BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78650_g1_i1 len=975 path=[1:0-974]

Length=975
                                                                      Score     E

gb|KHG02911.1|  superoxide dismutase 1 copper chaperone                 248   1e-78   
ref|XP_008232814.1|  PREDICTED: heavy metal-associated isoprenyla...    243   1e-76   
ref|XP_002281217.1|  PREDICTED: heavy metal-associated isoprenyla...    243   1e-76   Vitis vinifera
ref|XP_007159730.1|  hypothetical protein PHAVU_002G262500g             243   2e-76   
ref|XP_007206070.1|  hypothetical protein PRUPE_ppa012771mg             242   5e-76   
ref|XP_004302198.1|  PREDICTED: heavy metal-associated isoprenyla...    241   1e-75   
ref|XP_004237423.1|  PREDICTED: heavy metal-associated isoprenyla...    240   2e-75   
ref|XP_009369898.1|  PREDICTED: heavy metal-associated isoprenyla...    239   3e-75   
ref|XP_007048040.1|  Heavy metal transport/detoxification domain-...    239   5e-75   
ref|XP_011039548.1|  PREDICTED: heavy metal-associated isoprenyla...    239   7e-75   
ref|XP_002528981.1|  metal ion binding protein, putative                239   8e-75   Ricinus communis
emb|CDP01410.1|  unnamed protein product                                238   1e-74   
ref|XP_008365962.1|  PREDICTED: heavy metal-associated isoprenyla...    238   1e-74   
ref|XP_006366527.1|  PREDICTED: heavy metal-associated isoprenyla...    238   1e-74   
ref|XP_006363944.1|  PREDICTED: heavy metal-associated isoprenyla...    238   1e-74   
ref|NP_001238649.1|  uncharacterized protein LOC100500473               238   1e-74   
ref|XP_006579369.1|  PREDICTED: uncharacterized protein LOC100500...    238   2e-74   
ref|XP_003531366.1|  PREDICTED: heavy metal-associated isoprenyla...    237   2e-74   
ref|XP_009378545.1|  PREDICTED: heavy metal-associated isoprenyla...    237   3e-74   
ref|XP_004239997.1|  PREDICTED: heavy metal-associated isoprenyla...    237   3e-74   
ref|XP_004504043.1|  PREDICTED: heavy metal-associated isoprenyla...    237   3e-74   
ref|XP_008374328.1|  PREDICTED: heavy metal-associated isoprenyla...    236   8e-74   
ref|XP_003630071.1|  hypothetical protein MTR_8g091420                  236   9e-74   
ref|XP_003602005.1|  hypothetical protein MTR_3g087770                  236   1e-73   
gb|AFK43755.1|  unknown                                                 235   2e-73   
gb|AFK40125.1|  unknown                                                 234   6e-73   
ref|XP_002307111.1|  heavy-metal-associated domain-containing fam...    233   8e-73   Populus trichocarpa [western balsam poplar]
gb|ACJ86072.1|  unknown                                                 233   1e-72   Medicago truncatula
ref|XP_008440632.1|  PREDICTED: heavy metal-associated isoprenyla...    233   1e-72   
ref|XP_004143484.1|  PREDICTED: heavy metal-associated isoprenyla...    233   1e-72   
ref|XP_004502447.1|  PREDICTED: heavy metal-associated isoprenyla...    232   3e-72   
ref|XP_009781991.1|  PREDICTED: heavy metal-associated isoprenyla...    231   1e-71   
ref|XP_011005631.1|  PREDICTED: heavy metal-associated isoprenyla...    230   2e-71   
ref|XP_009613481.1|  PREDICTED: heavy metal-associated isoprenyla...    229   3e-71   
ref|XP_006380445.1|  hypothetical protein POPTR_0007s06000g             228   2e-70   
ref|XP_009804016.1|  PREDICTED: heavy metal-associated isoprenyla...    227   3e-70   
ref|XP_011090461.1|  PREDICTED: heavy metal-associated isoprenyla...    226   5e-70   
ref|XP_006428133.1|  hypothetical protein CICLE_v10026695mg             226   6e-70   
ref|XP_010027813.1|  PREDICTED: heavy metal-associated isoprenyla...    226   6e-70   
ref|XP_009607089.1|  PREDICTED: heavy metal-associated isoprenyla...    224   3e-69   
gb|KDP46890.1|  hypothetical protein JCGZ_24099                         224   4e-69   
gb|KHN29092.1|  hypothetical protein glysoja_008427                     223   7e-69   
ref|XP_011097602.1|  PREDICTED: heavy metal-associated isoprenyla...    223   1e-68   
gb|KHN38201.1|  hypothetical protein glysoja_003866                     221   3e-68   
ref|XP_010269164.1|  PREDICTED: heavy metal-associated isoprenyla...    219   2e-67   
ref|XP_007163627.1|  hypothetical protein PHAVU_001G250300g             218   7e-67   
ref|XP_009126827.1|  PREDICTED: heavy metal-associated isoprenyla...    218   9e-67   
gb|KDO42373.1|  hypothetical protein CISIN_1g036289mg                   218   1e-66   
ref|XP_010261203.1|  PREDICTED: heavy metal-associated isoprenyla...    217   2e-66   
emb|CDY42647.1|  BnaC01g00590D                                          216   4e-66   
gb|KHN44322.1|  hypothetical protein glysoja_014363                     216   8e-66   
ref|XP_010680588.1|  PREDICTED: heavy metal-associated isoprenyla...    214   2e-65   
ref|NP_001241088.1|  uncharacterized protein LOC100778653               213   1e-64   
ref|XP_002285811.1|  PREDICTED: heavy metal-associated isoprenyla...    209   3e-63   Vitis vinifera
emb|CBI21468.3|  unnamed protein product                                207   5e-63   
ref|XP_008812723.1|  PREDICTED: heavy metal-associated isoprenyla...    207   1e-62   
ref|XP_010916917.1|  PREDICTED: heavy metal-associated isoprenyla...    207   1e-62   
ref|XP_008790801.1|  PREDICTED: heavy metal-associated isoprenyla...    206   3e-62   
ref|XP_010905918.1|  PREDICTED: heavy metal-associated isoprenyla...    206   3e-62   
ref|XP_009394956.1|  PREDICTED: heavy metal-associated isoprenyla...    206   5e-62   
ref|XP_008798426.1|  PREDICTED: heavy metal-associated isoprenyla...    206   5e-62   
ref|XP_010555349.1|  PREDICTED: heavy metal-associated isoprenyla...    205   1e-61   
ref|XP_010926254.1|  PREDICTED: heavy metal-associated isoprenyla...    205   1e-61   
ref|XP_010939612.1|  PREDICTED: heavy metal-associated isoprenyla...    204   2e-61   
ref|XP_003552099.1|  PREDICTED: heavy metal-associated isoprenyla...    203   5e-61   
ref|NP_195680.1|  heavy metal transport/detoxification domain-con...    202   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446527.1|  PREDICTED: heavy metal-associated isoprenyla...    201   6e-60   
gb|KFK30539.1|  hypothetical protein AALP_AA7G275500                    201   7e-60   
gb|ABK23213.1|  unknown                                                 200   7e-60   Picea sitchensis
ref|XP_006282486.1|  hypothetical protein CARUB_v10006258mg             200   7e-60   
ref|XP_010431947.1|  PREDICTED: heavy metal-associated isoprenyla...    199   2e-59   
ref|XP_010437096.1|  PREDICTED: heavy metal-associated isoprenyla...    199   2e-59   
ref|XP_002866879.1|  predicted protein                                  199   3e-59   
gb|ACN27116.1|  unknown                                                 197   2e-58   Zea mays [maize]
gb|EMT26095.1|  Superoxide dismutase 1 copper chaperone                 196   4e-58   
ref|XP_003578035.1|  PREDICTED: heavy metal-associated isoprenyla...    196   5e-58   
ref|NP_001152036.1|  metal ion binding protein                          196   5e-58   Zea mays [maize]
ref|XP_006411764.1|  hypothetical protein EUTSA_v10026454mg             195   8e-58   
ref|XP_003562643.1|  PREDICTED: heavy metal-associated isoprenyla...    195   1e-57   
ref|XP_008442145.1|  PREDICTED: heavy metal-associated isoprenyla...    192   6e-57   
gb|EMS58641.1|  hypothetical protein TRIUR3_09648                       196   2e-56   
gb|ABK24206.1|  unknown                                                 191   4e-56   Picea sitchensis
ref|XP_009381902.1|  PREDICTED: heavy metal-associated isoprenyla...    189   1e-55   
gb|ABK22742.1|  unknown                                                 188   2e-55   Picea sitchensis
ref|XP_009390577.1|  PREDICTED: heavy metal-associated isoprenyla...    188   3e-55   
ref|XP_008346878.1|  PREDICTED: heavy metal-associated isoprenyla...    188   3e-55   
ref|XP_009391452.1|  PREDICTED: heavy metal-associated isoprenyla...    188   4e-55   
gb|EEC75375.1|  hypothetical protein OsI_11838                          188   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_006660571.1|  PREDICTED: heavy metal-associated isoprenyla...    187   8e-55   
gb|KHF99345.1|  Superoxide dismutase 1 copper chaperone                 187   1e-54   
ref|NP_001050249.1|  Os03g0383900                                       187   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002460130.1|  hypothetical protein SORBIDRAFT_02g023130          186   3e-54   Sorghum bicolor [broomcorn]
ref|XP_010105872.1|  hypothetical protein L484_021527                   186   3e-54   
ref|XP_004146413.1|  PREDICTED: heavy metal-associated isoprenyla...    185   5e-54   
ref|XP_004958383.1|  PREDICTED: heavy metal-associated isoprenyla...    185   5e-54   
gb|KDP32706.1|  hypothetical protein JCGZ_11998                         184   1e-53   
ref|XP_002307397.1|  hypothetical protein POPTR_0005s16490g             184   1e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004956674.1|  PREDICTED: heavy metal-associated isoprenyla...    184   1e-53   
ref|NP_001168502.1|  metal ion binding protein                          184   1e-53   Zea mays [maize]
ref|XP_011027672.1|  PREDICTED: heavy metal-associated isoprenyla...    184   2e-53   
ref|XP_002301034.1|  hypothetical protein POPTR_0002s09280g             184   2e-53   Populus trichocarpa [western balsam poplar]
ref|XP_009345527.1|  PREDICTED: heavy metal-associated isoprenyla...    183   2e-53   
ref|XP_007136210.1|  hypothetical protein PHAVU_009G027600g             183   3e-53   
ref|XP_002463215.1|  hypothetical protein SORBIDRAFT_02g039890          183   4e-53   Sorghum bicolor [broomcorn]
ref|XP_011039025.1|  PREDICTED: heavy metal-associated isoprenyla...    182   4e-53   
ref|XP_011013863.1|  PREDICTED: heavy metal-associated isoprenyla...    182   5e-53   
ref|XP_007045081.1|  Heavy metal transport/detoxification superfa...    182   8e-53   
gb|ABR17552.1|  unknown                                                 182   1e-52   Picea sitchensis
ref|XP_009347206.1|  PREDICTED: heavy metal-associated isoprenyla...    181   1e-52   
ref|XP_006382273.1|  hypothetical protein POPTR_0005s00570g             181   2e-52   
ref|XP_008243341.1|  PREDICTED: heavy metal-associated isoprenyla...    181   2e-52   
ref|XP_004300657.1|  PREDICTED: heavy metal-associated isoprenyla...    181   2e-52   
gb|EAZ44469.1|  hypothetical protein OsJ_29086                          181   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006827006.1|  hypothetical protein AMTR_s00010p00214870          180   4e-52   
ref|XP_007018869.1|  Heavy metal transport/detoxification superfa...    180   4e-52   
ref|XP_008346877.1|  PREDICTED: heavy metal-associated isoprenyla...    180   5e-52   
ref|XP_003522815.1|  PREDICTED: heavy metal-associated isoprenyla...    180   5e-52   
ref|XP_004515645.1|  PREDICTED: heavy metal-associated isoprenyla...    179   6e-52   
ref|XP_009357754.1|  PREDICTED: heavy metal-associated isoprenyla...    179   7e-52   
gb|EAZ08809.1|  hypothetical protein OsI_31075                          180   7e-52   Oryza sativa Indica Group [Indian rice]
gb|EMS55854.1|  hypothetical protein TRIUR3_04753                       180   7e-52   
ref|XP_008339571.1|  PREDICTED: heavy metal-associated isoprenyla...    179   8e-52   
ref|XP_008378054.1|  PREDICTED: heavy metal-associated isoprenyla...    179   9e-52   
gb|KHN24785.1|  hypothetical protein glysoja_037127                     179   9e-52   
gb|AFK38176.1|  unknown                                                 179   1e-51   
ref|XP_007226004.1|  hypothetical protein PRUPE_ppa012978mg             179   1e-51   
ref|XP_008233984.1|  PREDICTED: heavy metal-associated isoprenyla...    178   2e-51   
gb|KHN09147.1|  hypothetical protein glysoja_025608                     178   2e-51   
gb|EPS58148.1|  hypothetical protein M569_16668                         177   2e-51   
ref|XP_010320148.1|  PREDICTED: heavy metal-associated isoprenyla...    178   2e-51   
ref|XP_004238514.1|  PREDICTED: heavy metal-associated isoprenyla...    178   4e-51   
gb|EYU36526.1|  hypothetical protein MIMGU_mgv1a020859mg                176   1e-50   
ref|XP_010544234.1|  PREDICTED: heavy metal-associated isoprenyla...    176   1e-50   
ref|XP_006354021.1|  PREDICTED: heavy metal-associated isoprenyla...    176   1e-50   
ref|XP_010096770.1|  hypothetical protein L484_025888                   176   1e-50   
ref|NP_001242585.1|  uncharacterized protein LOC100805807               176   2e-50   
ref|XP_009409154.1|  PREDICTED: heavy metal-associated isoprenyla...    176   2e-50   
ref|XP_010044169.1|  PREDICTED: heavy metal-associated isoprenyla...    176   2e-50   
ref|XP_010692589.1|  PREDICTED: heavy metal-associated isoprenyla...    176   2e-50   
ref|XP_011038679.1|  PREDICTED: heavy metal-associated isoprenyla...    176   2e-50   
ref|XP_007223670.1|  hypothetical protein PRUPE_ppa012855mg             175   5e-50   
gb|KHG01622.1|  Copper-exporting P-type ATPase A                        175   5e-50   
ref|XP_004297355.1|  PREDICTED: heavy metal-associated isoprenyla...    174   5e-50   
ref|XP_008811964.1|  PREDICTED: heavy metal-associated isoprenyla...    174   5e-50   
ref|XP_006448292.1|  hypothetical protein CICLE_v10017849mg             174   6e-50   
ref|XP_002872408.1|  predicted protein                                  174   6e-50   
ref|XP_010243803.1|  PREDICTED: heavy metal-associated isoprenyla...    174   7e-50   
ref|XP_010916340.1|  PREDICTED: heavy metal-associated isoprenyla...    174   8e-50   
ref|NP_001151667.1|  metal ion binding protein                          174   1e-49   Zea mays [maize]
ref|XP_004297353.1|  PREDICTED: heavy metal-associated isoprenyla...    174   1e-49   
ref|XP_006354022.1|  PREDICTED: heavy metal-associated isoprenyla...    174   1e-49   
ref|XP_002531065.1|  metal ion binding protein, putative                174   1e-49   Ricinus communis
gb|EMT23051.1|  hypothetical protein F775_43162                         174   1e-49   
ref|XP_010906975.1|  PREDICTED: heavy metal-associated isoprenyla...    173   2e-49   
ref|XP_002315894.1|  heavy-metal-associated domain-containing fam...    173   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006378456.1|  hypothetical protein POPTR_0010s12480g             172   2e-49   
ref|XP_006650141.1|  PREDICTED: heavy metal-associated isoprenyla...    174   2e-49   
gb|KDO64716.1|  hypothetical protein CISIN_1g032170mg                   173   2e-49   
ref|XP_006448293.1|  hypothetical protein CICLE_v10017086mg             173   2e-49   
ref|XP_009606650.1|  PREDICTED: heavy metal-associated isoprenyla...    173   3e-49   
gb|AFK39599.1|  unknown                                                 172   4e-49   
ref|NP_192597.1|  heavy-metal-associated domain-containing protein      172   4e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557809.1|  PREDICTED: heavy metal-associated isoprenyla...    172   5e-49   
ref|XP_010066640.1|  PREDICTED: heavy metal-associated isoprenyla...    172   5e-49   
ref|XP_009782213.1|  PREDICTED: heavy metal-associated isoprenyla...    172   5e-49   
ref|XP_009389530.1|  PREDICTED: heavy metal-associated isoprenyla...    171   9e-49   
ref|XP_006434045.1|  hypothetical protein CICLE_v10002768mg             171   1e-48   
ref|XP_010257308.1|  PREDICTED: heavy metal-associated isoprenyla...    172   1e-48   
gb|KGN52144.1|  hypothetical protein Csa_5G611750                       171   1e-48   
ref|XP_002284123.1|  PREDICTED: heavy metal-associated isoprenyla...    171   2e-48   Vitis vinifera
ref|XP_003533947.1|  PREDICTED: heavy metal-associated isoprenyla...    171   2e-48   
emb|CAN63279.1|  hypothetical protein VITISV_023249                     171   3e-48   Vitis vinifera
ref|XP_006472653.1|  PREDICTED: heavy metal-associated isoprenyla...    170   3e-48   
ref|XP_010533407.1|  PREDICTED: heavy metal-associated isoprenyla...    170   4e-48   
ref|XP_006845276.1|  hypothetical protein AMTR_s00005p00265500          169   4e-48   
ref|XP_008389229.1|  PREDICTED: heavy metal-associated isoprenyla...    169   5e-48   
ref|XP_006289069.1|  hypothetical protein CARUB_v10002466mg             169   5e-48   
ref|XP_003555948.1|  PREDICTED: heavy metal-associated isoprenyla...    169   5e-48   
emb|CAN63619.1|  hypothetical protein VITISV_017617                     168   7e-48   Vitis vinifera
gb|KDP38035.1|  hypothetical protein JCGZ_04678                         169   1e-47   
ref|XP_002272293.1|  PREDICTED: heavy metal-associated isoprenyla...    168   1e-47   Vitis vinifera
emb|CDP21674.1|  unnamed protein product                                168   1e-47   
ref|XP_003536626.1|  PREDICTED: heavy metal-associated isoprenyla...    168   2e-47   
ref|XP_007153287.1|  hypothetical protein PHAVU_003G022700g             167   2e-47   
ref|XP_004144847.1|  PREDICTED: heavy metal-associated isoprenyla...    167   3e-47   
ref|XP_002888817.1|  hypothetical protein ARALYDRAFT_894936             167   3e-47   
ref|XP_009356157.1|  PREDICTED: heavy metal-associated isoprenyla...    167   3e-47   
ref|XP_006422591.1|  hypothetical protein CICLE_v10029481mg             167   4e-47   
ref|XP_010922550.1|  PREDICTED: heavy metal-associated isoprenyla...    167   4e-47   
ref|XP_006577898.1|  PREDICTED: heavy metal-associated isoprenyla...    167   4e-47   
gb|AFK36881.1|  unknown                                                 167   5e-47   
gb|EYU43598.1|  hypothetical protein MIMGU_mgv1a015689mg                166   7e-47   
ref|XP_008447957.1|  PREDICTED: heavy metal-associated isoprenyla...    166   9e-47   
ref|XP_011098106.1|  PREDICTED: heavy metal-associated isoprenyla...    166   1e-46   
ref|XP_004498327.1|  PREDICTED: heavy metal-associated isoprenyla...    166   1e-46   
ref|XP_010042028.1|  PREDICTED: heavy metal-associated isoprenyla...    166   1e-46   
ref|XP_010670695.1|  PREDICTED: heavy metal-associated isoprenyla...    166   1e-46   
ref|XP_006430657.1|  hypothetical protein CICLE_v10013659mg             166   1e-46   
gb|KDP29662.1|  hypothetical protein JCGZ_18824                         166   2e-46   
ref|XP_011046678.1|  PREDICTED: heavy metal-associated isoprenyla...    166   2e-46   
gb|KFK41529.1|  hypothetical protein AALP_AA2G141400                    166   2e-46   
ref|XP_010496704.1|  PREDICTED: heavy metal-associated isoprenyla...    167   2e-46   
ref|XP_010471111.1|  PREDICTED: heavy metal-associated isoprenyla...    166   2e-46   
gb|KHN33671.1|  hypothetical protein glysoja_013677                     166   2e-46   
ref|XP_009397973.1|  PREDICTED: heavy metal-associated isoprenyla...    166   2e-46   
ref|XP_004150477.1|  PREDICTED: heavy metal-associated isoprenyla...    165   2e-46   
ref|XP_002534419.1|  metal ion binding protein, putative                166   2e-46   Ricinus communis
ref|XP_008467147.1|  PREDICTED: heavy metal-associated isoprenyla...    165   2e-46   
ref|XP_009783112.1|  PREDICTED: heavy metal-associated isoprenyla...    165   2e-46   
ref|XP_006466995.1|  PREDICTED: heavy metal-associated isoprenyla...    165   2e-46   
ref|NP_177261.1|  heavy-metal-associated domain-containing protein      165   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427920.1|  PREDICTED: heavy metal-associated isoprenyla...    165   3e-46   
gb|EMT25393.1|  hypothetical protein F775_27945                         165   3e-46   
ref|XP_011070641.1|  PREDICTED: heavy metal-associated isoprenyla...    165   3e-46   
ref|XP_010415801.1|  PREDICTED: heavy metal-associated isoprenyla...    166   3e-46   
ref|XP_004512304.1|  PREDICTED: heavy metal-associated isoprenyla...    164   3e-46   
ref|XP_006302959.1|  hypothetical protein CARUB_v10021096mg             165   3e-46   
ref|XP_006390811.1|  hypothetical protein EUTSA_v10019290mg             164   4e-46   
ref|XP_010421776.1|  PREDICTED: heavy metal-associated isoprenyla...    164   4e-46   
ref|XP_009403879.1|  PREDICTED: heavy metal-associated isoprenyla...    164   4e-46   
gb|KDO37877.1|  hypothetical protein CISIN_1g039645mg                   166   4e-46   
ref|NP_001061762.1|  Os08g0403300                                       164   5e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004237014.1|  PREDICTED: heavy metal-associated isoprenyla...    164   6e-46   
ref|XP_006360417.1|  PREDICTED: heavy metal-associated isoprenyla...    164   6e-46   
ref|XP_002513871.1|  metal ion binding protein, putative                164   6e-46   Ricinus communis
gb|ADE76654.1|  unknown                                                 164   7e-46   
ref|XP_002890547.1|  hypothetical protein ARALYDRAFT_472550             164   8e-46   
ref|XP_009105774.1|  PREDICTED: heavy metal-associated isoprenyla...    163   1e-45   
ref|XP_006416133.1|  hypothetical protein EUTSA_v10008952mg             164   1e-45   
ref|XP_009622066.1|  PREDICTED: heavy metal-associated isoprenyla...    163   1e-45   
ref|XP_010265998.1|  PREDICTED: heavy metal-associated isoprenyla...    163   2e-45   
ref|XP_009610148.1|  PREDICTED: heavy metal-associated isoprenyla...    162   3e-45   
ref|XP_003574446.1|  PREDICTED: heavy metal-associated isoprenyla...    162   3e-45   
ref|XP_007143033.1|  hypothetical protein PHAVU_007G037900g             162   3e-45   
gb|EMS48252.1|  hypothetical protein TRIUR3_33177                       162   3e-45   
ref|XP_009775115.1|  PREDICTED: heavy metal-associated isoprenyla...    162   3e-45   
ref|NP_001147129.1|  metal ion binding protein                          162   3e-45   Zea mays [maize]
ref|XP_002306185.1|  GMFP7 family protein                               162   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010477581.1|  PREDICTED: heavy metal-associated isoprenyla...    162   3e-45   
tpg|DAA49093.1|  TPA: hypothetical protein ZEAMMB73_689973              162   3e-45   
ref|XP_009115570.1|  PREDICTED: heavy metal-associated isoprenyla...    162   3e-45   
ref|XP_007137345.1|  hypothetical protein PHAVU_009G119300g             162   4e-45   
gb|KDO64717.1|  hypothetical protein CISIN_1g032170mg                   160   4e-45   
ref|XP_002444313.1|  hypothetical protein SORBIDRAFT_07g020020          161   5e-45   Sorghum bicolor [broomcorn]
ref|XP_006305742.1|  hypothetical protein CARUB_v10010550mg             161   6e-45   
emb|CDY04750.1|  BnaC05g18390D                                          161   7e-45   
ref|NP_173712.1|  heavy-metal-associated domain-containing protein      161   9e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009791012.1|  PREDICTED: heavy metal-associated isoprenyla...    161   1e-44   
emb|CDY21408.1|  BnaA09g30190D                                          161   1e-44   
ref|XP_011097135.1|  PREDICTED: heavy metal-associated isoprenyla...    160   1e-44   
ref|XP_003612216.1|  Atfp6-like protein                                 161   1e-44   
ref|XP_011099491.1|  PREDICTED: heavy metal-associated isoprenyla...    160   1e-44   
gb|KDP22659.1|  hypothetical protein JCGZ_02501                         160   1e-44   
ref|XP_010460075.1|  PREDICTED: heavy metal-associated isoprenyla...    160   2e-44   
gb|EYU44589.1|  hypothetical protein MIMGU_mgv1a018204mg                160   2e-44   
gb|ACG36377.1|  metal ion binding protein                               160   2e-44   Zea mays [maize]
gb|AFK45838.1|  unknown                                                 160   2e-44   
gb|KEH40541.1|  heavy metal transport/detoxification superfamily ...    160   2e-44   
ref|XP_004231044.1|  PREDICTED: heavy metal-associated isoprenyla...    160   2e-44   
ref|XP_011074143.1|  PREDICTED: heavy metal-associated isoprenyla...    160   2e-44   
ref|XP_007041823.1|  Farnesylated protein 6 isoform 1                   160   2e-44   
ref|XP_010107664.1|  hypothetical protein L484_008381                   160   3e-44   
ref|XP_007033097.1|  Heavy metal transport/detoxification superfa...    160   3e-44   
ref|XP_006359700.1|  PREDICTED: heavy metal-associated isoprenyla...    160   3e-44   
gb|ABK96034.1|  unknown                                                 160   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006397275.1|  hypothetical protein EUTSA_v10029043mg             159   4e-44   
ref|XP_011075734.1|  PREDICTED: heavy metal-associated isoprenyla...    159   4e-44   
ref|XP_007216858.1|  hypothetical protein PRUPE_ppa021641mg             159   4e-44   
ref|XP_010266835.1|  PREDICTED: heavy metal-associated isoprenyla...    159   4e-44   
ref|XP_010498791.1|  PREDICTED: heavy metal-associated isoprenyla...    159   4e-44   
gb|KDO71301.1|  hypothetical protein CISIN_1g045611mg                   160   4e-44   
ref|XP_009355667.1|  PREDICTED: heavy metal-associated isoprenyla...    159   4e-44   
emb|CDY12089.1|  BnaC03g60050D                                          159   4e-44   
emb|CDP00747.1|  unnamed protein product                                159   4e-44   
ref|XP_006282751.1|  hypothetical protein CARUB_v10005941mg             159   5e-44   
gb|KHG07180.1|  Superoxide dismutase 1 copper chaperone                 159   6e-44   
gb|ABK95274.1|  unknown                                                 159   8e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009109542.1|  PREDICTED: heavy metal-associated isoprenyla...    159   8e-44   
ref|XP_010069775.1|  PREDICTED: heavy metal-associated isoprenyla...    158   9e-44   
ref|XP_002866809.1|  hypothetical protein ARALYDRAFT_490624             159   9e-44   
ref|XP_011046114.1|  PREDICTED: heavy metal-associated isoprenyla...    158   1e-43   
ref|XP_004973389.1|  PREDICTED: heavy metal-associated isoprenyla...    158   1e-43   
ref|XP_009773515.1|  PREDICTED: heavy metal-associated isoprenyla...    158   1e-43   
ref|XP_007201826.1|  hypothetical protein PRUPE_ppa012801mg             158   1e-43   
ref|XP_008357285.1|  PREDICTED: heavy metal-associated isoprenyla...    158   1e-43   
ref|XP_008377735.1|  PREDICTED: heavy metal-associated isoprenyla...    158   1e-43   
ref|XP_006659384.1|  PREDICTED: heavy metal-associated isoprenyla...    158   1e-43   
ref|XP_004135057.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-43   
ref|XP_010446365.1|  PREDICTED: heavy metal-associated isoprenyla...    158   2e-43   
ref|XP_006411650.1|  hypothetical protein EUTSA_v10026471mg             158   2e-43   
ref|XP_008236023.1|  PREDICTED: heavy metal-associated isoprenyla...    158   2e-43   
ref|XP_010933357.1|  PREDICTED: heavy metal-associated isoprenyla...    158   2e-43   
ref|XP_004979813.1|  PREDICTED: heavy metal-associated isoprenyla...    158   2e-43   
ref|XP_009608111.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-43   
ref|XP_011046131.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-43   
ref|NP_195570.1|  farnesylated protein 6                                157   2e-43   
ref|XP_009103208.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-43   
ref|XP_006652131.1|  PREDICTED: heavy metal-associated isoprenyla...    157   2e-43   
gb|AGW45453.1|  metal ion binding                                       157   2e-43   
ref|XP_006357789.1|  PREDICTED: heavy metal-associated isoprenyla...    157   3e-43   
gb|KDP23989.1|  hypothetical protein JCGZ_25377                         157   3e-43   
gb|KHG30573.1|  Copper chaperone for superoxide dismutase               157   3e-43   
ref|XP_009101937.1|  PREDICTED: heavy metal-associated isoprenyla...    157   4e-43   
ref|XP_004232003.1|  PREDICTED: heavy metal-associated isoprenyla...    156   5e-43   
ref|XP_011092975.1|  PREDICTED: heavy metal-associated isoprenyla...    157   5e-43   
emb|CDY25762.1|  BnaA07g10200D                                          157   5e-43   
ref|XP_009592412.1|  PREDICTED: heavy metal-associated isoprenyla...    156   5e-43   
emb|CDY12499.1|  BnaC07g13390D                                          156   5e-43   
ref|XP_008460493.1|  PREDICTED: heavy metal-associated isoprenyla...    156   6e-43   
ref|XP_009790755.1|  PREDICTED: heavy metal-associated isoprenyla...    156   7e-43   
ref|XP_003604043.1|  Farnesylated protein (ATFP6)                       156   7e-43   
ref|XP_004140315.1|  PREDICTED: heavy metal-associated isoprenyla...    156   8e-43   
ref|XP_010436952.1|  PREDICTED: heavy metal-associated isoprenyla...    156   9e-43   
ref|XP_003581604.1|  PREDICTED: heavy metal-associated isoprenyla...    156   9e-43   
gb|AAM60879.1|  farnesylated protein (ATFP6)                            156   9e-43   
ref|XP_009791644.1|  PREDICTED: heavy metal-associated isoprenyla...    156   9e-43   
ref|NP_001052304.1|  Os04g0244800                                       156   9e-43   
ref|XP_008457089.1|  PREDICTED: heavy metal-associated isoprenyla...    155   1e-42   
ref|XP_010108935.1|  hypothetical protein L484_027130                   155   1e-42   
ref|XP_010920102.1|  PREDICTED: heavy metal-associated isoprenyla...    155   1e-42   
ref|XP_008381309.1|  PREDICTED: heavy metal-associated isoprenyla...    155   1e-42   
ref|XP_007046632.1|  Farnesylated protein 6                             155   1e-42   
gb|ADE77428.1|  unknown                                                 155   2e-42   
ref|XP_002447552.1|  hypothetical protein SORBIDRAFT_06g003280          155   2e-42   
ref|XP_010531538.1|  PREDICTED: heavy metal-associated isoprenyla...    155   2e-42   
ref|XP_009605894.1|  PREDICTED: heavy metal-associated isoprenyla...    155   2e-42   
ref|XP_011021357.1|  PREDICTED: heavy metal-associated isoprenyla...    154   3e-42   
gb|ACG43933.1|  farnesylated protein 1                                  154   3e-42   
emb|CAD48128.1|  farnesylated protein 1                                 154   3e-42   
ref|XP_010028730.1|  PREDICTED: heavy metal-associated isoprenyla...    154   4e-42   
ref|XP_009413013.1|  PREDICTED: heavy metal-associated isoprenyla...    154   4e-42   
ref|NP_001149664.1|  farnesylated protein 1                             154   4e-42   
ref|XP_008357284.1|  PREDICTED: heavy metal-associated isoprenyla...    158   5e-42   
ref|XP_004500726.1|  PREDICTED: heavy metal-associated isoprenyla...    154   5e-42   
ref|NP_001151691.1|  LOC100285326                                       154   6e-42   
ref|XP_008809430.1|  PREDICTED: heavy metal-associated isoprenyla...    154   7e-42   
ref|XP_010431798.1|  PREDICTED: heavy metal-associated isoprenyla...    153   9e-42   
ref|XP_007202938.1|  hypothetical protein PRUPE_ppa016811mg             153   9e-42   
ref|XP_006383348.1|  heavy-metal-associated domain-containing fam...    153   9e-42   
gb|KFK30460.1|  hypothetical protein AALP_AA7G264000                    153   1e-41   
ref|XP_004140740.1|  PREDICTED: heavy metal-associated isoprenyla...    153   1e-41   
ref|XP_009376948.1|  PREDICTED: heavy metal-associated isoprenyla...    153   1e-41   
ref|XP_011088612.1|  PREDICTED: heavy metal-associated isoprenyla...    153   1e-41   
ref|XP_004234634.1|  PREDICTED: heavy metal-associated isoprenyla...    152   1e-41   
ref|XP_008807137.1|  PREDICTED: heavy metal-associated isoprenyla...    153   1e-41   
ref|XP_004162724.1|  PREDICTED: heavy metal-associated isoprenyla...    152   1e-41   
ref|XP_003612452.1|  hypothetical protein MTR_5g025150                  152   1e-41   
ref|XP_004157176.1|  PREDICTED: heavy metal-associated isoprenyla...    152   1e-41   
gb|KHG07179.1|  Superoxide dismutase 1 copper chaperone                 152   1e-41   
ref|XP_008440847.1|  PREDICTED: heavy metal-associated isoprenyla...    153   1e-41   
ref|XP_002278879.1|  PREDICTED: heavy metal-associated isoprenyla...    153   2e-41   
ref|XP_004287788.1|  PREDICTED: heavy metal-associated isoprenyla...    152   2e-41   
emb|CDP02719.1|  unnamed protein product                                152   2e-41   
ref|XP_009371810.1|  PREDICTED: heavy metal-associated isoprenyla...    152   2e-41   
gb|AIE40060.1|  heavy metal-associated isoprenylated protein 1          152   3e-41   
ref|XP_010062228.1|  PREDICTED: heavy metal-associated isoprenyla...    152   3e-41   
ref|XP_009113496.1|  PREDICTED: heavy metal-associated isoprenyla...    152   3e-41   
gb|AFK33831.1|  unknown                                                 152   3e-41   
emb|CDY36193.1|  BnaAnng04390D                                          152   3e-41   
emb|CDX72748.1|  BnaC07g47700D                                          152   3e-41   
ref|XP_007131717.1|  hypothetical protein PHAVU_011G035900g             152   4e-41   
gb|EYU41325.1|  hypothetical protein MIMGU_mgv1a026598mg                151   4e-41   
ref|XP_006651448.1|  PREDICTED: heavy metal-associated isoprenyla...    151   4e-41   
gb|EYU31042.1|  hypothetical protein MIMGU_mgv1a017832mg                150   5e-41   
ref|XP_004134849.1|  PREDICTED: heavy metal-associated isoprenyla...    151   5e-41   
ref|XP_008242048.1|  PREDICTED: heavy metal-associated isoprenyla...    151   5e-41   
gb|EYU37957.1|  hypothetical protein MIMGU_mgv1a015538mg                151   5e-41   
ref|XP_011021358.1|  PREDICTED: heavy metal-associated isoprenyla...    151   6e-41   
ref|XP_009403887.1|  PREDICTED: heavy metal-associated isoprenyla...    150   7e-41   
ref|XP_010693750.1|  PREDICTED: heavy metal-associated isoprenyla...    150   1e-40   
ref|XP_011004609.1|  PREDICTED: heavy metal-associated isoprenyla...    151   2e-40   
ref|XP_009622067.1|  PREDICTED: heavy metal-associated isoprenyla...    149   2e-40   
ref|XP_009379348.1|  PREDICTED: heavy metal-associated isoprenyla...    150   2e-40   
ref|XP_003607174.1|  Farnesylated protein (ATFP6)                       149   3e-40   
ref|XP_006425400.1|  hypothetical protein CICLE_v10027274mg             150   3e-40   
ref|NP_001043154.1|  Os01g0507700                                       149   4e-40   
ref|NP_001239806.1|  uncharacterized protein LOC100815905               149   5e-40   
ref|XP_004232511.2|  PREDICTED: heavy metal-associated isoprenyla...    149   6e-40   
ref|XP_008344223.1|  PREDICTED: heavy metal-associated isoprenyla...    149   6e-40   
ref|XP_007150871.1|  hypothetical protein PHAVU_004G001200g             148   7e-40   
emb|CDP21685.1|  unnamed protein product                                148   8e-40   
ref|XP_003537715.1|  PREDICTED: heavy metal-associated isoprenyla...    148   8e-40   
gb|KEH24715.1|  heavy metal transport/detoxification superfamily ...    148   1e-39   
gb|ACU21394.1|  unknown                                                 147   2e-39   
ref|XP_009788334.1|  PREDICTED: heavy metal-associated isoprenyla...    147   2e-39   
ref|XP_004289875.1|  PREDICTED: heavy metal-associated isoprenyla...    147   2e-39   
gb|KHN13913.1|  hypothetical protein glysoja_016197                     146   3e-39   
ref|XP_007041824.1|  Farnesylated protein 6 isoform 2                   147   3e-39   
gb|EPS65925.1|  hypothetical protein M569_08856                         147   3e-39   
ref|XP_006340767.1|  PREDICTED: heavy metal-associated isoprenyla...    147   3e-39   
gb|AFG49647.1|  hypothetical protein 0_13209_02                         144   6e-39   
ref|NP_001236173.1|  uncharacterized protein LOC100306004               145   6e-39   
ref|XP_009599463.1|  PREDICTED: heavy metal-associated isoprenyla...    146   7e-39   
ref|XP_002465836.1|  hypothetical protein SORBIDRAFT_01g046650          145   9e-39   
ref|XP_004505822.1|  PREDICTED: heavy metal-associated isoprenyla...    145   9e-39   
ref|XP_007139206.1|  hypothetical protein PHAVU_008G010200g             145   1e-38   
gb|AFG49660.1|  hypothetical protein 0_13209_02                         143   1e-38   
ref|XP_009150857.1|  PREDICTED: heavy metal-associated isoprenyla...    145   1e-38   
ref|NP_001049010.1|  Os03g0156600                                       145   2e-38   
ref|XP_008651178.1|  PREDICTED: heavy metal-associated isoprenyla...    145   2e-38   
ref|XP_002531159.1|  metal ion binding protein, putative                144   2e-38   
gb|ACG27273.1|  farnesylated protein 2                                  144   2e-38   
ref|NP_001148035.1|  LOC100281644                                       144   2e-38   
ref|XP_002866773.1|  metal ion binding protein                          144   3e-38   
ref|XP_010444836.1|  PREDICTED: heavy metal-associated isoprenyla...    144   3e-38   
ref|XP_006644215.1|  PREDICTED: heavy metal-associated isoprenyla...    144   3e-38   
ref|XP_010558674.1|  PREDICTED: heavy metal-associated isoprenyla...    143   5e-38   
ref|XP_004492985.1|  PREDICTED: heavy metal-associated isoprenyla...    143   6e-38   
ref|XP_004968816.1|  PREDICTED: heavy metal-associated isoprenyla...    143   7e-38   
gb|AAD09515.1|  GMFP7                                                   142   7e-38   
ref|XP_009107517.1|  PREDICTED: heavy metal-associated isoprenyla...    143   8e-38   
emb|CDX88005.1|  BnaA06g25960D                                          142   9e-38   
emb|CDX75144.1|  BnaC09g25380D                                          142   1e-37   
ref|NP_201412.2|  heavy metal associated isoprenylated plant prot...    142   1e-37   
emb|CDY07874.1|  BnaC03g47480D                                          142   1e-37   
ref|XP_002444859.1|  hypothetical protein SORBIDRAFT_07g000380          142   1e-37   
ref|XP_010465932.1|  PREDICTED: heavy metal-associated isoprenyla...    142   1e-37   
ref|XP_006281271.1|  hypothetical protein CARUB_v10027319mg             142   1e-37   
emb|CDY38431.1|  BnaA10g17270D                                          142   2e-37   
ref|XP_003558539.1|  PREDICTED: heavy metal-associated isoprenyla...    142   2e-37   
ref|XP_003518642.1|  PREDICTED: heavy metal-associated isoprenyla...    142   2e-37   
emb|CAD70173.1|  farnesylated protein 3                                 142   2e-37   
emb|CDY16919.1|  BnaC09g40460D                                          141   2e-37   
emb|CAD70172.1|  farnesylated protein 2                                 141   3e-37   
ref|XP_008393893.1|  PREDICTED: heavy metal-associated isoprenyla...    141   3e-37   
ref|XP_010029655.1|  PREDICTED: heavy metal-associated isoprenyla...    141   4e-37   
ref|XP_006383068.1|  hypothetical protein POPTR_0005s11250g             141   4e-37   
ref|XP_008381310.1|  PREDICTED: heavy metal-associated isoprenyla...    140   4e-37   
gb|AIE40061.1|  heavy metal-associated isoprenylated protein 3          141   4e-37   
ref|XP_006649426.1|  PREDICTED: heavy metal-associated isoprenyla...    141   4e-37   
ref|XP_002312958.2|  hypothetical protein POPTR_0009s13760g             141   5e-37   
ref|XP_003624424.1|  Metal ion binding protein                          140   7e-37   
gb|EAY88605.1|  hypothetical protein OsI_10080                          140   8e-37   
ref|XP_004985648.1|  PREDICTED: heavy metal-associated isoprenyla...    140   9e-37   
gb|EMT21257.1|  hypothetical protein F775_28702                         139   2e-36   
ref|XP_009379349.1|  PREDICTED: heavy metal-associated isoprenyla...    138   2e-36   
ref|XP_010549763.1|  PREDICTED: heavy metal-associated isoprenyla...    140   2e-36   
ref|XP_010108382.1|  hypothetical protein L484_010390                   139   2e-36   
gb|EPS58116.1|  hypothetical protein M569_16700                         139   2e-36   
ref|XP_010550479.1|  PREDICTED: heavy metal-associated isoprenyla...    139   2e-36   
ref|NP_197247.1|  heavy metal transport/detoxification domain-con...    139   3e-36   
ref|XP_008375088.1|  PREDICTED: heavy metal-associated isoprenyla...    140   3e-36   
ref|XP_010420469.1|  PREDICTED: heavy metal-associated isoprenyla...    139   3e-36   
emb|CDY55938.1|  BnaC02g44160D                                          138   5e-36   
gb|KCW69323.1|  hypothetical protein EUGRSUZ_F02815                     137   6e-36   
dbj|BAJ89496.1|  predicted protein                                      138   6e-36   
gb|KFK28270.1|  hypothetical protein AALP_AA8G494900                    137   6e-36   
gb|KFK25957.1|  hypothetical protein AALP_AA8G184700                    137   1e-35   
ref|XP_010679885.1|  PREDICTED: LOW QUALITY PROTEIN: heavy metal-...    137   1e-35   
gb|EMS52209.1|  hypothetical protein TRIUR3_10047                       137   1e-35   
ref|XP_004513852.1|  PREDICTED: heavy metal-associated isoprenyla...    135   4e-35   
gb|EYU40439.1|  hypothetical protein MIMGU_mgv1a019014mg                136   4e-35   
ref|XP_011043157.1|  PREDICTED: heavy metal-associated isoprenyla...    135   6e-35   
dbj|BAJ97551.1|  predicted protein                                      135   7e-35   
ref|XP_003574995.1|  PREDICTED: heavy metal-associated isoprenyla...    135   8e-35   
ref|XP_004297354.1|  PREDICTED: heavy metal-associated isoprenyla...    134   8e-35   
ref|XP_010550480.1|  PREDICTED: heavy metal-associated isoprenyla...    134   1e-34   
ref|XP_002272623.1|  PREDICTED: heavy metal-associated isoprenyla...    135   1e-34   
ref|XP_011043158.1|  PREDICTED: heavy metal-associated isoprenyla...    134   1e-34   
gb|AAD09511.1|  ATFP7                                                   133   1e-34   
gb|EMS63565.1|  hypothetical protein TRIUR3_29878                       134   2e-34   
emb|CDP01864.1|  unnamed protein product                                134   2e-34   
ref|NP_001288682.1|  heavy metal-associated isoprenylated plant p...    134   2e-34   
ref|XP_006601735.1|  PREDICTED: uncharacterized protein LOC100306...    133   2e-34   
ref|NP_001236151.1|  uncharacterized protein LOC100527442               134   2e-34   
ref|XP_010530914.1|  PREDICTED: heavy metal-associated isoprenyla...    134   2e-34   
ref|XP_010690364.1|  PREDICTED: heavy metal-associated isoprenyla...    134   3e-34   
gb|EPS64000.1|  hypothetical protein M569_10783                         132   3e-34   
ref|XP_007153284.1|  hypothetical protein PHAVU_003G022400g             133   4e-34   
ref|XP_009126185.1|  PREDICTED: heavy metal-associated isoprenyla...    133   4e-34   
ref|XP_010447003.1|  PREDICTED: heavy metal-associated isoprenyla...    133   4e-34   
ref|XP_006284680.1|  hypothetical protein CARUB_v10005938mg             133   4e-34   
ref|XP_010437530.1|  PREDICTED: heavy metal-associated isoprenyla...    133   6e-34   
gb|KEH24716.1|  heavy metal transport/detoxification superfamily ...    131   8e-34   
ref|XP_002272585.1|  PREDICTED: heavy metal-associated isoprenyla...    132   8e-34   
ref|XP_010432344.1|  PREDICTED: heavy metal-associated isoprenyla...    132   1e-33   
ref|XP_002867093.1|  predicted protein                                  131   3e-33   
ref|XP_006412158.1|  hypothetical protein EUTSA_v10026474mg             131   3e-33   
dbj|BAF00942.1|  hypothetical protein                                   131   3e-33   
ref|NP_567975.1|  heavy metal transport/detoxification domain-con...    130   3e-33   
dbj|BAB10416.1|  atfp6-like protein                                     130   3e-33   
dbj|BAJ91258.1|  predicted protein                                      130   3e-33   
ref|XP_003614523.1|  hypothetical protein MTR_5g055020                  130   4e-33   
ref|XP_008792882.1|  PREDICTED: heavy metal-associated isoprenyla...    129   4e-33   
emb|CDX69108.1|  BnaC01g03450D                                          130   6e-33   
gb|AAD09510.1|  ATFP6                                                   129   6e-33   
ref|XP_009106425.1|  PREDICTED: heavy metal-associated isoprenyla...    130   8e-33   
ref|XP_009107518.1|  PREDICTED: heavy metal-associated isoprenyla...    128   9e-33   
emb|CAN71845.1|  hypothetical protein VITISV_036265                     128   1e-32   
emb|CDY17504.1|  BnaC03g65590D                                          129   2e-32   
ref|XP_004968520.1|  PREDICTED: heavy metal-associated isoprenyla...    129   2e-32   
gb|EMT00914.1|  hypothetical protein F775_21792                         129   2e-32   
ref|XP_009108689.1|  PREDICTED: heavy metal-associated isoprenyla...    129   2e-32   
gb|KFK30144.1|  farnesylated protein                                    128   3e-32   
ref|NP_974795.1|  heavy metal transport/detoxification domain-con...    125   9e-32   
gb|EMT29574.1|  hypothetical protein F775_21124                         125   2e-31   
gb|EMT10052.1|  hypothetical protein F775_28446                         126   2e-31   
gb|EPS58418.1|  hypothetical protein M569_16395                         119   3e-29   
dbj|BAD33452.1|  putative ATFP7                                         119   3e-29   
ref|NP_001063001.1|  Os09g0364800                                       115   5e-28   



