v10024855mg [Capsella rubella]
 gb|EOA28634.1| hypothetical protein CARUB_v10024855mg [Capsella rubella]
Length=479

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 101/176 (57%), Gaps = 0/176 (0%)
 Frame = +1

Query  364  LIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTI  543
            +I++V+G+ +    + +RL  +W+P+  M ++DL   +++ARFE + +Y  A   GPW +
Sbjct  70   MIVKVLGKNISIAAMSRRLKEMWKPKGAMHVLDLPRQFFMARFEHEEEYLEALTGGPWRM  129

Query  544  FDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTT  723
            F  Y++V  W P F+   +        VR   +PV ++ +  L  + + +G P+KVD  T
Sbjct  130  FGSYLMVCAWSPEFDPVRHEIMTTPVLVRVSNIPVIFYHKMILMGMAQGLGRPLKVDLNT  189

Query  724  SLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
               +  +FARICV++D+ KPL+    I  ++Y + Y GL+ +CS CG+YG     C
Sbjct  190  MNIECARFARICVEVDLRKPLKGAIMINGDRYFVSYEGLNSICSGCGVYGHLVHSC  245



>ref|XP_006285413.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
 gb|EOA18311.1| hypothetical protein CARUB_v10006824mg [Capsella rubella]
Length=446

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 97/170 (57%), Gaps = 2/170 (1%)
 Frame = +1

Query  388  TVGYNYL--LQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYII  561
            T+G   L  ++ L  LW+P   M ++DL    ++ RFE + +Y  A   GPW +F  Y++
Sbjct  64   TIGSKVLDVMKGLVKLWKPTGGMYVLDLPRQCFMIRFEREEEYLAALTGGPWKVFGSYLL  123

Query  562  VQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRG  741
            VQ W P+FN   +       W+R   +PV Y+ E+ L  I   +G+PVKVD TT   +R 
Sbjct  124  VQDWSPDFNPLRDDIVTTPVWIRVSNIPVIYYHEDILLGIASGLGKPVKVDLTTLQIERA  183

Query  742  KFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            +FAR+CV+++++KPL+    I  E+Y + Y  L  +CS CG++G     C
Sbjct  184  RFARVCVEVNLSKPLKGSVMINGERYYVAYESLSNICSGCGVFGHLVHNC  233



>ref|XP_004309385.1| PREDICTED: uncharacterized protein LOC101293944, partial [Fragaria 
vesca subsp. vesca]
Length=328

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 110/189 (58%), Gaps = 3/189 (2%)
 Frame = +1

Query  334  RRLRAPWRRSLIIRVVGR---TVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQR  504
             +L   W  S+II+++G+   T  ++++L+ L   W+ +   +L+DL  DY++ +F  + 
Sbjct  32   NKLDFGWHCSVIIKLMGKPNSTNTFDFILKSLRRKWQTKGGWQLVDLPNDYFIVKFNLED  91

Query  505  DYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIG  684
            D +     GPW I    +IV++W  +FN  ++   K+  W+R   LPVK+F    + KIG
Sbjct  92   DMNEVLCGGPWIIAGQTLIVRKWSSDFNPETDVIGKMALWIRICGLPVKFFKPYAIEKIG  151

Query  685  KNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCG  864
            K +G+ VKVD  T    RGKFAR+CV++D+ KPL+    +    Y + Y G+ L+  +CG
Sbjct  152  KILGDVVKVDPITLGQARGKFARVCVEVDLGKPLKPFAEMESVAYSVIYEGISLIGFECG  211

Query  865  LYGQKREQC  891
             +G  +++C
Sbjct  212  CFGHSKDKC  220



>ref|XP_009774449.1| PREDICTED: uncharacterized protein LOC104224474 [Nicotiana sylvestris]
Length=338

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 110/195 (56%), Gaps = 0/195 (0%)
 Frame = +1

Query  307  RIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            ++ ++ E+ +R+  PW+ S+II+++ + + ++YL +++   W+   N  LIDL  DYYVA
Sbjct  20   KVNLSSEDVQRIYDPWKHSVIIKLLVKRIMHHYLRKKVQEQWKISENFPLIDLGTDYYVA  79

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            +F  + +      +GPW I  H + VQ+WVPNF  +  +      WVR P LP ++++  
Sbjct  80   KFTKEENLTKVMHQGPWFINGHLLSVQRWVPNFVASEAKPLNTTIWVRLPHLPTEFYNGV  139

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHL  846
             L KIG  +G  ++VD  TS + RG++AR+ V+I + +P++S   I   K  I Y G + 
Sbjct  140  ILRKIGNTIGRLLRVDACTSATLRGRYARLYVEIHMEQPVKSFIFIGSHKQSIHYEGENF  199

Query  847  VCSKCGLYGQKREQC  891
            +  K    G     C
Sbjct  200  LRKKYSRLGHISPHC  214



>ref|XP_006305928.1| hypothetical protein CARUB_v10011149mg [Capsella rubella]
 gb|EOA38826.1| hypothetical protein CARUB_v10011149mg [Capsella rubella]
Length=245

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 104/188 (55%), Gaps = 0/188 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    + + W++ ++++V+GR V    L ++L  +W P   + ++DL   +++
Sbjct  33   PVITIGEEVLDAMNSLWKQCIVVKVLGRNVSLQVLSRKLKEMWEPIGAIYVVDLPRQFFM  92

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++VQ W P F+   +       WVR   LPV ++ +
Sbjct  93   VRFELEEEYLTALTGGPWKAFGSYLMVQAWSPEFDPLRDDIFTTAVWVRLLNLPVNFYHK  152

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L +I + +G+P+KVD       + +F R+CV++++ KPL+    I  E+Y + Y GL 
Sbjct  153  AILMEIARGLGKPIKVDARALSFVKARFVRVCVEVNLVKPLKGTVLINGERYFVSYEGLS  212

Query  844  LVCSKCGL  867
             + S CGL
Sbjct  213  NIRSMCGL  220



>ref|XP_006289364.1| hypothetical protein CARUB_v10002859mg [Capsella rubella]
 gb|EOA22262.1| hypothetical protein CARUB_v10002859mg [Capsella rubella]
Length=364

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 103/196 (53%), Gaps = 12/196 (6%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + + +E    +   W+  +I++V+GRTV    L ++L  LW+P   M + DL   ++ 
Sbjct  54   PVVTIEEEVLEVMNGLWKLCMIVKVLGRTVPITVLSRKLRELWKPRGAMYVTDLPRQFFT  113

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++            +       WVR   +PV ++ E
Sbjct  114  IRFEVEDEYLAALTGGPWRAFRIYLM------------DDIVTTPVWVRLTNIPVNFYHE  161

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I + +G P+KVD  T    R +FARICV++D++ PL+    I  E+Y + Y GL 
Sbjct  162  TILLSIAEGLGRPLKVDIPTLNIDRARFARICVEVDLSMPLKGTMVINGERYVVSYEGLT  221

Query  844  LVCSKCGLYGQKREQC  891
            ++CS+CG++G    +C
Sbjct  222  VICSRCGIFGHMVHKC  237



>ref|XP_009792247.1| PREDICTED: uncharacterized protein LOC104239331 [Nicotiana sylvestris]
Length=344

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 109/195 (56%), Gaps = 0/195 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++++EK RL   WR S+II+V  R + ++ L  +L+ LW+    + LIDL +D+Y+ +
Sbjct  66   IPLSQDEKERLYFLWRYSVIIKVFKRKIPHHLLRSKLNDLWKLSEQLILIDLGWDFYIVK  125

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +     A   GPW I  +++ V++W P F            W+R P LP +++D++ 
Sbjct  126  FSLEESMVKALHLGPWFISGNFLYVRKWEPKFIPQEATLTSTAIWIRLPQLPTEFYDQDI  185

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G+ +G+ +K+DQ TS +  G++ RIC+Q+ +  P+ +   I   K  + Y     +
Sbjct  186  LEKVGRKLGKLLKIDQYTSSNLSGRYDRICIQVPLKIPVETSVIIGDHKQAVIYEREGTL  245

Query  850  CSKCGLYGQKREQCG  894
            C+ CG  G   + C 
Sbjct  246  CTVCGRIGHTAQNCN  260



>ref|XP_006299187.1| hypothetical protein CARUB_v10015332mg, partial [Capsella rubella]
 gb|EOA32085.1| hypothetical protein CARUB_v10015332mg, partial [Capsella rubella]
Length=388

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 103/196 (53%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I V +E    +   +++ +I+ V+GR V      ++L  LW+P   M ++DL   +++
Sbjct  13   PVITVGQEVVEAMNGLYKQCMIVNVLGRHVTVESFNRKLRELWKPTGGMCVVDLPRQFFM  72

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              F+++ DY  A   GPW +    ++V+ W P F+   +       WVR   +PV ++  
Sbjct  73   VMFDAEEDYLAAMTGGPWRVLGSILMVKAWSPEFDPLCDDIVTTPVWVRISHIPVIFYHR  132

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L    + +G+P++VD TT   +R +F R+CV++++  PL+    I  E+Y + Y GL 
Sbjct  133  AILMGFDEGLGKPLRVDMTTLKMERARFVRVCVEVNLRDPLKGSLLINGERYHVSYEGLT  192

Query  844  LVCSKCGLYGQKREQC  891
             +C  CG+YG     C
Sbjct  193  HICPTCGVYGHMVSGC  208



>ref|XP_010467353.1| PREDICTED: uncharacterized protein LOC104747425 isoform X2 [Camelina 
sativa]
Length=351

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 103/196 (53%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  +    +   W++ +I++V+G+ V    L ++   LW+    M ++DL   +++
Sbjct  80   PVITIHNDVLVAMNGLWKQYMIVKVLGQNVPLPVLSRKFWELWKLRGGMTVLDLPRQFFI  139

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++VQ W P+F+  ++       W R   +P   +  
Sbjct  140  IRFEVEEEYMAAVIGGPWKAFGSYLMVQAWSPSFDPLTDDIFTTPVWNRLSHIPFNLYHR  199

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I  ++G+P+++D  T   +R +FARICV++D+  PL+    I  E+Y + Y GL 
Sbjct  200  SILLGIAGSLGKPIRIDPMTLNVERARFARICVEVDLRNPLKMSVVINGERYFVMYEGLT  259

Query  844  LVCSKCGLYGQKREQC  891
              CS CG+YG     C
Sbjct  260  NTCSGCGVYGHLVHGC  275



>ref|XP_009790993.1| PREDICTED: uncharacterized protein LOC104238354 [Nicotiana sylvestris]
Length=251

 Score =   130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 103/174 (59%), Gaps = 0/174 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP+++E+K RL  PWR S+II++  R + ++ L  +L+ LW+P   + LIDL +D+Y+ +
Sbjct  66   IPLSQEDKERLHLPWRYSVIIKIFKRKMSHHMLRSKLNDLWKPSDQLILIDLGWDFYIVK  125

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +     A   GPW I  +++ V++W P F            W+R P LP ++ D++ 
Sbjct  126  FSLEESMVRALHLGPWFISGNFLFVRKWEPKFVPQEATLTSTAIWIRLPQLPTEFCDKDI  185

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEY  831
            L K+G+ +G+ +K+DQ TS + R ++ARIC+Q+ +  P+ +   I   K  + Y
Sbjct  186  LEKVGRKLGKLLKIDQCTSSTLRERYARICIQVPLETPVETIVIIGDHKQAVIY  239



>gb|KHN27519.1| hypothetical protein glysoja_018631, partial [Glycine soja]
Length=165

 Score =   127 bits (320),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 95/163 (58%), Gaps = 0/163 (0%)
 Frame = +1

Query  364  LIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTI  543
            L++ ++G+ VG+  L  +L+  W  +  +++  +  +YY   F S  DY+ A F+G W +
Sbjct  3    LMVTLLGKRVGFKLLEAKLNCEWAKKGAIKIFYVSREYYQVLFSSNEDYNHAIFDGSWMV  62

Query  544  FDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTT  723
             DHYI+VQ+W   F   +N   K+  W+R P LP + F  EF  ++G  +G  +KVD+  
Sbjct  63   VDHYILVQRWRSFFLANTNVARKLAMWIRVPVLPTELFSNEFFTRLGSTLGVMLKVDKVM  122

Query  724  SLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVC  852
            ++  RG F RICV+I + +PL++K         ++YGGLH +C
Sbjct  123  TVQTRGCFVRICVEIGLDEPLQAKVIARGYLLHLQYGGLHSIC  165



>ref|XP_003623584.1| hypothetical protein MTR_7g072780 [Medicago truncatula]
Length=189

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 90/170 (53%), Gaps = 0/170 (0%)
 Frame = +1

Query  415  RLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLA  594
            R   +W+     E++D +   Y+ + +   D +     GPW IFD  + V  W+  F+  
Sbjct  4    RFQKVWKLHRGFEIMDNDNGLYMMKLDQLADKEKIISGGPWMIFDQCLAVSYWLSEFSSP  63

Query  595  SNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDI  774
            + +   I+  VRFP L + Y+DE FL  I   +G P+KVD  T   +RG+F+R+CV++D+
Sbjct  64   NAKIEHIMVRVRFPCLNLVYYDEIFLLAIASTIGRPIKVDTNTLKVERGRFSRVCVEVDL  123

Query  775  TKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQCGLGRKEQKATG  924
            T P   K  +    Y +++ GLHL+C+ CG YG     C L   E KA  
Sbjct  124  TVPAVGKIWVNGHLYKVQHEGLHLICTNCGCYGHLSRNCPLDTTESKAAA  173



>ref|XP_010467351.1| PREDICTED: uncharacterized protein LOC104747425 isoform X1 [Camelina 
sativa]
 ref|XP_010467352.1| PREDICTED: uncharacterized protein LOC104747425 isoform X1 [Camelina 
sativa]
Length=377

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 103/196 (53%), Gaps = 0/196 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I +  +    +   W++ +I++V+G+ V    L ++   LW+    M ++DL   +++
Sbjct  106  PVITIHNDVLVAMNGLWKQYMIVKVLGQNVPLPVLSRKFWELWKLRGGMTVLDLPRQFFI  165

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW  F  Y++VQ W P+F+  ++       W R   +P   +  
Sbjct  166  IRFEVEEEYMAAVIGGPWKAFGSYLMVQAWSPSFDPLTDDIFTTPVWNRLSHIPFNLYHR  225

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I  ++G+P+++D  T   +R +FARICV++D+  PL+    I  E+Y + Y GL 
Sbjct  226  SILLGIAGSLGKPIRIDPMTLNVERARFARICVEVDLRNPLKMSVVINGERYFVMYEGLT  285