>gb|KHG02911.1| superoxide dismutase 1 copper chaperone [Gossypium arboreum]
Length=153

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 139/155 (90%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+MSSS     K+K  QLQTVELKVRMDCDGCELKVKKALSSL+GVK+V
Sbjct  1    MGVSGTLEYLSDLMSSSGHKHKKRK--QLQTVELKVRMDCDGCELKVKKALSSLNGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYA  AYDKKAPPGYV
Sbjct  59   NINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVTAYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+VDN   +T T  R++DPY+T+FSDENPNACSVM
Sbjct  119  RKVDNNVSSTATVTRYEDPYITMFSDENPNACSVM  153



>ref|XP_008232814.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Prunus mume]
 ref|XP_008246221.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Prunus mume]
Length=155

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 139/157 (89%), Gaps = 6/157 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++ +S     KKK  QLQTVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLVHNSSHKHKKKK--QLQTVELKVRMDCDGCELKVKKALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV+VTGYVEANKVLKKAKSTGK+AEIWPY+PYNLVAQPY AQAYDKKAPPGYV
Sbjct  59   EINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYIPYNLVAQPYIAQAYDKKAPPGYV  118

Query  439  RRVDN----PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+N     +TGT  R++DPY T+FSD+NPNACS+M
Sbjct  119  RNVENMNMTSSTGTVTRYEDPYTTMFSDDNPNACSIM  155



>ref|XP_002281217.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
Length=151

 Score =   243 bits (621),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+MSS H HK +K   Q QTVELKVRMDC+GCELKVKK LSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMSSGHKHKKRK---QSQTVELKVRMDCEGCELKVKKTLSSLSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DINRKQQKVTVTGYV+ANKVLKKAKSTGKKAE+WPYVPYNLVAQPYA  AYDKKAPPGYV
Sbjct  58   DINRKQQKVTVTGYVDANKVLKKAKSTGKKAELWPYVPYNLVAQPYAVHAYDKKAPPGYV  117

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+  P +GT  R++DPY+T+FSDENPNACS+M
Sbjct  118  RNVEQPPISGTVTRYEDPYITMFSDENPNACSIM  151



>ref|XP_007159730.1| hypothetical protein PHAVU_002G262500g [Phaseolus vulgaris]
 gb|ESW31724.1| hypothetical protein PHAVU_002G262500g [Phaseolus vulgaris]
Length=153

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M S + HK KKKK Q QTVELKVRMDCDGCELKVK ALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMGSGYQHKKKKKK-QFQTVELKVRMDCDGCELKVKNALSSLSGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTV+GYVEANKVLKKAKSTGKKAEIWPYVPYNLVA PYA  AYDKKAPPGYV
Sbjct  60   EINRKQQKVTVSGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAHPYAVAAYDKKAPPGYV  119

Query  439  RRVDNP-TTGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+ P  TGT  R++DPYVT+FSD+NPNACS+M
Sbjct  120  RRVEVPANTGTITRYEDPYVTMFSDDNPNACSIM  153



>ref|XP_007206070.1| hypothetical protein PRUPE_ppa012771mg [Prunus persica]
 gb|EMJ07269.1| hypothetical protein PRUPE_ppa012771mg [Prunus persica]
Length=155

 Score =   242 bits (617),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 140/157 (89%), Gaps = 6/157 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++++S     KKK  QLQTVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLVNNSGHKHKKKK--QLQTVELKVRMDCDGCELKVKKALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV+VTGYVEANKVLKKAKSTGK+AEIWPYVPYNLVAQPY AQAYDK+APPG+V
Sbjct  59   EINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKRAPPGHV  118

Query  439  RRVDN----PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+N     +TGT  R++DPY T+FSD+NPNACS+M
Sbjct  119  RNVENMNMTSSTGTVTRYEDPYTTMFSDDNPNACSIM  155



>ref|XP_004302198.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Fragaria vesca subsp. vesca]
Length=152

 Score =   241 bits (614),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M S      KKK  QLQTVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMGSGGHKHKKKK--QLQTVELKVRMDCDGCELKVKKALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQK +VTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVAQPY A AYDKKAPPGYV
Sbjct  59   EINRKQQKASVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYMAPAYDKKAPPGYV  118

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V+N  TTGT  R++DPY  +FSDENPNACS+M
Sbjct  119  RKVENTATTGTMTRYEDPYTAMFSDENPNACSIM  152



>ref|XP_004237423.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Solanum lycopersicum]
Length=152

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 5/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEYIS+MMS     K KK   Q  TVELKVRMDC+GCE+KVK  LSS+SGVK+V
Sbjct  1    MGVGGTLEYISEMMSIEKPKKKKK---QFNTVELKVRMDCEGCEMKVKNTLSSMSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPY+PYNLV+QPYAAQAYDKKAPPGYV
Sbjct  58   EINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYIPYNLVSQPYAAQAYDKKAPPGYV  117

Query  439  RRVDN-PTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRVD  PTTGT AR++DP YV +FSD+NPNACS+M
Sbjct  118  RRVDQYPTTGTVARYEDPSYVNMFSDDNPNACSIM  152



>ref|XP_009369898.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=153

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 139/155 (90%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++++S     KKK  QLQTVELK+RMDCDGCELKVK ALSSL+GVK+V
Sbjct  1    MGVGGTLEYLSDLVNNSGHKHKKKK--QLQTVELKIRMDCDGCELKVKNALSSLTGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV+VTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVAQPY AQAYDKKAPPGYV
Sbjct  59   EINRKQQKVSVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R VDN   +TGTA +++DPY T+FSD+NPNACS+M
Sbjct  119  RNVDNNPSSTGTATKYEDPYTTMFSDDNPNACSIM  153



>ref|XP_007048040.1| Heavy metal transport/detoxification domain-containing protein 
[Theobroma cacao]
 gb|EOX92197.1| Heavy metal transport/detoxification domain-containing protein 
[Theobroma cacao]
Length=152

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+MSSS     KKK  QL TVELKVRMDCDGCELKVKKAL+SLSGVK+V
Sbjct  1    MGVAGTLEYLSDLMSSSGHKYKKKK--QLHTVELKVRMDCDGCELKVKKALASLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVAQPYAA AYDKKAPPGYV
Sbjct  59   NINRKQQKVTVTGYVETNKVLKKAKSTGKRAEIWPYVPYNLVAQPYAAPAYDKKAPPGYV  118

Query  439  RRVDNP-TTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+N  TT    R++DPY+++FSD+NPNACSVM
Sbjct  119  RNVENNVTTAAVTRYEDPYISLFSDDNPNACSVM  152



>ref|XP_011039548.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
 ref|XP_011015668.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=151

 Score =   239 bits (609),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++ S      KK   QLQTVELKVRMDCDGCELKVK A+SSLSGVK V
Sbjct  1    MGVSGTLEYLSDLVGSGGHKNKKK---QLQTVELKVRMDCDGCELKVKNAISSLSGVKKV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQ+VTVTGYV++NKVLKKAKSTGKKAEIWPYVPYNLVAQPYA QAYDKKAPPGYV
Sbjct  58   EINRKQQRVTVTGYVDSNKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVQAYDKKAPPGYV  117

Query  439  RRVDNP-TTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+N  TTGT  R++DPY +IFSD+NPNACS+M
Sbjct  118  RNVENTVTTGTVTRYEDPYTSIFSDDNPNACSIM  151



>ref|XP_002528981.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF33400.1| metal ion binding protein, putative [Ricinus communis]
Length=153

 Score =   239 bits (609),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M SS     KKKK QLQTVELK+RMDCDGCELKVK ALSS+SGVK V
Sbjct  1    MGVGGTLEYLSDLMGSSGHKYKKKKK-QLQTVELKIRMDCDGCELKVKNALSSMSGVKKV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYV+ NKVLKKAKSTGKKAEIWPYVPYNLVAQPY AQAYDKKAPPGYV
Sbjct  60   EINRKQQKVTVTGYVDPNKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYV  119

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+N  T+GT  R++DPY ++FSD+NPNACS+M
Sbjct  120  RNVENTATSGTVTRYEDPYSSMFSDDNPNACSIM  153



>emb|CDP01410.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS H HK KK   Q+QTVELKVRMDC+GCELKVKKALSSLSGVKTV
Sbjct  1    MGVSGTLEYLSDLVSSGHKHKKKK---QMQTVELKVRMDCEGCELKVKKALSSLSGVKTV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRK QK TVTGYVE NKVLKKAKSTGKKAEIWPYVPY LVAQPYA Q+YDKKAPPGYV
Sbjct  58   EINRKLQKATVTGYVEPNKVLKKAKSTGKKAEIWPYVPYGLVAQPYAVQSYDKKAPPGYV  117

Query  439  RRVDNPTTGTAARFD-DPYVTIFSDENPNACSVM  341
            R+V+ PTTGT  R+D DPY+++FSDENPNACS+M
Sbjct  118  RKVEYPTTGTVTRYDQDPYISMFSDENPNACSIM  151



>ref|XP_008365962.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
Length=153

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 138/155 (89%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++++S     KKK  QLQTVELKVRMDCDGCELKVK ALSSL+GVK+V
Sbjct  1    MGVGGTLEYLSDLVNNSGHKHKKKK--QLQTVELKVRMDCDGCELKVKNALSSLTGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV+VTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVAQPY AQAYDKKAPPGYV
Sbjct  59   EINRKQQKVSVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R VDN   +TGT  +++DPY T+FSD+NPNACS+M
Sbjct  119  RNVDNNPSSTGTVTKYEDPYTTMFSDDNPNACSIM  153



>ref|XP_006366527.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=154

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 137/156 (88%), Gaps = 5/156 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MGLGGTLEYIS+MM+ SH   +KK+  Q  TVELKVRMDCDGCELKVKK LSSLSGVK+V
Sbjct  1    MGLGGTLEYISNMMNISHKSNNKKR--QFHTVELKVRMDCDGCELKVKKTLSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYA  +YDKKAPPGYV
Sbjct  59   EINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVASYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDD-PYVTIFSDENPNACSVM  341
            RRVD+   TT T +RF+D  YV++FSD+NPNAC +M
Sbjct  119  RRVDHNMTTTETISRFEDLAYVSMFSDDNPNACFIM  154



>ref|XP_006363944.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=152

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 5/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEYIS+MMS     K KK   Q  TVELKVRMDC+GCE+KVK  LSS+SGVK+V
Sbjct  1    MGVGGTLEYISEMMSIDKPKKKKK---QFTTVELKVRMDCEGCEMKVKNTLSSMSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPYVPYNLV+QPYAAQAYDKKAPPG+V
Sbjct  58   EINRKQQKVTVTGYVEQNKVLKKAKSTGKKAEIWPYVPYNLVSQPYAAQAYDKKAPPGFV  117

Query  439  RRVDN-PTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRVD  PTTGT AR+DDP YV +FSD+NPNAC +M
Sbjct  118  RRVDQYPTTGTVARYDDPSYVNMFSDDNPNACFIM  152



>ref|NP_001238649.1| uncharacterized protein LOC100500473 [Glycine max]
 gb|ACU15561.1| unknown [Glycine max]
Length=152

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 135/154 (88%), Gaps = 3/154 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M S H H  KKK  Q QTVELKVRMDCDGCELKVK ALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMGSGHHHHKKKK--QFQTVELKVRMDCDGCELKVKNALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPYVPYNLV  PYA  +YDKKAPPGYV
Sbjct  59   EINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPYNLVVHPYAVPSYDKKAPPGYV  118

Query  439  RRVDNPT-TGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+ P  TGT  R++DPY+T+FSD+NPNACS+M
Sbjct  119  RRVEAPAHTGTITRYEDPYITMFSDDNPNACSIM  152



>ref|XP_006579369.1| PREDICTED: uncharacterized protein LOC100500473 isoform X1 [Glycine 
max]
Length=153

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M S H H  KKKK Q QTVELKVRMDCDGCELKVK ALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMGSGHHHHKKKKK-QFQTVELKVRMDCDGCELKVKNALSSLSGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPYVPYNLV  PYA  +YDKKAPPGYV
Sbjct  60   EINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPYNLVVHPYAVPSYDKKAPPGYV  119

Query  439  RRVDNPT-TGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+ P  TGT  R++DPY+T+FSD+NPNACS+M
Sbjct  120  RRVEAPAHTGTITRYEDPYITMFSDDNPNACSIM  153



>ref|XP_003531366.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform 1 [Glycine max]
 ref|XP_003531367.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform 2 [Glycine max]
Length=153

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 136/154 (88%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M S H H  KKKK Q QTVELKVRMDCDGCELKVK ALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMGSGHHHHKKKKK-QFQTVELKVRMDCDGCELKVKNALSSLSGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPYVPYNLVA PYA  +YDKKAPPGYV
Sbjct  60   EINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPYNLVAHPYAVPSYDKKAPPGYV  119

Query  439  RRVDNPT-TGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+ P  TG   R++DPY+T+FSD+NPNACS+M
Sbjct  120  RRVEAPAHTGIITRYEDPYITMFSDDNPNACSIM  153



>ref|XP_009378545.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=153

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 137/155 (88%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+G TLEY+SD++++S     KKK  QLQTVELKVRMDCDGCELKVK ALSSL+GVK+V
Sbjct  1    MGVGETLEYLSDLVNNSGYKHKKKK--QLQTVELKVRMDCDGCELKVKNALSSLTGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVAQPY AQAYDKKAPPGYV
Sbjct  59   EINRKQQKVTVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAQAYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R VDN   +TGT  +++DPY T+FSD+NPNACS+M
Sbjct  119  RNVDNNPSSTGTVTKYEDPYTTMFSDDNPNACSIM  153



>ref|XP_004239997.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
Length=154

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 135/156 (87%), Gaps = 5/156 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MGLGGTLEYI DMM  SH   +KK+  Q  TVELK+RMDCDGCELKVKK LSS+SGVK+V
Sbjct  1    MGLGGTLEYIYDMMKISHKSNNKKR--QFHTVELKIRMDCDGCELKVKKTLSSISGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYA  +YDKKAPPGYV
Sbjct  59   EINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVASYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRVD+   T GT +RF+D  YVT+FSD+NPNAC +M
Sbjct  119  RRVDHNMTTIGTISRFEDHDYVTMFSDDNPNACFIM  154



>ref|XP_004504043.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=154

 Score =   237 bits (605),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 3/155 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+MS+ H H  KKKK+  QTVELK+RMDCDGCELK+KK LSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLMSTGHHHLKKKKKQL-QTVELKIRMDCDGCELKIKKTLSSLSGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVAQPYA  +YDKKAPPGYV
Sbjct  60   EINRKQQKVTVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAQPYAVSSYDKKAPPGYV  119

Query  439  RRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+N   TTGT  R++DPYV +FSDENPNACS+M
Sbjct  120  RRVENAAATTGTMTRYEDPYVNMFSDENPNACSIM  154



>ref|XP_008374328.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Malus domestica]
Length=153

 Score =   236 bits (602),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 137/155 (88%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++++S     KKK  QLQTVELKVRMDCDGCELKVK ALSSL+GVK+V
Sbjct  1    MGVGGTLEYLSDLVNNSGYKHKKKK--QLQTVELKVRMDCDGCELKVKNALSSLTGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV VTGYVE NKVLKKAKSTGK+AEIWPYVPY+LVAQPY AQAYDKKAPPGYV
Sbjct  59   EINRKQQKVXVTGYVEPNKVLKKAKSTGKRAEIWPYVPYSLVAQPYIAQAYDKKAPPGYV  118

Query  439  RRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R VDN   +TGT  +++DPY T+FSD+NPNACS+M
Sbjct  119  RNVDNNPSSTGTVTKYEDPYTTMFSDDNPNACSIM  153



>ref|XP_003630071.1| hypothetical protein MTR_8g091420 [Medicago truncatula]
 gb|AET04547.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=153

 Score =   236 bits (602),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 140/154 (91%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++SS H H  KKKK+  QTVELKVRMDCDGCELKVKK LSSLSGV++V
Sbjct  1    MGVGGTLEYLSDLVSSGHHHLKKKKKQL-QTVELKVRMDCDGCELKVKKTLSSLSGVQSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DINRKQQKVTVTG+V+ NKVLKKAKSTGKKAEIWPYVPYNLVAQPYA  +YDKKAPPGYV
Sbjct  60   DINRKQQKVTVTGFVDPNKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVSSYDKKAPPGYV  119

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+N PTTGT  +++DPYV +FSDENPNACS+M
Sbjct  120  RRVENAPTTGTMTKYEDPYVNMFSDENPNACSIM  153



>ref|XP_003602005.1| hypothetical protein MTR_3g087770 [Medicago truncatula]
 gb|AES72256.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
 gb|AFK47104.1| unknown [Medicago truncatula]
Length=152

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 139/154 (90%), Gaps = 3/154 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD+M S H H   KKKKQLQTVELKVRMDCDGCELKVKKALSS++GVK+V
Sbjct  1    MGVGGTLEYLSDLMGSGHHHHKIKKKKQLQTVELKVRMDCDGCELKVKKALSSMNGVKSV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYN+V  PYAA +YDKKAPPGYV
Sbjct  61   EINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNMVVHPYAAPSYDKKAPPGYV  120

Query  439  RRVDNPTTGTAARFDDPYV-TIFSDENPNACSVM  341
            RR++  TTGT   +++P++ T+FSDENPNACS+M
Sbjct  121  RRLE--TTGTVRAYEEPHLTTMFSDENPNACSIM  152



>gb|AFK43755.1| unknown [Medicago truncatula]
Length=153

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 140/154 (91%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++SS H H  KKKK+  QTVELKVRMDCDGCEL+VKK LSSLSGV++V
Sbjct  1    MGVGGTLEYLSDLVSSGHHHLKKKKKQL-QTVELKVRMDCDGCELRVKKTLSSLSGVQSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DINRKQQKVTVTG+V+ NKVLKKAKSTGKKAEIWPYVPYNLVAQPYA  +YDKKAPPGYV
Sbjct  60   DINRKQQKVTVTGFVDPNKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVSSYDKKAPPGYV  119

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+N PTTGT  +++DPYV +FSDENPNACS+M
Sbjct  120  RRVENAPTTGTMTKYEDPYVNMFSDENPNACSIM  153



>gb|AFK40125.1| unknown [Lotus japonicus]
Length=155

 Score =   234 bits (597),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMsss-hghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG+ GTLEY+SD+M S  H H   KKKKQLQTVELKVRMDCDGCELKVKK LSSLSGVK+
Sbjct  1    MGISGTLEYLSDLMGSGYHHHHKMKKKKQLQTVELKVRMDCDGCELKVKKTLSSLSGVKS  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V+INRKQQKVTVTGYVE NKVLKKAKSTGK+AEIWPYVPYNLVA PYAA AYDKKAP GY
Sbjct  61   VEINRKQQKVTVTGYVEPNKVLKKAKSTGKRAEIWPYVPYNLVAHPYAAPAYDKKAPAGY  120

Query  442  VRRVD-NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VRRV+    TGT  R++DPY  +FSDENPNACS+M
Sbjct  121  VRRVETTAATGTVTRYEDPYSNMFSDENPNACSIM  155



>ref|XP_002307111.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEE94107.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=153

 Score =   233 bits (595),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 136/155 (88%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++ S      KKK  QLQTVELKVRMDCDGCELKVKKA+SSLSGVK V
Sbjct  1    MGVSGTLEYLSDLVGSGGHKHKKKK--QLQTVELKVRMDCDGCELKVKKAISSLSGVKKV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQ+VTVTGYV+++KVLKKAKSTGKKAEIWPYVPYNLVAQPYA QAYDKKAPPGYV
Sbjct  59   EINRKQQRVTVTGYVDSSKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVQAYDKKAPPGYV  118

Query  439  RRVDNP-TTGTAARFD-DPYVTIFSDENPNACSVM  341
            R V+N  TTGT  R+D DPY ++FSD+NPNACS+M
Sbjct  119  RNVENTVTTGTVTRYDQDPYTSMFSDDNPNACSIM  153



>gb|ACJ86072.1| unknown [Medicago truncatula]
Length=153

 Score =   233 bits (595),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 139/154 (90%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+G TLEY+SD++SS H H  KKKK+  QTVELKVRMDCDGCELKVKK LSSLSGV++V
Sbjct  1    MGVGDTLEYLSDLVSSGHHHLKKKKKQL-QTVELKVRMDCDGCELKVKKTLSSLSGVQSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DINRKQQKVTVTG+V+ NKVLKKAKSTGKKAEIWPYVPYNLVAQPYA  +YDKKAPPGYV
Sbjct  60   DINRKQQKVTVTGFVDPNKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVSSYDKKAPPGYV  119

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            RRV+N PTTGT  +++DPYV +FSDENPNACS+M
Sbjct  120  RRVENAPTTGTMTKYEDPYVNMFSDENPNACSIM  153



>ref|XP_008440632.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Cucumis melo]
Length=151

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 138/154 (90%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++ ++H HK KK   QLQTVELKVRMDCDGCELKVK ALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLVGNTHKHKKKK---QLQTVELKVRMDCDGCELKVKNALSSLSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEA+KVLKKAKSTGKKAEIWPYVPY+LV+QPY AQAYDKKAPPGYV
Sbjct  58   EINRKQQKVTVTGYVEASKVLKKAKSTGKKAEIWPYVPYSLVSQPYIAQAYDKKAPPGYV  117

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+   TT +  +++DPY+ +FSD+NPNACS+M
Sbjct  118  RNVEQTATTASVTKYEDPYINMFSDDNPNACSIM  151



>ref|XP_004143484.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004162311.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN48774.1| hypothetical protein Csa_6G500660 [Cucumis sativus]
Length=151

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 138/154 (90%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY+SD++ ++H HK KK   QLQTVELKVRMDCDGCELKVK ALSSLSGVK+V
Sbjct  1    MGVGGTLEYLSDLVGNTHKHKKKK---QLQTVELKVRMDCDGCELKVKNALSSLSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEA+K+LKKAKSTGKKAEIWPYVPY+LV+QPY AQAYDKKAPPGYV
Sbjct  58   EINRKQQKVTVTGYVEASKILKKAKSTGKKAEIWPYVPYSLVSQPYIAQAYDKKAPPGYV  117

Query  439  RRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+   TT +  +++DPY+ +FSD+NPNACSVM
Sbjct  118  RNVEQTATTASVTKYEDPYINMFSDDNPNACSVM  151



>ref|XP_004502447.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=153

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 135/155 (87%), Gaps = 4/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMss-shghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG+GGTLEY+SD+M S  H     K+KKQLQTVELKVRMDCDGCELKVKKALSSL+GVK+
Sbjct  1    MGVGGTLEYLSDLMGSGHHHQHKIKRKKQLQTVELKVRMDCDGCELKVKKALSSLNGVKS  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V+INRKQQKVTV GYVEANKVLKKAKSTGKKAEIWPYVPYN+V  PYA  AYDKKAPPGY
Sbjct  61   VEINRKQQKVTVMGYVEANKVLKKAKSTGKKAEIWPYVPYNMVTHPYAVPAYDKKAPPGY  120

Query  442  VRRVDNPTTGTAARFDDPYV-TIFSDENPNACSVM  341
            VRR++  TTGT   ++D ++ T+FSDENPNACS+M
Sbjct  121  VRRLE--TTGTVITYEDSHITTLFSDENPNACSIM  153



>ref|XP_009781991.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=152

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 142/154 (92%), Gaps = 3/154 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MGL GTLEYISDMMSSSH  K KKK  Q QTVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGLIGTLEYISDMMSSSHKSKKKKK--QFQTVELKVRMDCDGCELKVKKALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKK+EIWPYVPYNLVAQPYAA AYDKKAPPGYV
Sbjct  59   EINRKQQKVTVTGYVEANKVLKKAKSTGKKSEIWPYVPYNLVAQPYAAAAYDKKAPPGYV  118

Query  439  RRVDNPTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRV+NPT GT + F+DP YVT+FSD+NPNACS+M
Sbjct  119  RRVENPTIGTISTFEDPAYVTMFSDDNPNACSIM  152



>ref|XP_011005631.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=151

 Score =   230 bits (586),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 134/154 (87%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLE++SD++ S      KK   QLQTVELKVRMDCDGCELKVK ALSS+SGVK V
Sbjct  1    MGVSGTLEFLSDLVGSGGHKHKKK---QLQTVELKVRMDCDGCELKVKNALSSMSGVKKV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQ+VTV+GYV++NKVLKKAKSTGK+AEIWPYVPY+LVAQP+AAQAYDK+APPGYV
Sbjct  58   EINRKQQRVTVSGYVDSNKVLKKAKSTGKRAEIWPYVPYSLVAQPFAAQAYDKRAPPGYV  117

Query  439  RRVDNPTT-GTAARFDDPYVTIFSDENPNACSVM  341
            R+V+N    GT  R++DPY ++FSD+NPNACS+M
Sbjct  118  RKVENTAAIGTVTRYEDPYTSMFSDDNPNACSIM  151



>ref|XP_009613481.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nicotiana tomentosiformis]
Length=153

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 140/156 (90%), Gaps = 6/156 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MGLGGTLEYISD+MSS    K KK   Q  TVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGLGGTLEYISDIMSSDKPKKKKK---QFNTVELKVRMDCDGCELKVKKALSSLSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLV+QPYAA AYDKKAPPGYV
Sbjct  58   EINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVSQPYAAAAYDKKAPPGYV  117

Query  439  RRVD--NPTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRVD  NPTTGT AR++DP Y+ +FSD+NPNACS+M
Sbjct  118  RRVDHNNPTTGTVARYEDPAYINMFSDDNPNACSIM  153



>ref|XP_006380445.1| hypothetical protein POPTR_0007s06000g [Populus trichocarpa]
 gb|ERP58242.1| hypothetical protein POPTR_0007s06000g [Populus trichocarpa]
Length=151

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 133/154 (86%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLE++SD++ S      KK   QLQTVELKVRMDCDGCELKVK ALSS+SGVK V
Sbjct  1    MGVSGTLEFLSDLVGSGGHKHKKK---QLQTVELKVRMDCDGCELKVKNALSSMSGVKKV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQ+VTV+GYV++NKVLKKAKSTGK+AEIWPYVPY+LVAQP+A QAYDKKAPPGYV
Sbjct  58   EINRKQQRVTVSGYVDSNKVLKKAKSTGKRAEIWPYVPYSLVAQPFATQAYDKKAPPGYV  117

Query  439  RRVDNPTT-GTAARFDDPYVTIFSDENPNACSVM  341
            R+V+N    GT  +++DPY ++FSD+NPNACS+M
Sbjct  118  RKVENTAAIGTVTKYEDPYTSMFSDDNPNACSIM  151



>ref|XP_009804016.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=153

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 138/156 (88%), Gaps = 6/156 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MGLGGTLEYISD+MSS    K KK   Q  TVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGLGGTLEYISDIMSSDKPKKKKK---QFNTVELKVRMDCDGCELKVKKALSSLSGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLV+QPYAA AYDKKAPPGYV
Sbjct  58   EINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVSQPYAAAAYDKKAPPGYV  117

Query  439  RRVD--NPTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRVD  N TTGT AR++DP Y  IFSD+NPNACS+M
Sbjct  118  RRVDQNNSTTGTVARYEDPAYTNIFSDDNPNACSIM  153



>ref|XP_011090461.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=152

 Score =   226 bits (577),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEYIS++MSS    K K+KK Q QTV LKVRMDCDGCELKVK ALSSL+GVK+V
Sbjct  1    MGVSGTLEYISELMSSGRKDKKKRKK-QFQTVNLKVRMDCDGCELKVKNALSSLTGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTVTGYVE +KVLKKAKSTGKKAEIWPYVPYNLVAQPYA QAYDKKAP G+V
Sbjct  60   EINRKQQKVTVTGYVEESKVLKKAKSTGKKAEIWPYVPYNLVAQPYAPQAYDKKAPAGFV  119

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R++DNP   T     DPY+ +FSD+NPNACS+M
Sbjct  120  RKLDNPPPPTRIDHQDPYIAMFSDDNPNACSIM  152



>ref|XP_006428133.1| hypothetical protein CICLE_v10026695mg [Citrus clementina]
 ref|XP_006464268.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR41373.1| hypothetical protein CICLE_v10026695mg [Citrus clementina]
Length=153

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+M SS     KKKK QLQTV+LKVRMDCDGCELKVK A+SSLSGVK+V
Sbjct  1    MGVAGTLEYLSDLMGSSGHKHKKKKK-QLQTVDLKVRMDCDGCELKVKNAVSSLSGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV+VTGYVEANKVLKKAKSTGK+AEIWPYVPYNLVAQPY A AYDK+APPGYV
Sbjct  60   EINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAGAYDKRAPPGYV  119

Query  439  RRVD-NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V+   T  +    +DPY+++FSD+NPNACS+M
Sbjct  120  RKVEGTATNASVTTLEDPYISMFSDDNPNACSIM  153



>ref|XP_010027813.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Eucalyptus grandis]
Length=152

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 136/155 (88%), Gaps = 5/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+MSS H HK +K   QLQTVELKVRMDCDGCELKV+KALSSL GVKTV
Sbjct  1    MGVAGTLEYLSDLMSSGHKHKRRK---QLQTVELKVRMDCDGCELKVRKALSSLDGVKTV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVA-QPYAAQAYDKKAPPGY  443
            +INRKQQKVTV+GYV+ NKVLK+AKSTGKKAEIWPY+PY++VA QPY AQ+YDKKAPPG+
Sbjct  58   EINRKQQKVTVSGYVDQNKVLKRAKSTGKKAEIWPYIPYSVVAHQPYIAQSYDKKAPPGH  117

Query  442  VRRVD-NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VRRV+   T+    R +DPY+T+FSD+NPNACS+M
Sbjct  118  VRRVEPTATSAIVTRHEDPYMTLFSDDNPNACSIM  152



>ref|XP_009607089.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana tomentosiformis]
Length=152

 Score =   224 bits (572),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 141/154 (92%), Gaps = 3/154 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MGL GTLEYISDMMS SH  K KKK  Q QTVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGLIGTLEYISDMMSGSHKFKKKKK--QFQTVELKVRMDCDGCELKVKKALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRK+QKVTVTGYVEANKVLKKAKSTGKK+EIWPYVPYNLVAQPYAA AYDKKAPPGYV
Sbjct  59   EINRKEQKVTVTGYVEANKVLKKAKSTGKKSEIWPYVPYNLVAQPYAAAAYDKKAPPGYV  118

Query  439  RRVDNPTTGTAARFDDP-YVTIFSDENPNACSVM  341
            RRV+NPT GT + F+DP YVT+FSD+NPNACS+M
Sbjct  119  RRVENPTIGTISTFEDPAYVTMFSDDNPNACSIM  152



>gb|KDP46890.1| hypothetical protein JCGZ_24099 [Jatropha curcas]
Length=146

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 3/148 (2%)
 Frame = -3

Query  781  LEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQ  602
            + Y+SD+M S      KKK  QLQTVELKVRMDCDGCELKVK ALSSLSGVK V+INRKQ
Sbjct  1    MGYLSDLMGSGGYKHKKKK--QLQTVELKVRMDCDGCELKVKNALSSLSGVKKVEINRKQ  58

Query  601  QKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNP  422
            QKVTVTGYV++NKVLKKAKSTGKKAEIWPYVPYNLVAQPY AQAYDKKAPPGYVR+V++ 
Sbjct  59   QKVTVTGYVDSNKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPGYVRKVESS  118

Query  421  -TTGTAARFDDPYVTIFSDENPNACSVM  341
              +GT  R++DPY ++FSD+NPNACS+M
Sbjct  119  VASGTITRYEDPYTSMFSDDNPNACSIM  146



>gb|KHN29092.1| hypothetical protein glysoja_008427 [Glycine soja]
Length=140

 Score =   223 bits (568),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 1/127 (1%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            Q QTVELKVRMDCDGCELKVK ALSSLSGVK+V+INRKQQKVTVTGYVE NKVLKKAKST
Sbjct  14   QFQTVELKVRMDCDGCELKVKNALSSLSGVKSVEINRKQQKVTVTGYVEPNKVLKKAKST  73

Query  538  GKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPT-TGTAARFDDPYVTIFSDEN  362
            GKKAEIWPYVPYNLVA PYA  +YDKKAPPGYVRRV+ P  TGT  R++DPY+T+FSD+N
Sbjct  74   GKKAEIWPYVPYNLVAHPYAVPSYDKKAPPGYVRRVEAPAHTGTITRYEDPYITMFSDDN  133

Query  361  PNACSVM  341
            PNACS+M
Sbjct  134  PNACSIM  140



>ref|XP_011097602.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=158

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 135/158 (85%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMsssh---ghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGV  629
            MG+ G+ +Y+S++M SS      K KKK KQLQTV LKVRMDCDGCELKVKKALSSLSGV
Sbjct  1    MGVMGSFDYLSELMMSSSYKQKQKKKKKLKQLQTVNLKVRMDCDGCELKVKKALSSLSGV  60

Query  628  KTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPP  449
            K+V+INRK QKVTVTGYVE NKVLKKAKSTGKKAE+WPYVPYNLVAQPYA  AYDKKAPP
Sbjct  61   KSVEINRKLQKVTVTGYVEQNKVLKKAKSTGKKAELWPYVPYNLVAQPYAPAAYDKKAPP  120

Query  448  GYVRRVDNPT--TGTAARFDDPYVTIFSDENPNACSVM  341
            G+VR+VDNP    GT  RF+DPY T+FSD+NPNACS+M
Sbjct  121  GFVRKVDNPQKDMGTITRFEDPYFTMFSDDNPNACSIM  158



>gb|KHN38201.1| hypothetical protein glysoja_003866 [Glycine soja]
Length=140

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 115/127 (91%), Gaps = 1/127 (1%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            Q QTVELKVRMDCDGCELKVK ALSSLSGVK+V+INRKQQKVTVTGYVE NKVLKKAKST
Sbjct  14   QFQTVELKVRMDCDGCELKVKNALSSLSGVKSVEINRKQQKVTVTGYVEPNKVLKKAKST  73

Query  538  GKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPT-TGTAARFDDPYVTIFSDEN  362
            GKKAEIWPYVPYNLV  PYA  +YDKKAPPGYVRRV+ P  TGT  R++DPY+T+FSD+N
Sbjct  74   GKKAEIWPYVPYNLVVHPYAVPSYDKKAPPGYVRRVEAPAHTGTITRYEDPYITMFSDDN  133

Query  361  PNACSVM  341
            PNACS+M
Sbjct  134  PNACSIM  140



>ref|XP_010269164.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nelumbo nucifera]
Length=150

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY S ++SS H  K KK   QLQTVELKVRMDC+GCELKV+KALSSL GVK+V
Sbjct  1    MGVGGTLEYFSGLLSSGHKQKKKK---QLQTVELKVRMDCEGCELKVRKALSSLKGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DIN KQQK TVTGYV+A KVLKKA+STGKKAEIWPYVPYNLVA PY AQAYDKKAPPGYV
Sbjct  58   DINMKQQKATVTGYVDAKKVLKKAQSTGKKAEIWPYVPYNLVAHPYTAQAYDKKAPPGYV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V+   T      ++ Y TIFSDENPNACS+M
Sbjct  118  RNVETTATSMVHTQEEKYTTIFSDENPNACSIM  150



>ref|XP_007163627.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 ref|XP_007163628.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 ref|XP_007163629.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 gb|ESW35621.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 gb|ESW35622.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
 gb|ESW35623.1| hypothetical protein PHAVU_001G250300g [Phaseolus vulgaris]
Length=154

 Score =   218 bits (556),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 129/157 (82%), Gaps = 7/157 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMsssh--ghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+G   +Y+SD+M +       + K +KQLQTVELKV MDCDGC LKVKK LSSL GV+
Sbjct  1    MGVG---DYLSDLMGTGSGNHQHNTKNRKQLQTVELKVMMDCDGCVLKVKKTLSSLDGVE  57

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +V+INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYN+VA PY  QAYDKKAPPG
Sbjct  58   SVEINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNMVANPYTVQAYDKKAPPG  117

Query  445  YVRRVDNPTT-GT-AARFDDPYVTIFSDENPNACSVM  341
            YVRRVDN    GT  A ++DPY T+FSDENPNACS+M
Sbjct  118  YVRRVDNSAAIGTVTAAYEDPYTTMFSDENPNACSIM  154



>ref|XP_009126827.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Brassica rapa]
 emb|CDY41999.1| BnaA01g05710D [Brassica napus]
Length=158

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 136/158 (86%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ S   H    +KKKKQ QTVELKVRMDCDGC LKVK +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGSGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +V+IN+KQQKVTV+GY EA+KVLKKAKSTGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   SVEINKKQQKVTVSGYAEASKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGTAARF-DDP-YVTIFSDENPNACSVM  341
            YVR++D   TTGT A + DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKMDPYVTTGTMAVYNDDPSYTSMFSDDNPNACSIM  158



>gb|KDO42373.1| hypothetical protein CISIN_1g036289mg, partial [Citrus sinensis]
Length=149

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+M SS     KKKK QLQTV+LKVRMDCDGCELKVK A+SSLSGVK+V
Sbjct  1    MGVAGTLEYLSDLMGSSGHKHKKKKK-QLQTVDLKVRMDCDGCELKVKNAVSSLSGVKSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKV+VTGYVEANKVLKKAKSTGK+AEIWPYVPYNLVAQPY A AYDK+APPGYV
Sbjct  60   EINRKQQKVSVTGYVEANKVLKKAKSTGKRAEIWPYVPYNLVAQPYIAGAYDKRAPPGYV  119

Query  439  RRVD-NPTTGTAARFDDPYVTIFSDENPNA  353
            R+V+   T  +    +DPY+++FSD+NPNA
Sbjct  120  RKVEGTATNASVTTLEDPYISMFSDDNPNA  149



>ref|XP_010261203.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=151

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY S +MSS H HK KK   QLQTVELKVRMDC+GCELKV+KALSSL GVK+V
Sbjct  1    MGVGGTLEYFSGLMSSGHKHKKKK---QLQTVELKVRMDCEGCELKVRKALSSLKGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D+N KQQKVTVTGYV+  KVLKKA+STGKKAEIWPYVPYNLVA PY AQAYDKKAPPGYV
Sbjct  58   DMNMKQQKVTVTGYVDEKKVLKKAQSTGKKAEIWPYVPYNLVAHPYTAQAYDKKAPPGYV  117

Query  439  RRVDNPT-TGTAARFDDPYVTIFSDENPNACSVM  341
            R V+  T T T    ++ Y ++FSDENPNACS+M
Sbjct  118  RNVETITATATVHTQEERYTSMFSDENPNACSIM  151



>emb|CDY42647.1| BnaC01g00590D [Brassica napus]
 emb|CDX86196.1| BnaA06g29130D [Brassica napus]
Length=158

 Score =   216 bits (551),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ S   H    +KKKKQ QTVELKVRMDCDGC LKVK +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGSGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +V+IN+KQQKVTV+GY EA+KVLKKAKSTGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   SVEINKKQQKVTVSGYAEASKVLKKAKSTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR++D   TTGT A   DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKMDPYVTTGTMAVDNDDPSYTSMFSDDNPNACSIM  158



>gb|KHN44322.1| hypothetical protein glysoja_014363 [Glycine soja]
Length=155

 Score =   216 bits (549),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 129/158 (82%), Gaps = 8/158 (5%)
 Frame = -3

Query  799  MGLGGTLEYISDMMsssh--ghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+G   +Y+SD++ S +       K KKQLQTVELKV MDCDGC LKVKKALSSL GVK
Sbjct  1    MGVG---DYLSDLIGSGNGNHQHKNKNKKQLQTVELKVMMDCDGCVLKVKKALSSLDGVK  57

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +V+INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPYVP+N+VA PYA QAYDKKAPPG
Sbjct  58   SVEINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPFNMVANPYAVQAYDKKAPPG  117

Query  445  YVRRVDNP--TTGTAAR-FDDPYVTIFSDENPNACSVM  341
            YVRRVDN   T GT    + DPY T+FSDENPNACS+M
Sbjct  118  YVRRVDNSSVTIGTVTTAYADPYTTMFSDENPNACSIM  155



>ref|XP_010680588.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Beta vulgaris subsp. vulgaris]
Length=155

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 137/157 (87%), Gaps = 6/157 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+GGTLEY S+MM   H HK K+K  Q QTVELKVRMDCDGCELKVKKALSSLSGVK+V
Sbjct  1    MGVGGTLEYFSEMMGGGHMHKKKRK--QFQTVELKVRMDCDGCELKVKKALSSLSGVKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTV+GYVEANKVLKKAK+TGKKAEIWPYVPYNLV+QPYA  AYDKKAPPG+V
Sbjct  59   EINRKQQKVTVSGYVEANKVLKKAKATGKKAEIWPYVPYNLVSQPYATAAYDKKAPPGHV  118

Query  439  RRVD---NPTTGTAARFD-DPYVTIFSDENPNACSVM  341
            R+VD   NP T T  ++D DP V++FSD+NPNACS+M
Sbjct  119  RKVDFMENPKTATVTQYDQDPLVSMFSDDNPNACSIM  155



>ref|NP_001241088.1| uncharacterized protein LOC100778653 [Glycine max]
 gb|ACU20497.1| unknown [Glycine max]
Length=155

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 127/158 (80%), Gaps = 8/158 (5%)
 Frame = -3

Query  799  MGLGGTLEYISDMMsssh--ghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+G   +Y+S ++ S +       K KKQLQTVELKV MDCDGC LKVKKALSSL GVK
Sbjct  1    MGVG---DYLSHLIGSGNGNHQHKNKNKKQLQTVELKVMMDCDGCVLKVKKALSSLDGVK  57

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +V+INRKQQKVTVTGYVE NKVLKKA STGKKAEIWPYVP+N+VA PYA QAYDKKAPPG
Sbjct  58   SVEINRKQQKVTVTGYVEPNKVLKKANSTGKKAEIWPYVPFNMVANPYAVQAYDKKAPPG  117

Query  445  YVRRVDNP--TTGTAAR-FDDPYVTIFSDENPNACSVM  341
            YVRRVDN   T GT    + DPY T+FSDENPNACS+M
Sbjct  118  YVRRVDNSSVTIGTVTTAYADPYTTMFSDENPNACSIM  155



>ref|XP_002285811.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI19116.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   209 bits (532),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+  TLEY SD++SS  G K K    QLQTV+LKVRMDC+GC+LKVKKALSSL GVK+V
Sbjct  1    MGVVATLEYFSDLLSSKKGKKRK----QLQTVDLKVRMDCEGCQLKVKKALSSLKGVKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D+N KQQK +VTGY +A KVLKKA+STGKKAE+WPYVPYNLVA PY AQ YDKKAPPGYV
Sbjct  57   DVNLKQQKASVTGYADAKKVLKKAQSTGKKAELWPYVPYNLVAHPYVAQVYDKKAPPGYV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R  +NP     +  ++ Y T+FSD+NPNACS+M
Sbjct  117  RSSENPAITAMSPLEEQYTTMFSDDNPNACSIM  149



>emb|CBI21468.3| unnamed protein product [Vitis vinifera]
Length=117

 Score =   207 bits (527),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/117 (83%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = -3

Query  688  MDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYV  509
            MDC+GCELKVKK LSSLSGVK+VDINRKQQKVTVTGYV+ANKVLKKAKSTGKKAE+WPYV
Sbjct  1    MDCEGCELKVKKTLSSLSGVKSVDINRKQQKVTVTGYVDANKVLKKAKSTGKKAELWPYV  60

Query  508  PYNLVAQPYAAQAYDKKAPPGYVRRVDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            PYNLVAQPYA  AYDKKAPPGYVR V+  P +GT  R++DPY+T+FSDENPNACS+M
Sbjct  61   PYNLVAQPYAVHAYDKKAPPGYVRNVEQPPISGTVTRYEDPYITMFSDENPNACSIM  117



>ref|XP_008812723.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=149

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTLEY S +  SS  H+ +K   Q QTVELKVRMDCDGCELKVK ALSS+ GVK+VDI
Sbjct  1    MGGTLEYFSGLFGSSRRHRKRK---QFQTVELKVRMDCDGCELKVKNALSSMKGVKSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQQKVTV+GYVE +KVLKKA+STGKKAEIWPYVPYNLV  PYAA AYDKKAPPGYVR 
Sbjct  58   NRKQQKVTVSGYVEQHKVLKKAQSTGKKAEIWPYVPYNLVMHPYAAHAYDKKAPPGYVRN  117

Query  433  VDNPTTGTAA-RFDDPYVTIFSDENPNACSVM  341
            V+  T  +   R +D    +F+D+NPNACS+M
Sbjct  118  VEAITISSQPFRQEDQLTNLFNDDNPNACSIM  149



>ref|XP_010916917.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=150

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTLEY S ++ S H HK KK   QLQTVELKVRMDC+GCELKVKKALSS+ GV++VDI
Sbjct  1    MGGTLEYFSGLLGSGHKHKKKK---QLQTVELKVRMDCEGCELKVKKALSSMKGVQSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQ KVTV GYVE NKVLKKA+STGKKAEIWPYVPYNLV  PYAA AYDKKAPPGYVR 
Sbjct  58   NRKQHKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNLVTHPYAAGAYDKKAPPGYVRN  117

Query  433  VDNP--TTGTAARFDDPYVTIFSDENPNACSVM  341
            V++   ++  A++ DD    +FSD+NPN+CS+M
Sbjct  118  VESVAISSSQASKQDDQITNMFSDDNPNSCSIM  150



>ref|XP_008790801.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=149

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GG LEY   ++  SH  K +K   QLQTVELKVRMDC+GCELKVKKALSS+ GV++VDI
Sbjct  1    MGGPLEYFVGLLGGSHKRKKRK---QLQTVELKVRMDCEGCELKVKKALSSMKGVQSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQQKVTV GYVE +KVLKKAKSTGKKAEIWPYVPYNLV  PYAAQAYDKKAPPGYVR 
Sbjct  58   NRKQQKVTVIGYVEQHKVLKKAKSTGKKAEIWPYVPYNLVLHPYAAQAYDKKAPPGYVRN  117

Query  433  VDNPTTGTAA-RFDDPYVTIFSDENPNACSVM  341
            V+  T  +   R +D    +FSD+NPNACSVM
Sbjct  118  VEAITISSQPYRQEDQLTNLFSDDNPNACSVM  149



>ref|XP_010905918.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Elaeis guineensis]
Length=149

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 121/152 (80%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTLEY S +  SSH  K +K   Q QTVELKVRMDCDGCELKVK ALSS+ GVK+VDI
Sbjct  1    MGGTLEYFSGLFGSSHRRKKRK---QFQTVELKVRMDCDGCELKVKNALSSMKGVKSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQQKVTVTGYVE +KVLKKA+STGKKAEIWPYVPYNLV  PYAA  YDKKAPPGYVR 
Sbjct  58   NRKQQKVTVTGYVEQHKVLKKAQSTGKKAEIWPYVPYNLVMHPYAANTYDKKAPPGYVRN  117