Query  844  LVCSKCGLYGQKREQC  891
              CS CG+YG     C
Sbjct  286  NTCSGCGVYGHLVHGC  301



>ref|XP_008391272.1| PREDICTED: uncharacterized protein LOC103453511 [Malus domestica]
Length=254

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 113/216 (52%), Gaps = 10/216 (5%)
 Frame = +1

Query  334  RRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYD  513
            +++  PW +SLI++++G+      L  RL     P  N  LI+    Y+VA FE + D +
Sbjct  2    KKMCEPWEKSLIVKLLGKPFSIAVLYNRLKGKRGP--NFPLIN---GYFVATFEKKEDLE  56

Query  514  FARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNV  693
            F    GPW I   Y ++ +W P F+ +S++  +   WVR   +  ++ D   L +IG  +
Sbjct  57   FVLAGGPWVISGQYHVIHKWKPGFDASSSKITRTAVWVRILGIQAEFLDVCALKRIGSFL  116

Query  694  GEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYG  873
            G+ +K+D  T    RGKFARICV++D+TK L +   +    + +EY GL  +C KCG+Y 
Sbjct  117  GKALKIDALTLARARGKFARICVELDLTKHLEAYVQLNGAWFNLEYEGLPDICFKCGVYC  176

Query  874  QKREQC-----GLGRKEQKATGEEVGVDISTIPAQE  966
             +R+ C      +G      TG  V +    I A +
Sbjct  177  HRRDXCIVTNEVVGGVSSDVTGMNVDIGGKEIGASD  212



>ref|XP_007227335.1| hypothetical protein PRUPE_ppa015712mg [Prunus persica]
 gb|EMJ28534.1| hypothetical protein PRUPE_ppa015712mg [Prunus persica]
Length=230

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 109/197 (55%), Gaps = 8/197 (4%)
 Frame = +1

Query  358  RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPW  537
             +LIIR++GR+  YNYL  RL   W      +L+DL  DY+V RFE + D +F    GPW
Sbjct  35   NALIIRLLGRSHTYNYLHARLQQKWSLNRGWKLVDLVNDYFVVRFELEEDLNFVLIGGPW  94

Query  538  TIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKY---FDEEFLWKIGKNVGEPVK  708
             I   Y+++++W P F  A  +  +   W+   T   ++   FD   L +I   +G+ +K
Sbjct  95   IIAGQYLVMKKWRPEFCPAIEKIKQ--GWINSTTPSDRFLLCFDVWTLKRIWNFLGKLLK  152

Query  709  VDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQ  888
            +D  T+   +GKFAR+CV++D+++PL +   I    Y +EY GL   C  CG YG KRE 
Sbjct  153  IDALTTSLNQGKFARLCVKLDLSRPLEAFIQINNVWYNVEYEGLPDTCYMCGRYGHKREH  212

Query  889  CGLGRKEQKATGEEVGV  939
            C +   +  A  E+ GV
Sbjct  213  CDV---QDVAPVEKTGV  226



>ref|XP_008227226.1| PREDICTED: uncharacterized protein LOC103326763 [Prunus mume]
Length=557

 Score =   132 bits (331),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 103/204 (50%), Gaps = 0/204 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  ++  K ++  PW+  +II+ VG+T  YN++  RL   WR +  M+L+DL+  +++
Sbjct  22   PSIRFSEHVKNKIYRPWKNYVIIQFVGKTHTYNFVFARLKQRWRLKGPMQLVDLDNGFFI  81

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F  + D  +    G W +   Y+ VQ+W PNF  A     +I  WVR   + V+ F+ 
Sbjct  82   VQFVLEEDMLYVLTGGLWVVAGQYVAVQKWRPNFCAAEEHVSRITVWVRLSGMGVELFNY  141

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
            E +  IG  +G   KVD  T    RGKFAR+ V+I +  PL     +      +EY  L 
Sbjct  142  ETIKCIGDLIGSSYKVDVHTVGQMRGKFARVYVEIHLNMPLIPYLVVEGRSVRVEYENLP  201

Query  844  LVCSKCGLYGQKREQCGLGRKEQK  915
            ++C  C   G  +E C   +   K
Sbjct  202  VICFNCCRVGHSKEHCPFAKPVHK  225



>gb|KHN46281.1| hypothetical protein glysoja_047459, partial [Glycine soja]
Length=129

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 84/129 (65%), Gaps = 0/129 (0%)
 Frame = +1

Query  505  DYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIG  684
            DY+FA  EG W + +HY+I+Q+W P F +   +   +  W++   LP++ +++ FL KIG
Sbjct  1    DYNFALLEGMWMVANHYLILQRWRPLFLMNVEKEKNVAIWIQIQRLPIELYNDVFLNKIG  60

Query  685  KNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCG  864
             ++G+ +KVD+ TS+  RGKFARICV++D+ KPL     +   K  +EY GLH +C  CG
Sbjct  61   SSLGKFLKVDRLTSIHYRGKFARICVELDLEKPLEMHIYVRGHKLYLEYEGLHSICFWCG  120

Query  865  LYGQKREQC  891
            L   K++QC
Sbjct  121  LVRHKKDQC  129



>ref|XP_010490183.1| PREDICTED: uncharacterized protein LOC104767918 [Camelina sativa]
Length=236

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 95/163 (58%), Gaps = 0/163 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P   + KE    ++  W++ +I++V+GR VG + L ++L  LW P+ +M + DL   +++
Sbjct  72   PVATIGKEVLDVMKELWKQCMIVKVLGRNVGISVLNRKLKELWNPKGSMYVTDLLRGFFM  131

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RFE + +Y  A   GPW +F  Y++VQ W P+F+   +       W+R   LPV Y+  
Sbjct  132  VRFEREEEYLAALTGGPWRVFGSYLLVQAWSPDFDPLCDDIVTTPVWIRLSNLPVHYYHR  191

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRS  792
              L  I + +G+P++VD  T   +R +FA ICV +D+++PL+ 
Sbjct  192  AILMGIARGIGDPIRVDLNTMNFERARFACICVAVDLSQPLKG  234



>ref|XP_002534404.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27982.1| conserved hypothetical protein [Ricinus communis]
Length=181

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I ++++E  R+R  W+++LII+++GR++G+NYL + +  LW+ + +++L+ L+ D+Y
Sbjct  59   CPTILLSRDENIRMRKSWKQTLIIKLLGRSIGHNYLFRIVKELWKAKGSIDLVALDNDFY  118

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPT  639
            +A+   + DYDFA FEGPW + DHY+ V++W PNF+   +   ++L WVR P 
Sbjct  119  IAKLSFKNDYDFALFEGPWMVVDHYLTVRRWYPNFDTTQDTVEQLLVWVRLPC  171



>ref|XP_010424626.1| PREDICTED: uncharacterized protein LOC104709762 [Camelina sativa]
Length=246

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 101/180 (56%), Gaps = 0/180 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + KE    +   +R+ +I++V+GR +    + +RL  LW+P   M ++DL   +++
Sbjct  65   PVITIGKEVLDAMNGLFRQCMIVKVMGRHISVEAMNRRLKELWKPRGGMSVLDLPRQFFM  124

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + DY  A   G W +F   ++V+ W P+F+   +       WVR   LPV ++ +
Sbjct  125  VRFDVEEDYLRAVTGGLWRVFGSILMVKTWSPDFDPVRDEIRTRPVWVRIANLPVNFYHK  184

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I   +G+P+KVD T+   +R +FAR+CV++DI + L+    +  E+Y + Y GL+
Sbjct  185  TILMGIAGGLGKPIKVDLTSLRVERARFARVCVEVDIKRQLKGTLMVNGERYYVSYEGLY  244



>ref|XP_002317857.1| hypothetical protein POPTR_0012s00280g [Populus trichocarpa]
 gb|EEE96077.1| hypothetical protein POPTR_0012s00280g [Populus trichocarpa]
Length=288

 Score =   126 bits (317),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 92/167 (55%), Gaps = 0/167 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +  +    L  PW  SLI++++G+ +GY  +  RL  +W      EL+D+ + +++
Sbjct  85   PSVHLDDKVFTELCYPWCDSLIVKLLGKNIGYTQMNIRLKKVWNFAKGFELMDVGHGFFM  144

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F  + D       GPW I DHY+ V+ W P+F   + +    L W R P L V ++DE
Sbjct  145  VKFNQEMDRMKVMNGGPWMILDHYLTVRTWSPSFVSTTAKIDWTLVWARIPDLNVVFYDE  204

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTI  804
             FL  +   +G P+KVD  T    RGKFARIC+++D+ KP+  K  I
Sbjct  205  IFLLALASALGTPIKVDMNTVNVTRGKFARICIEVDLDKPVVGKVWI  251



>ref|XP_006387180.1| hypothetical protein POPTR_1595s00200g, partial [Populus trichocarpa]
 gb|ERP46094.1| hypothetical protein POPTR_1595s00200g, partial [Populus trichocarpa]
Length=447

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 0/117 (0%)
 Frame = +1

Query  541  IFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQT  720
            + +HY+ V+ W PNF+       K+  WVR P L ++Y+D   LWKIG  +G+ +KVD+T
Sbjct  2    VTNHYLTVRTWHPNFDPFEATIDKVAVWVRLPDLALEYYDTSVLWKIGNKIGKTLKVDRT  61

Query  721  TSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            TS+  RG FAR+CV++D+TKPL +KF +      I Y GLHL+C  CG YG K+E C
Sbjct  62   TSVGTRGNFARLCVEVDLTKPLLAKFKLRRRIRRIMYEGLHLICFHCGQYGHKQEIC  118



>ref|XP_009802092.1| PREDICTED: uncharacterized protein At4g02000-like [Nicotiana 
sylvestris]
Length=216

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (57%), Gaps = 0/159 (0%)
 Frame = +1

Query  415  RLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLA  594
            +L SLW+P   + LID   D+++ +F+ + +   A   GPW I  H++ V+ W P F  +
Sbjct  4    KLMSLWKPTEALPLIDFGSDFFLIKFQREENMHKALHGGPWFILSHFLTVRGWEPKFKAS  63

Query  595  SNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDI  774
            S +      WVR P LP +++D E    IG  +G  +K+D  TS + RG++ARI +++ +
Sbjct  64   STQLTYSALWVRLPELPTEFYDLEIFGMIGSKLGRLLKIDTCTSSTTRGRYARIYIEVPL  123

Query  775  TKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
             KPL++   I   +  + Y GL+++C+ CG +G     C
Sbjct  124  EKPLKTHLYIGNHRQTLLYKGLNILCTSCGGFGHPANNC  162



>ref|XP_009795271.1| PREDICTED: uncharacterized protein LOC104241995 [Nicotiana sylvestris]
Length=225

 Score =   124 bits (311),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 94/147 (64%), Gaps = 0/147 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++  +K RL  PW+ S+II++ GR + ++ L  +L +LW+P   + LIDL +D+++ +
Sbjct  79   IPISANDKSRLYEPWKYSVIIKLFGRKIAHHILRNKLINLWKPTEELSLIDLGFDFFLIK  138

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+ + +   + + GPW I +H++ V++W P F  +S +      W+R P LP K++D E 
Sbjct  139  FKKEENMMTSLYGGPWFILNHFLSVRRWEPKFIASSTQLMYSALWMRLPELPTKFYDLEI  198

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFA  750
            L ++G  +G+ +K+D  TS + RG++A
Sbjct  199  LQRVGSKLGKLLKIDSCTSSTSRGRYA  225



>ref|XP_006606936.1| PREDICTED: uncharacterized protein LOC102668273 [Glycine max]
Length=280

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 101/167 (60%), Gaps = 1/167 (1%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P + +       L A W+ +L+I+++G+++G++ + +RL  +W+  A  E++D+++ Y
Sbjct  52   LKPTVIIDDSMFEGLYALWQEALVIKLIGKSIGFHVMKERLTRIWKLNAGFEILDIDHGY  111

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTL-PVKY  654
            Y+  F+ +        E PW IFD+Y+IV+ W P+F        K + W+RFP L  + Y
Sbjct  112  YMVTFDQEAYRVKLIGEEPWMIFDNYLIVELWTPDFISPVASINKTMVWIRFPGLNNLVY  171

Query  655  FDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSK  795
            +DE  L  +   +G+PVKVD      +RG+FAR+C+++++TKP+  +
Sbjct  172  YDETILLALASAIGKPVKVDINPKDVRRGRFARVCIEVNLTKPVVGR  218



>ref|XP_009788839.1| PREDICTED: uncharacterized protein LOC104236581 [Nicotiana sylvestris]
Length=256

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 100/176 (57%), Gaps = 0/176 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +++E++ R+  PW+ SLII+++G+ + ++ L +++   W+   N  LIDL  DYY+ +
Sbjct  73   IQLSEEDQARIYQPWKYSLIIKLIGKKIQHHILKKKIQEAWKIIDNFTLIDLGADYYIVK  132

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +         GPW IF H++ +Q+W PNF     ++     W+R   LP +++D   
Sbjct  133  FNCEEHMIKVLNSGPWFIFGHFLSIQRWKPNFVATEVKSSLTAIWIRLSQLPTEFYDGII  192

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            L KIG  + + +KVD  TS + RG++ R+C+++ +  P+     I   +  I+Y G
Sbjct  193  LAKIGNGISKLLKVDACTSSTLRGRYTRLCIELPLEVPVIPFINIGHHRQTIQYEG  248



>ref|XP_009785842.1| PREDICTED: uncharacterized protein LOC104234049 [Nicotiana sylvestris]
Length=206

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 97/159 (61%), Gaps = 0/159 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +++E++ R+  PW+ SLII+++G+ + ++ L +++   W+   N  LIDL  DYY+A+
Sbjct  25   IQLSEEDQARICQPWKYSLIIKLIGKKIQHHILKKKIQEAWKIIDNFPLIDLGADYYIAK  84

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +         GPW IF +++ +Q+W PNF     ++     W+  P LP +++D   
Sbjct  85   FNCEEHMIKVLNSGPWFIFGYFLSIQRWKPNFMATEVKSSLTAIWICLPQLPTEFYDGII  144

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPL  786
            L KIG  +G+ +KVD  TS + RG++AR+C+++ +  P+
Sbjct  145  LAKIGNAIGKLLKVDACTSSTLRGRYARLCIELPLEVPV  183



>gb|KHN06230.1| hypothetical protein glysoja_030296, partial [Glycine soja]
Length=175

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 86/137 (63%), Gaps = 7/137 (5%)
 Frame = +1