Query  433  VDNPTTGTAA-RFDDPYVTIFSDENPNACSVM  341
            V+  T  +   R +D    +F+D+NPNACS+M
Sbjct  118  VEAITISSQPFRQEDQLTNLFNDDNPNACSIM  149



>ref|XP_009394956.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394957.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394958.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394959.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
 ref|XP_009394960.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGT++Y+S ++ S H ++ +K   Q QTVELKVRMDCDGCELKV+ ALSS+ GV++VDI
Sbjct  1    MGGTMDYLSSLLGSGHKYRKRK---QFQTVELKVRMDCDGCELKVRNALSSMKGVQSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQ KVTVTGYVE +KVLKK +STGKKAEIWPYVPYNLVA PYAAQ YDKKAPPGYVR 
Sbjct  58   NRKQYKVTVTGYVEPHKVLKKVQSTGKKAEIWPYVPYNLVAHPYAAQTYDKKAPPGYVRN  117

Query  433  VD-NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V+    +  A R +D + T+FSD+NPNACS+M
Sbjct  118  VEVIKVSSQAVRPEDQFTTLFSDDNPNACSIM  149



>ref|XP_008798426.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=151

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTLEY S ++ S H    +KK  QLQTVELKVRMDC+GCELKVKKALSS+ GV+++DI
Sbjct  1    MGGTLEYFSGLLGSGHEKHKRKK--QLQTVELKVRMDCEGCELKVKKALSSMKGVQSIDI  58

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQQKVTV GYVE NKVLKKA+STGKKAEIWPYVPYNLV  PY A AYDKKAPPGYVR 
Sbjct  59   NRKQQKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNLVTHPYTAGAYDKKAPPGYVRN  118

Query  433  VDNPTTGT--AARFDDPYVTIFSDENPNACSVM  341
            V++ +  +  A++ DD    +FSD+NPN+CS+M
Sbjct  119  VESVSVSSSQASKQDDQITNMFSDDNPNSCSIM  151



>ref|XP_010555349.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Tarenaya hassleriana]
Length=157

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 131/157 (83%), Gaps = 4/157 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG GGT+EY+S++++       KKKKKQ QTVELKVRMDCDGC LKVK ALSSLSGVKTV
Sbjct  1    MGFGGTMEYLSELINGGRHKHGKKKKKQFQTVELKVRMDCDGCVLKVKNALSSLSGVKTV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQ KVTVTGYV+A+KVLKKAK TGKKAEIWPYVPYNLVA+PY A AYDKKAPPGYV
Sbjct  61   EINRKQHKVTVTGYVDASKVLKKAKGTGKKAEIWPYVPYNLVARPYVAGAYDKKAPPGYV  120

Query  439  RRVDNPT---TGTAARFDDP-YVTIFSDENPNACSVM  341
            RRVD P    T T    DDP YV++FSD+NPNACS+M
Sbjct  121  RRVDPPVSTGTMTIHHDDDPSYVSLFSDDNPNACSIM  157



>ref|XP_010926254.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=150

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 5/153 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTLEY S ++ S H H+ K+   QLQTVELKVRMDC+GCELKVKKALSS+ GV++V+I
Sbjct  1    MGGTLEYFSGLLGSGHKHRKKQ---QLQTVELKVRMDCEGCELKVKKALSSMKGVQSVNI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQQKVTV GYVE NKVLKKA+STGKKAEIWPYVPYN V  PY A  YDKKAPPGYVR 
Sbjct  58   NRKQQKVTVVGYVEPNKVLKKAQSTGKKAEIWPYVPYNSVTHPYTAGTYDKKAPPGYVRS  117

Query  433  VDNPTTGT--AARFDDPYVTIFSDENPNACSVM  341
            V+  T  +  A++ DD  + +FSD+NPN+CS+M
Sbjct  118  VEAGTVSSIQASKQDDQMINMFSDDNPNSCSIM  150



>ref|XP_010939612.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=149

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GG LEY + +++ S   K +K   Q QTVELKVRMDC+GCE KVKKALSS+ GV++VD+
Sbjct  1    MGGALEYFAGLLAGSRRRKKRK---QFQTVELKVRMDCEGCERKVKKALSSMKGVQSVDV  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQ KVTVTGYVE +KVLKKA+STGKKAEIWPY+PYNLV  PYAAQAYDKKAPPGYVR 
Sbjct  58   NRKQNKVTVTGYVEQHKVLKKARSTGKKAEIWPYIPYNLVMHPYAAQAYDKKAPPGYVRN  117

Query  433  VDNPTTGTAA-RFDDPYVTIFSDENPNACSVM  341
            V+  T  +   R +D    +FSDENPNACS+M
Sbjct  118  VEAITISSQPYRQEDQLTNLFSDENPNACSIM  149



>ref|XP_003552099.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN31351.1| hypothetical protein glysoja_023005 [Glycine soja]
Length=157

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 125/160 (78%), Gaps = 10/160 (6%)
 Frame = -3

Query  799  MGLGGTLEYISDMMss----shghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSG  632
            MG+G   +Y SD+M S       +   K KKQLQTVELKV MDCDGC LKV+K LSSL G
Sbjct  1    MGVG---DYWSDLMGSGNGNHQHNNKNKNKKQLQTVELKVMMDCDGCVLKVRKTLSSLDG  57

Query  631  VKTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAP  452
            V++V+INRKQQKVTVTGYVE NKVLKKAKSTGKKAEIWPYVP+N+VA PY  QAYDKKAP
Sbjct  58   VESVEINRKQQKVTVTGYVEPNKVLKKAKSTGKKAEIWPYVPFNMVANPYTVQAYDKKAP  117

Query  451  PGYVRRVDNP--TTGTAAR-FDDPYVTIFSDENPNACSVM  341
            PGYVRRVDN   T GT    + D Y T+FSDENPNACS+M
Sbjct  118  PGYVRRVDNSAATIGTVTTAYADSYTTMFSDENPNACSIM  157



>ref|NP_195680.1| heavy metal transport/detoxification domain-containing protein 
[Arabidopsis thaliana]
 emb|CAA18756.1| putative protein [Arabidopsis thaliana]
 emb|CAB80633.1| putative protein [Arabidopsis thaliana]
 gb|AEE87106.1| heavy metal transport/detoxification domain-containing protein 
[Arabidopsis thaliana]
Length=158

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 137/158 (87%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ +   H    +KKKKQ QTVELKVRMDCDGC LK+K +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKIKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY +A+KVLKKAK+TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEINKKQQKVTVSGYADASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD N TTGT A  +DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKVDPNVTTGTMAVYYDDPSYTSLFSDDNPNACSIM  158



>ref|XP_010446527.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=158

 Score =   201 bits (510),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ +   H    +KKKKQ QTVELKVRMDCDGC LKVK +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY +A+KVLKKAK TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEINKKQQKVTVSGYADASKVLKKAKGTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD N  TGT A  +DDP Y  +FSD+NPNACS+M
Sbjct  121  YVRKVDPNVNTGTMAVHYDDPSYTAMFSDDNPNACSIM  158



>gb|KFK30539.1| hypothetical protein AALP_AA7G275500 [Arabis alpina]
Length=158

 Score =   201 bits (510),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEY+S+++ +   H    +KKKKQ QTVELKVRMDCDGC LK+K +LSSL GVK
Sbjct  1    MGVGGTLEYLSELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKIKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY EANKVLKKAK+TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEINKKQQKVTVSGYAEANKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+V+   TTGT A  +DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKVEPQVTTGTMAVYYDDPSYTSLFSDDNPNACSIM  158



>gb|ABK23213.1| unknown [Picea sitchensis]
Length=150

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GG L+Y+SD++      KHKK K QLQTVELKVRMDCDGCE KVK A+SS+ GVK+VD+
Sbjct  1    MGGPLDYVSDLLGGGGSKKHKKMK-QLQTVELKVRMDCDGCERKVKNAISSMKGVKSVDV  59

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            +RK+QKVTVTGYV+ANKVLKK K+TGK+AE+WPYVPY+LVAQPY AQAYDKKAP GYVR+
Sbjct  60   SRKEQKVTVTGYVDANKVLKKVKATGKRAEVWPYVPYSLVAQPYTAQAYDKKAPAGYVRK  119

Query  433  VDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V++ T       D+ Y T+FS++N NAC++M
Sbjct  120  VESHTFPNLNSTDEQYTTLFSEDNTNACTIM  150



>ref|XP_006282486.1| hypothetical protein CARUB_v10006258mg [Capsella rubella]
 gb|EOA15384.1| hypothetical protein CARUB_v10006258mg [Capsella rubella]
Length=158

 Score =   200 bits (509),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 136/158 (86%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ +   H    +KKKKQ QTVELKVRMDCDGC LKVK +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY +A+KVLKKAK+TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEINKKQQKVTVSGYADASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD N  TGT A  +DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKVDPNVNTGTMAVYYDDPSYTSLFSDDNPNACSIM  158



>ref|XP_010431947.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=158

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGT EYIS+++ +   H    +KKKKQ QTVELKVRMDCDGC LKVK +LSSL GVK
Sbjct  1    MGVGGTFEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY +A+KVLKKAK TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEINKKQQKVTVSGYADASKVLKKAKGTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD N  TGT A  +DDP Y  +FSD+NPNACS+M
Sbjct  121  YVRKVDPNVNTGTMAVHYDDPSYTAMFSDDNPNACSIM  158



>ref|XP_010437096.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=158

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ +   H    +KKKKQ QTVELKVRMDCDGC LKVK +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKVKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY +A+KVLKKAK TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEINKKQQKVTVSGYADASKVLKKAKGTGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD N  TGT A  +DDP Y  +FSD+NPNACS+M
Sbjct  121  YVRKVDPNVNTGTMAVYYDDPSYTAMFSDDNPNACSIM  158



>ref|XP_002866879.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43138.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=158

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 137/158 (87%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGTLEYIS+++ +   H + K+KK+   QTVELKVRMDCDGC LK+K +LSSL GVK
Sbjct  1    MGVGGTLEYISELIGNGGSHSYGKRKKKKLFQTVELKVRMDCDGCVLKIKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV++N+KQQKVTV+GY +A+KVLKKAK+TGKKAEIWPYVPYNLVAQPY AQAYDKKAPPG
Sbjct  61   TVEVNKKQQKVTVSGYADASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPPG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD N TTGT A  +DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKVDPNVTTGTMAVYYDDPSYTSLFSDDNPNACSIM  158



>gb|ACN27116.1| unknown [Zea mays]
 tpg|DAA61192.1| TPA: metal ion binding protein [Zea mays]
Length=162

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 125/163 (77%), Gaps = 11/163 (7%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG GGTLEY+SD++    G +  KK+KQ QTVELKVRMDCDGCE+KV+ ALSS+ GV +V
Sbjct  1    MG-GGTLEYLSDLLGGGGGRRRYKKRKQFQTVELKVRMDCDGCEMKVRNALSSMKGVHSV  59

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQ KVTV GYVE +KV+K+ ++TGKKAEIWPYVPY+LVA PYAA AYDKKAPPGYV
Sbjct  60   EINRKQYKVTVQGYVEPHKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGYV  119

Query  439  RRVDN--PTTGTAARF--------DDPYVTIFSDENPNACSVM  341
            RRVD   P + T            ++   T+FSD+NPNACSVM
Sbjct  120  RRVDAVMPVSSTYGGPAAAAGPPQEERLATMFSDDNPNACSVM  162



>gb|EMT26095.1| Superoxide dismutase 1 copper chaperone [Aegilops tauschii]
Length=160

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 13/163 (8%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkh-kkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG+GGTL+Y+S+++      +  K+K+KQ QTVELKVRMDCDGCELKV+ ALSS+ GV++
Sbjct  1    MGVGGTLDYLSELLGGGGRRRSYKQKRKQFQTVELKVRMDCDGCELKVRNALSSMKGVQS  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V+INRKQ KVTV G+VE +KV+K+ ++TGKKAEIWPY+PYNLVA PYAAQ YDKKAPPGY
Sbjct  61   VEINRKQYKVTVQGFVEPHKVVKRVQTTGKKAEIWPYIPYNLVAHPYAAQTYDKKAPPGY  120

Query  442  VRRVD---------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+VD          P  G     ++   T+FSD+NPNACSVM
Sbjct  121  VRKVDAVMPVASYGGPGAGAQ---EERLTTMFSDDNPNACSVM  160



>ref|XP_003578035.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Brachypodium distachyon]
Length=160

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 7/160 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG+ GTLEY+SD++S+S   +  K+K++  QTVELKVRMDC+GCELKV+ ALSS+ GV++
Sbjct  1    MGVSGTLEYLSDLLSNSSRRRRYKQKRRQFQTVELKVRMDCEGCELKVRNALSSMKGVQS  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V+INRKQ KVTV G+VE +KV+K+ ++TGKKAEIWPY+PYNLVA PYAAQ YDKKAPPGY
Sbjct  61   VEINRKQYKVTVQGFVEPHKVVKRVQATGKKAEIWPYIPYNLVAHPYAAQTYDKKAPPGY  120

Query  442  VRRVD------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VRR D      +  +G  A  ++   T+FSD+NPNACS+M
Sbjct  121  VRRQDAVMPVASYGSGPGAAQEERLTTMFSDDNPNACSIM  160



>ref|NP_001152036.1| metal ion binding protein [Zea mays]
 gb|ACG45494.1| metal ion binding protein [Zea mays]
Length=161

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 122/160 (76%), Gaps = 11/160 (7%)
 Frame = -3

Query  790  GGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            GGTLEY+SD++      ++KK+K Q QTVELKVRMDCDGCE+KV+ ALSS+ GV +V+IN
Sbjct  3    GGTLEYLSDLLGGGGRRRYKKRK-QFQTVELKVRMDCDGCEMKVRNALSSMKGVHSVEIN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RKQ KVTV GYVE +KV+K+ ++TGKKAEIWPYVPY+LVA PYAA AYDKKAPPGYVRRV
Sbjct  62   RKQYKVTVQGYVEPHKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGYVRRV  121

Query  430  D----------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            D           PT       ++   T+FSD+NPNACSVM
Sbjct  122  DAVMPVSSTYGGPTAAAGPPQEERLATMFSDDNPNACSVM  161



>ref|XP_006411764.1| hypothetical protein EUTSA_v10026454mg [Eutrema salsugineum]
 gb|ESQ53217.1| hypothetical protein EUTSA_v10026454mg [Eutrema salsugineum]
Length=158

 Score =   195 bits (496),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 134/158 (85%), Gaps = 5/158 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            MG+GGT+EYIS ++ +   H    +KKKKQ QTVELKVRMDCDGC LK+K +LSSL GVK
Sbjct  1    MGVGGTIEYISALIGNGGSHSYGKRKKKKQFQTVELKVRMDCDGCVLKIKNSLSSLKGVK  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            TV+IN+KQQKVTV+GY EA+KVLKKAK+TGKKAEIWPYVPYNLVAQPY AQAYDKKAP G
Sbjct  61   TVEINKKQQKVTVSGYAEASKVLKKAKATGKKAEIWPYVPYNLVAQPYIAQAYDKKAPAG  120

Query  445  YVRRVD-NPTTGT-AARFDDP-YVTIFSDENPNACSVM  341
            YVR+VD + TTGT    +DDP Y ++FSD+NPNACS+M
Sbjct  121  YVRKVDPHVTTGTMGVYYDDPSYASMFSDDNPNACSIM  158



>ref|XP_003562643.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Brachypodium distachyon]
Length=157

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = -3

Query  793  LGGTLEYISDMMsss---hghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            +GGTLEY+S ++  S   HG   +KK++QLQTVELKVRMDC+GCELKVK ALSSL GV++
Sbjct  1    MGGTLEYLSGLLGGSSGGHGRSQRKKRRQLQTVELKVRMDCEGCELKVKNALSSLKGVQS  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VDINRKQQKVTVTGY EA+KVLKKA+STGKKAEIWPYVPY+LV+QPY A  YD++APPGY
Sbjct  61   VDINRKQQKVTVTGYAEASKVLKKAQSTGKKAEIWPYVPYSLVSQPYVAGTYDRRAPPGY  120

Query  442  VRRVD---NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR VD      +   +R DD    +F+DEN N+CSVM
Sbjct  121  VRSVDPGYGYVSSQVSRQDDQLADMFNDENANSCSVM  157



>ref|XP_008442145.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis melo]
Length=153

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 108/134 (81%), Gaps = 8/134 (6%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            QLQTVELKV MDCDGCELKVKKALSSL GVK+V INRKQ KVTV GYVEA+KVLKKAKST
Sbjct  20   QLQTVELKVAMDCDGCELKVKKALSSLRGVKSVKINRKQLKVTVIGYVEASKVLKKAKST  79

Query  538  GKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNP-----TTGTAARFDDP--YVT  380
            GKKAEIWPYVPYNLVA PY    YDKKAPPGYVR  +N         +  +FDDP  +V+
Sbjct  80   GKKAEIWPYVPYNLVAHPYIPPFYDKKAPPGYVRNANNAPVEDNNNASFLKFDDPSNFVS  139

Query  379  IFSDENPN-ACSVM  341
            IFSD+NPN ACS+M
Sbjct  140  IFSDDNPNAACSIM  153



>gb|EMS58641.1| hypothetical protein TRIUR3_09648 [Triticum urartu]
Length=293

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 126/164 (77%), Gaps = 13/164 (8%)
 Frame = -3

Query  802  RMGLGGTLEYISDMMssshghkh-kkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            RMG+GGTL+Y+S+++      +  K+K+KQ QTVELKVRMDCDGCELKV+ ALS + GV+
Sbjct  40   RMGVGGTLDYLSELLGGGGRRRSYKQKRKQFQTVELKVRMDCDGCELKVRNALSGMKGVQ  99

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +V+INRKQ KVTV G+VE +KV+K+ ++TGKKAEIWPY+PYNLVA PYAAQ YDKKAPPG
Sbjct  100  SVEINRKQYKVTVQGFVEPHKVVKRVQATGKKAEIWPYIPYNLVAHPYAAQTYDKKAPPG  159

Query  445  YVRRVD---------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            YVR+VD          P  G     ++   T+FSD+NPNACSV+
Sbjct  160  YVRKVDAVMPVASYGGPGAGAQ---EERLTTMFSDDNPNACSVI  200



>gb|ABK24206.1| unknown [Picea sitchensis]
Length=152

 Score =   191 bits (484),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 4/150 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G LEY SD+   S  +K +K   QLQTVEL+VRMDC+GCE K+ K LSS+SGV+TVDINR
Sbjct  6    GALEYFSDLFGGSRENKKRK---QLQTVELRVRMDCEGCERKINKVLSSMSGVQTVDINR  62

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            K QKVTVTGYVE NKVLKK K TGK+AE+WPYVPYN V+QP++ Q YDKKAP G+VR+  
Sbjct  63   KMQKVTVTGYVEPNKVLKKVKRTGKRAELWPYVPYNSVSQPFSTQNYDKKAPSGFVRKES  122

Query  427  NPTTGTAARFDDPYVT-IFSDENPNACSVM  341
              T   + R DD Y T +FS+ENPNAC++M
Sbjct  123  FNTRSYSNRQDDQYGTNMFSEENPNACTIM  152



>ref|XP_009381902.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=146

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 1/127 (1%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            QLQTVELKVRMDC+GCELKV+ A+SS++GV++VDINRKQ KVTVTGYVE +KVLKK +ST
Sbjct  20   QLQTVELKVRMDCEGCELKVRNAISSVTGVQSVDINRKQNKVTVTGYVEQHKVLKKVRST  79

Query  538  GKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTA-ARFDDPYVTIFSDEN  362
            GK+ EIWPYVPYNLV  P+ AQ YDKKAPPGYVR V+  T  +   R DD    +FSD+N
Sbjct  80   GKRVEIWPYVPYNLVTHPHGAQIYDKKAPPGYVRNVEVVTVSSQPLRQDDLLTNLFSDDN  139

Query  361  PNACSVM  341
            PNACS+M
Sbjct  140  PNACSIM  146



>gb|ABK22742.1| unknown [Picea sitchensis]
Length=152

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 4/148 (3%)
 Frame = -3

Query  781  LEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQ  602
            LEY SD+   S  +K +K   QLQTVEL+VRMDC+GCE K+ K LSS+SGV+TVDINRK 
Sbjct  8    LEYFSDLFGGSRENKKRK---QLQTVELRVRMDCEGCERKINKVLSSMSGVQTVDINRKM  64

Query  601  QKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNP  422
            QKVTVTGYVE NKVLKK K TGK+AE+WPYVPYN V+QP++ Q YDKKAP G+VR+    
Sbjct  65   QKVTVTGYVEPNKVLKKVKRTGKRAELWPYVPYNSVSQPFSTQNYDKKAPSGFVRKESFN  124

Query  421  TTGTAARFDDPYVT-IFSDENPNACSVM  341
            T   + R DD Y T +FS+ENPNAC++M
Sbjct  125  TRSYSNRQDDQYGTNMFSEENPNACTIM  152



>ref|XP_009390577.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTLE  S+ + S   HK +K   Q QTVELKVRMDC+GCELKV+ ALS++ GV++VDI
Sbjct  1    MGGTLECFSNFLGSGRRHKKRK---QFQTVELKVRMDCEGCELKVRNALSTMRGVQSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQ KVTVTGYVE +KV+K+ +STGKKAE+WPYVPYNLVA PY A  YDKKAPPGYVR 
Sbjct  58   NRKQYKVTVTGYVEPHKVIKRVQSTGKKAELWPYVPYNLVAHPYVAPTYDKKAPPGYVRN  117

Query  433  VD-NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            ++    +    R +D   ++FSD+NPNACS+M
Sbjct  118  MEVIAVSSQVVRPEDQLTSLFSDDNPNACSIM  149



>ref|XP_008346878.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
Length=150

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 117/153 (76%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS+   K KK   Q+QTV +K+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGIQGTLEYLSDVLSSAKKGKXKK---QMQTVAVKIRMDCEGCAXKVKNVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTGYVEA KVLK A+ST KK E+WPYVPYNLVA PY +QAYDKKAPP  V
Sbjct  58   DVDLKQQKATVTGYVEAKKVLKAAQSTKKKCELWPYVPYNLVAHPYISQAYDKKAPPNMV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V + +  T    DD Y+ +FSD+NPNACSVM
Sbjct  118  RKVADTSNITETAVDDRYIVMFSDDNPNACSVM  150



>ref|XP_009391452.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 120/152 (79%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            +GGTL+++S ++   H +  +K   Q QTVEL+VRMDC+GCELKV+ ALS++ GV++VDI
Sbjct  1    MGGTLDFLSSLLGGGHRYNKRK---QFQTVELRVRMDCEGCELKVRNALSTMKGVRSVDI  57

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            +RKQ KVTVTGYVE +KV+K+ KSTGKKAEIWPYVPYN+VA+PYAAQ YDKKAP GYVR 
Sbjct  58   SRKQYKVTVTGYVEPHKVVKRVKSTGKKAEIWPYVPYNVVARPYAAQTYDKKAPAGYVRN  117

Query  433  VDN-PTTGTAARFDDPYVTIFSDENPNACSVM  341
            V+    +    + +D    +FSD+NPNACS+M
Sbjct  118  VEAIRVSSQVVKPEDELAALFSDDNPNACSIM  149



>gb|EEC75375.1| hypothetical protein OsI_11838 [Oryza sativa Indica Group]
Length=160

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 123/160 (77%), Gaps = 9/160 (6%)
 Frame = -3

Query  793  LGGTLEYISDMMs-----sshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGV  629
            +GG+LEY++ + S       H +    KK+QLQTVELKVRMDCDGCELKVK ALSSL GV
Sbjct  1    MGGSLEYLAGLFSCGDHHHGHKNSKNSKKRQLQTVELKVRMDCDGCELKVKNALSSLKGV  60

Query  628  KTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPY-AAQAYDKKAP  452
            ++V INRKQQKVTV+GYVEA+KVL+KA+STGKK+E+WPYVPY+  +QPY AA AYD++AP
Sbjct  61   ESVKINRKQQKVTVSGYVEASKVLRKAQSTGKKSELWPYVPYSAASQPYVAAAAYDRRAP  120

Query  451  PGYVRRVDNPTTG---TAARFDDPYVTIFSDENPNACSVM  341
            PG+VR V+  +        R ++    +F+DE+PNACSVM
Sbjct  121  PGHVRNVEASSAAYVSGGGRTEERLTNLFNDEDPNACSVM  160



>ref|XP_006660571.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Oryza brachyantha]
Length=162

 Score =   187 bits (476),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 121/162 (75%), Gaps = 11/162 (7%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkK-QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            +GGT+EY+SD++    G + + +K+ Q QTVELKVRMDCDGCELKV+ ALS + GV++V+
Sbjct  1    MGGTMEYLSDLLGGGGGGRRRYRKRKQFQTVELKVRMDCDGCELKVRNALSGMKGVQSVE  60

Query  616  INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            INRKQ KVTV G+VE  KV+K+ ++TGKKAEIWPYVPY+LVA PYAA AYDKKAPPG+VR
Sbjct  61   INRKQYKVTVQGFVEPGKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGHVR  120

Query  436  RVDNPTTGTAARF----------DDPYVTIFSDENPNACSVM  341
            RVD       A            ++   T+FSDENPNACS+M
Sbjct  121  RVDAVVPVPPAXXXXAAAAAAAQEERLTTMFSDENPNACSIM  162



>gb|KHF99345.1| Superoxide dismutase 1 copper chaperone [Gossypium arboreum]
Length=150

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEYISD++SS    K KK   Q+QTV LK+RMDC+GC  KVKK LS + G K+V
Sbjct  1    MGVEGTLEYISDLLSSVKKKKKKK---QIQTVALKIRMDCEGCARKVKKVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTGYVEA KVL  A+ST KK E+WPYVPY LVA PY AQAYDKKAPP +V
Sbjct  58   DVDLKQQKATVTGYVEAKKVLAAAQSTKKKVELWPYVPYTLVANPYVAQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V    T +    D+ Y  +FSD+NPNACS+M
Sbjct  118  RKVPASATVSETTIDNRYTNLFSDDNPNACSIM  150



>ref|NP_001050249.1| Os03g0383900 [Oryza sativa Japonica Group]
 gb|ABF96289.1| heavy-metal-associated domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|ABF96290.1| heavy-metal-associated domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12163.1| Os03g0383900 [Oryza sativa Japonica Group]
 dbj|BAG91565.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59159.1| hypothetical protein OsJ_11078 [Oryza sativa Japonica Group]
Length=157

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 122/157 (78%), Gaps = 6/157 (4%)
 Frame = -3

Query  793  LGGTLEYISDMMs--sshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            +GG+LEY++ + S    H      K++QLQTVELKVRMDCDGCELKVK ALS+L GV++V
Sbjct  1    MGGSLEYLAGLFSCGDHHHGHKNSKRRQLQTVELKVRMDCDGCELKVKNALSTLKGVESV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPY-AAQAYDKKAPPGY  443
             INRKQQKVTV+GYVEA+KVL+KA+STGKK+E+WPYVPY+  +QPY AA AYD++APPG+
Sbjct  61   KINRKQQKVTVSGYVEASKVLRKAQSTGKKSELWPYVPYSAASQPYVAAAAYDRRAPPGH  120

Query  442  VRRVDNPTTG---TAARFDDPYVTIFSDENPNACSVM  341
            VR V+  +        R ++    +F+DE+PNACS+M
Sbjct  121  VRNVEASSAAYVSGGGRTEERLTNLFNDEDPNACSLM  157



>ref|XP_002460130.1| hypothetical protein SORBIDRAFT_02g023130 [Sorghum bicolor]
 gb|EER96651.1| hypothetical protein SORBIDRAFT_02g023130 [Sorghum bicolor]
Length=161

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 125/163 (77%), Gaps = 14/163 (9%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhk---kkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            +GGTLEY+SD++    G   +   KK+KQ QTVELKVRMDCDGCE+KV+ ALSS+ GV +
Sbjct  1    MGGTLEYLSDLLGGGGGGSSRRRYKKRKQFQTVELKVRMDCDGCEMKVRNALSSMKGVHS  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V+INRKQ KVTV GYVE +KV+K+ ++TGKKAEIWPYVPY+LVA PYAA AYDKKAPPGY
Sbjct  61   VEINRKQYKVTVQGYVEPHKVVKRVQATGKKAEIWPYVPYSLVAHPYAAPAYDKKAPPGY  120

Query  442  VRRVD---------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VRRVD          PT   A   ++  VT+FSD+NPNACS+M
Sbjct  121  VRRVDAVMPVSSYGGPT--AAGPQEERLVTMFSDDNPNACSIM  161



>ref|XP_010105872.1| hypothetical protein L484_021527 [Morus notabilis]
 gb|EXC06691.1| hypothetical protein L484_021527 [Morus notabilis]
Length=149

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY S+++SS    K K    Q+QTV LKVRMDC+GC  KVK  LS + G K+V
Sbjct  1    MGVEGTLEYFSNLLSSKKRKKKK----QMQTVALKVRMDCEGCARKVKSVLSGVKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTVTGYVE  KVLK A+ST KK E+WPYVPY LVA PY AQAYDKKAPP  V
Sbjct  57   DVDLKQQKVTVTGYVEPKKVLKAAQSTKKKVEMWPYVPYPLVANPYVAQAYDKKAPPNMV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V +  T T    DD Y  +FSDENPNACS+M
Sbjct  117  RKVPDTATATETTVDDRYTQMFSDENPNACSIM  149



>ref|XP_004146413.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004168088.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN54783.1| hypothetical protein Csa_4G496240 [Cucumis sativus]
Length=151

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 108/131 (82%), Gaps = 5/131 (4%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            QLQTVELKV MDCDGCELKVKKALSSL GVK+V INRKQ KVTV GYVEA+KVLKKAKST
Sbjct  21   QLQTVELKVAMDCDGCELKVKKALSSLRGVKSVKINRKQLKVTVVGYVEASKVLKKAKST  80

Query  538  GKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR--RVDNPTTGTAARFDDP--YVTIFS  371
            GKKAEIWPY+PYNLV+ PY    YDKKAPPGYVR   +++    +  +FDDP  +VT+FS
Sbjct  81   GKKAEIWPYLPYNLVSYPYIPPVYDKKAPPGYVRNAHLEDNNNPSFLKFDDPSNFVTMFS  140

Query  370  DENPNA-CSVM  341
            D+N NA CS+M
Sbjct  141  DDNTNAPCSIM  151



>ref|XP_004958383.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Setaria italica]
Length=159

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 122/159 (77%), Gaps = 8/159 (5%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghk--hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            +GGTLEY+S ++  S GH     K++KQLQTVELKVRMDC+GCELKV+ ALSS+ GV++V
Sbjct  1    MGGTLEYLSGLLGGSGGHGHGKMKRRKQLQTVELKVRMDCEGCELKVRSALSSMKGVESV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQQKVTV G+VEA+KVLKKA+STGKKAEIWPYVPY+LV+QPY A  YDK+APPGYV
Sbjct  61   EINRKQQKVTVVGFVEASKVLKKAQSTGKKAEIWPYVPYSLVSQPYVAGTYDKRAPPGYV  120

Query  439  RRVDNPTTGTA------ARFDDPYVTIFSDENPNACSVM  341
            R  +              R  D    +F+DENPN+CSVM
Sbjct  121  RSAEPGYVAAGGQQQHVGRPHDHLTDMFNDENPNSCSVM  159



>gb|KDP32706.1| hypothetical protein JCGZ_11998 [Jatropha curcas]
Length=150

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS    K +K   Q+QTV LK+RMDCDGC  KVK  LS + G K+V
Sbjct  1    MGVAGTLEYLSDLLSSVKKGKKRK---QMQTVALKIRMDCDGCARKVKNVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DI+ KQQK TVTGYVE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAP  +V
Sbjct  58   DIDMKQQKATVTGYVEPKKVLKAAQSTKKKVELWPYVPYTLVANPYVSQAYDKKAPANHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V    T T    DD Y  +FSDENPN+CS+M
Sbjct  118  RAVPATATITETTVDDQYTNMFSDENPNSCSIM  150



>ref|XP_002307397.1| hypothetical protein POPTR_0005s16490g [Populus trichocarpa]
 gb|EEE94393.1| hypothetical protein POPTR_0005s16490g [Populus trichocarpa]
Length=150

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY SD++S+    K +K   Q+QTV LKVRMDC+GCE K+K  LS + G K+V
Sbjct  1    MGVAGTLEYFSDLLSNVKKGKKRK---QMQTVALKVRMDCEGCERKIKSVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTVTGYVE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAP  +V
Sbjct  58   DVDMKQQKVTVTGYVEPKKVLKAAQSTKKKVEMWPYVPYTLVANPYVSQAYDKKAPANHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V    T +    DD Y  +FSDENPNACS+M
Sbjct  118  RAVPVTATISETTMDDNYTNMFSDENPNACSIM  150



>ref|XP_004956674.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Setaria italica]
Length=159

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 126/161 (78%), Gaps = 12/161 (7%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhk-kkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            +GGTLEY+SD++    G + + KK+KQ QTVEL+VRMDCDGCE+KV+ ALSS+ GV++V+
Sbjct  1    MGGTLEYLSDLLGGGGGSRRRYKKRKQFQTVELRVRMDCDGCEMKVRNALSSMKGVQSVE  60

Query  616  INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            INRKQ KVTV GYVE +KV+K+ ++TGKKAEIWPYVPY+ VA PYAA AYDKKAPPGYVR
Sbjct  61   INRKQYKVTVQGYVEPHKVVKRVQATGKKAEIWPYVPYSHVAHPYAAPAYDKKAPPGYVR  120

Query  436  RVD---------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            RVD          PT   A   ++  VT+FSD+NPNACS+M
Sbjct  121  RVDAVMPVSSYGGPT--AAGPQEERLVTMFSDDNPNACSIM  159



>ref|NP_001168502.1| metal ion binding protein [Zea mays]
 gb|ACN28459.1| unknown [Zea mays]
 tpg|DAA39963.1| TPA: metal ion binding protein [Zea mays]
Length=161

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 14/163 (9%)
 Frame = -3

Query  793  LGGTLEYISDMMs--sshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            +GGTLEY+SD++   SS   +   ++ Q QTVELKVRMDCDGCE+KV+ ALS + GV +V
Sbjct  1    MGGTLEYLSDLLGGCSSSSRRRYNRRTQFQTVELKVRMDCDGCEMKVRNALSRMKGVHSV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKK-AEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            +I+RKQ KVTV GYVE +KV+K+ ++TGKK AEIWPYVPY+LVA PYAA AYD+KAPPGY
Sbjct  61   EIDRKQSKVTVQGYVEPHKVVKRVQATGKKAAEIWPYVPYSLVAHPYAAPAYDRKAPPGY  120

Query  442  VRRVD---------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VRRVD          PT   A   ++  V +FSD+NPNACS+M
Sbjct  121  VRRVDAVMPASSYGGPT--AAGPQEERLVNMFSDDNPNACSIM  161



>ref|XP_011027672.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Populus euphratica]
Length=150

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY SD++S+    K KK   Q+QTV LKVRMDC+GCE KVK  L  + GVK+V
Sbjct  1    MGVAGTLEYFSDLLSNVKRRKKKK---QMQTVALKVRMDCEGCERKVKSVLFGVKGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTVTG VE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAPP +V
Sbjct  58   DVDMKQQKVTVTGNVEPKKVLKAAQSTKKKVEMWPYVPYTLVAHPYVSQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R +    T +    DD Y  +FSDENPNACS+M
Sbjct  118  RAIPVTATISETTMDDNYTNMFSDENPNACSIM  150



>ref|XP_002301034.1| hypothetical protein POPTR_0002s09280g [Populus trichocarpa]
 gb|EEE80307.1| hypothetical protein POPTR_0002s09280g [Populus trichocarpa]
Length=150

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY SD++S+    + KK   Q+QTV LKVRMDC+GCE KVK  LS + GVK+V
Sbjct  1    MGVAGTLEYFSDLLSNLKRRRKKK---QMQTVALKVRMDCEGCERKVKSVLSGVKGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
             ++ KQQKVTVTG VE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAPP +V
Sbjct  58   GVDMKQQKVTVTGNVEPKKVLKAAQSTKKKVEMWPYVPYTLVAHPYVSQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R +    T +    DD Y  +FSDENPNACS+M
Sbjct  118  RAIPVTATISETTMDDNYTNMFSDENPNACSIM  150



>ref|XP_009345527.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=150

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS+   K K    Q+QTV +K+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGIQGTLEYLSDVLSSAKKGKKK----QMQTVAVKIRMDCEGCARKVKNVLSGVKGAKSV  56

Query  619  DINRKQQKVTVTGY-VEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            D++ KQQK TVTGY VEA KVLK A+ST KK E+WPYVPYNLVA PY +QAYDKKAPP  
Sbjct  57   DVDLKQQKATVTGYNVEAKKVLKAAQSTKKKCELWPYVPYNLVAHPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V + +  T    DD Y+ +FSD+NPNACSVM
Sbjct  117  VRKVADTSNITETAVDDRYIVMFSDDNPNACSVM  150



>ref|XP_007136210.1| hypothetical protein PHAVU_009G027600g [Phaseolus vulgaris]
 gb|ESW08204.1| hypothetical protein PHAVU_009G027600g [Phaseolus vulgaris]
Length=150

 Score =   183 bits (465),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY SD++SS+   K KK   Q+QTV LK+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGVQGTLEYFSDLLSSTKKKKKKK---QIQTVALKIRMDCEGCARKVKHVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +++ KQQK TVTGYVEA KVLK A+ST KK E+WPY+PY +VA PY +QAYDKKAPP  V
Sbjct  58   EVDLKQQKATVTGYVEAKKVLKAAQSTKKKVELWPYIPYTMVANPYVSQAYDKKAPPNMV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V +    +    DD Y+ +FSDENPNACS+M
Sbjct  118  RKVADTANMSETTVDDRYIQMFSDENPNACSIM  150



>ref|XP_002463215.1| hypothetical protein SORBIDRAFT_02g039890 [Sorghum bicolor]
 gb|EER99736.1| hypothetical protein SORBIDRAFT_02g039890 [Sorghum bicolor]
Length=168

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 120/169 (71%), Gaps = 19/169 (11%)
 Frame = -3

Query  793  LGGTLEYISDMMss-----shghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGV  629
            +GGTLEY+S ++             KKK+KQLQTVELKVRMDC+GCELKV+  LSS+ GV
Sbjct  1    MGGTLEYLSGLLGVGGSGSHDHENKKKKRKQLQTVELKVRMDCEGCELKVRSTLSSMKGV  60

Query  628  KTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPP  449
            ++V+INRKQQKVTV GYVEA KVLKKA+STGKKAE+WPYVPYNLVAQPY A  YDK+APP
Sbjct  61   ESVEINRKQQKVTVVGYVEATKVLKKAQSTGKKAELWPYVPYNLVAQPYVAGTYDKRAPP  120

Query  448  GYVRRVDNPTTGTAARF-------------DDPYVTIFSDENPNACSVM  341
            GYVR V+ P  G                   D    +F+DENPN+CSVM
Sbjct  121  GYVRSVE-PAAGYVVAASSQLQAAAGGRPPGDHLTDMFNDENPNSCSVM  168



>ref|XP_011039025.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=150

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY SD++S++   K KK    +QTV LKVRMDC GCE KVK  L  + GVK+V
Sbjct  1    MGVAGTLEYFSDLLSNAKKGKKKK---MMQTVALKVRMDCQGCERKVKSVLYRVEGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
             I+ KQQKVTVTG+VE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAPP +V
Sbjct  58   KIDMKQQKVTVTGFVEPEKVLKAAQSTKKKVELWPYVPYTLVAHPYLSQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V    T + +  DD Y+ +FSDENPNACS+M
Sbjct  118  RAVPVTATISESTIDDYYIYMFSDENPNACSIM  150



>ref|XP_011013863.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=150

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++S+    K +K    +QTV LKVRMDC GCE K+K  LS + GVK+V
Sbjct  1    MGVAGTLEYLSDLLSNVKKGKKRK---HMQTVALKVRMDCQGCERKIKSVLSGVKGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTVTGY E  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAP  +V
Sbjct  58   DVDMKQQKVTVTGYAEPKKVLKAAQSTKKKVEMWPYVPYTLVANPYVSQAYDKKAPANHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V    T +    DD Y  +FSDENPNACS+M
Sbjct  118  RAVPVTATISETTMDDNYTNMFSDENPNACSIM  150



>ref|XP_007045081.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
 gb|EOY00913.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
Length=150

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 118/156 (76%), Gaps = 9/156 (6%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L +YISD+++     K +K    +QTVE+KV+MDCDGCE +VK A+SS+ G K+
Sbjct  1    MGALDSLSDYISDLITVHTKRKKRKV---MQTVEIKVKMDCDGCERRVKNAVSSMKGAKS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRKQ +VTVTGYVE NKVLKK KSTGK+AE WPYVPYNLVA PY AQAYDKKAP GY
Sbjct  58   VNVNRKQSRVTVTGYVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGY  117

Query  442  VRRVDN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            V+      P+   A   D+ ++T+FSDENPNACSVM
Sbjct  118  VKNAVQALPSPNAA---DEKFITLFSDENPNACSVM  150



>gb|ABR17552.1| unknown [Picea sitchensis]
Length=148

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 4/150 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L Y SD+       K +K   Q++TVELKVRMDCDGCE KV+KAL+S+SGV++V+I+R
Sbjct  2    GALGYFSDLFGRRKIIKKRK---QIKTVELKVRMDCDGCERKVRKALASMSGVQSVEIDR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            K QKVTVTGYVEANKVLKK K +GK+AE+WPYVPYNLV++PY+   YDKKAPPGYVR+  
Sbjct  59   KLQKVTVTGYVEANKVLKKVKESGKRAELWPYVPYNLVSEPYSPHTYDKKAPPGYVRKES  118

Query  427  -NPTTGTAARFDDPYVTIFSDENPNACSVM  341
             + TT  +   D+   T+FS+ENPNAC +M
Sbjct  119  FSTTTSNSNPLDEQLTTVFSEENPNACLIM  148



>ref|XP_009347206.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=151

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 115/154 (75%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS+   K KK   Q+QTV +K+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGIQGTLEYLSDVLSSAKKGKKKK---QMQTVAIKIRMDCEGCARKVKSVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGY-VEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            DI+ KQQK TV GY VEA KVLK A+ST KK E+WPYVPYNLVA PY +QAYDKKAPP  
Sbjct  58   DIDLKQQKATVIGYNVEAKKVLKAAQSTKKKCELWPYVPYNLVAHPYISQAYDKKAPPNM  117

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V + +  T    DD Y  +FSD+NPNACS+M
Sbjct  118  VRKVADTSNITETAMDDRYTVMFSDDNPNACSIM  151



>ref|XP_006382273.1| hypothetical protein POPTR_0005s00570g [Populus trichocarpa]
 gb|ERP60070.1| hypothetical protein POPTR_0005s00570g [Populus trichocarpa]
Length=150

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY SD++S++   K KK    +QTV LKVRMDC GCE KVK  L  + GVK+V
Sbjct  1    MGVAGTLEYFSDLLSNAKKGKKKKL---MQTVALKVRMDCQGCERKVKSVLYGVEGVKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
             ++ KQQKVTVTG+VE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAPP +V
Sbjct  58   KVDMKQQKVTVTGFVEPEKVLKAAQSTKKKVELWPYVPYFLVAHPYVSQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V    T + +  DD Y+ +FSDENPNACS+M
Sbjct  118  RAVPVTATISESIIDDYYINMFSDENPNACSIM  150



>ref|XP_008243341.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Prunus mume]
Length=146

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A+S++ G K V++NRKQ +VTVTGYVE NKVLKK KSTG
Sbjct  23   MQTVEIKVKMDCDGCERRVKNAVSNMKGAKQVEVNRKQSRVTVTGYVEPNKVLKKVKSTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDN--PTTGTAARFDDPYVTIFSDEN  362
            KKAE+WPYVPYNLVA PYA  AYDKKAP GYVR V    PT G     DD Y T+FSDEN
Sbjct  83   KKAELWPYVPYNLVAYPYATGAYDKKAPSGYVRNVAQALPTPGAP---DDKYTTMFSDEN  139

Query  361  PNACSVM  341
            PNACS+M
Sbjct  140  PNACSIM  146



>ref|XP_004300657.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Fragaria vesca subsp. vesca]
Length=150

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+++S    K KK   Q+QTV +K+RMDCDGC  KVKK LS + G K+V
Sbjct  1    MGVQGTLEYLSDLLNSVKSKKKKK---QIQTVAVKIRMDCDGCGRKVKKVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DI+ KQQK TVTGYV+A KVLK A+ST KK E+WPYVP+ LVA PY A AYDKKAPP  V
Sbjct  58   DIDLKQQKATVTGYVDAKKVLKAAQSTKKKCELWPYVPFTLVAHPYVAGAYDKKAPPNMV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R + +  T T +  DD Y  +FS++NPNACSVM
Sbjct  118  RSLPSTATITESAVDDHYTQMFSEDNPNACSVM  150



>gb|EAZ44469.1| hypothetical protein OsJ_29086 [Oryza sativa Japonica Group]
Length=160

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 124/160 (78%), Gaps = 9/160 (6%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhk--kkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            +GGT++Y+SD++        +  KK+KQ QTVELKVRMDCDGCELKV+ ALSS+ GV++V
Sbjct  1    MGGTMDYLSDLLGGGGSSSRRRYKKRKQFQTVELKVRMDCDGCELKVRNALSSMKGVQSV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQ KVTV G+VE +KV+K+ ++TGKKAEIWPYVPY LVA PYAA AYDK+APPG+V
Sbjct  61   EINRKQYKVTVQGFVEPHKVVKRVQATGKKAEIWPYVPYTLVAHPYAAPAYDKRAPPGHV  120

Query  439  RRVDN----PTTGTAARFDDP---YVTIFSDENPNACSVM  341
            RRVD      + G+AA    P     T+FSDENPNACS+M
Sbjct  121  RRVDAVMPVASYGSAAAAAAPEERLTTMFSDENPNACSIM  160



>ref|XP_006827006.1| hypothetical protein AMTR_s00010p00214870 [Amborella trichopoda]
 gb|ERM94243.1| hypothetical protein AMTR_s00010p00214870 [Amborella trichopoda]
Length=154

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            + GTLEY SD++S +   K KK   Q QTV+LKV MDC+GCE KV+KA+SSL GVK+V+ 
Sbjct  6    IEGTLEYFSDLLSRTQKKKKKK---QFQTVDLKVTMDCEGCENKVRKAVSSLKGVKSVET  62

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            +RK ++V+VTGYVEA KVLKK + TGKKAE WPYVPYNLVA PYA QAYDKKAP GYVR 
Sbjct  63   SRKDKRVSVTGYVEAKKVLKKVQDTGKKAEFWPYVPYNLVAHPYAPQAYDKKAPAGYVRN  122

Query  433  VDNPT-TGTAARFDDPYVTIFSDENPNACSVM  341
            V++   T +  + ++   ++FSD+NPNACS+M
Sbjct  123  VESIVPTNSDDKQEEKMTSMFSDDNPNACSIM  154



>ref|XP_007018869.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
 gb|EOY16094.1| Heavy metal transport/detoxification superfamily protein [Theobroma 
cacao]
Length=149

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEYISD++SS    K K      QTV LK+RMDC+GC  KVKK LS + G K+V
Sbjct  1    MGVEGTLEYISDLLSSVKKKKKK----HTQTVALKIRMDCEGCARKVKKVLSGVKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTGYVEA KVL  A+ST KK E+WPYVPY LVA PY AQAYDKKAP  +V
Sbjct  57   DVDLKQQKATVTGYVEAKKVLAAAQSTKKKVELWPYVPYTLVANPYVAQAYDKKAPLNHV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V      T    DD Y  +FSDENPNACS+M
Sbjct  117  RAVPLTANITETTMDDGYTNMFSDENPNACSIM  149



>ref|XP_008346877.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
Length=150

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+       K  KKKKQ+QTV +K+RMDC+ C  KVK  LS + G K+V
Sbjct  1    MGIQGTLEYLSDV----SSAKKGKKKKQMQTVAVKIRMDCEXCARKVKNVLSGVKGAKSV  56

Query  619  DINRKQQKVTVTGY-VEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            DI+ KQQK TVTGY VEA KVLK A+ST KK E+WPYVPYNLVA PY +QAYDKKAPP  
Sbjct  57   DIDLKQQKATVTGYNVEAKKVLKAAQSTKKKCELWPYVPYNLVAHPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V + +  T    DD Y+ +FSD+NPNACSVM
Sbjct  117  VRKVADTSNITETAVDDRYIVMFSDDNPNACSVM  150



>ref|XP_003522815.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
Length=149

 Score =   180 bits (456),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ G LEY+SD++S+    K K    Q+QTV LK+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGVQGPLEYLSDLLSTKKKKKKK----QVQTVALKIRMDCEGCARKVKHVLSGVKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +++ KQQK TVTGYVE  KVLK A+ST KK E+WPYVPY +VA PY +QAYDKKAPP  V
Sbjct  57   EVDLKQQKATVTGYVEPKKVLKAAQSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNMV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V + T  +    DD Y+ +FSDENPNACS+M
Sbjct  117  RKVSDTTNISETTVDDRYIQMFSDENPNACSIM  149



>ref|XP_004515645.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=150

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S         K KKK+KQ QTV LK+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGVQGTLEYLS---DLLSSKKKKKKRKQTQTVALKIRMDCEGCARKVKHVLSGVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTV+GYVEA KVLK A+ST KK E+WPYVPY +VA PY +QAYDKKAPP  V
Sbjct  58   DVDMKQQKVTVSGYVEAKKVLKAAQSTKKKVELWPYVPYTMVAHPYISQAYDKKAPPNMV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V + +      FDD YV +FSDENPNACSVM
Sbjct  118  RKVADTSNIKETTFDDTYVEMFSDENPNACSVM  150



>ref|XP_009357754.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Pyrus x bretschneideri]
Length=146

 Score =   179 bits (455),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A+S++ G K V++NRKQ +VTVTGYVE NKVLKK KSTG
Sbjct  23   MQTVEIKVKMDCDGCERRVKNAVSNMKGAKQVEVNRKQSRVTVTGYVEPNKVLKKVKSTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPYVPYNLVA PY A AYDKKAP GYVR V     G  A  DD Y ++FSDENP+
Sbjct  83   KKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVTQALPGPNAP-DDKYTSMFSDENPH  141

Query  355  ACSVM  341
            ACS+M
Sbjct  142  ACSIM  146



>gb|EAZ08809.1| hypothetical protein OsI_31075 [Oryza sativa Indica Group]
Length=161

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 10/161 (6%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhk--kkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            +GGT++Y+SD++        +  KK+KQ QTVELKVRMDCDGCELKV+ ALSS+ GV++V
Sbjct  1    MGGTMDYLSDLLGGGGSSSRRRYKKRKQFQTVELKVRMDCDGCELKVRNALSSMKGVQSV  60

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +INRKQ KVTV G+VE +KV+K+ ++TGKKAEIWPYVPY LVA PYAA AYDK+APPG+V
Sbjct  61   EINRKQYKVTVQGFVEPHKVVKRVQATGKKAEIWPYVPYTLVAHPYAAPAYDKRAPPGHV  120

Query  439  RRVDN--PTTGTAARF------DDPYVTIFSDENPNACSVM  341
            RRVD   P     +        ++   T+FSDENPNACS+M
Sbjct  121  RRVDAVMPVASYGSAAAAAAAPEERLTTMFSDENPNACSIM  161



>gb|EMS55854.1| hypothetical protein TRIUR3_04753 [Triticum urartu]
Length=162

 Score =   180 bits (456),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 123/162 (76%), Gaps = 9/162 (6%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk------hkkkkKQLQTVELKVRMDCDGCELKVKKALSSL  638
            MG+GGTLEY+S ++    GH       +++++KQ+QTVELKV MDC+GCE KVK ALSS+
Sbjct  1    MGVGGTLEYLSGLLGGGGGHGHGHGHGNRRRRKQMQTVELKVSMDCEGCERKVKNALSSM  60

Query  637  SGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKK  458
             GV++V+INRKQQKVTV GY +A+KVL+KA+STGKKAEIWPYVPY+ V+QPY A  YDK+
Sbjct  61   KGVRSVNINRKQQKVTVAGYADASKVLRKAQSTGKKAEIWPYVPYSQVSQPYVAGTYDKR  120

Query  457  APPGYVRRVD---NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            AP GYVR  +      +G  +R DD    +F+D+N N+C+VM
Sbjct  121  APAGYVRSQEPGYGNVSGQVSRQDDQLTDMFNDDNANSCAVM  162



>ref|XP_008339571.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
 ref|XP_008352914.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Malus domestica]
 ref|XP_008352915.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Malus domestica]
 ref|XP_008352916.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X2 [Malus domestica]
Length=146

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A++++ G K V++NRKQ KVTVTGYVE NKVLKK KSTG
Sbjct  23   MQTVEIKVKMDCDGCERRVKNAVTNMKGAKQVEVNRKQSKVTVTGYVEPNKVLKKVKSTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPYVPYNLVA PY A AYDKKAP GYVR V     G  A  DD Y ++FSDENP+
Sbjct  83   KKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVTQALPGPNAP-DDKYTSMFSDENPH  141

Query  355  ACSVM  341
            ACS+M
Sbjct  142  ACSIM  146



>ref|XP_008378054.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Malus domestica]
Length=151

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 114/154 (74%), Gaps = 4/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS+   K KK   Q+QTV +K+RMDC+GC  KVK  LS + G K  
Sbjct  1    MGIQGTLEYLSDVLSSAKKGKKKK---QMQTVAIKIRMDCEGCARKVKSVLSXVKGGKIC  57

Query  619  DINRKQQKVTVTGY-VEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            DI+ KQQK TVTGY VEA KVLK A+ST KK E+WPYVPYNLVA PY +QAYDKKAPP  
Sbjct  58   DIDLKQQKATVTGYNVEAKKVLKAAQSTKKKCELWPYVPYNLVAHPYISQAYDKKAPPNM  117

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V + +  T    DD Y  +FSD+NPNACS+M
Sbjct  118  VRKVADTSNITETAMDDRYTVMFSDDNPNACSIM  151



>gb|KHN24785.1| hypothetical protein glysoja_037127 [Glycine soja]
Length=149

 Score =   179 bits (454),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ G LEY+SD++S+    K K    Q+QTV LK+RMDC+GC  KVK  LS + G K+V
Sbjct  1    MGVQGPLEYLSDLLSTKKKKKKK----QVQTVALKIRMDCEGCARKVKHVLSGVKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +++ KQQK TVTGYVE  KVLK A+ST KK E+WPYVPY +VA PY +QAYDKKAPP  V
Sbjct  57   EVDLKQQKATVTGYVEPKKVLKAAQSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNMV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V + T  +    DD Y+ +FSDENPNACS+M
Sbjct  117  RKVADTTNISETTVDDRYIQMFSDENPNACSIM  149



>gb|AFK38176.1| unknown [Medicago truncatula]
 gb|KEH34866.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=149

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 114/153 (75%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD++SS+   K K    Q QTV LK+RMDC+GC  KVK  LS + G K V
Sbjct  1    MGVQGTLEYLSDLLSSTKKKKKK----QTQTVSLKIRMDCEGCARKVKHVLSGVKGAKKV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTV+GYVE  KVLK A+ST KK E+WPYVPY +VA PY +QAYDKKAPP  V
Sbjct  57   DVDLKQQKVTVSGYVEPKKVLKAAQSTKKKVELWPYVPYTMVAHPYISQAYDKKAPPNMV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V + +    + FDD YV +FSDENPNACS+M
Sbjct  117  RKVGDTSNIKESTFDDSYVEMFSDENPNACSIM  149



>ref|XP_007226004.1| hypothetical protein PRUPE_ppa012978mg [Prunus persica]
 gb|EMJ27203.1| hypothetical protein PRUPE_ppa012978mg [Prunus persica]
Length=146

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE KVK A+S++ G K V++NRKQ +VTVTGYVE NKVLKK KSTG
Sbjct  23   MQTVEIKVKMDCDGCERKVKNAVSNMKGAKQVEVNRKQSRVTVTGYVEPNKVLKKVKSTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDN--PTTGTAARFDDPYVTIFSDEN  362
            KKAE+WPYVPYNLVA PY   AYDKKAP GYVR V    P+ G     DD Y T+FSDEN
Sbjct  83   KKAELWPYVPYNLVAYPYVTGAYDKKAPSGYVRNVAQALPSPGAP---DDKYTTMFSDEN  139

Query  361  PNACSVM  341
            PNACS+M
Sbjct  140  PNACSIM  146



>ref|XP_008233984.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Prunus mume]
Length=149

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 119/154 (77%), Gaps = 6/154 (4%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++SS+   K K+K  Q+QTV +K+RMDC+GC  KVKK LS + G K+V
Sbjct  1    MGVQGTLEYLSNLLSSARRGKKKRK--QIQTVAVKIRMDCEGCARKVKKVLSGVKGAKSV  58

Query  619  DINRKQQKVTVTGY-VEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            DI+ KQQK TVTGY VEA KVLK A+ST KK E+WPYVPY LVA PYA+ AYDKKAPP  
Sbjct  59   DIDLKQQKATVTGYNVEAKKVLKAAQSTKKKCELWPYVPYTLVAHPYASGAYDKKAPPNM  118

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V  P T TAA  D+ Y  +FSD+NPNACS+M
Sbjct  119  VRKV--PDTATAA-VDESYTIMFSDDNPNACSIM  149



>gb|KHN09147.1| hypothetical protein glysoja_025608 [Glycine soja]
Length=149

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 112/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GT+EY+SD++S+    K K    Q+QTV LK+RMDC+GC  KVK  L  + G K+V
Sbjct  1    MGVQGTMEYLSDLLSTKKKKKKK----QVQTVALKIRMDCEGCARKVKHVLFGVKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +++ KQQK TVTGYVE  KVLK A+ST KK E+WPYVPY++VA PY +QAYDKKAPP  V
Sbjct  57   EVDLKQQKATVTGYVEPKKVLKAAQSTKKKVELWPYVPYSMVANPYISQAYDKKAPPNMV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V +    +    DD Y+ IFSDENPNACS+M
Sbjct  117  RKVADTANISETTVDDRYIQIFSDENPNACSIM  149



>gb|EPS58148.1| hypothetical protein M569_16668, partial [Genlisea aurea]
Length=125

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 6/124 (5%)
 Frame = -3

Query  712  QTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGK  533
            QTV LKVRMDCDGCELKVKKALSSL GV +V+INRKQQKVTV G+V+  KVL KA STGK
Sbjct  8    QTVNLKVRMDCDGCELKVKKALSSLPGVDSVEINRKQQKVTVRGFVDQTKVLNKAMSTGK  67

Query  532  KAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPNA  353
            +AEIWPY+PY LVA+PYAA +YD++APPG+VRR D       A     YV++FSD+NPNA
Sbjct  68   RAEIWPYLPYELVARPYAAASYDRRAPPGFVRRND------GAYDHQSYVSMFSDDNPNA  121

Query  352  CSVM  341
            CS+M
Sbjct  122  CSLM  125



>ref|XP_010320148.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X2 [Solanum lycopersicum]
Length=150

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++S+    K KK   Q+ TV +K+RMDC+GC  KVK ALS + G K+V
Sbjct  1    MGVSGTLEYLSEVLSNVKKSKKKK---QIATVSIKIRMDCEGCARKVKNALSKVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTG+VE  KVLK AKSTGKK EIWPYVPY++VA PYAA  YDKKAPP +V
Sbjct  58   DVDLKQQKATVTGFVEPKKVLKAAKSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R   +P+       ++ Y  +FSDENPNAC++M
Sbjct  118  RATTDPSVAHLNPVEEQYSLMFSDENPNACNIM  150



>ref|XP_004238514.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X1 [Solanum lycopersicum]
Length=169

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++S+    K KK   Q+ TV +K+RMDC+GC  KVK ALS + G K+V
Sbjct  1    MGVSGTLEYLSEVLSNVKKSKKKK---QIATVSIKIRMDCEGCARKVKNALSKVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTG+VE  KVLK AKSTGKK EIWPYVPY++VA PYAA  YDKKAPP +V
Sbjct  58   DVDLKQQKATVTGFVEPKKVLKAAKSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R   +P+       ++ Y  +FSDENPNAC++M
Sbjct  118  RATTDPSVAHLNPVEEQYSLMFSDENPNACNIM  150



>gb|EYU36526.1| hypothetical protein MIMGU_mgv1a020859mg [Erythranthe guttata]
Length=151

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 112/153 (73%), Gaps = 2/153 (1%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+SD+ SSS   K KKK  QL TV +K+RMDCDGC LKV +ALS + G K+V
Sbjct  1    MGVAGTLEYLSDVFSSSSNKKKKKK--QLNTVSVKIRMDCDGCALKVNRALSRVKGAKSV  58

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +++ KQQK TV GY+EA  V+K A+STGKK E WPYVPY +VA PY A  YDKKAPP +V
Sbjct  59   ELDMKQQKATVYGYIEAKDVMKAAQSTGKKVEPWPYVPYTMVAHPYVAGVYDKKAPPNFV  118

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R  D+P   T    ++ Y  +FSDENPNACS+M
Sbjct  119  RASDDPAVVTLTPVEEQYTLMFSDENPNACSIM  151



>ref|XP_010544234.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Tarenaya hassleriana]
Length=150

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 113/154 (73%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVKT  623
            MG+ GT+EYIS+++  +   K K    Q+QTV L+V R+DC+GCE K+K  LS + GVKT
Sbjct  1    MGVEGTMEYISELLKKTKKKKKK----QMQTVALRVARIDCEGCERKIKHILSGVKGVKT  56

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VD++ KQQKVTVTGYVE  KVL+ AKST KK E+WPYVPY +VA PY +QAYDKKAPP  
Sbjct  57   VDVDAKQQKVTVTGYVEPKKVLEAAKSTKKKVELWPYVPYTMVAHPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V +    +    DD Y  +FSDENPN+CS++
Sbjct  117  VRKVPDTAALSETTVDDRYTIMFSDENPNSCSIV  150



>ref|XP_006354021.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=150

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S++ S+    K KK   Q+ TV +K+RMDC+GC  KVK ALS + G K+V
Sbjct  1    MGVSGTLEYLSEVFSNVKKSKKKK---QIATVSIKIRMDCEGCARKVKNALSKVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTG+VE  KVLK A+STGKK EIWPYVPY++VA PYAA  YDKKAPP +V
Sbjct  58   DVDLKQQKATVTGFVEPKKVLKAAQSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R   +P+       ++ Y  +FSDENPNAC++M
Sbjct  118  RATTDPSVAHLNPVEEQYSLMFSDENPNACNIM  150



>ref|XP_010096770.1| hypothetical protein L484_025888 [Morus notabilis]
 gb|EXB65622.1| hypothetical protein L484_025888 [Morus notabilis]
Length=146