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F+   DY+ A  +GPW I DHYI+VQ W P F LA+    + L++       +  F+E+F
Sbjct  33   FDRYEDYNHAFMKGPWMIVDHYIVVQIWRPLF-LANTLMGRKLSF------QLNLFNEKF  85

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            LW++G  +GE +K+D+ T++  RGKFARICV++D+ KPL+ K  +      ++Y GLH+V
Sbjct  86   LWRLGSTLGEMLKIDKVTTIQSRGKFARICVELDLDKPLQPKAIVREYLLNMQYEGLHVV  145

Query  850  CSKCGLYGQKREQCGLG  900
            C KCG YG +   C  G
Sbjct  146  CFKCGRYGHRERDCVHG  162



>ref|XP_007220807.1| hypothetical protein PRUPE_ppb020060mg [Prunus persica]
 gb|EMJ22006.1| hypothetical protein PRUPE_ppb020060mg [Prunus persica]
Length=383

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/231 (34%), Positives = 105/231 (45%), Gaps = 57/231 (25%)
 Frame = +1

Query  337  RLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDF  516
            R   PW+ +LII+++GR+  YNYL  RL   W      +LIDL  DY+V RF+ + D +F
Sbjct  3    RFCEPWKNALIIKLLGRSHTYNYLHDRLAPKWSLVGGWKLIDLMNDYFVVRFDLEEDLNF  62

Query  517  ARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVG  696
                GPW I  H                                           G  +G
Sbjct  63   VLTRGPWMIAGH-------------------------------------------GNLLG  79

Query  697  EPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQ  876
            + +K+D  T+   RGKFAR+CV++D+ KPL +   I    Y IEY GL  +C  CG YG 
Sbjct  80   KLLKIDSLTTSQNRGKFARLCVELDLNKPLDASVQINQNWYNIEYEGLPDICYLCGCYGH  139

Query  877  KREQC-----GLGRKEQKATG--------EEVGVDISTIPAQEDQLLGPQL  990
            KRE+C      L  +  KA G        + VGV   T+   ED LLGP +
Sbjct  140  KRERCTLKSVNLSDEAGKAQGAGMGPMNRDSVGV-TETVKMAEDSLLGPWM  189



>gb|KHN35462.1| hypothetical protein glysoja_032217, partial [Glycine soja]
Length=141

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 88/140 (63%), Gaps = 0/140 (0%)
 Frame = +1

Query  367  IIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIF  546
            II+++G+++GYN++ ++L  LW+ +A  E++D+   ++  +F+ + D      E PW IF
Sbjct  1    IIKLLGKSLGYNFMREKLRRLWKLKAGFEMLDIGNSFFTIKFDIEEDRIKVNQEDPWMIF  60

Query  547  DHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTS  726
            DHY+ V+ W  +      +    +  +RFP L + Y+DE  +  +   VG+P+KVD  T 
Sbjct  61   DHYLTVRAWSADLISQEAKIDTTMVCIRFPGLYLFYYDESIILAMAATVGKPIKVDTNTK  120

Query  727  LSKRGKFARICVQIDITKPL  786
              +RG+FAR+CV++D+TKP+
Sbjct  121  DVRRGRFARVCVEVDLTKPV  140



>gb|KDO36602.1| hypothetical protein CISIN_1g037725mg, partial [Citrus sinensis]
Length=276

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 100/177 (56%), Gaps = 4/177 (2%)
 Frame = +1

Query  406  LLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNF  585
            L+Q++  L        +IDLE D+Y+  F+++ D   A  +GPWTI  HY+ VQ W   F
Sbjct  70   LVQQIRILVGNVQGFSVIDLENDFYLVWFKTETDAHHALTQGPWTILGHYLTVQPWHLRF  129

Query  586  NLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQ  765
              ++     I+AW+R P +P+ Y+ +  L  +G  +G+ +++D  T  + RGKFARI VQ
Sbjct  130  ESSTKTIDSIIAWIRLPGMPLHYYHKCILRMLGLIIGKVLRIDYNTESATRGKFARIVVQ  189

Query  766  IDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQCGLGRKEQKATGEEVG  936
            + + KPL S+F +  +   +EY  L  +C +CG YG    +C     ++  T +++G
Sbjct  190  VALNKPLVSQFLLDGKIQKMEYESLPTICFECGKYGHVLSEC----PDKHKTNDQIG  242



>ref|XP_006428819.1| hypothetical protein CICLE_v10013460mg, partial [Citrus clementina]
 gb|ESR42059.1| hypothetical protein CICLE_v10013460mg, partial [Citrus clementina]
Length=332

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 110/212 (52%), Gaps = 18/212 (8%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
              P I  +++   +L  PW+ +++++++GR +GY  L  +L  LW       +IDL+  Y
Sbjct  68   FLPSISFSRKVHEQLIKPWQSTVVVKLLGRMIGYKALCSQLEILWPNSGRYSVIDLDNGY  127

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++ +F  + D D+                  W P+F+ ++ +  KI AW+R P +P+ Y+
Sbjct  128  FLVKFRKEDDADYL-----------------WSPHFDSSNEKIDKITAWIRLPGMPLHYY  170

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
             ++ +  +G  +G+ +K+D    L+ RGKFA I V++ +  PL S+F +      +EY  
Sbjct  171  YKKIIRMLGHVIGKVIKIDYNMELATRGKFACIAVEVSLESPLISQFLLDGRIQRVEYEA  230

Query  838  LHLVCSKCGLYGQKREQCGLGRKEQKATGEEV  933
            L  +C  CG YG     C L +   KA GE++
Sbjct  231  LPTICFGCGKYGHTSSSC-LDKLILKARGEKM  261



>ref|XP_010263702.1| PREDICTED: uncharacterized protein LOC104601894 [Nelumbo nucifera]
Length=332

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 80/129 (62%), Gaps = 0/129 (0%)
 Frame = +1

Query  505  DYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIG  684
            DYD A F+GPW + + Y+ + +W P+F  A         WVR   LP++YFD+E L  IG
Sbjct  148  DYDKAMFQGPWIVANQYLSLCKWRPDFRAAREEINNTAVWVRVAELPIEYFDQEVLELIG  207

Query  685  KNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCG  864
              +G  VK+D  T L+ RG+FAR+CV+ID+ K L+++  +  + Y + Y  L L+C  CG
Sbjct  208  NKIGRLVKIDSVTQLASRGRFARLCVEIDLRKALKTRIKVEGQWYVVIYERLPLICFSCG  267

Query  865  LYGQKREQC  891
            + G K+++C
Sbjct  268  VVGHKKDEC  276



>gb|KHN04719.1| hypothetical protein glysoja_041220, partial [Glycine soja]
Length=170

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 99/187 (53%), Gaps = 19/187 (10%)
 Frame = +1

Query  313  PVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARF  492
            P  K   + L APW  +L+++++G+++G++ + +RL  +W+  A  +++D+  +Y++  F
Sbjct  1    PYFKISVKSLCAPWNEALVVKLLGKSIGFHTMKERLSRIWKLFAGFDILDIGNEYFMVSF  60

Query  493  ESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFL  672
            +   D      +GP  I DHY+IV                   W+ F  L   Y+D   L
Sbjct  61   DMDVDRMKVIEDGPCLILDHYLIV-------------------WICFLGLNPIYYDNSIL  101

Query  673  WKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVC  852
              +   +G P+KVD  T   KRG+F R+C+++D+TKP+  +  +    Y ++Y GLH +C
Sbjct  102  LALAFAIGTPIKVDINTKYVKRGRFTRVCIEVDLTKPVMGRVWMKVYWYQVQYVGLHQIC  161

Query  853  SKCGLYG  873
              C  YG
Sbjct  162  GICSCYG  168



>ref|XP_010693413.1| PREDICTED: uncharacterized protein LOC104906370 [Beta vulgaris 
subsp. vulgaris]
Length=203

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 100/160 (63%), Gaps = 0/160 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +TK+EKR++R PW  +LIIR+   ++GY  L++ L   W+ + ++ L D+   Y+
Sbjct  44   CPIILLTKDEKRKIRQPWTTTLIIRMFDGSLGYMSLMKILKKKWKLKGDLALTDIGSKYF  103

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF ++ DY F   + PW I D Y+ +++W PNF         +  W+R   L V+YFD
Sbjct  104  IARFSNREDYHFVLTQDPWLIDDTYLTIRKWSPNFIPEEASINVLTTWLRIHNLSVEYFD  163

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITK  780
            ++FL KIG  +G+  +VD++ + + R +F R+ V++D+ K
Sbjct  164  KDFLHKIGSEIGKVFRVDKSKANADRRQFTRLSVEVDLAK  203



>ref|XP_010684971.1| PREDICTED: uncharacterized protein LOC104899471 [Beta vulgaris 
subsp. vulgaris]
Length=243

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +1

Query  526  EGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPV  705
            EGPW I + Y+ +++WVPNF         + AWVR P L V+YFD++ L KIG  +G+ +
Sbjct  65   EGPWMIGESYLTIRRWVPNFIADEAPIKTLTAWVRIPHLSVEYFDKQILHKIGSKIGKVI  124

Query  706  KVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKRE  885
            K+D+ T    RG + R C+++D++KPL SKF +    + I+Y GL L+C KCG  G + +
Sbjct  125  KIDRNTESMDRGPYVRFCIEVDLSKPLLSKFVLNKRTWIIQYEGLKLICFKCGRLGDRED  184

Query  886  QC  891
             C
Sbjct  185  NC  186



>ref|XP_010474076.1| PREDICTED: uncharacterized protein LOC104753532 [Camelina sativa]
Length=269

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 84/148 (57%), Gaps = 0/148 (0%)
 Frame = +1

Query  448  MELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWV  627
            M +IDL   +++ RFE + +Y  A   GPW  F  Y++V  W   F+   +     L W+
Sbjct  1    MYVIDLPRQFFMVRFELEDEYLTALTGGPWRAFGSYLMVLAWTSEFDTLVDEIVTTLGWI  60

Query  628  RFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA  807
            R   +PV ++ +  L  I K +G+PVKVD TT   +RG+FARICV++++ + L+    I 
Sbjct  61   RLSNIPVSFYHKALLMIIVKGLGKPVKVDLTTLNFERGRFARICVEVNLKRLLKGTIMIN  120

Query  808  *EKYPIEYGGLHLVCSKCGLYGQKREQC  891
             E+Y + Y GL  +CS CG++G     C
Sbjct  121  GERYFVSYEGLKNICSLCGMFGHVVHSC  148



>ref|XP_008345657.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like protein kinase At5g49770 [Malus domestica]
Length=1223

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 92/146 (63%), Gaps = 0/146 (0%)
 Frame = +1

Query  448  MELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWV  627
            M+LID+++D+ + +F+ + D +F    GPW I   Y+++Q+W   F LA+     +  W 
Sbjct  1    MQLIDIDHDFNIVKFDLEEDKEFVLTGGPWIIAGQYLMIQKWRLGFVLATEVITHMAIWF  60

Query  628  RFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA  807
            R   +P++YF+   + KIG  +G+ +K+D  T+   RGKFARICV++D+T+PL +   I 
Sbjct  61   RILGVPIEYFNVWAMRKIGCVLGKLLKIDVNTNPQYRGKFARICVELDVTEPLEAFIQIN  120

Query  808  *EKYPIEYGGLHLVCSKCGLYGQKRE  885
              +Y +EY G+  +C +CG YG KRE
Sbjct  121  KGRYDLEYKGMPEICFRCGCYGHKRE  146



>ref|XP_010412659.1| PREDICTED: uncharacterized protein At4g02000-like [Camelina sativa]
Length=155

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 80/137 (58%), Gaps = 0/137 (0%)
 Frame = +1

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            + RFE + +Y FA   GPW  F  Y++VQ W P F+   +     L W+R   +P+ ++ 
Sbjct  1    MVRFELEDEYLFALTGGPWRAFGSYLMVQAWTPEFDPLVDEIMTTLVWIRLSNIPISFYH  60

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGL  840
            +  L  I K++G+P+KVD TT   +RG+FARICV++++ +P +    I  E+Y + Y  L
Sbjct  61   KALLMSIAKSLGKPIKVDLTTLNFERGRFARICVELNLKRPFKGTIMINGEQYFVSYEWL  120

Query  841  HLVCSKCGLYGQKREQC  891
              +CS CG++G     C
Sbjct  121  TNICSLCGMFGHVVHIC  137



>ref|XP_010480590.1| PREDICTED: uncharacterized protein LOC104759346 [Camelina sativa]
Length=254

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 100/181 (55%), Gaps = 0/181 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +  E    +   W++ +I++V+GR +    L ++L  LW P+  M ++DL   +++
Sbjct  61   PVVTIGAEILDVMNGMWKQCMIVKVLGRNISIAVLSRKLRELWNPKGGMYVLDLPRQFFM  120

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + ++  A   GPW  F  Y++V+ W P F+   +       W+R   +P+ ++ +
Sbjct  121  IRFDIEEEFLAALTGGPWKAFGSYLMVKAWSPEFDPLRDEIVMTPVWIRLTNIPLNFYHQ  180

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L ++ K +G P+KV+  T   +R +FAR+ V++++ KPL+    I  E+Y + Y GL 
Sbjct  181  SILMRLAKGLGSPIKVNMMTLNVERARFARVYVEVNLRKPLKGTIMINGERYFVAYEGLT  240

Query  844  L  846
            +
Sbjct  241  I  241



>ref|XP_009781293.1| PREDICTED: uncharacterized protein LOC104230235 [Nicotiana sylvestris]
Length=177

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 87/151 (58%), Gaps = 0/151 (0%)
 Frame = +1

Query  424  SLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNR  603
            +LW+P     LIDL   Y++ +F  + + +    +G W +F H++ VQ+W PNF  A ++
Sbjct  24   TLWKPTEVFPLIDLGEQYFIVKFNKEENLETILQKGSWFVFGHFLSVQRWEPNFVPAMDK  83

Query  604  T*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKP  783
                  W+  P LP +++D++ L K+G  +G+ +KVD  TS +  G++ R+C+++ + KP
Sbjct  84   QVLTAIWIHLPNLPTEFYDKKILKKVGNTIGKLLKVDAFTSAALMGRYVRLCIELPLDKP  143

Query  784  LRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQ  876
            ++S   I   K  I Y G +L+C  CG  G 
Sbjct  144  VKSNVWIGNHKQQILYEGKNLLCRNCGCLGH  174



>ref|XP_009140418.1| PREDICTED: uncharacterized protein LOC103864421 [Brassica rapa]
Length=245