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +V+ A++S+ G K+VD+NRKQ +VTVTGYVE NKVLKK KSTG
Sbjct  23   MQTVEIKVKMDCDGCERRVRNAVTSMRGAKSVDVNRKQSRVTVTGYVEPNKVLKKVKSTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            K+AE WPYVPYNLVA PY AQAYDKKAP GYV+ V        A  D+ + ++FSDENPN
Sbjct  83   KRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQALPSPNAP-DEKFTSMFSDENPN  141

Query  355  ACSVM  341
            ACS+M
Sbjct  142  ACSIM  146



>ref|NP_001242585.1| uncharacterized protein LOC100805807 [Glycine max]
 gb|ACU17253.1| unknown [Glycine max]
Length=149

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GT+EY+SD++S+    K K    Q+QTV LK+RMDC+GC  KVK  L  + G K+V
Sbjct  1    MGVQGTMEYLSDLLSTKKKKKKK----QVQTVALKIRMDCEGCARKVKHVLFGVKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            +++ KQQK TVTGYVE  KVLK A+ST KK E+W YVPY++VA PY +QAYDKKAPP  V
Sbjct  57   EVDLKQQKATVTGYVEPKKVLKAAQSTKKKVELWSYVPYSMVANPYISQAYDKKAPPNMV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+V +    +    DD Y+ IFSDENPNACS+M
Sbjct  117  RKVADTANISETTVDDRYIQIFSDENPNACSIM  149



>ref|XP_009409154.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=149

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 114/150 (76%), Gaps = 6/150 (4%)
 Frame = -3

Query  784  TLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRK  605
            TL+Y+S  + + H  K K    Q QTVELKVRMDCDGCELKVKKALSS++GV++VD++RK
Sbjct  4    TLDYLSGFLCTGHKVKKK----QFQTVELKVRMDCDGCELKVKKALSSINGVQSVDVDRK  59

Query  604  QQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD-  428
            QQK TVTGYVE N+VL+KAK+TG KAE+WPY+PY+LV  PY A  YDKKAP G+VR V+ 
Sbjct  60   QQKATVTGYVEPNQVLRKAKATGNKAELWPYLPYSLVTHPYTAGIYDKKAPSGHVRNVEC  119

Query  427  -NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                +    + +D    +FS++NPN+CS+M
Sbjct  120  VAVVSDHGRKQEDQLADMFSEDNPNSCSIM  149



>ref|XP_010044169.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
 gb|KCW86205.1| hypothetical protein EUGRSUZ_B02894 [Eucalyptus grandis]
Length=146

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 116/153 (76%), Gaps = 12/153 (8%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD  + S   K +K    +QTVE+KV+MDCDGCE +VK  +SS+ GVK+V++NR
Sbjct  2    GALDFLSDFCTISTPRKKRKP---MQTVEIKVKMDCDGCERRVKSVVSSMKGVKSVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV-  431
            KQ +VTV G+VE NKVL++ KSTGKKAE+WPY+PYNLVA PY AQAYDKKAP GYV+ V 
Sbjct  59   KQSRVTVRGHVEPNKVLQRVKSTGKKAELWPYIPYNLVAYPYVAQAYDKKAPAGYVKNVA  118

Query  430  ---DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                +PTT    RF    VT+FSDENPNACS+M
Sbjct  119  QALPSPTT-PGERF----VTLFSDENPNACSIM  146



>ref|XP_010692589.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Beta vulgaris subsp. vulgaris]
Length=147

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 115/154 (75%), Gaps = 8/154 (5%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVKT  623
            MG+ GTLEY+SDM+SS+   K KK   Q  TV LKV R+DC+GC +K+KKALS L GVKT
Sbjct  1    MGVQGTLEYLSDMISSAKKGKKKK---QFNTVNLKVTRIDCEGCAMKIKKALSGLKGVKT  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VD++ KQQKVTVTGY+EA KVL  AKST KK E+WPYVPY +VA PY A AYDKKAP   
Sbjct  58   VDVDMKQQKVTVTGYMEAKKVLAAAKSTKKKVELWPYVPYTMVAHPYMAGAYDKKAPANC  117

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V++P T      ++ Y T+FSDENP AC +M
Sbjct  118  VRKVEDPMT----PMEEQYTTMFSDENPGACYIM  147



>ref|XP_011038679.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Populus euphratica]
Length=150

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+ +SD +S       KK+K++ +QTV++KV+MDCDGCE +VK ++SS+ GVK+V++N
Sbjct  2    GALDDLSDYLSDLFTVSRKKRKRKPMQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVEVN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RKQ +VTV+G+VE NKVLKK KSTGK+AE WPYVPYNLVA PYAAQAYDKKAP GYV+ V
Sbjct  62   RKQSRVTVSGHVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYAAQAYDKKAPAGYVKNV  121

Query  430  DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                    A  D+ + ++FSDENPNACS+M
Sbjct  122  VQALPSPNAT-DERFTSMFSDENPNACSIM  150



>ref|XP_007223670.1| hypothetical protein PRUPE_ppa012855mg [Prunus persica]
 gb|EMJ24869.1| hypothetical protein PRUPE_ppa012855mg [Prunus persica]
Length=152

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++SS+   K K+K  Q+QTV +K+RMDC+GC  KVKK LS + G K+V
Sbjct  1    MGVQGTLEYLSNLLSSARRGKKKRK--QIQTVAVKIRMDCEGCARKVKKVLSGVKGAKSV  58

Query  619  DINRKQQKVTVTGY-VEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            DI+ KQQK TVTGY VEA KVLK A+ST KK E+WPYVPY LVA PY + AYDKKAPP  
Sbjct  59   DIDLKQQKATVTGYNVEAKKVLKAAQSTKKKCELWPYVPYTLVAHPYVSGAYDKKAPPNM  118

Query  442  VRRV-DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V D  T G  A  D+ Y  +FSD+NPNACSVM
Sbjct  119  VRKVPDTATIGDTA-VDESYTIMFSDDNPNACSVM  152



>gb|KHG01622.1| Copper-exporting P-type ATPase A [Gossypium arboreum]
Length=150

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 114/154 (74%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L +YISD+++     K +K    +QTVE+KV+MDCDGCE +VK A+SS+ GVK+
Sbjct  1    MGALDSLSDYISDLVTVHGKRKKRKV---MQTVEIKVKMDCDGCERRVKNAVSSMKGVKS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK+  V+V+GYVE NKVL K KSTGK+AE WPYVPYNLVA PY AQAYDKKAP GY
Sbjct  58   VEVNRKKSYVSVSGYVEPNKVLNKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGY  117

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V+          A  D+ +VT FSDENPNACS+M
Sbjct  118  VKEAVQALPSPNA-VDEKFVTFFSDENPNACSIM  150



>ref|XP_004297355.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Fragaria vesca subsp. vesca]
Length=145

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 99/125 (79%), Gaps = 3/125 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A+S++ G + V++NRKQ +V VTGYVE NKVLKK KSTG
Sbjct  24   MQTVEIKVKMDCDGCERRVKSAVSNMKGARQVEVNRKQSRVKVTGYVEPNKVLKKVKSTG  83

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPYVPYNLVA PY A AYDKKAP GYVR V    T      +D Y ++FSDENP+
Sbjct  84   KKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVAQAVTSAP---EDQYTSMFSDENPH  140

Query  355  ACSVM  341
            AC++M
Sbjct  141  ACAIM  145



>ref|XP_008811964.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=150

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 115/152 (76%), Gaps = 6/152 (4%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+Y+S+  S +   +  +KK++ LQTVELKV+MDCDGCE +VK A++SL GV  VD+N
Sbjct  2    GALDYLSNFCSVTETRRSLRKKRKPLQTVELKVKMDCDGCERRVKHAVTSLKGVTMVDVN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RKQ +VTVTG+VE  KVL K KSTGK+ E WPYVPYNLV  PYAAQAYDK+AP G+VR V
Sbjct  62   RKQSRVTVTGHVEPKKVLNKVKSTGKRVEFWPYVPYNLVYYPYAAQAYDKRAPSGFVRNV  121

Query  430  DN--PTTGTAARFDDPYVTIFSDENPNACSVM  341
            D   P+ G     ++ + ++FSD+NPNACS+M
Sbjct  122  DQAVPSPGAP---EEQFTSLFSDDNPNACSIM  150



>ref|XP_006448292.1| hypothetical protein CICLE_v10017849mg [Citrus clementina]
 ref|XP_006468830.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR61532.1| hypothetical protein CICLE_v10017849mg [Citrus clementina]
 gb|KDO64715.1| hypothetical protein CISIN_1g032167mg [Citrus sinensis]
Length=146

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 8/151 (5%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++ D+   +   K +K     QTVE+KV+MDCDGCE +V+ A+SS+ G K+V++NR
Sbjct  2    GVLDHLFDLFEITPRRKRRKP---WQTVEIKVKMDCDGCERRVRHAVSSMKGAKSVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTVTG+V+ NKVLKK +STGK+AE WPYVPYNLVA PY AQAYDKKAP GYVR V 
Sbjct  59   KQSRVTVTGHVDPNKVLKKVRSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVRNVA  118

Query  427  N--PTTGTAARFDDPYVTIFSDENPNACSVM  341
               P+   A   D+  V++FSDENPNACS+M
Sbjct  119  QALPSPNAA---DEKLVSLFSDENPNACSIM  146



>ref|XP_002872408.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48667.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=150

 Score =   174 bits (442),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 110/154 (71%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVKT  623
            MG+ GT+EYISD +      K K    QLQTV L+V R+DC+GCE K+K  LS + GVK+
Sbjct  1    MGVEGTMEYISDFLKKRKRKKKK----QLQTVALRVARIDCEGCERKIKHILSGVKGVKS  56

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VD++ K QKVTVTGY+E  KVL+ AKST KK E+WPYVPY +VA PY +QAYDKKAPP  
Sbjct  57   VDVDVKLQKVTVTGYIEPKKVLEAAKSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V + T+      DD Y  +FSDENPN+C +M
Sbjct  117  VRKVPDTTSVNETTVDDSYTIMFSDENPNSCIIM  150



>ref|XP_010243803.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=146

 Score =   174 bits (441),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 101/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +V+ A+SS+ GV++V++NRKQ +VTV GYVE NKVLKK + TG
Sbjct  23   MQTVEIKVKMDCDGCERRVRHAVSSMKGVRSVEVNRKQSRVTVAGYVEPNKVLKKVQGTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV--DNPTTGTAARFDDPYVTIFSDEN  362
            KKAE WPYVPYNLVA PYA QAYDKKAP GYV+ V   NP        D+  +T+FSDEN
Sbjct  83   KKAEFWPYVPYNLVAYPYATQAYDKKAPAGYVKNVVQANPAPNAT---DENLMTLFSDEN  139

Query  361  PNACSVM  341
            PNACS+M
Sbjct  140  PNACSIM  146



>ref|XP_010916340.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Elaeis guineensis]
Length=150

 Score =   174 bits (441),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 115/152 (76%), Gaps = 6/152 (4%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+Y+S+  S +   +  +KK++ LQTVELKV+MDCDGCE +VK A++SL GV  VD+N
Sbjct  2    GALDYLSNFCSVTETRRSLRKKRKPLQTVELKVKMDCDGCERRVKHAVTSLKGVTMVDVN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RKQ +VTVTG+VE  KVL K KSTGK+ E WPYVPYNLV  PYAAQAYDK+AP GYVR V
Sbjct  62   RKQSRVTVTGHVEPKKVLNKVKSTGKRVEFWPYVPYNLVYYPYAAQAYDKRAPSGYVRNV  121

Query  430  --DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                P+ G     ++ ++++FSD+NPNACS+M
Sbjct  122  VQAEPSPGAP---EEQFISLFSDDNPNACSIM  150



>ref|NP_001151667.1| metal ion binding protein [Zea mays]
 gb|ACG43765.1| metal ion binding protein [Zea mays]
Length=163

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 120/165 (73%), Gaps = 16/165 (10%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghkhkk----kkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            +GGTLEY+SD++         +    ++ Q QTVELKVRMDCDGCE+KV+ ALS + GV 
Sbjct  1    MGGTLEYLSDLLGGGGSSSSSRRRYNRRTQFQTVELKVRMDCDGCEMKVRNALSRMKGVH  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKK-AEIWPYVPYNLVAQPYAAQAYDKKAPP  449
            +V+++RKQ KVTV GYVE +KV+K+ ++TGKK AEIWPYVPY+LVA PYAA AYD+KAPP
Sbjct  61   SVEMDRKQSKVTVQGYVEPHKVVKRVQATGKKAAEIWPYVPYSLVAHPYAAPAYDRKAPP  120

Query  448  GYVRRVD---------NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            GYVRRVD          PT   A   ++  V +FSD+NPNACS+M
Sbjct  121  GYVRRVDAVMPVSSYGGPT--AAGPQEERLVNMFSDDNPNACSIM  163



>ref|XP_004297353.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform 1 [Fragaria vesca subsp. vesca]
Length=145

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            LQTV++KV+MDCDGCE +VK A+S++ G K V++NRKQ +VTVTGYVEA KVLK+ KSTG
Sbjct  24   LQTVDIKVKMDCDGCERRVKSAVSNMKGAKQVEVNRKQSRVTVTGYVEAKKVLKRVKSTG  83

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            K+AEIWPYVPYNLVA PY A AYDKKAP GYVR V       A   DD Y ++FSDENP+
Sbjct  84   KRAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVPQ---AFALAPDDQYTSMFSDENPH  140

Query  355  ACSVM  341
            AC++M
Sbjct  141  ACAIM  145



>ref|XP_006354022.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=150

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++S++   K KK   Q+ TV +K+RMDC+GC  KVK ALS + G K+V
Sbjct  1    MGVSGTLEYLSEVLSNAKKSKKKK---QIATVSIKIRMDCEGCARKVKNALSKVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTG+VE  KVLK A+STGKK EIWPYVPY++VA PYAA  YDKKAPP +V
Sbjct  58   DVDLKQQKATVTGFVEPKKVLKAAQSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R   +P+       ++ Y  +FSDEN NAC++M
Sbjct  118  RATTDPSVAHLNPVEEQYSLMFSDENLNACNIM  150



>ref|XP_002531065.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF31326.1| metal ion binding protein, putative [Ricinus communis]
Length=150

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 115/154 (75%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MG-LGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG L    +Y+SD+ + +   + +K    +QTVE+KV+MDCDGCE +VK A+S++ GVK+
Sbjct  1    MGALDDLSDYLSDLFTYARKKRKRKP---MQTVEIKVKMDCDGCERRVKHAVSNIKGVKS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRKQ +V V+GY+E NKVLKK +STGK+AE WPYVPYNLVA PY AQAYDKKAP GY
Sbjct  58   VEVNRKQSRVVVSGYIEPNKVLKKVRSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGY  117

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V+ V        A  D+ Y T+FSDENP+ACS+M
Sbjct  118  VKNVFQALPSPNAP-DEKYTTMFSDENPHACSIM  150



>gb|EMT23051.1| hypothetical protein F775_43162 [Aegilops tauschii]
Length=162

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 123/162 (76%), Gaps = 9/162 (6%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghk------hkkkkKQLQTVELKVRMDCDGCELKVKKALSSL  638
            MG+GGTLEY+S ++    GH       +++++KQ+QTVELKV MDC+GCE KVK ALSS+
Sbjct  1    MGVGGTLEYLSGLLGGGGGHGHGHGYGNRRRRKQMQTVELKVSMDCEGCERKVKNALSSM  60

Query  637  SGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKK  458
             GV++V+INRKQQKVTV GYVE +KVL+KA+STGKKAEIWPYVPY+ V+QPY A  YDK+
Sbjct  61   KGVRSVNINRKQQKVTVAGYVEPSKVLRKAQSTGKKAEIWPYVPYSQVSQPYVAGTYDKR  120

Query  457  APPGYVRRVD---NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            AP GYVR  +      +G  +R DD    +F+D+N N+C+VM
Sbjct  121  APAGYVRSQEPGYGNVSGQVSRQDDQLTDMFNDDNANSCAVM  162



>ref|XP_010906975.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=151

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 115/151 (76%), Gaps = 3/151 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            G L+Y+S+  S ++  +  K++K+  LQTVE++V+MDCDGCE +VK A+ SL GV +V++
Sbjct  2    GALDYLSNFFSVTNTRRALKRRKRKPLQTVEIRVKMDCDGCERRVKHAVQSLKGVTSVNV  61

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            +RKQ +VTVTG+VE NKVLKK KSTGK AE WPYVPYNLVA PY A AYDK+AP G+VR 
Sbjct  62   SRKQSRVTVTGHVEPNKVLKKVKSTGKVAEFWPYVPYNLVAYPYVAGAYDKRAPSGFVRN  121

Query  433  VDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V        A  D+ Y+++FSDENPNACS+M
Sbjct  122  VAQALPSPQAH-DEQYMSLFSDENPNACSIM  151



>ref|XP_002315894.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
 gb|EEF02065.1| heavy-metal-associated domain-containing family protein [Populus 
trichocarpa]
Length=150

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+ +SD +S       KK+K++ +QTV++KV+MDCDGCE +VK ++SS+ GVK+V++N
Sbjct  2    GALDDLSDYLSDLFTVARKKRKRKPMQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVEVN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RKQ +VTV+G VE NKVLKK KSTGK+AE WPYVPYNLVA PYAAQAYDKKAP GYV+ V
Sbjct  62   RKQSRVTVSGNVEPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYAAQAYDKKAPAGYVKNV  121

Query  430  DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                    A  D+ + ++FSDENPNACS+M
Sbjct  122  VQALPSPNAT-DERFTSMFSDENPNACSIM  150



>ref|XP_006378456.1| hypothetical protein POPTR_0010s12480g [Populus trichocarpa]
 gb|ERP56253.1| hypothetical protein POPTR_0010s12480g [Populus trichocarpa]
Length=130

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
             QTV++KV+MDCDGCE +VK ++SS+ GVK+V++NRKQ +VTV+G VE NKVLKK KSTG
Sbjct  7    FQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVEVNRKQSRVTVSGNVEPNKVLKKVKSTG  66

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            K+AE WPYVPYNLVA PYAAQAYDKKAP GYV+ V        A  D+ + ++FSDENPN
Sbjct  67   KRAEFWPYVPYNLVAYPYAAQAYDKKAPAGYVKNVVQALPSPNAT-DERFTSMFSDENPN  125

Query  355  ACSVM  341
            ACS+M
Sbjct  126  ACSIM  130



>ref|XP_006650141.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Oryza brachyantha]
Length=163

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 116/163 (71%), Gaps = 12/163 (7%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghk----hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVK  626
            +GGTLEY++ + +   G         +++QLQTVELKVRMDC+GCELKVK ALSS+ GV+
Sbjct  1    MGGTLEYLASLFTGGGGGDHHGHKNSRRRQLQTVELKVRMDCEGCELKVKNALSSMKGVE  60

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQ--PYAAQAYDKKAP  452
            +V INRKQQKVTV+GYVEA KVLKKA+ST KK+E+WPYVPY   +   PY A AYD++AP
Sbjct  61   SVKINRKQQKVTVSGYVEAGKVLKKAQSTRKKSELWPYVPYGAASHPYPYVAAAYDRRAP  120

Query  451  PGYVRRVDNPTT------GTAARFDDPYVTIFSDENPNACSVM  341
            PG+VR V+  +          +R  +    +F+DE+PNAC VM
Sbjct  121  PGHVRNVEASSAAYVQSGAGGSRAVERLTNLFNDEDPNACVVM  163



>gb|KDO64716.1| hypothetical protein CISIN_1g032170mg [Citrus sinensis]
Length=146

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++ D+  ++   K +K    +QTV++KV+MDCDGCE KV+ A+SS+ G K+V++NR
Sbjct  2    GVLDHLFDLFETTPRGKKRK---PMQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTVTGYV+ NKVLKK KSTGK+AE WPYVPYNLVA PY AQAYDKKAP GYV+ V 
Sbjct  59   KQSRVTVTGYVDPNKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVV  118

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  D+   T+FSDENPNACS+M
Sbjct  119  QALPSPNAT-DERLTTLFSDENPNACSIM  146



>ref|XP_006448293.1| hypothetical protein CICLE_v10017086mg [Citrus clementina]
 ref|XP_006468829.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR61533.1| hypothetical protein CICLE_v10017086mg [Citrus clementina]
Length=146

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV++KV+MDCDGCE KV+ A+SS+ G K+V++NRKQ +VTVTGYV+ NKVLKK KSTG
Sbjct  23   MQTVDIKVKMDCDGCERKVRNAVSSIRGAKSVEVNRKQSRVTVTGYVDPNKVLKKVKSTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            K+AE WPYVPYNLVA PY AQAYDKKAP GYV+ V        A  D+   T+FSDENPN
Sbjct  83   KRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNVVQALPSPNAT-DERLTTLFSDENPN  141

Query  355  ACSVM  341
            ACS+M
Sbjct  142  ACSIM  146



>ref|XP_009606650.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nicotiana tomentosiformis]
Length=150

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 111/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++SS   HK KK   Q+ TV +KVRMDC+GC  KVK  LS + G K+V
Sbjct  1    MGVAGTLEYLSEVLSSVKKHKKKK---QITTVAVKVRMDCEGCARKVKNVLSRVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTG+VE  KVLK A++TGKK E+WPYVPY+LVA PY A  YDKKAPP  V
Sbjct  58   DVDLKQQKATVTGFVEPKKVLKAAQATGKKCELWPYVPYSLVAHPYVAGVYDKKAPPNLV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R  ++P        ++ Y  +FSDENPNACS+M
Sbjct  118  RATNDPAIAHLNPVEEQYTLMFSDENPNACSIM  150



>gb|AFK39599.1| unknown [Lotus japonicus]
Length=147

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+Y+SD  S S     K+K   +QTVE+KV+MDCDGCE +V+ +++ + GV++V+INR
Sbjct  2    GVLDYLSDYFSVSPSTGKKRK--PMQTVEIKVKMDCDGCERRVRNSVAHMKGVRSVEINR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTV+GYV+ N+VLKK +STGK+AE WPY+PYNLVA PY AQ YDKKAPPGYV+   
Sbjct  60   KQSKVTVSGYVDRNRVLKKVQSTGKRAEFWPYIPYNLVAYPYVAQVYDKKAPPGYVKNSV  119

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  DD    +FSDENPNACS+M
Sbjct  120  QALPSPNA-LDDKLTNLFSDENPNACSIM  147



>ref|NP_192597.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC28185.1| contains similarity to heavy-metal-associated domain containing 
proteins (Pfam: HMA.hm, score: 12.02) [Arabidopsis thaliana]
 emb|CAB77982.1| putative metal-binding isoprenylated protein [Arabidopsis thaliana]
 gb|AAL49902.1| putative metal-binding isoprenylated protein [Arabidopsis thaliana]
 gb|AAM20235.1| putative metal-binding isoprenylated protein [Arabidopsis thaliana]
 dbj|BAE98609.1| putative metal-binding isoprenylated protein [Arabidopsis thaliana]
 gb|AEE82659.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=150

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVKT  623
            MG+ GT+EYISD++      K K    Q+QTV L+V R+DC+GCE K+K  LS + GVK+
Sbjct  1    MGVEGTMEYISDLLKKRKRKKKK----QMQTVALRVARIDCEGCERKIKHVLSGVKGVKS  56

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VD++ K QKVTVTGY++  KVL+ AKST KK E+WPYVPY +VA PY +QAYDKKAPP  
Sbjct  57   VDVDVKLQKVTVTGYIDPKKVLEAAKSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V +  +      DD Y  +FSDENPN+C++M
Sbjct  117  VRKVPDTASVNETTVDDSYTIMFSDENPNSCAIM  150



>ref|XP_003557809.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Brachypodium distachyon]
 gb|ACF22725.1| heavy-metal associated domain protein [Brachypodium distachyon]
Length=154

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 118/158 (75%), Gaps = 11/158 (7%)
 Frame = -3

Query  793  LGGTLEYISDMMssshgh-khkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            +GGTLEY++ ++   + H     +++QLQTVELKVRMDC+GCELKVK ALSSL G+++V 
Sbjct  1    MGGTLEYMTGLLGGRNHHGVKSNERRQLQTVELKVRMDCEGCELKVKNALSSLKGLESVR  60

Query  616  INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            INRKQQKVTV G VEA KVLKKA+STGKKAE+WP      V+ PY A +YD++APPG+VR
Sbjct  61   INRKQQKVTVKGRVEAGKVLKKAQSTGKKAELWPCT---TVSMPYVAASYDRRAPPGHVR  117

Query  436  RVDNPT------TGTAARFDDPYVTIFSDENPNACSVM  341
            RV+ PT      +   +R +D    +F+D+NPNACSVM
Sbjct  118  RVE-PTAMPYVSSSHVSRPEDRLTDMFNDDNPNACSVM  154



>ref|XP_010066640.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
 gb|KCW64610.1| hypothetical protein EUGRSUZ_G02198 [Eucalyptus grandis]
 gb|KCW64611.1| hypothetical protein EUGRSUZ_G02198 [Eucalyptus grandis]
Length=148

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+  SDM         KK+K  +QTV++KV+MDCDGCE +V+ A SS+ G K+V++NR
Sbjct  2    GVLDRFSDMFDFELSKPRKKRKP-MQTVDIKVKMDCDGCERRVRNAFSSMKGAKSVEVNR  60

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KV+VTGYVE+ KVL K +STGKKAE+WPYVPYNLVA PYA QAYDKKAP GYV+ V 
Sbjct  61   KQSKVSVTGYVESGKVLNKVRSTGKKAELWPYVPYNLVAYPYAPQAYDKKAPSGYVKNVP  120

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  +  + T+FSDENPNACS+M
Sbjct  121  QALPSPNAPGEH-FTTLFSDENPNACSIM  148



>ref|XP_009782213.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nicotiana sylvestris]
Length=150

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY+S+++SS   HK KK   Q+ TV +K+RMDC+GC  KVK ALS + G K+V
Sbjct  1    MGVAGTLEYLSEVLSSVKKHKKKK---QITTVAVKIRMDCEGCARKVKNALSRVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ K QK TVTG+VE  KVLK A++TGKK E+WPYVPY++VA PY A  YDKKAPP +V
Sbjct  58   DVDLKLQKATVTGFVEPKKVLKAAQATGKKCELWPYVPYSMVAHPYVAGVYDKKAPPNFV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R  ++P        ++ Y  +FSDENPNACS+M
Sbjct  118  RATNDPAIAHLNPVEEQYTLMFSDENPNACSIM  150



>ref|XP_009389530.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=151

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 11/155 (7%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            G L+++SDM S +   +  + +K+  LQTV+LKV+MDCDGCE +VK A+SS+ GV  V++
Sbjct  2    GALDHLSDMCSVTETKRTLQIRKRRPLQTVDLKVKMDCDGCERRVKHAVSSIRGVTNVNV  61

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQ +VTVTG++EA +VL++ KSTGK+AE+WPYVPYNLVA PY A AYDKKAP G+VR 
Sbjct  62   NRKQSRVTVTGHIEAKQVLERIKSTGKRAELWPYVPYNLVAYPYVAGAYDKKAPSGFVRN  121

Query  433  ----VDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                V NP        ++ Y+++FSD+NPNACS+M
Sbjct  122  AAQAVPNPNAP-----EEQYMSLFSDDNPNACSIM  151



>ref|XP_006434045.1| hypothetical protein CICLE_v10002768mg [Citrus clementina]
 gb|ESR47285.1| hypothetical protein CICLE_v10002768mg [Citrus clementina]
Length=150

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GT+EYISD++SS    K KK   Q+QTV LKVRMDCDGC  K+K  LSS+ G K+V
Sbjct  1    MGVEGTIEYISDLLSSVKKKKKKK---QMQTVALKVRMDCDGCARKMKGVLSSVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTVTG+VE  KVL  AK+T KK EIWPYVPYN+V+ PY +QAYDKKAPP +V
Sbjct  58   DVDLKQQKVTVTGFVEPKKVLAAAKATKKKVEIWPYVPYNIVSNPYVSQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R +    T T +  DD Y  +FSDENPNACS+M
Sbjct  118  RSIPATATVTESTMDDHYTNMFSDENPNACSIM  150



>ref|XP_010257308.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=182

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 102/127 (80%), Gaps = 5/127 (4%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +V+ A+ S+ GV++V++NRKQ +VTVTGYVE NKVLK+ KSTG
Sbjct  59   MQTVEIKVKMDCDGCERRVRHAVCSMKGVRSVEVNRKQSRVTVTGYVEPNKVLKRVKSTG  118

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV--DNPTTGTAARFDDPYVTIFSDEN  362
            K+AE WPYVPYNLVA PY  QAYDKKAP G+V+ V   NP+       D+  +T+FSD+N
Sbjct  119  KRAEFWPYVPYNLVAYPYVVQAYDKKAPAGFVKNVVQANPSPNAT---DEKIMTLFSDDN  175

Query  361  PNACSVM  341
            PNACS+M
Sbjct  176  PNACSIM  182



>gb|KGN52144.1| hypothetical protein Csa_5G611750 [Cucumis sativus]
Length=149

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 1/149 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G  + +SD++S       ++KKK LQTVE+KV+MDCDGCE +VK A++ + G KTV++NR
Sbjct  2    GIFDSVSDLISDYVATSRQRKKKPLQTVEIKVKMDCDGCERRVKNAVTKMKGAKTVEVNR  61

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTVTG+VEAN+VLKK + TGK+AE+WPYVPYN+VA PY  QAYDK+AP G+V+   
Sbjct  62   KQSKVTVTGFVEANRVLKKVRRTGKRAELWPYVPYNVVAYPYVTQAYDKRAPAGFVKNAV  121

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  D+   T+FSD+NPN CSVM
Sbjct  122  QAIPSPNA-VDEKLTTMFSDDNPNGCSVM  149



>ref|XP_002284123.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI26923.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+Y S++ + +   K K+K   +QTV++KV+MDCDGCE +VK A+SS+ GVKTVDINR
Sbjct  2    GALDYFSNLCTVTSTRKSKRK--PMQTVDIKVKMDCDGCERRVKNAVSSMKGVKTVDINR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV+G+V+ NKVLK+ KSTGK+AE WPYVPYNLV  PY  +AYDKKAP GYV+ V 
Sbjct  60   KQSRVTVSGFVDPNKVLKRVKSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVV  119

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                  +A  D+   T+FSD+NPNACS+M
Sbjct  120  QALPSPSAT-DERLTTLFSDDNPNACSIM  147



>ref|XP_003533947.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN36417.1| hypothetical protein glysoja_036964 [Glycine soja]
Length=147

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+YIS+  S S     K+K   +QTVE+KV+MDCDGCE +V+ ++  + GVK V++NR
Sbjct  2    GVLDYISEFFSVSPATGKKRKA--MQTVEIKVKMDCDGCERRVRNSVVHMKGVKQVEVNR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTVTGYV+ N+VLKK +STGK+A+ WPY+PYNLVA PY AQAYDKKAP GYV+   
Sbjct  60   KQSKVTVTGYVDRNRVLKKVQSTGKRADFWPYIPYNLVAYPYVAQAYDKKAPSGYVKNAA  119

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                 + +  D+   ++FSDENPNACS+M
Sbjct  120  QALPASNS-LDEKLTSLFSDENPNACSIM  147



>emb|CAN63279.1| hypothetical protein VITISV_023249 [Vitis vinifera]
Length=170

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+Y S++ + +   K K+K   +QTV++KV+MDCDGCE +VK A+SS+ GVKTVDINR
Sbjct  2    GALDYFSNLCTVTSTRKSKRK--PMQTVDIKVKMDCDGCERRVKNAVSSMKGVKTVDINR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV+G+V+ NKVLK+ KSTGK+AE WPYVPYNLV  PY  +AYDKKAP GYV+ V 
Sbjct  60   KQSRVTVSGFVDPNKVLKRVKSTGKRAEFWPYVPYNLVYYPYIKEAYDKKAPSGYVKNVV  119