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 84/148 (57%), Gaps = 0/148 (0%)
 Frame = +1

Query  448  MELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWV  627
            M ++DL   +++ RFE + +Y  A   GPW +F  Y++V+ W P F+   +       W+
Sbjct  1    MYVMDLPRQFFMIRFEKESEYLAALTGGPWRVFGSYLMVRAWSPEFDPLRDDIVTTPIWI  60

Query  628  RFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA  807
            R   +PV ++    L  I K +G+ ++VD TT   +R +FAR+CV++++ KPL+    I 
Sbjct  61   RLTNIPVNFYHRSILMGIAKGLGKTIRVDLTTLNFERARFARVCVEVNLEKPLKGTVLIN  120

Query  808  *EKYPIEYGGLHLVCSKCGLYGQKREQC  891
             E Y + Y GL  + SKCG+YG    +C
Sbjct  121  GEMYFVAYEGLSEIWSKCGIYGHMVHEC  148



>ref|XP_010424323.1| PREDICTED: uncharacterized protein LOC104709398 [Camelina sativa]
Length=246

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 95/191 (50%), Gaps = 27/191 (14%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + +  E    +   W+  +I++++ R V  + L +RL  +W+P   M ++DL  ++++
Sbjct  79   PVVTIGYEVLEAMYGLWKNCMIVKMLRRNVSVSVLSKRLREMWKPVGKMAMLDLPRNFFM  138

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW +F  Y++ Q W P                           E
Sbjct  139  IRFDVEAEYMAALTGGPWRVFGSYLLTQAWTP---------------------------E  171

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLH  843
              L  I K  G+P+K    T   +R +FAR+CV++++ +PL+    +  E+Y + Y GL 
Sbjct  172  SILMSIAKGFGKPLKFYLNTLNVERARFARVCVEVNLKRPLKGTVMVNGERYFVSYEGLS  231

Query  844  LVCSKCGLYGQ  876
             +CS+CG+YG 
Sbjct  232  AICSRCGMYGH  242



>gb|KHN25996.1| hypothetical protein glysoja_046925 [Glycine soja]
Length=134

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  526  EGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPV  705
            EGP  +FDHY+ +Q W P F   +    K + W+RFP L + ++DE  L  +   VG P+
Sbjct  3    EGPLMVFDHYLTMQLWSPEFASPTTTIDKKMVWIRFPGLNLYFYDESILLALATRVGSPI  62

Query  706  KVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKRE  885
            K ++ T    RG+ AR+C+++D+ KP+  K  +    Y +EY GLH +CS CG YG    
Sbjct  63   KANENTLDFTRGRVARVCIEVDLNKPVIGKVWMKGHWYKVEYEGLHHICSNCGCYGHLIR  122

Query  886  QC  891
            +C
Sbjct  123  EC  124



>ref|XP_010694032.1| PREDICTED: uncharacterized protein LOC104906902 [Beta vulgaris 
subsp. vulgaris]
Length=226

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 78/124 (63%), Gaps = 0/124 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I ++K+EK+RL  PW+ +LII++    +GY  L++RL   W  +  + L D+ +DY+
Sbjct  103  CPIILLSKKEKKRLCHPWKHALIIKMFNGKIGYMSLIKRLKKKWELKGGLTLTDIGHDYF  162

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            +ARF    DY+    +GPW   D+Y+ +++W+PNF         + AWVR P L V+YFD
Sbjct  163  IARFSLLDDYNHVLTQGPWMFDDNYLTIRKWIPNFFPDDTPMPFLTAWVRIPHLSVEYFD  222

Query  661  EEFL  672
            +EFL
Sbjct  223  KEFL  226



>gb|KDO74197.1| hypothetical protein CISIN_1g037882mg, partial [Citrus sinensis]
Length=396

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 96/188 (51%), Gaps = 27/188 (14%)
 Frame = +1

Query  358  RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPW  537
             S++I+ +GR +GY  + +RL  +W       +IDL  DYY+  + +++D ++A  EGPW
Sbjct  2    NSVVIKTLGRNLGYRVINERLKRIWSSTMGFSIIDLANDYYLVHYRNEKDVEYALTEGPW  61

Query  538  TIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQ  717
            T+  HY+ VQQW  +F++A+N+   I+AW+R   + + ++ +             +K+D 
Sbjct  62   TVIGHYLTVQQWSSDFDIATNKIDHIVAWIRLSGINIHFYYKTI-----------IKIDY  110

Query  718  TTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQCGL  897
                ++RGKFA I  +I                  +EY  L L+C  CG +G  ++ C  
Sbjct  111  NIVATQRGKFAHIAGRIQ----------------KVEYENLPLICFYCGKFGHYKDACPD  154

Query  898  GRKEQKAT  921
            G     AT
Sbjct  155  GGVTPLAT  162



>ref|XP_006285575.1| hypothetical protein CARUB_v10007019mg [Capsella rubella]
 gb|EOA18473.1| hypothetical protein CARUB_v10007019mg [Capsella rubella]
Length=311

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 102/180 (57%), Gaps = 8/180 (4%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEG  531
            W++ + ++V+G+ +        + ++ R EA M ++D+   +++ RFE +++Y  A   G
Sbjct  72   WKQRMFVKVLGKNIS-------IAAMSRREA-MHVLDMPRQFFMVRFEIEKEYLEALIGG  123

Query  532  PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKV  711
            PW  F  Y++V+ W  +F+   +      AW+R   + V ++ +  L  + + +G P+K+
Sbjct  124  PWRAFGSYMMVRAWSLDFDPLWHEIMTTPAWIRVSNILVIFYQKTILMGMARGLGRPLKL  183

Query  712  DQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
               T   +R +FARICV++D+ KPL+ K  I  ++Y + Y GL+L+CS  G+YG     C
Sbjct  184  YLNTMNIERARFARICVEVDLRKPLKGKIMINGDRYFVSYEGLNLICSGYGVYGHLVHSC  243



>ref|XP_010673145.1| PREDICTED: uncharacterized protein LOC104889585 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 93/194 (48%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            +P++KEE   L  PW  S+I +V+G++  Y +L Q L  LW+ +  +++I     ++  +
Sbjct  44   VPISKEEYEELSKPWETSVICKVLGKSFSYEFLQQELRKLWKWDGKLDIIAFGKGFFSIK  103

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
              S         EGPW I  H I VQ W P F  +S    +   W+  P LP++++  + 
Sbjct  104  CGSSERRSSILAEGPWFILGHLIWVQPWTPGFQPSSACINQFPVWLHLPELPMEFYTRKI  163

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KIG  VG+ +KVD  +    R ++A IC  +D  K L     I      + +      
Sbjct  164  LEKIGNGVGKTIKVDSHSLEGGRRRYAAICTLVDGKKKLPMTTRIGGVTQKLIFVEGPWW  223

Query  850  CSKCGLYGQKREQC  891
            CS C L G   + C
Sbjct  224  CSHCKLVGHSNKSC  237



>ref|XP_009772651.1| PREDICTED: uncharacterized protein LOC104222998 [Nicotiana sylvestris]
Length=224

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 87/140 (62%), Gaps = 2/140 (1%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I ++ EE +RL  PW+ SLII++ G+ + + YL ++L   W+P     LIDL  D+Y+ +
Sbjct  84   IILSSEEMQRLYEPWKYSLIIKLFGKRILHQYLKKKLLEHWKPIEQSPLIDLGNDFYIVK  143

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILA-WVRFPTLPVKYFDEE  666
            F  + +   A  +GPW I  HY+ V++WVPNF +AS    +I A W+R P LP +++D  
Sbjct  144  FFEEVNLSKALHQGPWFINGHYLSVKKWVPNF-VASKEKLQISAVWLRLPQLPTEFYDST  202

Query  667  FLWKIGKNVGEPVKVDQTTS  726
             L +IG  +G+ +K+D  TS
Sbjct  203  ILARIGNKIGKLLKIDACTS  222



>ref|XP_008370578.1| PREDICTED: uncharacterized protein LOC103434047 [Malus domestica]
Length=393

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 86/151 (57%), Gaps = 0/151 (0%)
 Frame = +1

Query  439  EANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KIL  618
            + N ++    + + V  F S  D +F    GPW I   Y+++Q+W   F  A+     + 
Sbjct  65   KGNTQISGPAWGWLVGSFGSAEDKEFVLTGGPWIIAGQYLMIQKWRLGFVPATEVITHMA  124

Query  619  AWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKF  798
             W R   +P++YF+   + KIG  +G+ +K+D  T+   RGKFA+ICV+ID+T+PL +  
Sbjct  125  IWFRILGVPIEYFNVWAMRKIGCVLGKLLKIDVNTNPQYRGKFAKICVEIDVTEPLEAFI  184

Query  799  TIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
             I   +Y +EY G+  +C +CG YG KRE C
Sbjct  185  QINKGRYDLEYKGMPEICFRCGCYGHKRESC  215



>ref|XP_006285939.1| hypothetical protein CARUB_v10007452mg, partial [Capsella rubella]
 gb|EOA18837.1| hypothetical protein CARUB_v10007452mg, partial [Capsella rubella]
Length=309

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 79/150 (53%), Gaps = 15/150 (10%)
 Frame = +1

Query  442  ANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILA  621
             +M ++DL   +++ R++++ DY  A   GPW +F   ++VQ W P FNL          
Sbjct  1    GSMCVLDLPRQFFMVRYDAEDDYMAAMTSGPWRVFGSILMVQAWSPTFNLVCEEIVTTPV  60

Query  622  WVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFT  801
            WVR   +P+ ++ E  L  I + VG+P+KVD TT   +R  FA +CV++D++KPL+    
Sbjct  61   WVRIAHIPISFYHETILMGIAERVGKPLKVDLTTLKMERASFAHVCVEVDLSKPLK----  116

Query  802  IA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
                       GL  +C  CG+YG     C
Sbjct  117  -----------GLTNICPTCGVYGHTVYAC  135



>gb|KDO35980.1| hypothetical protein CISIN_1g037800mg [Citrus sinensis]
Length=402

 Score =   112 bits (281),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 92/169 (54%), Gaps = 11/169 (7%)
 Frame = +1

Query  511  DFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKN  690
            +F   +GPWT+  HY+IVQ W P F+ +      ++ W+R P + + Y+ +  L  IG+ 
Sbjct  2    EFVLTQGPWTLMGHYLIVQLWSPQFDSSKEECDSVIVWIRLPGMALHYYHKRILRMIGQV  61

Query  691  VGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLY  870
            +G  V+V+  T  + RGKFARI V++ ++KPL S+F +  +   +EY  L  +C  CG Y
Sbjct  62   IGNVVRVNYNTESATRGKFARIAVEVSLSKPLVSQFLLDGKVQKVEYENLPFICFSCGKY  121

Query  871  GQKREQC---GLGRKEQ---KATGEEVGVDISTIPAQEDQLLGPQLIAT  999
            G   E C   GLG ++     A G++ G D      Q +   GP ++ +
Sbjct  122  GHYYEACPDRGLGGEKTTTAAAPGKDAGRD-----DQNEPKFGPWMVVS  165



>gb|KHN14868.1| hypothetical protein glysoja_045073, partial [Glycine soja]
Length=124

 Score =   107 bits (267),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = +1

Query  541  IFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQT  720
            I+DHY+IV++W PNF+  S     +   VRF  LP+ Y+D   L  +G ++   V+VD++
Sbjct  2    IYDHYLIVREWCPNFHPNSQPIEFVAIQVRFFGLPIHYYDGNILCALGNHIRRTVRVDRS  61

Query  721  TSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            T  +++GK+ ++CV++D+TKPL + F I    Y IEY GLH +C  CG +G   E C
Sbjct  62   TWTNEKGKYTKLCVEVDLTKPLLALFKINQRYYKIEYKGLHFLCLGCGRFGHYVEGC  118



>ref|XP_009792816.1| PREDICTED: uncharacterized protein LOC104239798 [Nicotiana sylvestris]
Length=211

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 82/139 (59%), Gaps = 0/139 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +++E++ R+  PW+ SLII+++G  + ++ L +++  +W+   N  LIDL+ DYY+A+
Sbjct  70   IQISEEDQARIYQPWKFSLIIKLIGMRIQHHILKRKVQEVWKIPKNFPLIDLDADYYIAK  129

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  Q         GPW IF H + +Q+W PNF     +      W+R P LP +++ E  
Sbjct  130  FNCQEHMVKVLSFGPWFIFGHVLSIQRWKPNFVATEFKNSLTAIWIRLPRLPTEFYGEIV  189

Query  670  LWKIGKNVGEPVKVDQTTS  726
            + KIG  +G+ +KVD  TS
Sbjct  190  MAKIGNAIGKLLKVDACTS  208



>ref|XP_008381949.1| PREDICTED: uncharacterized protein LOC103444784 [Malus domestica]
 ref|XP_008391274.1| PREDICTED: uncharacterized protein LOC103453513 [Malus domestica]
Length=148

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 79/143 (55%), Gaps = 0/143 (0%)
 Frame = +1

Query  334  RRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYD  513
            +++  PW +SLI++++G+      L  RL   W P    +L+DL   Y+VA FE + D +
Sbjct  2    KKMCEPWEKSLIVKLLGKPFSIAVLYNRLKGKWGPNVGFKLVDLINGYFVATFEKKEDLE  61

Query  514  FARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNV  693
            F    G W I   Y ++ +W P F+ +S++  +   WVR   +  ++ D   L +IG  +
Sbjct  62   FVLTGGLWVISGQYHVIHKWKPGFDASSSKITRTAVWVRILGIQAEFLDVCALKRIGSFL  121

Query  694  GEPVKVDQTTSLSKRGKFARICV  762
            G+ +K+D  T    RGKFARICV
Sbjct  122  GKALKIDALTLARARGKFARICV  144



>ref|XP_009758586.1| PREDICTED: uncharacterized protein LOC104211257 [Nicotiana sylvestris]
Length=272

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  526  EGPWTIFDHYIIVQQWVPNFNLASNRT*KILA-WVRFPTLPVKYFDEEFLWKIGKNVGEP  702
            +GPW ++  ++ VQ+W+PNF +AS  T    A W+R P LP +++D+E L K+G ++G  
Sbjct  7    KGPWFLYGFFLSVQRWIPNF-VASKATQSYTAIWIRLPQLPTEFYDKEILQKVGSSIGRL  65

Query  703  VKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKR  882
            +KVD  TS++ RG++AR+CV++ + KP+     I   K  I Y G  L+C+ CGL G  +
Sbjct  66   LKVDACTSVALRGRYARLCVELPLNKPVTPFLFIDSHKQFILYEGDKLLCTSCGLLGHTK  125

Query  883  EQCGLGRKEQK  915
             QC   +  QK
Sbjct  126  PQCHHPKSMQK  136



>ref|XP_009789326.1| PREDICTED: uncharacterized protein LOC104236971 [Nicotiana sylvestris]
Length=278

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/206 (28%), Positives = 105/206 (51%), Gaps = 21/206 (10%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP+T+++K  L  PW  S+I +V+ + + ++ L  +L+ LW+    + LIDL +D+Y+ +
Sbjct  46   IPLTEDDKECLYLPWCYSVINKVLKQKMSHHLLRSKLNDLWKTSEQLILIDLGWDFYIVK  105

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  +     A   GPW I  +++ +                     R P LP +++D++ 
Sbjct  106  FSLEESMVKALHLGPWFISGNFLSI---------------------RLPQLPTEFYDQDI  144

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G+ +G+  K+DQ TS + R ++ARIC+Q+ +   +++   I   +  + Y G   +
Sbjct  145  LEKVGRKLGKLFKIDQCTSSTLRERYARICIQVPLETLVKTSVIIGDHEQAVIYEGEGTL  204

Query  850  CSKCGLYGQKREQCGLGRKEQKATGE  927
            C+ CG  G   + C        AT E
Sbjct  205  CTVCGRIGHTAQICNYRAPTPTATHE  230



>gb|KEH41789.1| endonuclease/exonuclease/phosphatase family protein [Medicago 
truncatula]
Length=1456

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 82/143 (57%), Gaps = 0/143 (0%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P + V       L  P++  LI++++G+++GYN +  RL  +W+     +L+++E  +
Sbjct  304  LLPMLHVQDSVMEELNLPYKGCLIVKLLGKSIGYNMMKTRLERVWKLTGGFDLMEVENSF  363

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++  F+ + D +     GPW IFDHY+   QW P FN A+    K +AW+R P+L + Y+
Sbjct  364  FMVIFDEEADKNKVINGGPWMIFDHYLAFCQWSPTFNAATATIDKTMAWIRIPSLNLVYY  423

Query  658  DEEFLWKIGKNVGEPVKVDQTTS  726
            DE  LW +   VG  VK++ T S
Sbjct  424  DESLLWAVASMVGTLVKLELTES  446



>gb|KHN47225.1| hypothetical protein glysoja_035016, partial [Glycine soja]
Length=172

 Score =   106 bits (264),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 97/193 (50%), Gaps = 25/193 (13%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P+  +      +L   W++ L+++++G+ +G+  L  +L S W+     +L+D++  Y
Sbjct  4    LLPKFSLDATVFTKLCESWKKFLVLKLLGKRIGFLALRDKLKSQWKCSGGFDLMDVDNGY  63

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++  F+ + D + A                          +     L W+ FP L + Y+
Sbjct  64   FLITFDFEDDKNKA------------------------IKDNIDTTLVWILFPNLGMVYY  99

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
            D+  L  I   +G P++VD  T+   RG+F R+C++ID+T  L  KF +  + Y +EY G
Sbjct  100  DDSVLLTIALAMGTPLRVDMNTANLVRGRFTRVCIEIDLT-VLVGKFYLNGKWYNVEYEG  158

Query  838  LHLVCSKCGLYGQ  876
            LH++C+ CG YG 
Sbjct  159  LHILCASCGCYGH  171



>ref|XP_006388296.1| hypothetical protein POPTR_0241s00200g, partial [Populus trichocarpa]
 gb|ERP47210.1| hypothetical protein POPTR_0241s00200g, partial [Populus trichocarpa]
Length=212

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 85/162 (52%), Gaps = 15/162 (9%)
 Frame = +1

Query  391  VGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQ  570
            +G+  L  RL +L +     EL+D+   +++ +F  + D      EGPW +FDH++ V+ 
Sbjct  1    IGFYQLNTRLKNLSKLTGGFELMDVANGFFMVKFGLEVDKTKVINEGPWMVFDHHLAVRS  60

Query  571  WVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFA  750
             +PN                 P+L + ++DE  L  +   + +P+KVD  TS   RG FA
Sbjct  61   RIPN---------------SIPSLNLAFYDENLLMAMTSAISKPIKVDMHTSNVDRGGFA  105

Query  751  RICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQ  876
            R+CV+I++ KP+  +  I    Y +EY  LH++  KCG YG 
Sbjct  106  RVCVEIELKKPVAGRVWITYHWYNVEYKELHIIYRKCGCYGH  147



>gb|KHN30016.1| hypothetical protein glysoja_049086 [Glycine soja]
Length=173

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (58%), Gaps = 9/135 (7%)
 Frame = +1

Query  382  GRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYII  561
            G  VG+  L  +LH  W  E  + + DL  ++YV +F S  DY  A ++G W I DH I+
Sbjct  33   GWKVGFKRLEAKLHRDWEKEGKIRITDLPCNFYVVQFTSLVDYKLALYDGLWLIADHCIL  92

Query  562  VQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRG  741
            VQ+W P F         +  WVR P+LP++  +E FL ++G+ +G+  KVD  TS+  RG
Sbjct  93   VQRWHPMF---------MENWVRIPSLPLELCNEVFLRRVGEKLGKFRKVDCLTSIHSRG  143

Query  742  KFARICVQIDITKPL  786
               R+C++I++ + L
Sbjct  144  LLVRVCIEINLERKL  158



>ref|XP_010689853.1| PREDICTED: uncharacterized protein LOC104903510 [Beta vulgaris 
subsp. vulgaris]
Length=228

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +1

Query  547  DHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTS  726
            D+Y+ +++WVPNF         + A VR P L ++YFD+EFL KIG  +G+ +++DQ T+
Sbjct  4    DNYLTIRKWVPNFIPDDKPMRFLTARVRIPQLSIEYFDKEFLLKIGNKIGKVMRIDQHTT  63

Query  727  LSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQCGL  897
             ++RG+F R+ +++D++KPL SKF +    + I+Y GL L+C  CG  G   E C L
Sbjct  64   NAERGQFTRLSIELDLSKPLLSKFWLKGRIWKIQYEGLRLICFNCGKIGHMAENCTL  120



>ref|XP_006279401.1| hypothetical protein CARUB_v10007980mg [Capsella rubella]
 gb|EOA12299.1| hypothetical protein CARUB_v10007980mg [Capsella rubella]
Length=435

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 107/219 (49%), Gaps = 19/219 (9%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I V +E    +   W+  +I++V+   V      ++L  LWRPE  M ++DL   +++  
Sbjct  63   ITVGEEVLEAMYGLWKNCMIVKVLRSYVLIAVQNRKLRELWRPEGAMTVMDLPRQFFLVL  122

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            FE + +Y  A   G W+              F+   +       WVR   +PV Y+ E  
Sbjct  123  FEKEEEY-MAALAGAWS------------AKFDPLKDDIVTAHVWVRLNNIPVFYYHESI  169

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L +I + +G+ ++VD TT   +R +FA +CV+++++KPL+    +  + Y + Y GL  +
Sbjct  170  LLEIARGLGQLLRVDMTTLQFERARFAWVCVEVNLSKPLKGTKVVNGKIYLVAYEGLAKI  229

Query  850  CSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIPAQE  966
            CS+CGLYG     C       + T E   V ++  P QE
Sbjct  230  CSECGLYGHLIHSC------PRRTSEMERVMVAANPVQE  262



>ref|XP_010463487.1| PREDICTED: uncharacterized protein LOC104744173 [Camelina sativa]
Length=271

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 84/154 (55%), Gaps = 0/154 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P + + +E    +   W+R +I++V+GR V    L ++L  LWRP   M +++L   +++
Sbjct  42   PMVSIAEEVLDAMNGLWKRCMIVKVLGRNVALPVLTRKLKELWRPSGAMYVMELPRQFFM  101

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
              FE + +Y  A  EGPW  F   ++V+ W P+F+   +       W+RF  L   ++ E
Sbjct  102  IHFELEEEYMAALTEGPWRAFGSNLMVRDWAPDFDPLRDEIVTTPVWIRFSNLRFNFYHE  161

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQ  765
              L  I   +G+P++VD TT   +RG+FAR  V+
Sbjct  162  AILMGIAGGLGKPLRVDGTTLNLERGRFARKMVE  195



>ref|XP_007216733.1| hypothetical protein PRUPE_ppa025421mg [Prunus persica]
 gb|EMJ17932.1| hypothetical protein PRUPE_ppa025421mg [Prunus persica]
Length=332

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 77/171 (45%), Gaps = 28/171 (16%)
 Frame = +1

Query  379  VGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYI  558
            +G  + Y +L  RL   W  +  M LIDLE +Y++ +F  + D  +    GPW I   YI
Sbjct  1    MGHPLAYTFLRSRLLQRWALKGPMSLIDLENNYFIVKFLYEEDMRYVFTGGPWQIAGQYI  60

Query  559  IVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKR  738
            + Q+W P FN    +   + AW                            VD  T    R
Sbjct  61   VTQKWKPGFNAKEEKITHMTAW----------------------------VDAHTLSQDR  92

Query  739  GKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            GKFARICV+ D+ KP      I    Y + Y G++LVC +CG +G  R+ C
Sbjct  93   GKFARICVEFDLAKPFTPFIKIEGRTYGVVYEGINLVCFECGCFGHGRDSC  143



>ref|XP_006580860.1| PREDICTED: uncharacterized protein LOC102664004 [Glycine max]
Length=344

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 113/219 (52%), Gaps = 18/219 (8%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYD---YYVARFESQRDYDFAR  522
            W  +LI+ V+GR +  N + Q +   W   ++++L DL Y+   Y++ RF S +D D   
Sbjct  131  WESALIMYVIGRDLSMNSVKQFMEKNW---SSVKLPDLFYNDEGYFIMRFHSSQDKDEIL  187

Query  523  FEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEP  702
             +GP+TI +  ++++ W P FNL  +    I  W++ P LP+  +  + + KIG  +G+P
Sbjct  188  SKGPYTIMNMTMLLRDWSPEFNLKRDMLRTIPIWIKLPQLPLYLWGAKTMGKIGSILGKP  247

Query  703  VKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK-----YPIEYGGLHLVCSKCGL  867
            +  D+ T+   R  +AR+ V+IDIT+ +  + TIA  +       +EY      C KC  
Sbjct  248  IVTDECTAQRLRISYARMLVEIDITQEMPKEITIADNEGHELIQAVEYEWKPKYCGKCKK  307

Query  868  YGQKREQCGLGRKEQKATGEEVGVDISTIPAQEDQLLGP  984
            +G   E+        K   E+V V   T+ + E +  GP
Sbjct  308  FGHVCEK-------PKVRKEKVWVPKPTLKSNEQEEGGP  339



>ref|XP_009759687.1| PREDICTED: uncharacterized protein LOC104212176 [Nicotiana sylvestris]
Length=344

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 96/203 (47%), Gaps = 40/203 (20%)
 Frame = +1

Query  307  RIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            RI +T ++KRR+  PW+  +I+++ G+ + Y YL Q++  LWRP   ++LIDL  DY++ 
Sbjct  33   RITLTDDDKRRIYEPWKNVVIVKLFGKRMLYQYLRQKIQELWRPMEQIKLIDLGEDYFII  92

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            +F  + + D A                                        L  +++D +
Sbjct  93   KFVKRENMDTA----------------------------------------LHQEFYDTK  112

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHL  846
             + +IG ++G  +K+D  TS + RG +AR+CV+I +  P++    I   K  I Y G  L
Sbjct  113  TVERIGNSIGRLLKIDVCTSTTIRGCYARLCVEIPLEHPVQPYIYIGTHKKSIHYEGEKL  172

Query  847  VCSKCGLYGQKREQCGLGRKEQK  915
             C+ CG  G     C   +K  K
Sbjct  173  FCTICGRLGHISTLCSFAQKPSK  195



>ref|XP_006385277.1| hypothetical protein POPTR_0003s02390g, partial [Populus trichocarpa]
 gb|ERP63074.1| hypothetical protein POPTR_0003s02390g, partial [Populus trichocarpa]
Length=285

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 95/203 (47%), Gaps = 34/203 (17%)
 Frame = +1

Query  298  LCPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDY  477
            L P++ +  +    L   W+  LII+++G+ +G+  L  RL +L +     EL+D+   +
Sbjct  17   LLPKVFIKDDIFNDLFLSWKDLLIIKLLGKEIGFYQLNTRLKNLLKLTGGFELMDVANGF  76

Query  478  YVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYF  657
            ++ +F+ + D      EGPW +FDH++                                 
Sbjct  77   FMVKFDLEMDKTKVINEGPWMVFDHHL---------------------------------  103

Query  658  DEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGG  837
                L  +   + +P+KVD  TS   RG FAR CV+I++ KP+  +  I    Y +EY  
Sbjct  104  -ANLLMAMASAISKPIKVDMHTSNVDRGGFARFCVEIELKKPVVGRVWIKYHWYNVEYKE  162

Query  838  LHLVCSKCGLYGQKREQCGLGRK  906
            LH++  KCG YG   ++C L +K
Sbjct  163  LHIIYRKCGCYGHHGKECKLVKK  185



>ref|XP_009770244.1| PREDICTED: uncharacterized protein LOC104220969 [Nicotiana sylvestris]
Length=315

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 95/196 (48%), Gaps = 5/196 (3%)
 Frame = +1

Query  322  KEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQ  501
            KEE  +    W+  LI+ ++G   GYNY+   +   W      E+   +  YY+ +F+S 
Sbjct  119  KEEVEQETQNWKSDLIVYIIGDIPGYNYMKNYVAQNWAIVGEPEVFLHDEGYYIIKFQSV  178

Query  502  RDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKI  681
             D +   + GP+TI +  I+++ W P+F+L +    +I  WV+FP LP+  +  + L  I
Sbjct  179  ADMNEILYSGPYTINNRPIVIKPWSPDFDLKTEFLIEIPIWVKFPKLPINCWGAKSLSSI  238

Query  682  GKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*E-----KYPIEYGGLHL  846
               +G P+  D  T+   R  FARI +++++TKPL  +  +        + P+ Y     
Sbjct  239  ASTIGTPLYADSCTAKQTRISFARILIEVNVTKPLPDEVEVMDPTGRFFQQPVLYDWKPN  298

Query  847  VCSKCGLYGQKREQCG  894
             C KC   G      G
Sbjct  299  FCEKCMKIGHDCNAVG  314



>ref|XP_007224188.1| hypothetical protein PRUPE_ppa016658mg, partial [Prunus persica]
 gb|EMJ25387.1| hypothetical protein PRUPE_ppa016658mg, partial [Prunus persica]
Length=495