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                  +A  D+   T+FSD+NPNACS+M
Sbjct  120  QALPSPSAT-DERLTTLFSDDNPNACSIM  147



>ref|XP_006472653.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|KDO80884.1| hypothetical protein CISIN_1g031931mg [Citrus sinensis]
Length=150

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 115/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GT+EYISD++SS    K KK   Q+QTV LKVRMDCDGC  K+K  LSS+ G K+V
Sbjct  1    MGVEGTIEYISDLLSSVKKKKKKK---QMQTVALKVRMDCDGCARKMKGVLSSVKGAKSV  57

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQKVTVTG+VE  KVL  AK+T KK EIWPYVPYN+V+ PY +QAYDKKAPP +V
Sbjct  58   DVDLKQQKVTVTGFVEPKKVLAAAKATKKKVEIWPYVPYNIVSNPYVSQAYDKKAPPNHV  117

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R +    T T +  DD Y  +FSDENPNACS+M
Sbjct  118  RAIPATATVTESTMDDRYTNMFSDENPNACSIM  150



>ref|XP_010533407.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Tarenaya hassleriana]
Length=151

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 113/150 (75%), Gaps = 1/150 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+ +SD +S       K++K++ +QTV +KV+MDCDGCE KVK A+SS+ GVK+V++N
Sbjct  2    GALDSLSDYLSDYFSVSRKRRKRKVMQTVNIKVKMDCDGCERKVKNAVSSMKGVKSVEVN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RK  KVTV+GYV+  KVLK+ + TGKKAE+WPYVPYNLVA PY A AYDKKAP G+VRRV
Sbjct  62   RKMSKVTVSGYVDGKKVLKRVQRTGKKAEMWPYVPYNLVAYPYVAGAYDKKAPAGFVRRV  121

Query  430  DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            +       A   +  V++FSD+NPNACS++
Sbjct  122  EAAMPPPDAPPHENLVSLFSDDNPNACSIV  151



>ref|XP_006845276.1| hypothetical protein AMTR_s00005p00265500 [Amborella trichopoda]
 gb|ERN06951.1| hypothetical protein AMTR_s00005p00265500 [Amborella trichopoda]
Length=147

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 119/154 (77%), Gaps = 13/154 (8%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+Y+S+ ++ S   K +K    LQTVE+KV+MDC+GCE KVK A+SS+ GV+ V++NR
Sbjct  2    GALDYLSNFITISGSRKKRKP---LQTVEIKVKMDCEGCEKKVKDAVSSMKGVRKVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTG-KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            KQ KVTV+GYVEANKVLKK +STG KKAE WPYVPYNLV  PYA Q+YDKKAP G+V+++
Sbjct  59   KQHKVTVSGYVEANKVLKKVQSTGKKKAEFWPYVPYNLVYYPYAPQSYDKKAPAGHVKKL  118

Query  430  D----NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            D    +PTT T  R    Y ++FSD+NP+AC++M
Sbjct  119  DYGLPSPTT-TQER----YTSLFSDDNPHACTIM  147



>ref|XP_008389229.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Malus domestica]
Length=146

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A+S + G K V+++RKQ +VTVTGYVE NKVLK+ K TG
Sbjct  23   MQTVEIKVKMDCDGCERRVKNAVSHMKGAKQVEVDRKQSRVTVTGYVEPNKVLKRVKRTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPYVPYNLVA PY A AYDKKAP GYVR V        A  D+ Y ++FSDENP+
Sbjct  83   KKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVAQALPPPDAP-DEKYTSMFSDENPH  141

Query  355  ACSVM  341
            ACS+M
Sbjct  142  ACSIM  146



>ref|XP_006289069.1| hypothetical protein CARUB_v10002466mg [Capsella rubella]
 gb|EOA21967.1| hypothetical protein CARUB_v10002466mg [Capsella rubella]
Length=150

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 108/154 (70%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVKT  623
            MG+ GT+EYISD +      K K    Q+QTV L+V R+DC+GCE K+K  LS + GVK+
Sbjct  1    MGVEGTMEYISDFLKKRKRKKKK----QMQTVALRVARIDCEGCERKIKHILSGVKGVKS  56

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VD++ K QKVTV GYV+  KVL+ AKST KK E+WPYVPY +VA PY +QAYDKKAPP  
Sbjct  57   VDVDVKLQKVTVMGYVDPKKVLEAAKSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+V +  T      DD Y  +FSDENPN+C +M
Sbjct  117  VRKVPDTATVNETTVDDSYTIMFSDENPNSCFIM  150



>ref|XP_003555948.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN42382.1| hypothetical protein glysoja_020094 [Glycine soja]
Length=146

 Score =   169 bits (429),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 112/149 (75%), Gaps = 4/149 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD  S S   K +K    +QTVE+KV+MDCDGCE +V+ ++S++SGVK V++NR
Sbjct  2    GALDFLSDYFSISTQKKKRKP---MQTVEIKVKMDCDGCERRVRNSVSNMSGVKQVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTVTGYV+ NKVLKK +STGK+AE WPY+ YNLVA PY AQAYDKKAP GYV+  +
Sbjct  59   KQSRVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVAQAYDKKAPSGYVKNTE  118

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  D+   ++FSD+NPNACS+M
Sbjct  119  QALPNPNAP-DEKLTSLFSDDNPNACSIM  146



>emb|CAN63619.1| hypothetical protein VITISV_017617 [Vitis vinifera]
Length=124

 Score =   168 bits (426),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 102/128 (80%), Gaps = 7/128 (5%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A++S+ GVK+V++ RKQ +VTVTGYV+ANKVLK+ KSTG
Sbjct  1    MQTVEIKVKMDCDGCERRVKNAVTSMRGVKSVEVIRKQSRVTVTGYVDANKVLKRVKSTG  60

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDP---YVTIFSDE  365
            K+AE WPY+PYNLV+ PYA QAYDK+AP GYVR V        A  +DP     ++FSD+
Sbjct  61   KRAEFWPYIPYNLVSYPYATQAYDKRAPAGYVRNV----VQAVAVPNDPEDRITSLFSDD  116

Query  364  NPNACSVM  341
            NPNACS+M
Sbjct  117  NPNACSIM  124



>gb|KDP38035.1| hypothetical protein JCGZ_04678 [Jatropha curcas]
Length=150

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ-LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+ +SD +S       KK+K++ +QTV++KV+MDCDGCE +V+ ++S + GVK+V++N
Sbjct  2    GALDSLSDYLSDLFTITSKKRKRKPMQTVDIKVKMDCDGCERRVRNSVSHMKGVKSVEVN  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            RKQ +VTV+GYVE +KVLKK KSTGK+AE WPYVPYNLVA PY AQAYDKKAP GYV+ V
Sbjct  62   RKQSRVTVSGYVEPSKVLKKVKSTGKRAEFWPYVPYNLVAYPYVAQAYDKKAPSGYVKNV  121

Query  430  DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                    A  D+   ++FSDENP+ACS+M
Sbjct  122  VQALPSPNAT-DERLTSLFSDENPHACSIM  150



>ref|XP_002272293.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Vitis vinifera]
 emb|CBI33560.3| unnamed protein product [Vitis vinifera]
Length=146

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 112/152 (74%), Gaps = 10/152 (7%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+Y S+  + +     +K    +QTVE+KV+MDCDGCE +VK A++S+ GVK+V++ R
Sbjct  2    GALDYFSNFCTVTSTKGKRK---PMQTVEIKVKMDCDGCERRVKNAVTSMRGVKSVEVIR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTVTGYV+ANKVLK+ KSTGK+AE WPY+PYNLV+ PYA QAYDK+AP GYVR V 
Sbjct  59   KQSRVTVTGYVDANKVLKRVKSTGKRAEFWPYIPYNLVSYPYATQAYDKRAPAGYVRNV-  117

Query  427  NPTTGTAARFDDP---YVTIFSDENPNACSVM  341
                   A  +DP     ++FSD+NPNACS+M
Sbjct  118  ---VQAVAVPNDPEDRITSLFSDDNPNACSIM  146



>emb|CDP21674.1| unnamed protein product [Coffea canephora]
Length=148

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 109/153 (71%), Gaps = 5/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTLEY++D++SS    K K       TV LKVRMDC+GC  KVKKAL  + G K V
Sbjct  1    MGVAGTLEYLADLISSRTAKKKKIT----NTVALKVRMDCEGCARKVKKALKGVKGAKKV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ KQQK TVTG+V+A KVL+ A++T KK E WPYVPY L+A PYAA  YDKKAPP +V
Sbjct  57   DVDLKQQKATVTGFVDAKKVLEAARATKKKVEPWPYVPYTLIAHPYAAGVYDKKAPPNFV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R+ D P   T    ++ ++ +F+DENPNACS+M
Sbjct  117  RKTDEPGVATLNPVEEQFL-MFNDENPNACSIM  148



>ref|XP_003536626.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN06752.1| hypothetical protein glysoja_021298 [Glycine soja]
Length=146

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD  S S   K +K    +QTVE+KV+MDCDGCE +V+ ++S++SGVK V++NR
Sbjct  2    GALDFLSDYFSVSTPKKKRKP---MQTVEIKVKMDCDGCERRVRNSVSNMSGVKQVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTVTGYV+ NKVLKK +STGK+AE WPY+ YNLVA PY  QAYDKKAP GYV+  +
Sbjct  59   KQSKVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVVQAYDKKAPSGYVKNTE  118

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  D+   ++FSD+NPNACS+M
Sbjct  119  QALPNPNAP-DEKLTSLFSDDNPNACSIM  146



>ref|XP_007153287.1| hypothetical protein PHAVU_003G022700g [Phaseolus vulgaris]
 gb|ESW25281.1| hypothetical protein PHAVU_003G022700g [Phaseolus vulgaris]
Length=147

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 109/151 (72%), Gaps = 7/151 (5%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G  +YISD  S +     K+K   +QTVE+KV+MDCDGCE +V+ ++  + GVK V++NR
Sbjct  2    GVFDYISDFFSVAPTTGKKRKP--MQTVEIKVKMDCDGCERRVRNSVVHMKGVKQVEVNR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTVTGYV+ N+VLKK +STGK+A+ WPY+PYNLVA PY AQAYDKKAP GYV+   
Sbjct  60   KQSKVTVTGYVDRNRVLKKVQSTGKRADFWPYIPYNLVAYPYVAQAYDKKAPSGYVK---  116

Query  427  NPTTGTAA--RFDDPYVTIFSDENPNACSVM  341
            N      A    D+   ++FSDENPNACS+M
Sbjct  117  NSVQALPAPNSLDEKLTSLFSDENPNACSIM  147



>ref|XP_004144847.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004164903.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN43252.1| hypothetical protein Csa_7G012410 [Cucumis sativus]
Length=154

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD    S      KK+KQLQTVELK+R+DC+GCE KVK+AL  + GVK VD++R
Sbjct  2    GVLDHLSDYFDCSSHGHKHKKRKQLQTVELKIRIDCEGCERKVKRALEGMKGVKQVDVDR  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  K TV GYVE +KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR+ 
Sbjct  62   KANKATVVGYVEPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRKA  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            D+P     AR       Y T FSDENP AC+VM
Sbjct  122  DDPNVYQLARASSTEVRYTTAFSDENPAACAVM  154



>ref|XP_002888817.1| hypothetical protein ARALYDRAFT_894936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65076.1| hypothetical protein ARALYDRAFT_894936 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L EYISD    S   + +K    +QTV +KV+MDCDGCE +VK A+SS+ GV++
Sbjct  1    MGALDSLSEYISDYFRVSRNRRKRKV---MQTVNIKVKMDCDGCERRVKNAVSSMKGVRS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK  KVTV+GYVE  KVLK+ + TGKKAEIWPYVPYN+VA PYA   YDKKAP GY
Sbjct  58   VEVNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGY  117

Query  442  VRRVDNPTTGTA-ARFDDPYVTIFSDENPNACSVM  341
            VR+ +           DD +V++FSDENPNAC+VM
Sbjct  118  VRKSEQSQLQLLPGAPDDNFVSLFSDENPNACTVM  152



>ref|XP_009356157.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Pyrus x bretschneideri]
Length=146

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +VK A+S + G K V+++RKQ +V VTGYVE NKVLK+ K TG
Sbjct  23   MQTVEIKVKMDCDGCERRVKNAVSHMKGAKQVEVDRKQSRVKVTGYVEPNKVLKRVKRTG  82

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPYVPYNLVA PY A AYDKKAP GYVR V        A  D+ Y ++FSDENP+
Sbjct  83   KKAEIWPYVPYNLVAYPYVAGAYDKKAPSGYVRNVAQALPPPDAP-DEKYTSMFSDENPH  141

Query  355  ACSVM  341
            ACS+M
Sbjct  142  ACSIM  146



>ref|XP_006422591.1| hypothetical protein CICLE_v10029481mg [Citrus clementina]
 ref|XP_006486737.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR35831.1| hypothetical protein CICLE_v10029481mg [Citrus clementina]
 gb|KDO68073.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis]
 gb|KDO68074.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis]
 gb|KDO68075.1| hypothetical protein CISIN_1g031714mg [Citrus sinensis]
Length=154

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G +++ SD    SHG    KK++QLQTVE+KVR+DC+GCE KVK+A+  + GVK VD+ R
Sbjct  2    GVVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVER  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYVE +KV+ + A  TGKKAEIWPYVPY++VA PYA   YD+KAP GYVRR 
Sbjct  62   KANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRA  121

Query  430  DNPTTGTAAR---FDDPYVTIFSDENPNACSVM  341
            D+P     AR   F+  Y T FSDEN  AC++M
Sbjct  122  DDPQVSQIARASSFEVRYTTAFSDENTQACAIM  154



>ref|XP_010922550.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Elaeis guineensis]
Length=151

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 111/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            G L+YIS+  S ++  +  K KK+  LQTV +KV+MDCDGCE +VK A+ SL GV +V++
Sbjct  2    GALDYISNFFSFTNTRRALKWKKRKPLQTVNIKVKMDCDGCERRVKHAVRSLKGVTSVNV  61

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRK  +VTV+G+VE NKVLKK KSTGK AE WPYVPYNLV  PY   AYDKKAP G+VR 
Sbjct  62   NRKDSRVTVSGHVEPNKVLKKVKSTGKVAEFWPYVPYNLVVYPYVGGAYDKKAPSGFVRN  121

Query  433  VDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V    +   A  ++ Y+++FSDENPNACS+M
Sbjct  122  VPQAQSKPDAT-EEKYMSVFSDENPNACSIM  151



>ref|XP_006577898.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
Length=154

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++IS++   S G    KK+KQLQTVE+KV+MDC+GCE KV+KA+  + GV  VD+ R
Sbjct  2    GALDHISELFDCSSGSSKHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVER  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYVEA+KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR  
Sbjct  62   KANKVTVVGYVEASKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRNT  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            D+P     AR       Y T FSDENP+AC VM
Sbjct  122  DDPHYSHLARASSTEVRYTTAFSDENPSACVVM  154



>gb|AFK36881.1| unknown [Lotus japonicus]
Length=146

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 111/153 (73%), Gaps = 12/153 (8%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G  +++SD  S S   K +K    +QTVE+KV+MDCDGCE +V+ ++S++ GVK V++NR
Sbjct  2    GAFDFLSDYFSVSTPRKKRKP---MQTVEIKVKMDCDGCERRVRNSVSNMKGVKEVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KV+VTGYV+ NKVLKK +STGK+AE WPY+ YNLVA PY AQAYDKKAP GYV+  D
Sbjct  59   KQSKVSVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVAQAYDKKAPSGYVKNTD  118

Query  427  ----NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                NP        D+   T+FSD+NPNACS+M
Sbjct  119  LALPNPNAP-----DEKLTTLFSDDNPNACSIM  146



>gb|EYU43598.1| hypothetical protein MIMGU_mgv1a015689mg [Erythranthe guttata]
Length=149

 Score =   166 bits (421),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GTL+Y++D++SS+   K +    QL TV LKVRMDC+GC  ++K  LS++ G ++V
Sbjct  1    MGVDGTLDYLADLISSTKKKKKR----QLNTVSLKVRMDCEGCGQRIKNVLSNMKGARSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ K QK TV G+V+A KVLK A++TGKK E WPYVPY+L+A PYAA  YDKKAPP  V
Sbjct  57   DVDWKNQKATVYGFVDAKKVLKVAQATGKKVEPWPYVPYDLMAHPYAAGVYDKKAPPNLV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R  D P   T    +  Y  +FSD+NPNACSVM
Sbjct  117  RGTDEPGVATLNPIEQQYTLMFSDDNPNACSVM  149



>ref|XP_008447957.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis melo]
Length=154

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD    S      KK+KQLQTVELK+R+DC+GCE KVK+AL  + GVK VD++R
Sbjct  2    GVLDHLSDYFDCSSHGSKHKKRKQLQTVELKIRIDCEGCERKVKRALEGMKGVKQVDVDR  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  K TV GYVE +KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR+ 
Sbjct  62   KSNKATVVGYVEPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPAGYVRKA  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            D+P     AR       Y T FSDENP AC VM
Sbjct  122  DDPNVYQLARASSTEVRYTTAFSDENPAACVVM  154



>ref|XP_011098106.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=149

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GT++YI+D++SS+   K K    QL TV LKVRMDC+GC  ++K  LS L G K+V
Sbjct  1    MGVEGTIDYIADLISSTKKKKKK----QLNTVSLKVRMDCEGCGQRIKNVLSGLKGAKSV  56

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            D++ K QK TV G+V+A KVLK A++TGKKAE WPYVPY L+A PYA+  YDKKAPP  V
Sbjct  57   DVDWKIQKATVYGFVDAKKVLKAAQATGKKAEPWPYVPYELIAHPYASGVYDKKAPPNLV  116

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R  D P   T    ++ Y  +FSD+NP+ACS+M
Sbjct  117  RGTDEPGVATLNPVEEKYSLMFSDDNPHACSIM  149



>ref|XP_004498327.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=147

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE +V+ +++ + GVK V++NRK+ KV+V+GYV+ N+VLKK +STG
Sbjct  24   MQTVEIKVKMDCDGCERRVRNSVAYMKGVKQVEVNRKESKVSVSGYVDGNRVLKKIQSTG  83

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            K+AE WPY+PYNLVA PY AQAYDKKAPPGYV+          A  D+    +FSDENPN
Sbjct  84   KRAEFWPYIPYNLVAYPYIAQAYDKKAPPGYVKNTMQALPSPNA-MDEKLTNLFSDENPN  142

Query  355  ACSVM  341
            ACS+M
Sbjct  143  ACSIM  147



>ref|XP_010042028.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
Length=148

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+  SDM         KK+K  +QTV++KV+MDC+GCE +V+ A+S   G K+V++NR
Sbjct  2    GVLDRFSDMFDFELSKPRKKRKP-MQTVDIKVKMDCEGCERRVRDAVSPKKGAKSVEVNR  60

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KV+VTGYVE+ KVL K +STGKKAE+WPYVPYNLVA PYA QAYDKKAP GYV+ V 
Sbjct  61   KQSKVSVTGYVESGKVLNKVRSTGKKAELWPYVPYNLVAYPYAPQAYDKKAPSGYVKNVP  120

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  +  + T+FSDENPNACS+M
Sbjct  121  QALPSPNAPGEH-FTTLFSDENPNACSIM  148



>ref|XP_010670695.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Beta vulgaris subsp. vulgaris]
Length=149

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++I D+  ++   +  +K   LQTVE+KV+MDCDGCE +V+ ++  + GVK+VD+NR
Sbjct  2    GMLDHILDLCDTTVVKRKNRKP--LQTVEIKVKMDCDGCERRVRNSVIHIKGVKSVDVNR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTVTG VE N+VL K KSTGK+AE WPYVPYN+V+ PYAAQ YDKKAP GYV+   
Sbjct  60   KQSKVTVTGNVEPNRVLNKVKSTGKRAEFWPYVPYNVVSYPYAAQVYDKKAPSGYVKNAP  119

Query  427  NPTTGTAARFDDPYVTIFSDENPNA-CSVM  341
                 T+    + Y+ +FSDENPNA CS+M
Sbjct  120  QAFATTSDATQEKYIQMFSDENPNASCSIM  149



>ref|XP_006430657.1| hypothetical protein CICLE_v10013659mg [Citrus clementina]
 ref|XP_006482156.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
 gb|ESR43897.1| hypothetical protein CICLE_v10013659mg [Citrus clementina]
 gb|KDO36137.1| hypothetical protein CISIN_1g032155mg [Citrus sinensis]
Length=146

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+Y+S+  + +     +K    +QTVE+KV+MDCDGCE +VK A++S+ GVK+V++NR
Sbjct  2    GALDYLSNFCTVTSTRSKRKA---MQTVEIKVKMDCDGCERRVKNAVNSMKGVKSVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV+GYVE NKVLK+ KSTGK+AE WPY+P +LV  PYA  AYDK+AP GYVR V 
Sbjct  59   KQSRVTVSGYVEPNKVLKRVKSTGKRAEFWPYIPQHLVHYPYAPGAYDKRAPAGYVRNVV  118

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                 T A  +D  V+IFSD+N NACS+M
Sbjct  119  QAFPATNAP-EDNLVSIFSDDNVNACSIM  146



>gb|KDP29662.1| hypothetical protein JCGZ_18824 [Jatropha curcas]
Length=154

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++ S +   SHG    KK+KQLQTVE+KVR+DC+GCE KVK+AL  + GVK VD+ R
Sbjct  2    GALDHFSHIFDCSHGRSKLKKRKQLQTVEIKVRIDCEGCERKVKRALEGMKGVKQVDVER  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYV+ +KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVRR 
Sbjct  62   KANKVTVVGYVDPSKVVARVAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRRA  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            ++P     AR       Y T FSDENP AC++M
Sbjct  122  EDPQVSNLARASSTEVRYTTAFSDENPQACAIM  154



>ref|XP_011046678.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
 ref|XP_011046679.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Populus euphratica]
Length=154

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD    S G    KK++QLQTVE+KVR+DC+GCE KVK+AL  + GVK VD+ R
Sbjct  2    GALDHLSDFFDCSSGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRALEGMKGVKQVDVER  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYV+ +KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR  
Sbjct  62   KANKVTVVGYVDPSKVVARVAHRTGKKAELWPYVPYDMVAHPYAPGVYDKKAPAGYVRNA  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            ++P     AR       Y T FSDENP AC+VM
Sbjct  122  EDPHVSQLARASSTEVRYTTAFSDENPAACAVM  154



>gb|KFK41529.1| hypothetical protein AALP_AA2G141400 [Arabis alpina]
Length=150

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 9/156 (6%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L EYISD    +   + +     +QTV +KV+MDCDGCE +VK A+SS+ GVK+
Sbjct  1    MGALDSLSEYISDYFRVAKKRRKRNV---MQTVNVKVKMDCDGCERRVKNAVSSMRGVKS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK  KVTV+GYVE  KVLK+ + TGKKAEIWPYVPYN+VA PYA  AYDKKAP G+
Sbjct  58   VEVNRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGAYDKKAPTGF  117

Query  442  VRRVD--NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+ +   P  G     DD  +++FSD+NPNAC+VM
Sbjct  118  VRKSEQSQPLPGAP---DDKIMSMFSDDNPNACTVM  150



>ref|XP_010496704.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=199

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = -3

Query  802  RMGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVK  626
            +MG+ GT+EYISD +      K K    Q+QTV L+V R+DC+GCE K+K  LS + GVK
Sbjct  49   KMGVEGTMEYISDFLKQRKRKKKK----QMQTVALRVARIDCEGCERKIKHILSGVKGVK  104

Query  625  TVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            +VD++ K QKVTV GYV+  KVL+ AKST KK E+WPYVPY +VA P+ +QAYDKKAPP 
Sbjct  105  SVDVDMKLQKVTVMGYVDPKKVLEAAKSTKKKVELWPYVPYTMVANPHISQAYDKKAPPN  164

Query  445  YVRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
             VR+V +  +      DD Y  IFSDENPN+C +M
Sbjct  165  MVRKVPDTASVNETTVDDSYTIIFSDENPNSCFIM  199



>ref|XP_010471111.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=170

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 99/129 (77%), Gaps = 7/129 (5%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV +KV+MDCDGCE +VK A+SS+ G K+V++NRK  KVTV+GYVE  KVLK+ + TG
Sbjct  45   MQTVNIKVKMDCDGCERRVKNAVSSMKGAKSVEVNRKIHKVTVSGYVEPKKVLKRVERTG  104

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD----NPTTGTAARFDDPYVTIFSD  368
            KKAEIWPYVPYN+VA PYA   YDKKAP G+VR+ +     P  G     DD +++IFSD
Sbjct  105  KKAEIWPYVPYNMVAYPYAVGTYDKKAPAGFVRKSEQSQLQPLPGAP---DDNFISIFSD  161

Query  367  ENPNACSVM  341
            ENPNAC+VM
Sbjct  162  ENPNACTVM  170



>gb|KHN33671.1| hypothetical protein glysoja_013677 [Glycine soja]
Length=180

 Score =   166 bits (421),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++IS++   S G    KK+KQLQTVE+KV+MDC+GCE KV+KA+  + GV  VD+ R
Sbjct  28   GALDHISELFDCSSGSSKHKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVDVER  87

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYVEA+KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR  
Sbjct  88   KANKVTVVGYVEASKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRNT  147

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            D+P     AR       Y T FSDENP+AC VM
Sbjct  148  DDPHYSHLARASSTEVRYTTAFSDENPSACVVM  180



>ref|XP_009397973.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Musa acuminata subsp. malaccensis]
Length=155

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 109/154 (71%), Gaps = 5/154 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G LE+IS++ S    H   KKK QLQTVE+KVRMDC+GCE KV+KA+  + GV +V+I  
Sbjct  2    GFLEHISEICSFPSSHNKFKKKNQLQTVEIKVRMDCEGCERKVRKAVEGMKGVSSVEIEA  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR-  434
            KQ KVTV GYV+  KV+++ A  TGKKAE WPYVPY++VA PYA  AYDKKAPPGYVR  
Sbjct  62   KQHKVTVVGYVDPKKVIRRVAWKTGKKAEPWPYVPYDVVAHPYAPGAYDKKAPPGYVRNV  121

Query  433  VDNPTTGTAARFDD---PYVTIFSDENPNACSVM  341
            VD+P     AR       Y T FSD+NPN CSVM
Sbjct  122  VDDPAAAPLARASSTEVKYTTAFSDDNPNNCSVM  155



>ref|XP_004150477.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 ref|XP_004161986.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis sativus]
 gb|KGN51508.1| hypothetical protein Csa_5G571510 [Cucumis sativus]
Length=148

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -3

Query  712  QTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGK  533
            QTVE+KV+MDCDGCE ++K A+SS+ GVK+V ++RKQ KVTV GY EA KVLKK +STGK
Sbjct  26   QTVEIKVKMDCDGCERRIKNAVSSVKGVKSVKVDRKQSKVTVNGYAEATKVLKKVESTGK  85

Query  532  KAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPNA  353
            KAE+WPYVPYN VA PY  QAYDKKAPPGYV++         A  D     +FSDENPNA
Sbjct  86   KAELWPYVPYNSVAYPYVPQAYDKKAPPGYVKKAPQALPVDEA-LDQRLTMMFSDENPNA  144

Query  352  CSVM  341
            CS+M
Sbjct  145  CSIM  148



>ref|XP_002534419.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF27963.1| metal ion binding protein, putative [Ricinus communis]
Length=154

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++ S +   SHG    KK+KQLQTVE+KVR+DC+GCE KVK+A+  + GVK VD++R
Sbjct  2    GALDHFSHLFDCSHGSSKHKKRKQLQTVEIKVRIDCEGCERKVKRAVEGMKGVKQVDVDR  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  K+TV GYV+ +KV+ + A  TGK+AE+WPYVPY++VA PYA   YDKKAP GYVRR 
Sbjct  62   KSNKLTVVGYVDPSKVVARVAHRTGKRAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRRA  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            ++P     AR       Y T FSDENP ACS+M
Sbjct  122  EDPQVSQLARASSTEVRYTTAFSDENPQACSIM  154



>ref|XP_008467147.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cucumis melo]
Length=148

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -3

Query  712  QTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGK  533
            QTVE+KV+MDCDGCE ++K A+SS+ GVK+V ++RKQ KVTV GY EA KVLKK +STGK
Sbjct  26   QTVEIKVKMDCDGCERRIKNAVSSVKGVKSVKVDRKQSKVTVNGYAEATKVLKKVESTGK  85

Query  532  KAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPNA  353
            KAE+WPYVPYN VA PY  QAYDKKAPPGYV++         A  D     +FSDENPNA
Sbjct  86   KAELWPYVPYNSVAYPYVPQAYDKKAPPGYVKKAPQALPVDEA-LDQRLTMMFSDENPNA  144

Query  352  CSVM  341
            CS+M
Sbjct  145  CSIM  148



>ref|XP_009783112.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=142

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 10/150 (7%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L Y+S+    +    ++K    +QTVE+KV+MDCDGCE KVK A++S+ GVKTV++NR
Sbjct  2    GALHYLSNCCIVTSTRTNRK---PMQTVEIKVKMDCDGCERKVKNAVNSMKGVKTVEVNR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV+GY++ NKVLK  KSTGK A  WPYVPY+LV+ PY AQAYDKKAPPG+V+ V 
Sbjct  59   KQNRVTVSGYIDPNKVLKSVKSTGKMAIFWPYVPYDLVSYPYVAQAYDKKAPPGFVKNV-  117

Query  427  NPTTGTAARFDDPYVT-IFSDENPNACSVM  341
                   A  D+  +T +FSD+NPNACS+M
Sbjct  118  -----RQANADEHTITYLFSDDNPNACSIM  142



>ref|XP_006466995.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Citrus sinensis]
Length=158

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 116/157 (74%), Gaps = 8/157 (5%)
 Frame = -3

Query  787  GTLEYIS---DMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            G LEY+S   D  S  H H+  KK+KQLQTVE+K++MDC+GCE +VKK++  + GV  V+
Sbjct  2    GFLEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQVE  61

Query  616  INRKQQKVTVTGYVEANKVLKKAKS-TGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            ++ KQ K+TV GYV+ +KVL++ +  TGKKAE WPYVPY++V +PYA +AYDKKAPPGYV
Sbjct  62   VDPKQSKLTVIGYVDPDKVLERVRHRTGKKAEFWPYVPYDVVPRPYAPEAYDKKAPPGYV  121

Query  439  RRV-DNPTTGTAAR---FDDPYVTIFSDENPNACSVM  341
            R V DNP     AR   F+  Y T FSDENPNAC+VM
Sbjct  122  RNVLDNPVAAPLARASSFEVKYTTAFSDENPNACAVM  158



>ref|NP_177261.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG51694.1|AC016972_13 putative isoprenylated protein; 28702-28078 [Arabidopsis thaliana]
 gb|AAM65427.1| putative isoprenylated protein [Arabidopsis thaliana]
 dbj|BAC42520.1| putative isoprenylated protein [Arabidopsis thaliana]
 gb|AAO39894.1| At1g71050 [Arabidopsis thaliana]
 gb|AEE35156.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=152

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L EYISD    +   + +K    +QTV +KV+MDCDGCE +VK A+SS+ GVK+
Sbjct  1    MGALDSLSEYISDYFRVTRKRRKRKV---MQTVNIKVKMDCDGCERRVKNAVSSMKGVKS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK  KVTV+GYVE  KVLK+ + TGKKAEIWPYVPYN+VA PYA   YDKKAP GY
Sbjct  58   VEVNRKIHKVTVSGYVEPKKVLKRIERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPAGY  117

Query  442  VRRVDNPTTGTA-ARFDDPYVTIFSDENPNACSVM  341
            VR+ +           ++ Y+++FSDENPNAC+VM
Sbjct  118  VRKSEQSQLQLLPGAPENHYISLFSDENPNACTVM  152