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 87/166 (52%), Gaps = 9/166 (5%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  +     R   PWR +LII+++G++  YNY+  RL   W  +   +LIDL  DYYV
Sbjct  95   PSIQFSNRAMDRFCKPWRNALIIKLLGKSHTYNYIHARLQQKWSLKGAWKLIDLVNDYYV  154

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +F+ + D +F    GPW +   Y+++Q+W P F  A+    ++ AW+R   + ++ FD 
Sbjct  155  VKFDLEEDLNFVLTSGPWIVAGQYLVMQKWRPGFCPATAHITRMAAWLRVSAIQLECFDV  214

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFT  801
              L +IG  + + +K+D  T+   R         +D + P+  + T
Sbjct  215  WSLKRIGNMLSKLLKIDSLTTAQNR---------VDCSSPVNDQIT  251



>ref|XP_008795223.1| PREDICTED: uncharacterized protein LOC103711032 [Phoenix dactylifera]
Length=305

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 104/199 (52%), Gaps = 5/199 (3%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWR-RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            + +  E+    RA WR  ++I+R +GR V   ++ + L ++ + + ++E   +  + +  
Sbjct  67   VDIPSEKMELARAAWRDTAVIMRSLGRRVPVEWISRELRTVGKLDYDVEDFTMAEETFAF  126

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            RF  ++D + A   GPW +    + +++W PNF   +NR  + + W+R P+LP++Y+ +E
Sbjct  127  RFRCEKDREAAMEAGPWLVAGQLLAMERWQPNFVPGANRLRRAVIWLRLPSLPMEYWRKE  186

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLR--SKFTIA*EKY--PIEYG  834
             +W I +  G P+ +D+ T   ++  FAR+ V++D+ +P R  +   +  + +     Y 
Sbjct  187  LIWSIAEKAGRPLALDKVTDQGRKLGFARVKVEMDVGEPFRPGTFIQVGADSHWQAFRYE  246

Query  835  GLHLVCSKCGLYGQKREQC  891
             L   C +C   G     C
Sbjct  247  NLPGFCYRCARLGHGEGVC  265



>gb|KCW60820.1| hypothetical protein EUGRSUZ_H03558 [Eucalyptus grandis]
Length=131

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 71/117 (61%), Gaps = 0/117 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
             P +  +KEEK RLR PWR+ LII ++G+TVGY+ L ++L  +W P+  +  I+L   ++
Sbjct  6    VPILKSSKEEKERLRQPWRQPLIINLLGQTVGYDLLCKKLLQIWSPKGELVRINLSNKFF  65

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVK  651
            +A F    DY F   E PW IFDHY+ +++W P F        ++  WV+FP + ++
Sbjct  66   IATFFLPEDYYFVVGERPWMIFDHYLAIRRWHPGFEPNEPTIDRVAIWVKFPNISIE  122



>ref|XP_006382318.1| hypothetical protein POPTR_0005s00970g [Populus trichocarpa]
 gb|ERP60115.1| hypothetical protein POPTR_0005s00970g [Populus trichocarpa]
Length=163

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            CP I +  EEK+R+R PWR++LII+V+G  V Y +LL+RL  +W+   ++ L+DL  D++
Sbjct  56   CPVIRLFMEEKKRIREPWRQTLIIKVLGCRVSYTFLLKRLQIIWKILGDLNLVDLGNDFF  115

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFN  588
             ARF ++ D + A   GPW + DHY+ ++ W PNF+
Sbjct  116  RARFSNKEDRESAMSGGPWMVADHYLTMRSWHPNFD  151



>gb|KHN29850.1| hypothetical protein glysoja_034094, partial [Glycine soja]
Length=111

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 69/105 (66%), Gaps = 0/105 (0%)
 Frame = +1

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F +  DY+FA FEGPW + DHY+IVQ+W+P F     +   +  W++   LP++ +++ F
Sbjct  4    FTTHDDYNFALFEGPWMVVDHYLIVQRWLPFFLTNVEKMKNVAVWLKVQCLPIELYNDVF  63

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTI  804
            L +IG ++ + +K D+ TS+  RGK+ARI +++D+ KPL S   +
Sbjct  64   LKRIGMSLRKSLKADKLTSIQSRGKYARIFMELDLYKPLESHIYV  108



>ref|XP_009607026.1| PREDICTED: uncharacterized protein LOC104101282 [Nicotiana tomentosiformis]
Length=162

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 0/128 (0%)
 Frame = +1

Query  526  EGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPV  705
             GPW IF H++ VQ+W P+F  ++ +      W+R P LP  ++D + L  +   VG  +
Sbjct  7    NGPWFIFGHFLSVQRWEPDFVSSTAKQTFTAIWIRLPHLPTGFYDGKVLKTVDNTVGRLL  66

Query  706  KVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKRE  885
            KVD  TS + +G++AR+C+++ + KP++    I   K  I Y G  L+C  CG  G   E
Sbjct  67   KVDACTSATLQGRYARLCLELPLNKPMKPFVLIGSHKQQILYKGDKLLCKNCGHLGHSTE  126

Query  886  QCGLGRKE  909
            QC   R++
Sbjct  127  QCTNARQQ  134



>gb|KHN04242.1| hypothetical protein glysoja_041006, partial [Glycine soja]
Length=136

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 82/134 (61%), Gaps = 0/134 (0%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEG  531
            W+  ++I+++ R +G+  L  RL S+   +  + +ID+  DY++  F  + D   A+ EG
Sbjct  3    WKSVVVIKLLERKIGHRALETRLKSICVRKDILHMIDIGNDYFLVYFSHKEDMIKAQIEG  62

Query  532  PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKV  711
            PW I+DHY++V++W+PNF+ +S    K++  VRF  LP++ +D +    I   +G  ++V
Sbjct  63   PWLIYDHYLVVREWMPNFHPSSEALEKVVVRVRFFGLPIECYDSKIWNAIRDRIGRTMRV  122

Query  712  DQTTSLSKRGKFAR  753
            DQ T   +RGK+ R
Sbjct  123  DQNTLTRERGKYER  136



>ref|XP_009770156.1| PREDICTED: uncharacterized protein LOC104220886 [Nicotiana sylvestris]
Length=339

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 0/116 (0%)
 Frame = +1

Query  529  GPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVK  708
            GPW IF H++ VQ+W PNF  +  +  K   W+R P LP +++D   L KIG  +G+ +K
Sbjct  2    GPWFIFGHFLSVQKWEPNFLASEAKISKTAVWIRLPQLPTEFYDSVILQKIGNKIGKLLK  61

Query  709  VDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQ  876
            VD  TS + RG++AR+CV++ +  P+     I   K  I Y   +L+C KCG  G 
Sbjct  62   VDACTSSTLRGRYARLCVELPLNIPVAHSIYIGSHKQSIHYEDGNLLCVKCGRLGH  117



>ref|XP_009759323.1| PREDICTED: uncharacterized protein LOC104211883 [Nicotiana sylvestris]
Length=207

 Score =   101 bits (252),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  526  EGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPV  705
            +GPW IF +++ VQ W PNF  +  +      W+R P LP K++DE+ L K+G  +G  +
Sbjct  7    KGPWFIFGNFLSVQCWEPNFVPSRAKQIFTAIWIRLPELPTKFYDEKILNKVGNTIGRLL  66

Query  706  KVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKRE  885
            KVD  TS + RG++ARICV++ + K ++S   I   K  I Y    L+C  CG  G    
Sbjct  67   KVDACTSAALRGRYARICVELPLNKQVKSSVWIGSHKQQILYECDKLLCLNCGFLGHSTG  126

Query  886  QC  891
            QC
Sbjct  127  QC  128



>ref|XP_010690458.1| PREDICTED: uncharacterized protein LOC104903992 [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   106 bits (265),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 98/195 (50%), Gaps = 0/195 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP++++E + L  PW  ++I +VVGR+    +L + L  +W  + N+E+  L   +Y  +
Sbjct  113  IPISEDEYKSLAQPWEAAIICKVVGRSFSKEFLRKELQKMWEWKGNLEMTTLGKGFYSIQ  172

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
              S          GPW +   ++ VQ W P F  ++ +  +   WV  P LP++++ +  
Sbjct  173  CPSHERKSEILIGGPWDLLGSHVWVQSWKPGFKPSTAQCTEYPRWVAMPELPIEFYSKII  232

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KIG ++G+ +K+D  +   ++ ++A +CV ++  KPL +   I      + +      
Sbjct  233  LEKIGNSLGKLLKIDVHSLTGEKKRYAAMCVLMEKAKPLPTGAWIGKNFQQLVFCEGPGY  292

Query  850  CSKCGLYGQKREQCG  894
            C  C  YG +   CG
Sbjct  293  CDVCQNYGHQARHCG  307



>ref|XP_006599769.1| PREDICTED: uncharacterized protein LOC102668549 [Glycine max]
Length=399

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 116/229 (51%), Gaps = 23/229 (10%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYD---YYVARFESQRDYDFAR  522
            W  +LI+ V+GR +  N + Q +   W   + ++L DL Y+   Y++ RF S +D D   
Sbjct  115  WESALIMYVIGRDLSMNSVKQFMEKNW---SFVKLPDLFYNDEGYFIMRFHSSQDKDEIL  171

Query  523  FEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEP  702
             +GP+TI +  ++++ W P FNL  +    I  W++ P LP+  +  + + KIG  +G+P
Sbjct  172  SKGPYTIMNMTMLLRDWSPEFNLKRDMLRTIPIWIKLPQLPLYLWGAKTMGKIGSILGKP  231

Query  703  VKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK-----YPIEYGGLHLVCSKCGL  867
            +  D+ T+   R  +AR+ V+IDIT+ +  + TIA  +       +EY      C KC  
Sbjct  232  IVTDECTAQRLRISYARMLVEIDITQEMPKEVTIADNEGHELIQAVEYEWKPKYCGKCKK  291

Query  868  YGQKREQCGLGRKEQKATGEEVGVDISTIPAQEDQLLGP-----QLIAT  999
            +G   E+        K   E+V V   T+ + E +  GP     Q+I T
Sbjct  292  FGHVCEK-------PKVRKEKVWVPKPTLKSNEQEEGGPSNKETQMINT  333



>ref|XP_008779513.1| PREDICTED: uncharacterized protein LOC103699249 [Phoenix dactylifera]
Length=274

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 99/202 (49%), Gaps = 9/202 (4%)
 Frame = +1

Query  316  VTKEEKRRLRAPWRRS-LIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARF  492
            V  +E    R+ WR + +I+R +GR+V   ++ + +  + + + ++E   L   + V RF
Sbjct  56   VPDQELEGARSEWRSTTVIVRSMGRSVPAVWVAKEIRRVGKLQYDVECFSLVDGFIVVRF  115

Query  493  ESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFL  672
             +  D + A   GPW++    + +++W PNF   +    +++ W+R   LP+ Y+    L
Sbjct  116  ANGDDREAALLNGPWSMAGQLLAMERWRPNFVPGAGGLGRVVVWLRLSGLPLDYWKGPTL  175

Query  673  WKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIE--------  828
            ++I    GEP+ VD  T    R  FAR+ + +D + PL+    +      +E        
Sbjct  176  FRIAARAGEPLAVDSFTEQGGRFGFARVKIALDCSAPLKPGIFLKGSSEGVEDKFWQAFI  235

Query  829  YGGLHLVCSKCGLYGQKREQCG  894
            Y  L   CSKCG  G   ++CG
Sbjct  236  YENLPAPCSKCGRIGHPTKECG  257



>ref|XP_010687419.1| PREDICTED: uncharacterized protein LOC104901529 [Beta vulgaris 
subsp. vulgaris]
Length=417

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 96/208 (46%), Gaps = 5/208 (2%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P   + K E  +L   W  S+I+ VVG+      L+  + + W      ++   E  Y+V
Sbjct  85   PIAKLDKNEVSKLSEIWINSIIVYVVGQNPTLTALMSYVKTHWSLVCEPKIFKHEDGYFV  144

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             +  +  D D     G    +   IIV+ W+P+FN  S     I  WV+FP LP+ Y+ +
Sbjct  145  VKLTNTEDKDRILISGRHMFYGKPIIVKPWLPSFNFHSEILKVIPIWVKFPNLPLHYWSD  204

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK-----YPIE  828
            + L +IG  +G P+  D+ TS + R  FAR+ +++DITK +  +  I           + 
Sbjct  205  DSLSRIGSLLGVPIYADECTSKALRVSFARVLIEMDITKEIPKEIQIVEPNGVTFAQKVT  264

Query  829  YGGLHLVCSKCGLYGQKREQCGLGRKEQ  912
            Y  L   CSKC + G   E      K Q
Sbjct  265  YDCLPPFCSKCSMIGHNCESLQAKAKTQ  292



>ref|XP_008806373.1| PREDICTED: uncharacterized protein LOC103719081 [Phoenix dactylifera]
Length=865

 Score =   105 bits (261),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 116/235 (49%), Gaps = 9/235 (4%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWR-RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            + +  E+    RA WR  ++++R +GR V   ++ + L  + + + ++E   +  + Y  
Sbjct  65   VDIPPEKMEAARAAWRDTTVLMRCLGRRVPVEWIRRELRVVGKLDYDVEDFVMAEETYAF  124

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            RF  ++D + A   GPW + +  + +++W PNF   +NR  + + W+R P LP +Y+ +E
Sbjct  125  RFRCEKDREAAMEAGPWLVAEQLLAMERWRPNFVPGANRLSRAIMWLRLPNLPTEYWSKE  184

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLR--SKFTIA*EKY--PIEYG  834
             +W I    G P+ +D+ T   ++  FAR+ V++D+ +PLR  +   +  + +     Y 
Sbjct  185  LIWCIAGKAGRPLALDKFTDQGRKLGFARVKVEMDVGEPLRPGTFIQVGGDSHWQEFRYE  244

Query  835  GLHLVCSKCGLYGQKREQCGLGRKEQKATGEEVGVDISTIP---AQEDQLLGPQL  990
             L   C +C   G     C     +  AT  E G  +   P   A+ED   G +L
Sbjct  245  NLPGFCYRCARLGHGEGDCPFPSTD-PATSAEQGGSLPPEPEAVAKEDNSQGSRL  298



>ref|XP_009758585.1| PREDICTED: uncharacterized protein LOC104211255 [Nicotiana sylvestris]
Length=210

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 84/145 (58%), Gaps = 0/145 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            I +++E+K RL  PWR S+II++ G+ + +  L  +L  LW P   + LIDL +D++  +
Sbjct  66   IILSQEDKNRLYEPWRFSVIIKLFGKKMSHYLLRSKLLDLWSPSKQLILIDLGWDFFKVK  125

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
            F  + +   A  +GPW + ++++ V++W P F            WVR   LP +++D E 
Sbjct  126  FSKEENLVKAIQKGPWFLLENFLSVRRWEPKFVPQEATLSFTAIWVRLLQLPTEFYDNEV  185

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGK  744
            L K+G+ +G+ +K+D   S + RG+
Sbjct  186  LEKVGQKLGKLLKIDTCASATLRGR  210



>ref|XP_010671910.1| PREDICTED: uncharacterized protein LOC104888586 [Beta vulgaris 
subsp. vulgaris]
Length=535

 Score =   103 bits (257),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 96/206 (47%), Gaps = 0/206 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            +P+++EE  +L  PW  ++I +V+GR+   ++L + +  LW  +  + L+ L   +Y  +
Sbjct  103  VPISEEEYAKLSQPWESAIIFKVLGRSFSQDFLRKEISKLWNWKGYLNLLSLGKGFYSIK  162

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
              S  +       GPW I    + VQ W P F  ++ +      WV+ P LP++ F ++ 
Sbjct  163  CSSNVEKSKVLSGGPWFILGSLVWVQPWTPGFKPSTAKAKHYPVWVQLPELPMELFHKQT  222

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L KIG  +GE +K+D  +    R ++A ICV +   K +     +   +  I       V
Sbjct  223  LEKIGNTLGETLKIDSNSLDGVRRRYAAICVLMKEDKTVPQWAWLGGLRQEIACVEGPWV  282

Query  850  CSKCGLYGQKREQCGLGRKEQKATGE  927
            C  C   G  R  C L    Q   G+
Sbjct  283  CEICRKVGHNRRHCALAPLSQHKAGD  308



>ref|XP_010695483.1| PREDICTED: uncharacterized protein LOC104908105 [Beta vulgaris 
subsp. vulgaris]
Length=388

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 96/194 (49%), Gaps = 0/194 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP+++++ R L  PW  +LI +VVG++  + +L + L  +W  + +++LI L   +Y   
Sbjct  21   IPISEKKYRELVKPWNEALICKVVGKSFSHEFLKKELQKVWSLKKSVDLISLGKGFYSFN  80

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
              S ++      EGPW +    I VQ W P F  ++    +   WV  P LP+++F ++ 
Sbjct  81   CGSTQEKSKILAEGPWFVMGSLIWVQTWQPGFKPSNANISQYPIWVSLPELPLEFFRKDI  140

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L+ IG  +G  +K+D  +   +  +FA +CV +  +  +  +  +      + Y     +
Sbjct  141  LYSIGNALGNIIKIDAHSLDGEWKRFASVCVLMRASSCVPGRVWVGGTCQDLVYSDSPWL  200

Query  850  CSKCGLYGQKREQC  891
            C KC   G   + C
Sbjct  201  CHKCRKVGHNVKGC  214



>ref|XP_007204051.1| hypothetical protein PRUPE_ppa026737mg, partial [Prunus persica]
 gb|EMJ05250.1| hypothetical protein PRUPE_ppa026737mg, partial [Prunus persica]
Length=147

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 74/141 (52%), Gaps = 0/141 (0%)
 Frame = +1

Query  301  CPRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
             P I  +K+ K  L  PWR  +I++++GR + Y +L   L   W  +  M LIDLE +Y+
Sbjct  3    VPSIQFSKKVKSCLYRPWRTVVILKLMGRPLSYAFLRTHLLHKWDLKRPMSLIDLENNYF  62

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            + +     D  +    GPW I   Y++ QQW P FN    +   + AWVR   L V+YF 
Sbjct  63   ITKSLLVEDMRYVLSGGPWQIAGQYVVTQQWKPRFNAKEEKITHMTAWVRINGLNVEYFR  122

Query  661  EEFLWKIGKNVGEPVKVDQTT  723
             + + KIG  +G  VKVD  T
Sbjct  123  YDVIEKIGNLIGTTVKVDAHT  143



>ref|XP_006577696.1| PREDICTED: uncharacterized protein LOC102664242 [Glycine max]
Length=449

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 116/229 (51%), Gaps = 23/229 (10%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYD---YYVARFESQRDYDFAR  522
            W  +LI+ V+GR +  N + Q +   W   + ++L DL Y+   Y++ RF+S +D D   
Sbjct  165  WESALIMYVIGRDLSMNSVKQFMEKNW---SFVKLPDLFYNDEGYFIMRFQSSQDKDEIL  221

Query  523  FEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEP  702
             +GP+TI +  ++++ W P FNL  +    I  W++ P LP+  +  + + KIG  +G+P
Sbjct  222  SKGPYTIMNMTMLLRDWSPEFNLKRDMLRTIPIWIKLPQLPLYLWGAKTMGKIGSILGKP  281

Query  703  VKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK-----YPIEYGGLHLVCSKCGL  867
            +  D+  +   R  +AR+ V+IDIT+ +  + TIA  +       +EY      C KC  
Sbjct  282  IVTDECKAQRLRISYARMLVEIDITQEMPKEVTIADNEGHELIQAVEYEWKPKYCGKCKK  341

Query  868  YGQKREQCGLGRKEQKATGEEVGVDISTIPAQEDQLLGP-----QLIAT  999
            +G   E+        K   E+V V   T+ + E +  GP     Q+I T
Sbjct  342  FGHVCEK-------PKVRKEKVWVPKPTLKSNEQEERGPSNKETQMINT  383



>ref|XP_009794040.1| PREDICTED: uncharacterized protein LOC104240845, partial [Nicotiana 
sylvestris]
Length=189

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 74/126 (59%), Gaps = 0/126 (0%)
 Frame = +1

Query  529  GPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVK  708
            GPW I +H++ V++W P F  +S +      WVR P LP +++D E L ++G  +G+ +K
Sbjct  8    GPWFILNHFLSVRRWEPKFIASSTQLTYSAIWVRLPKLPTEFYDVEILQRVGSKLGQLLK  67

Query  709  VDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQ  888
            +D  TS + RG++ RIC+++ + +PL++   I   K  + Y  ++++C+ C   G   + 
Sbjct  68   IDTCTSTTTRGRYERICIEVPLERPLKTHINIGNHKQILLYESINVLCTNCSHLGHIIQN  127

Query  889  CGLGRK  906
            C   +K
Sbjct  128  CPTPKK  133



>ref|XP_002516014.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46434.1| conserved hypothetical protein [Ricinus communis]
Length=753

 Score =   103 bits (258),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 73/128 (57%), Gaps = 1/128 (1%)
 Frame = +1

Query  406  LLQRLHS-LWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWTIFDHYIIVQQWVPN  582
            LL++L   L +P  N  ++DLE D+Y+ +     D   A   GPW +F HY+ VQ W P+
Sbjct  9    LLEKLKERLAKPWENTMVVDLENDFYLVKLSRHEDVVSALLGGPWVVFGHYLTVQSWAPS  68

Query  583  FNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICV  762
            F  +S    K++AW+ FP +P+ Y+  + L   G  VG  VK+D         +FAR+ V
Sbjct  69   FRASSAVLSKVIAWIHFPDMPMHYYHNKILRTNGNIVGRTVKIDFNIEEVNHDRFARVAV  128

Query  763  QIDITKPL  786
            ++D++KPL
Sbjct  129  ELDLSKPL  136



>ref|XP_006605232.1| PREDICTED: uncharacterized protein LOC102667279 [Glycine max]
Length=315

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 100/187 (53%), Gaps = 11/187 (6%)
 Frame = +1

Query  352  WRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYD---YYVARFESQRDYDFAR  522
            W  +LI+ V+GR +  N + Q +   W   + ++L DL Y+   Y++ RF S +D D   
Sbjct  31   WESALIMYVIGRDLSMNSVKQFMEKNW---SFVKLPDLFYNDEGYFIMRFHSSQDKDEIL  87

Query  523  FEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEP  702
             +GP+TI +  ++++ W P FNL  +    I  W++ P LP+  +  + + KIG  +G+P
Sbjct  88   SKGPYTIMNMTMLLRDWSPEFNLKRDMLRTIPIWIKLPQLPLYLWGAKTMGKIGSILGKP  147

Query  703  VKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK-----YPIEYGGLHLVCSKCGL  867
            +  D+ T+   R  +AR+ V+IDIT+ +  + TIA  +       +EY      C KC  
Sbjct  148  IVTDECTAQRLRISYARMLVEIDITQEMPKEVTIADNEGHELIQAVEYEWKPKYCGKCKK  207

Query  868  YGQKREQ  888
            +G   E+
Sbjct  208  FGHVCEK  214



>ref|XP_010672383.1| PREDICTED: uncharacterized protein LOC104888966 [Beta vulgaris 
subsp. vulgaris]
Length=1431

 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 99/203 (49%), Gaps = 1/203 (0%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVAR  489
            IP+++EE + L  PW  +LI +V+GR+    +L   L  LW+ E  +E+  L   +Y  +
Sbjct  29   IPISEEEYKNLAQPWESALICKVMGRSFSREFLRMELQKLWKWEGTLEMTTLGKGFYSIQ  88

Query  490  FESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEF  669
              SQ        EGPWT+   ++  Q W   F  +  +  +   WV  P LP+++F++  
Sbjct  89   CPSQARRAEIILEGPWTLLGSHVWTQCWEAGFRPSLAQFTERPRWVALPELPIEFFNKNI  148

Query  670  LWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLV  849
            L K+G ++G+ +K+D  +    + +FA +CV +D  K L     +     P+ Y      
Sbjct  149  LEKVGNSLGKLLKIDVHSLTGDKRRFAAMCVLMDKDKMLPKGAWLGRTFQPLIYCEGPWF  208

Query  850  CSKCGLYGQKREQCGLG-RKEQK  915
            C  C  +G +   C    RK QK
Sbjct  209  CEACNKFGHQMRNCTQNHRKWQK  231



>ref|XP_010695085.1| PREDICTED: uncharacterized protein LOC104907793 [Beta vulgaris 
subsp. vulgaris]
Length=390

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 104/216 (48%), Gaps = 11/216 (5%)
 Frame = +1

Query  310  IPVTKEEK---RRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            +PV K +K    +L   W  S I+ ++G++     +   + S W   ++ ++   E  Y+
Sbjct  60   VPVAKLDKTEVSKLSEIWINSRIVYIIGQSPTITAMTAYIRSHWNVNSDPKIFKHEEGYF  119

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V + +S+ D D     GP   +   IIV+QW P+FN  +     I  WV+ P LP+ Y+ 
Sbjct  120  VVKLDSRVDRDAILCAGPNLFYGKPIIVKQWDPSFNFHNEVLRIIPLWVKLPNLPLHYWS  179

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTI-----A*EKYPI  825
             + L +IG  +G+PV  D+ TS + R  FARI +++D+TK L S+  I     A     +
Sbjct  180  GDSLSRIGSLLGKPVYADECTSKALRVSFARILIEMDVTKKLPSEIQIEEPNGATFTQKV  239

Query  826  EYGGLHLVCSKCGLYGQKREQCGLGRKEQKATGEEV  933
             Y  L   C KC   G     C  G  + K   + V
Sbjct  240  SYDWLPPYCKKCLKVGH---NCKAGGSKPKINPKPV  272



>gb|KDO54331.1| hypothetical protein CISIN_1g037263mg, partial [Citrus sinensis]
Length=155

 Score = 97.1 bits (240),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  529  GPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVK  708
            G WTI  HY+I+Q W P+F+        ++AW++ P + + Y+ +  LW IG+ VG+ V+
Sbjct  1    GSWTIMGHYLIIQPWTPHFDSFKGEYDSVIAWIQLPGMALHYYHKLILWMIGQTVGKVVR  60

Query  709  VDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQ  888
            ++     + RGKFARI +++ ++KPL S+F +  +   ++Y  L  +   C  YG   E 
Sbjct  61   INYNMESATRGKFARIAIEVTLSKPLVSQFLLDGKVQKVKYENLPNISFGCSKYGHSCES  120

Query  889  C  891
            C
Sbjct  121  C  121



>ref|XP_010694057.1| PREDICTED: uncharacterized protein LOC104906925 [Beta vulgaris 
subsp. vulgaris]
Length=339

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 95/202 (47%), Gaps = 9/202 (4%)
 Frame = +1

Query  322  KEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQ  501
            K E  R    W+ +LI+ V+G+      ++    S W P+   ++   +  Y+V + E+ 
Sbjct  21   KMEVDRATESWQNALIVYVIGQNPSIMAIINYCKSQWAPKVEPKIFKHDEGYFVVKMETV  80

Query  502  RDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKI  681
             D D   F GP   F   +IV+QW  NF+        I  WV FP LP+  +  + L +I
Sbjct  81   EDRDAVLFSGPHLFFGKAMIVKQWTSNFSFNQEILKVIPIWVTFPNLPLNCWSMDSLSRI  140

Query  682  GKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*E-----KYPIEYGGLHL  846
            G  +G P+  D+ T+   R  FARI +++D+T  ++ +  +        K  + Y  L  
Sbjct  141  GSTLGVPIYADECTTKQLRISFARILIEMDVTGAVKEEINVEDPNGRVFKQRVSYAWLPP  200

Query  847  VCSKCGLYGQKREQCGLGRKEQ  912
             C+KC   G   E+    RK+Q
Sbjct  201  FCNKCQKVGHLCEE----RKKQ  218



>ref|XP_008807073.1| PREDICTED: uncharacterized protein LOC103719554 [Phoenix dactylifera]
Length=260

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 87/150 (58%), Gaps = 1/150 (1%)
 Frame = +1

Query  343  RAPWR-RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFA  519
            RA WR  ++I+R +GR V   ++ + L    + + ++E   +  + +V RF+S+RD + A
Sbjct  81   RAAWRDTAVIMRSLGRRVPVEWIKRELRVAGKLDYDVEDFLMADETFVFRFQSERDREAA  140

Query  520  RFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGE  699
               GPW +    + +++W PNF   +N+  + + W+R P+LP +Y+ +E +W I    G 
Sbjct  141  MEAGPWLVAGQLLAMERWRPNFVPGTNQLCRAVVWLRLPSLPTEYWTKELIWDIAAKAGR  200

Query  700  PVKVDQTTSLSKRGKFARICVQIDITKPLR  789
            P+ +D+ T   ++  FAR+ V++D   P+R
Sbjct  201  PLALDKVTDQGRKLGFARVKVELDAGMPIR  230



>ref|XP_008780218.1| PREDICTED: uncharacterized protein LOC103700017, partial [Phoenix 
dactylifera]
Length=412

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 96/205 (47%), Gaps = 9/205 (4%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWRRS-LIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            + V +EE    R+ WR S +++R +GR V  +++ + +  + R    +E   L   ++  
Sbjct  64   VDVPEEELEGSRSEWRNSTILVRSLGRYVPADWVAKEIKRVGRLGYEVECFLLTDGFFAV  123

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            RFE++ D + A   GPW +    + + +W PNF        +++ W+R P LP+ Y+ + 
Sbjct  124  RFENEADREAALASGPWMVAGQLLAMDRWRPNFIPGDEGLSRVVVWLRMPRLPLDYWKKA  183

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIE------  828
             + +I  + G P+ +D  T   +R  FAR+ V +D + PL+    +      +       
Sbjct  184  TIMRIAASAGTPLALDGVTEQGRRCGFARVKVAVDCSAPLKPGTLVRGSSMGVAEVFWQD  243

Query  829  --YGGLHLVCSKCGLYGQKREQCGL  897
              Y  L   CS+CG  G     C  
Sbjct  244  FIYENLPAPCSRCGRIGHPMVNCAF  268



>ref|XP_010670298.1| PREDICTED: uncharacterized protein LOC104887379 [Beta vulgaris 
subsp. vulgaris]
Length=427

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/203 (31%), Positives = 98/203 (48%), Gaps = 8/203 (4%)
 Frame = +1

Query  310  IPVTKEEK---RRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYY  480
            +PV K +K    +L   W  S+I+ V+G++     +     S W   ++ ++   E  Y+
Sbjct  100  VPVAKLDKTEVSKLSDIWINSIIVYVIGQSPTITAMTAYFRSHWNVNSDPKIFKHEEGYF  159

Query  481  VARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFD  660
            V + + + D D     GP   +   IIV+QW P+FN  +     I  WV+ P LP+ Y+ 
Sbjct  160  VVKLDFRVDRDAILCAGPHLFYGKPIIVKQWDPSFNFHNEVLRIIPLWVKLPNLPLHYWS  219

Query  661  EEFLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTI-----A*EKYPI  825
             + L +IG  +G PV  D+ TS + R  FARI +++D+TK L ++  I     A     +
Sbjct  220  GDSLSRIGSLLGRPVYADECTSKALRVSFARILIEMDVTKTLPTEIQIEEPNGATFTQKV  279

Query  826  EYGGLHLVCSKCGLYGQKREQCG  894
             Y  L   C KC   G   E  G
Sbjct  280  SYDWLPPYCKKCLKVGHNCETGG  302



>ref|XP_008245053.1| PREDICTED: uncharacterized protein LOC103343160 [Prunus mume]
Length=192

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 76/141 (54%), Gaps = 0/141 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I  ++  K ++  PWR S+II+ V +T  YN++   L   WR +  M+L+DL+  +++
Sbjct  22   PSIRFSEHVKNKIYRPWRNSVIIQFVRKTHTYNFVFAHLKQRWRLKGPMQLVDLDNGFFI  81

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF  + +  +    GPW +   Y+ VQ+W PNF +A      I  WVR   + V++F+ 
Sbjct  82   VRFVLEENLLYVLTGGPWVVAGQYVAVQKWRPNFWVAEEHVSHITVWVRLLGMGVEFFNY  141

Query  664  EFLWKIGKNVGEPVKVDQTTS  726
            E +  IG  +G   KVD  T 
Sbjct  142  ETIKCIGDLIGSSYKVDVHTD  162



>gb|KDO48120.1| hypothetical protein CISIN_1g045413mg, partial [Citrus sinensis]
Length=212

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 81/142 (57%), Gaps = 2/142 (1%)
 Frame = +1

Query  532  PWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGEPVKV  711
            PW +  HY+ VQ W P+F+ ++ +  KI A +R P++P+ Y+ ++ +  +G  +G+ +K+
Sbjct  1    PWIVSGHYLTVQLWSPHFDSSNEKIDKITALIRLPSMPLHYYHKKIIRMLGHVIGKIIKI  60

Query  712  DQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVCSKCGLYGQKREQC  891
            D  T L+ RGKFA I V++ +  PL S+F +      +EY  L  +C  C  Y      C
Sbjct  61   DCNTELATRGKFAHIAVEVSLESPLISQFLLDGRIQRVEYEALPTICFGCAKYRHTSSSC  120

Query  892  GLGRKEQKATGEEVGVDISTIP  957
             L +   +A GE++  D+++ P
Sbjct  121  -LDKLILEARGEKMN-DMASGP  140



>ref|XP_010681517.1| PREDICTED: uncharacterized protein LOC104896467 [Beta vulgaris 
subsp. vulgaris]
 emb|CCA65980.1| hypothetical protein [Beta vulgaris subsp. vulgaris]
Length=390

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 97/193 (50%), Gaps = 12/193 (6%)
 Frame = +1

Query  337  RLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDF  516
            R+   W  ++++ VVG+    N + Q + S W+ + + ++   +  Y++ R +++ + D 
Sbjct  83   RMSECWLNAVVVYVVGQNPTLNAISQYVKSHWQSQDDPQIFKHDEGYFIVRMKTREERDK  142

Query  517  ARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVG  696
              F GP   +   +IV+QW  NFN        I  WV+ P LP+  + E+ L +IG  +G
Sbjct  143  ILFSGPHLFYGKAMIVKQWSANFNFHEEVQKVIPIWVKLPNLPLNCWGEDSLSRIGSVLG  202

Query  697  EPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*E-------KYPIEYGGLHLVCS  855
             P+  D+ TS   R  +AR+ V++D+T+ +    T+A E       K  +EY  +   C 
Sbjct  203  VPLYADECTSKGLRVSYARMLVEMDVTQEI--PITVAVEDPNGVVFKQKLEYDWVPHFCK  260

Query  856  KCGLYGQKREQCG  894
            KC + G     CG
Sbjct  261  KCQMVGH---NCG  270



>ref|XP_008782110.1| PREDICTED: uncharacterized protein LOC103701725 [Phoenix dactylifera]
Length=311

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/255 (24%), Positives = 120/255 (47%), Gaps = 9/255 (4%)
 Frame = +1

Query  154  FQASEGSLGGRLEYKQILKGQTCAKAAVWNYdeeevsddeddymqeddLCPR----IPVT  321
             +A+ G++G +   K   KG+T A     +  +   ++ +    + + L  R    + ++
Sbjct  24   LEANSGNIGEKTHPKAPEKGRTWANVVKGSSRKPIWTNHQITTAELEALKRRFTDVVEIS  83

Query  322  KEEKRRLRAPWRRSLII-RVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFES  498
             E     RA WR +++I R +GR V   ++ + L    + + ++E   +  + +  RF  
Sbjct  84   PERMEVARAAWRDTVVIMRSLGRRVPAEWISRELRVAGKLDYDVEEFVMADETFAFRFRC  143

Query  499  QRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWK  678
            ++D + A   GPW +    + +++W PNF   +N+  + + W+R P+LP++Y+ +E +W 
Sbjct  144  EKDREAAMEGGPWLVAGQLLAMERWRPNFVPGTNQLGRTIVWLRLPSLPMEYWSKEMIWG  203

Query  679  IGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK----YPIEYGGLHL  846
            I    G+P+ +D+ T   ++  FAR+ V++D   P R    I            Y     
Sbjct  204  IAAKAGQPLALDKVTDQGRKLGFARVKVEVDAGAPFRPGTLIKVGSDLHWQAFRYESQPG  263

Query  847  VCSKCGLYGQKREQC  891
             C KC   G +   C
Sbjct  264  FCFKCARLGHEEGAC  278



>ref|XP_008779654.1| PREDICTED: uncharacterized protein LOC103699413 [Phoenix dactylifera]
Length=262

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 99/195 (51%), Gaps = 5/195 (3%)
 Frame = +1

Query  310  IPVTKEEKRRLRAPWR-RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVA  486
            + ++ E+    RA WR  ++IIR +GR V   ++ + L    + + ++E   +  + +  
Sbjct  68   VEISPEKMEVARAAWRDTAVIIRSLGRRVPAEWISRELRVAGKLDYDVEDFMMADETFAF  127

Query  487  RFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            RF  ++D + A   GPW +    +  ++W PNF   +N+  + + W+R P+LP++Y+ +E
Sbjct  128  RFRCEKDREAAMEGGPWLVAGQLLATERWRPNFVPGTNQLGRTVVWLRLPSLPMEYWSKE  187

Query  667  FLWKIGKNVGEPVKVDQTTSLSKRGKFARICVQIDITKPLR--SKFTIA*EKY--PIEYG  834
             +W I    G P+ +D+ T   ++  FAR+ V++D   P R  +   +  E +     Y 
Sbjct  188  MIWGIAAKAGRPLALDKVTDQGRKLGFARVKVEVDAGAPFRLGTFIRVGSELHWQAFRYE  247

Query  835  GLHLVCSKCGLYGQK  879
             L   C KC   G +
Sbjct  248  SLPGFCFKCARLGHE  262



>ref|XP_010474089.1| PREDICTED: uncharacterized protein LOC104753550 [Camelina sativa]
Length=227

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 83/149 (56%), Gaps = 0/149 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I + +E    +    +  +I++V+GR++    L ++L  LW+P+  M ++DL   +++
Sbjct  79   PEITIGQEVLDAMNGLLKSCMIVKVLGRSMPIAVLQRKLRVLWKPKGAMYVMDLPRQFFM  138

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDE  663
             RF+ + +Y  A   GPW IF +Y++VQ W   F+   +       WVR   LP  ++ +
Sbjct  139  VRFDVEEEYMVALTGGPWRIFGNYLMVQAWTLEFDPLKDEITTTPVWVRISILPYNFYHK  198

Query  664  EFLWKIGKNVGEPVKVDQTTSLSKRGKFA  750
              L  I +++G PVKV +TT   +RG+FA
Sbjct  199  AILSWIAQSLGRPVKVYRTTLSFERGRFA  227



>ref|XP_006380429.1| hypothetical protein POPTR_0007s05790g [Populus trichocarpa]
 gb|ERP58226.1| hypothetical protein POPTR_0007s05790g [Populus trichocarpa]
Length=378

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +1

Query  304  PRIPVTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYV  483
            P I ++ EEK+R+RAPWR++LII+++GR VGY YL +RL +  + + +  L+DL  ++++
Sbjct  87   PVIRLSVEEKKRIRAPWRQTLIIKIMGRKVGYMYLHKRLKTPRKLQGDPSLVDLGNEFFL  146

Query  484  ARFESQRDYDFARFEGPWTIFDHYIIVQQWVPNFN  588
            ++F +  D +   FEGPW   DHY+ ++ W PNF+
Sbjct  147  SKFSNNEDKEHVLFEGPWMDADHYLTIRTWHPNFD  181



>gb|KGN50455.1| hypothetical protein Csa_5G175790 [Cucumis sativus]
Length=648

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 95/194 (49%), Gaps = 4/194 (2%)
 Frame = +1

Query  316  VTKEEKRRLRAPWRRSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFE  495
            +T  E  R+   +  SLI RVVG+      L  RL    R   ++++  L   Y+V +F 
Sbjct  56   LTPSETTRITQQFVHSLIARVVGKDTRPGQLAARLRHHLRLTQDVKVFQLGLGYFVLKF-  114

Query  496  SQRDYDFARFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLW  675
            S+ DY  A  + PW+I +  I    W P+F  +      +  W+R P L ++Y+D   L 
Sbjct  115  SETDY-LALEDLPWSIPNLCIHAFPWTPDFKPSEAINSSVNVWIRLPELSIEYYDVGILK  173

Query  676  KIGKNVGEP-VKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EKYPIEYGGLHLVC  852
            +I   +G+P VK+D  T    + KFAR C+ +++  PL S   +   +  IEY G  L C
Sbjct  174  RIADAIGDPLVKIDPVTRDRWKCKFARFCISVNLCDPLPSMIELGRVRQRIEYEGFEL-C  232

Query  853  SKCGLYGQKREQCG  894
            +KC   G  R  C 
Sbjct  233  AKCNRVGDLRHDCS  246



>gb|KDO69928.1| hypothetical protein CISIN_1g039478mg, partial [Citrus sinensis]
Length=136

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = +1

Query  361  SLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFARFEGPWT  540
            +++++++GR +GY +L  RL SLW      ++IDLE  +++ RF S+ D D A  +GPWT
Sbjct  2    TVVVKLLGRPMGYKFLCNRLESLWTITKGFKVIDLENGFFLDRFRSEDDVDCALTQGPWT  61

Query  541  IFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEE  666
            +  HY I+QQW    +  S +   ++AW+R P++P+ Y+ ++
Sbjct  62   VLGHYFIIQQWTLYLDSTSEKIDSMVAWIRLPSMPLHYYKKK  103



>ref|XP_008795215.1| PREDICTED: uncharacterized protein LOC103711023 [Phoenix dactylifera]
Length=298

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = +1

Query  343  RAPWR-RSLIIRVVGRTVGYNYLLQRLHSLWRPEANMELIDLEYDYYVARFESQRDYDFA  519
            RA WR  ++IIR +GR V   ++ + L    + + ++E   +  + +  RF  ++D + A
Sbjct  79   RAAWRDTAVIIRSLGRWVPAEWISRELRVAGKLDYDVEEFVMAEETFAFRFRCEKDREAA  138

Query  520  RFEGPWTIFDHYIIVQQWVPNFNLASNRT*KILAWVRFPTLPVKYFDEEFLWKIGKNVGE  699
               GPW +    + +++W PNF   +N+  + + W+R P+LP +Y+ +E +W I    G 
Sbjct  139  MEGGPWLVAGQLLAMERWRPNFVPGTNQLGRTVVWLRLPSLPTEYWSKETIWGIAAKAGR  198

Query  700  PVKVDQTTSLSKRGKFARICVQIDITKPLRSKFTIA*EK----YPIEYGGLHLVCSKCGL  867
            P+ +D+ T   ++  FAR+ V++D   P R    I            Y  L   C KC  
Sbjct  199  PLALDKVTDEGRKLGFARVKVEVDAGAPFRPGTFIKVGSDLHWQAFRYESLPGFCFKCAR  258

Query  868  YGQKREQC  891
             G +   C
Sbjct  259  LGHEEGAC  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2230116990256