>ref|XP_010427920.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=152

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 111/158 (70%), Gaps = 11/158 (7%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L +YISD    S   + +K    +QTV +KV+MDCDGCE +VK A+SS+ G K 
Sbjct  1    MGALDSLSDYISDYFQVSKRRRKRKV---MQTVNIKVKMDCDGCERRVKNAVSSMKGAKA  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK  KVTV+GYVE  KVLK+ + TGKKAEIWPYVPYN+VA PYA   YDKKAP G+
Sbjct  58   VEVNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNVVAYPYAVGTYDKKAPAGF  117

Query  442  VRRVD----NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+ +     P  G     DD +++IFSDENPNAC+VM
Sbjct  118  VRKSEQSQLQPLPGAP---DDNFISIFSDENPNACTVM  152



>gb|EMT25393.1| hypothetical protein F775_27945 [Aegilops tauschii]
Length=148

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 115/152 (76%), Gaps = 5/152 (3%)
 Frame = -3

Query  793  LGGTLEYISD-MMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            +GGTL ++SD ++ SS   +H KK++Q  TVELKV+MDCDGCELK++  L+++ G ++V+
Sbjct  1    MGGTLRFLSDVLLGSSSQRQHSKKRRQFNTVELKVKMDCDGCELKIRNTLANMRGAQSVE  60

Query  616  INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            INRKQ KVTV G+VE  +VL++ +STGK+AE+WPYVPY     PY A  YDK+AP G+VR
Sbjct  61   INRKQHKVTVKGFVEPQRVLRRVQSTGKRAELWPYVPY---TNPYMAPVYDKRAPAGHVR  117

Query  436  RVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            +V+     +A + ++   TIFSD+NPNACSVM
Sbjct  118  KVEGVMPVSAGQ-EERLATIFSDDNPNACSVM  148



>ref|XP_011070641.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=147

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++ISD+ + +   K K+K   +QTVE+KV+MDC+GCE +V+ A+SS+ GVK+VD++R
Sbjct  2    GFLDHISDVCAVTSTRKSKRKP--MQTVEIKVKMDCEGCERRVRNAVSSMKGVKSVDVSR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV+GYVE NKVL + KSTGKKAEIWPYV YNL   PYA QAYDKKAP G+VR V 
Sbjct  60   KQSRVTVSGYVEPNKVLNRVKSTGKKAEIWPYVQYNLAYYPYAPQAYDKKAPSGFVRNVA  119

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  +  Y T+FSD+N NACS+M
Sbjct  120  QAFPSPNAPVEK-YTTLFSDDNVNACSIM  147



>ref|XP_010415801.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=169

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 112/153 (73%), Gaps = 7/153 (5%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+ +SD +S       ++K+K +QTV +KV+MDCDGCE +VK A+SS+ G K+V++NR
Sbjct  20   GALDSLSDYISDYFQVTRRRKRKVMQTVNIKVKMDCDGCERRVKNAVSSMKGAKSVEVNR  79

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            K  KVTV+GYVE  KVLK+ + TGKKAEIWPYVPYN+VA PYA   YDKKAP G+VR+ +
Sbjct  80   KIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNMVAYPYAVGTYDKKAPVGFVRKSE  139

Query  427  ----NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                 P  G     D+ +++I+SDENPNAC+VM
Sbjct  140  QSQLQPLPGAP---DENFISIYSDENPNACTVM  169



>ref|XP_004512304.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=145

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 110/153 (72%), Gaps = 13/153 (8%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD  S +   K K     +QTVE+KV+MDCDGCE +V+ +++++ GVK VD+NR
Sbjct  2    GALDFLSDYFSVTPKKKRK----PMQTVEIKVKMDCDGCERRVRNSVTNMKGVKEVDVNR  57

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            +Q KVTVTGYVEANKVLKK +STGK+A+ WPYV YNLVA PY AQAY KKAP G+V+  +
Sbjct  58   EQSKVTVTGYVEANKVLKKVQSTGKRAKFWPYVEYNLVAYPYIAQAYAKKAPSGFVKNTE  117

Query  427  ----NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                NP        DD   + FSD+NPNACS+M
Sbjct  118  LALPNPNG-----HDDKITSFFSDDNPNACSIM  145



>ref|XP_006302959.1| hypothetical protein CARUB_v10021096mg [Capsella rubella]
 gb|EOA35857.1| hypothetical protein CARUB_v10021096mg [Capsella rubella]
Length=152

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (78%), Gaps = 7/129 (5%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV +KV+MDCDGCE +VK A+SS+ GVK+V++NRK  KVTV+GYVE  KVLK+ + TG
Sbjct  27   MQTVNIKVKMDCDGCERRVKNAVSSMKGVKSVEMNRKINKVTVSGYVEPKKVLKRVEGTG  86

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD----NPTTGTAARFDDPYVTIFSD  368
            KKAEIWPYVPYN+VA PYA   YDKKAP G+VR+ +     P  G     DD ++++FSD
Sbjct  87   KKAEIWPYVPYNVVAYPYAVGTYDKKAPAGFVRKSEQSQLQPLPGAP---DDNFISLFSD  143

Query  367  ENPNACSVM  341
            ENPNAC+VM
Sbjct  144  ENPNACTVM  152



>ref|XP_006390811.1| hypothetical protein EUTSA_v10019290mg [Eutrema salsugineum]
 gb|ESQ28097.1| hypothetical protein EUTSA_v10019290mg [Eutrema salsugineum]
Length=150

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 9/156 (6%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG+  +L +YISD    S   + +K    +QTV +KV+MDCDGCE +VK A+SS+ GVK+
Sbjct  1    MGVLDSLCDYISDYFHVSRKRRKRKV---MQTVNIKVKMDCDGCERRVKNAVSSMKGVKS  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK  KVTV+GYVE  KVLK+ + TGKKAEIWPYVPYN+VA PYA   YDKKAP G+
Sbjct  58   VEMNRKIHKVTVSGYVEPKKVLKRVERTGKKAEIWPYVPYNVVAYPYAVGVYDKKAPAGF  117

Query  442  VRRVD--NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+ +   P  G     DD  +++FSDENPNAC+VM
Sbjct  118  VRKSEQSQPFPGAP---DDKIMSLFSDENPNACTVM  150



>ref|XP_010421776.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=150

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 107/154 (69%), Gaps = 5/154 (3%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKV-RMDCDGCELKVKKALSSLSGVKT  623
            MG+ GT+EYISD +      K K    Q+QTV L+V R+DC+GCE K+K  LS + GVK+
Sbjct  1    MGVEGTMEYISDFLKQRKRKKKK----QMQTVALRVARIDCEGCERKIKHILSGVKGVKS  56

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            VD++ K QKVTV GYV+  KVL+ AKST KK E+WPYVPY +VA PY +QAYDKKAPP  
Sbjct  57   VDVDMKLQKVTVMGYVDPKKVLEAAKSTKKKVELWPYVPYTMVANPYISQAYDKKAPPNM  116

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
             R+V +  +      DD Y  +FSDENPN+C +M
Sbjct  117  ARKVPDTASVNETTVDDSYTIMFSDENPNSCFIM  150



>ref|XP_009403879.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=151

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            G  +++SD  S +   +  + +K+  LQTV+LKV+MDCDGCE +VK A+SS+ GV  V++
Sbjct  2    GAFDHLSDFCSVTETRRALQIRKRKPLQTVDLKVKMDCDGCERRVKHAVSSIRGVTNVNV  61

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRR  434
            NRKQ +VTVTG++EA +V++K KSTGK+AE WPYVPY+LVA PY A AYDKKAP G+VR 
Sbjct  62   NRKQSRVTVTGHIEAKEVVRKIKSTGKRAEAWPYVPYSLVAYPYVAGAYDKKAPAGFVRN  121

Query  433  VDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            V       +A  ++   ++FSDENPNAC+VM
Sbjct  122  VAQAVASPSAP-EEKISSLFSDENPNACTVM  151



>gb|KDO37877.1| hypothetical protein CISIN_1g039645mg [Citrus sinensis]
Length=188

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 8/159 (5%)
 Frame = -3

Query  793  LGGTLEYIS---DMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            + G LEY+S   D  S  H H+  KK+KQLQTVE+K++MDC+GCE +VKK++  + GV  
Sbjct  30   IMGFLEYVSELCDFESRWHSHRKLKKRKQLQTVEIKIKMDCEGCERRVKKSVEGMKGVTQ  89

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKS-TGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPG  446
            V+++ KQ K+TV GYV+ +KVL++ +  TGKKAE WPYVPY++V +PYA +AYDKKAPPG
Sbjct  90   VEVDPKQSKLTVIGYVDPDKVLERVRHRTGKKAEFWPYVPYDVVPRPYAPEAYDKKAPPG  149

Query  445  YVRRV-DNPTTGTAAR---FDDPYVTIFSDENPNACSVM  341
            YVR V DNP     AR   F+  Y T FSDENPNAC+VM
Sbjct  150  YVRNVLDNPVAAPLARASSFEVKYTTAFSDENPNACAVM  188



>ref|NP_001061762.1| Os08g0403300 [Oryza sativa Japonica Group]
 dbj|BAC98695.1| putative farnesylated protein [Oryza sativa Japonica Group]
 dbj|BAC99355.1| putative farnesylated protein [Oryza sativa Japonica Group]
 dbj|BAF23676.1| Os08g0403300 [Oryza sativa Japonica Group]
 gb|EAZ06927.1| hypothetical protein OsI_29168 [Oryza sativa Indica Group]
 gb|EAZ42667.1| hypothetical protein OsJ_27234 [Oryza sativa Japonica Group]
Length=150

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = -3

Query  793  LGGTLEYISDMMssshg-hkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            +GGTL Y+SD++          KKK+Q  TVELKVRMDCDGCELKV+  L+++ GV++V+
Sbjct  1    MGGTLHYLSDLLLGGSSGKTSHKKKRQFNTVELKVRMDCDGCELKVRNTLANMKGVQSVE  60

Query  616  INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAA--QAYDKKAPPGY  443
            INRKQQKVTV G V+  +VL++A+STGK+ E+WPYVPY     PY A   AYDKKAP G+
Sbjct  61   INRKQQKVTVQGMVDTQRVLRRAQSTGKRTELWPYVPY---TNPYVAPPAAYDKKAPNGH  117

Query  442  VRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            +RRVD     T ++ ++   T+FSD+NPNAC+VM
Sbjct  118  IRRVDAVLPVTPSQ-EERLATLFSDDNPNACAVM  150



>ref|XP_004237014.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum lycopersicum]
Length=147

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 109/153 (71%), Gaps = 11/153 (7%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G +++ISDM   +   K K+K   +QTVE+KV+MDCDGCE KV  A+SS+ GVK+VD++R
Sbjct  2    GIIDHISDMFEVTSTRKSKRKP--MQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV-  431
            KQ KVTV+GY+E  KVLK+ ++TGKKAE WPYV YNLV+ PYA  AYDKKAP GYVR V 
Sbjct  60   KQSKVTVSGYIEPKKVLKRVQNTGKKAEFWPYVEYNLVSYPYAIGAYDKKAPSGYVRDVP  119

Query  430  ---DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                 P T T         ++FSDENPNAC +M
Sbjct  120  QAFQTPNTPTQR-----LTSMFSDENPNACQIM  147



>ref|XP_006360417.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Solanum tuberosum]
Length=147

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 109/153 (71%), Gaps = 11/153 (7%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G +++ISDM   +   K K+K   +QTVE+KV+MDCDGCE KV  A+SS+ GVK+VD++R
Sbjct  2    GIIDHISDMFEITSTRKSKRKP--MQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV-  431
            KQ KVTV+GY+E  KVLK+ ++TGKKAE WPYV YNLV+ PYA  AYDKKAP GYVR V 
Sbjct  60   KQSKVTVSGYIEPKKVLKRVQNTGKKAEFWPYVEYNLVSYPYAIGAYDKKAPSGYVRDVP  119

Query  430  ---DNPTTGTAARFDDPYVTIFSDENPNACSVM  341
                 P T T         ++FSDENPNAC +M
Sbjct  120  QAFQTPNTPTQR-----LTSMFSDENPNACQIM  147



>ref|XP_002513871.1| metal ion binding protein, putative [Ricinus communis]
 gb|EEF48454.1| metal ion binding protein, putative [Ricinus communis]
Length=139

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 106/153 (69%), Gaps = 14/153 (9%)
 Frame = -3

Query  799  MGLGGTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTV  620
            MG+ GT+EY+SD++SS    K KK   Q+QTV LK+RMDC+GC           +  K+V
Sbjct  1    MGVAGTVEYLSDLLSSVKKRKKKK---QIQTVALKIRMDCEGC-----------ARAKSV  46

Query  619  DINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYV  440
            DI+ KQQK TVTGYVE  KVLK A+ST KK E+WPYVPY LVA PY +QAYDKKAP  +V
Sbjct  47   DIDLKQQKATVTGYVEPKKVLKAAQSTKKKVEMWPYVPYTLVANPYVSQAYDKKAPANHV  106

Query  439  RRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            R V    T T +  DD Y  +FSDENPNACS+M
Sbjct  107  RAVPVTATITESTVDDRYTNMFSDENPNACSIM  139



>gb|ADE76654.1| unknown [Picea sitchensis]
Length=146

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            + QTVE+KVRMDC+GCE KVKK++SS+ GV++VD+NRK+QK+TVTGYV+ NKV+ K K T
Sbjct  21   KFQTVEMKVRMDCEGCERKVKKSVSSMKGVESVDVNRKEQKLTVTGYVDVNKVVNKVKGT  80

Query  538  GKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENP  359
            GK+AE+WPYVPYNLV  PY+AQ+YDKKAP GYVR V++       R D+ Y T+FS++N 
Sbjct  81   GKRAELWPYVPYNLVYHPYSAQSYDKKAPSGYVRNVESTFLSPPNRTDERYTTLFSEDNA  140

Query  358  NACSVM  341
            N+C++M
Sbjct  141  NSCTIM  146



>ref|XP_002890547.1| hypothetical protein ARALYDRAFT_472550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66806.1| hypothetical protein ARALYDRAFT_472550 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   164 bits (414),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 101/126 (80%), Gaps = 2/126 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV +KV++DCDGCE K+K A+SS+ G K+V++NRK  KVTV+GYV+  KVLK+ +STG
Sbjct  28   MQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEVNRKMHKVTVSGYVDPKKVLKRVQSTG  87

Query  535  -KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENP  359
             KKAE+WPYVPY +VA PYAA AYDKKAPPG+VR+ ++      +  DD  +++FSDENP
Sbjct  88   KKKAELWPYVPYTMVAYPYAAGAYDKKAPPGFVRKSEHAQAQPGST-DDKLMSLFSDENP  146

Query  358  NACSVM  341
            NAC+VM
Sbjct  147  NACTVM  152



>ref|XP_009105774.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Brassica rapa]
 emb|CDX96299.1| BnaA07g29100D [Brassica napus]
 emb|CDX72773.1| BnaC06g32210D [Brassica napus]
Length=150

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 111/156 (71%), Gaps = 9/156 (6%)
 Frame = -3

Query  799  MGLGGTL-EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            MG   +L EYISD    S   + +K     QTV +KV+MDCDGCE +VK A+SS+ GV+T
Sbjct  1    MGALDSLSEYISDYFHVSRKRRKRK---VKQTVNIKVKMDCDGCERRVKNAVSSMKGVET  57

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGY  443
            V++NRK  KVTV+GYVE  KVLK+ + TGKKAE+WPYVPYN+VA PYA   YDKKAP GY
Sbjct  58   VELNRKIHKVTVSGYVEPKKVLKRVERTGKKAEMWPYVPYNVVAYPYAVGVYDKKAPAGY  117

Query  442  VRRVD--NPTTGTAARFDDPYVTIFSDENPNACSVM  341
            VR+ +   P  G     DD  +++FSDENPNAC+VM
Sbjct  118  VRKSEQSQPLPGAP---DDVIMSLFSDENPNACTVM  150



>ref|XP_006416133.1| hypothetical protein EUTSA_v10008952mg [Eutrema salsugineum]
 gb|ESQ34486.1| hypothetical protein EUTSA_v10008952mg [Eutrema salsugineum]
Length=164

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            G L+++SD +S       +K+KK   +QTV +KV++DCDGCE K+K A+SS+ G K+V++
Sbjct  14   GALDFLSDYLSDHFYVSIRKRKKHKVMQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEV  73

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTG-KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            NRK  KVTV+GYV+  KVLK+ +STG KKAE+WPYVPY +VA PYAA AYDK+APPG+VR
Sbjct  74   NRKMNKVTVSGYVDPKKVLKRVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFVR  133

Query  436  RVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            + +          DD  +++FSDENPNAC+VM
Sbjct  134  KSEQAQAQPGGT-DDKLMSLFSDENPNACTVM  164



>ref|XP_009622066.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 isoform X1 [Nicotiana tomentosiformis]
Length=148

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE KV+ A+SS+ GVK+V+INRK  +VTVTGYVE +KVLKK + TG
Sbjct  25   MQTVEIKVKMDCDGCERKVRNAVSSIKGVKSVEINRKDSRVTVTGYVEKSKVLKKVQKTG  84

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPY+ YNLV+ PYA   YDKKAP GYV ++D           + + ++FSDENPN
Sbjct  85   KKAEIWPYIKYNLVSNPYAVGVYDKKAPSGYV-KIDPQALQIPNTPSEIFTSMFSDENPN  143

Query  355  ACSVM  341
            ACS+M
Sbjct  144  ACSIM  148



>ref|XP_010265998.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nelumbo nucifera]
Length=155

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = -3

Query  787  GTLEYISDMMs-sshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDIN  611
            G L+++SD+   +S   K  K +KQLQTVE+KV+MDC+GCE KVKKA+  + GV  V++ 
Sbjct  2    GALDHLSDLFYCTSRSKKKFKNRKQLQTVEIKVKMDCEGCERKVKKAVEGMKGVTQVEVE  61

Query  610  RKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
             KQ KVTV GYVE  KVLK+ ++TGKKAE WPYVPY++V  PYA  AYDKKAPPGYVR V
Sbjct  62   PKQSKVTVIGYVEPKKVLKRIQATGKKAEFWPYVPYDVVPHPYAPGAYDKKAPPGYVRNV  121

Query  430  -DNPTTGTAAR---FDDPYVTIFSDENPNACSVM  341
              +P     AR    ++ Y + FSD+NPN+C+VM
Sbjct  122  LQDPVASKLARASTMEERYSSAFSDDNPNSCAVM  155



>ref|XP_009610148.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana tomentosiformis]
Length=148

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 108/154 (70%), Gaps = 12/154 (8%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G +++ISDM   +   K K+K   +QTVE+KV+MDCDGCE KV  A+SS+ GVK+VD++R
Sbjct  2    GIIDHISDMFEVASTRKSKRKP--MQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV G VE NKVLKK ++TGKKAE WPYV YNLV+ PYA   YDKKAP GYVR V 
Sbjct  60   KQSRVTVIGNVEPNKVLKKVQNTGKKAEFWPYVEYNLVSYPYAPGVYDKKAPSGYVRDVP  119

Query  427  N-----PTTGTAARFDDPYVTIFSDENPNACSVM  341
                  P T T         ++FSDENPNACS+M
Sbjct  120  QAFQIVPNTPTHT-----LTSMFSDENPNACSIM  148



>ref|XP_003574446.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Brachypodium distachyon]
Length=152

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 112/155 (72%), Gaps = 7/155 (5%)
 Frame = -3

Query  793  LGGTLEYISDMMssshghk---hkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKT  623
            +GGTL ++SD++    G       KK++Q  TVELKVRMDCDGCE KV+ AL+++ GV+T
Sbjct  1    MGGTLRFLSDVLLGLGGGTGEGRHKKRRQFYTVELKVRMDCDGCERKVRNALATMRGVQT  60

Query  622  VDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAA-QAYDKKAPPG  446
            V+INRKQQKVTV G+VE  +VL++A STGK+AE+WPYVPY     PY A   YDK+AP G
Sbjct  61   VEINRKQQKVTVQGFVEPQRVLRRALSTGKRAELWPYVPYT---NPYMAPPVYDKRAPAG  117

Query  445  YVRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            +VR+ D      +A  ++   T+FSD+NPNACS+M
Sbjct  118  HVRKTDAAVMPASAAQEERLATLFSDDNPNACSLM  152



>ref|XP_007143033.1| hypothetical protein PHAVU_007G037900g [Phaseolus vulgaris]
 gb|ESW15027.1| hypothetical protein PHAVU_007G037900g [Phaseolus vulgaris]
Length=146

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 110/149 (74%), Gaps = 4/149 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++SD  S S   K +K    +QTVE+ V+MDCDGCE +V+ ++S++SGVK V+++R
Sbjct  2    GALDFLSDYFSVSTPKKKRKP---MQTVEIMVKMDCDGCERRVRNSVSNISGVKEVEVSR  58

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ KVTVTGYV+ NKVLKK +STGK+AE WPY+ YNLVA PY AQAYDKKAP GYV+  +
Sbjct  59   KQSKVTVTGYVDRNKVLKKVQSTGKRAEFWPYIQYNLVAYPYVAQAYDKKAPSGYVKNTE  118

Query  427  NPTTGTAARFDDPYVTIFSDENPNACSVM  341
                   A  D+   ++FSD+NPNAC +M
Sbjct  119  QALPNPNAP-DEKLTSLFSDDNPNACLIM  146



>gb|EMS48252.1| hypothetical protein TRIUR3_33177 [Triticum urartu]
Length=148

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 114/152 (75%), Gaps = 5/152 (3%)
 Frame = -3

Query  793  LGGTLEYISD-MMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVD  617
            +GGTL ++SD ++ SS   +H KK++Q  TVELKV+MDCDGCELK++  L+++ G ++V+
Sbjct  1    MGGTLRFLSDVLLGSSSQRRHSKKRRQFNTVELKVKMDCDGCELKIRNTLANMKGAQSVE  60

Query  616  INRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            INRKQ KVTV G+VE  +VL++ +STGK+AE+WPYVPY     PY    YDK+AP G+VR
Sbjct  61   INRKQHKVTVKGFVEPQRVLRRVQSTGKRAELWPYVPY---TNPYMPPVYDKRAPAGHVR  117

Query  436  RVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            +V+     +A + ++   T+FSD+NPNACSVM
Sbjct  118  KVEGAMPVSAGQ-EERLATLFSDDNPNACSVM  148



>ref|XP_009775115.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=148

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE KV+ A+SS+ GVK+V+INRK  +VTV+GYVE +KVLKK + TG
Sbjct  25   MQTVEIKVKMDCDGCERKVRNAVSSMKGVKSVEINRKDSRVTVSGYVEKSKVLKKVEKTG  84

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAEIWPYV YNLV+ PYA   YDKKAP GYV ++D           + + ++FSDENPN
Sbjct  85   KKAEIWPYVKYNLVSNPYAVGVYDKKAPSGYV-KIDPQVLQIPNTPSEIFTSMFSDENPN  143

Query  355  ACSVM  341
            ACS+M
Sbjct  144  ACSIM  148



>ref|NP_001147129.1| metal ion binding protein [Zea mays]
 gb|ACG25583.1| metal ion binding protein [Zea mays]
Length=144

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            Q  TVELKVRMDCDGCELKV+  L+ + GV++V+INRKQQKVTV G+VEA +VL++A+ST
Sbjct  22   QFHTVELKVRMDCDGCELKVRNTLARMRGVESVEINRKQQKVTVKGFVEAQRVLRRAQST  81

Query  538  GKKAEIWPYVPY-NLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDEN  362
            GK+ E+WPYVPY NL   P     YDK+APPG+VRRVD      AA  ++   T+FSD+N
Sbjct  82   GKRVELWPYVPYTNLYVAP---PVYDKRAPPGHVRRVD-ALIAPAAGQEEHLATLFSDDN  137

Query  361  PNACSVM  341
            PNACS+M
Sbjct  138  PNACSLM  144



>ref|XP_002306185.1| GMFP7 family protein [Populus trichocarpa]
 gb|EEE86696.1| GMFP7 family protein [Populus trichocarpa]
Length=154

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L+++S     S G    KK++QLQTVE+KVR+DC+GCE KVK+AL  + GVK VD+ R
Sbjct  2    GALDHLSGFFDCSSGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRALEGMKGVKQVDVER  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYV+ +KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR  
Sbjct  62   KANKVTVVGYVDPSKVVARVAHRTGKKAELWPYVPYDMVAHPYAPGVYDKKAPAGYVRNA  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            ++P     AR       Y T FSDENP AC++M
Sbjct  122  EDPQVSQLARASSTEVRYTTAFSDENPAACAIM  154



>ref|XP_010477581.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Camelina sativa]
Length=152

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV +KV+MDCDGCE K+K A+SS+ G K+V++NRK  KVTV+GYV+  KVLK  +STG
Sbjct  28   MQTVNIKVKMDCDGCERKIKNAVSSMKGAKSVEVNRKMHKVTVSGYVDPKKVLKTVQSTG  87

Query  535  -KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENP  359
             KKAE+WPYVPY +VA PYAA AYDK+APPG+VR+ +          DD  +++FSDENP
Sbjct  88   KKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFVRKSEQAQAQPGGT-DDKLMSLFSDENP  146

Query  358  NACSVM  341
            NAC+VM
Sbjct  147  NACTVM  152



>tpg|DAA49093.1| TPA: hypothetical protein ZEAMMB73_689973 [Zea mays]
Length=144

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 5/127 (4%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            Q  TVELK+RMDCDGCELKV+  L+ + GV++V+INRKQQKVTV G+VEA +VL++A+ST
Sbjct  22   QFHTVELKIRMDCDGCELKVRNTLARMRGVESVEINRKQQKVTVKGFVEAQRVLRRAQST  81

Query  538  GKKAEIWPYVPY-NLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDEN  362
            GK+ E+WPYVPY NL   P     YDK+APPG+VRRVD      AA  ++   T+FSD+N
Sbjct  82   GKRVELWPYVPYTNLYVAP---PVYDKRAPPGHVRRVD-ALIAPAAGQEEHLATLFSDDN  137

Query  361  PNACSVM  341
            PNACS+M
Sbjct  138  PNACSLM  144



>ref|XP_009115570.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Brassica rapa]
 gb|AAN23108.2| putative farnesylated protein [Brassica rapa subsp. pekinensis]
Length=152

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 99/126 (79%), Gaps = 2/126 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV +KV++DCDGCE K+K A+SS+ G K+V++NRK  KVTV+GYV+  KVLKK +STG
Sbjct  28   MQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEVNRKMHKVTVSGYVDPKKVLKKVQSTG  87

Query  535  -KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENP  359
             KKAE+WPYVPY +VA PYAA AYDK+APPG+VR+ +          DD  +++FSDENP
Sbjct  88   KKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFVRKSEQAQAQPGGT-DDKLMSLFSDENP  146

Query  358  NACSVM  341
            NAC++M
Sbjct  147  NACTIM  152



>ref|XP_007137345.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris]
 gb|AGV54330.1| metal ion binding protein [Phaseolus vulgaris]
 gb|ESW09339.1| hypothetical protein PHAVU_009G119300g [Phaseolus vulgaris]
Length=154

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G L++IS++   SHG    KK+KQLQTVE+KV+MDC+GCE KV+KA+  + GV  V+++R
Sbjct  2    GALDHISELFDCSHGSSKLKKRKQLQTVEVKVKMDCEGCERKVRKAVEGMKGVNQVEVDR  61

Query  607  KQQKVTVTGYVEANKVLKK-AKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRV  431
            K  KVTV GYV+ +KV+ + A  TGKKAE+WPYVPY++VA PYA   YDKKAP GYVR  
Sbjct  62   KANKVTVVGYVDPSKVVARIAHRTGKKAELWPYVPYDVVAHPYAPGVYDKKAPSGYVRNT  121

Query  430  DNPTTGTAARFDDP---YVTIFSDENPNACSVM  341
            D+P     AR       Y T FSDENP AC+VM
Sbjct  122  DDPHYSHLARASSTEVRYTTAFSDENPTACAVM  154



>gb|KDO64717.1| hypothetical protein CISIN_1g032170mg [Citrus sinensis]
Length=115

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 91/116 (78%), Gaps = 1/116 (1%)
 Frame = -3

Query  688  MDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYV  509
            MDCDGCE KV+ A+SS+ G K+V++NRKQ +VTVTGYV+ NKVLKK KSTGK+AE WPYV
Sbjct  1    MDCDGCERKVRNAVSSIRGAKSVEVNRKQSRVTVTGYVDPNKVLKKVKSTGKRAEFWPYV  60

Query  508  PYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            PYNLVA PY AQAYDKKAP GYV+ V        A  D+   T+FSDENPNACS+M
Sbjct  61   PYNLVAYPYVAQAYDKKAPSGYVKNVVQALPSPNAT-DERLTTLFSDENPNACSIM  115



>ref|XP_002444313.1| hypothetical protein SORBIDRAFT_07g020020 [Sorghum bicolor]
 gb|EES13808.1| hypothetical protein SORBIDRAFT_07g020020 [Sorghum bicolor]
Length=145

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 98/127 (77%), Gaps = 4/127 (3%)
 Frame = -3

Query  718  QLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKST  539
            Q  TVELKVRMDCDGCELKV+  L+ + GV++V+INRKQQKVTV G+VEA +VL++A+ST
Sbjct  22   QFHTVELKVRMDCDGCELKVRNTLARMRGVESVEINRKQQKVTVKGFVEAQRVLRRAQST  81

Query  538  GKKAEIWPYVPY-NLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDEN  362
            GK+ E+WPYVPY NL   P     YDK+APPG++RRVD      AA  ++   T+FSD+N
Sbjct  82   GKRVELWPYVPYTNLYVAP--PPVYDKRAPPGHIRRVD-ALIAPAAGQEEHLATLFSDDN  138

Query  361  PNACSVM  341
            PNACS+M
Sbjct  139  PNACSLM  145



>ref|XP_006305742.1| hypothetical protein CARUB_v10010550mg [Capsella rubella]
 gb|EOA38640.1| hypothetical protein CARUB_v10010550mg [Capsella rubella]
Length=152

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 99/126 (79%), Gaps = 2/126 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTV +KV++DCDGCE K+K A+SS+ G K+V++NRK  KVTV+GYV+  KVLK+ +STG
Sbjct  28   MQTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEVNRKIHKVTVSGYVDPKKVLKRVQSTG  87

Query  535  -KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENP  359
             KKAE+WPYVPY +VA PYAA AYDKKAPPG+VR+ +          DD  +++FSDENP
Sbjct  88   KKKAELWPYVPYTMVAYPYAAGAYDKKAPPGFVRKSEQAQAQPGGT-DDKLMSLFSDENP  146

Query  358  NACSVM  341
            NAC+VM
Sbjct  147  NACTVM  152



>emb|CDY04750.1| BnaC05g18390D [Brassica napus]
Length=153

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 108/147 (73%), Gaps = 3/147 (2%)
 Frame = -3

Query  778  EYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQ  599
            +Y+SD    S   + K+K  Q QTV +KV++DCDGCE K+K A+SS+ G K+V++NRK  
Sbjct  9    DYLSDHFYVSIRKRKKRKIMQ-QTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEVNRKMH  67

Query  598  KVTVTGYVEANKVLKKAKSTG-KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNP  422
            KVTV+GYV+  KVLKK  STG KKAE+WPYVPY +VA PYAA AYDK+APPG+VR+ +  
Sbjct  68   KVTVSGYVDPKKVLKKVHSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFVRKSEQA  127

Query  421  TTGTAARFDDPYVTIFSDENPNACSVM  341
                    DD  +++FSDENPNAC++M
Sbjct  128  QAQPGGT-DDKLMSLFSDENPNACTIM  153



>ref|NP_173712.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
 gb|AAK48953.1|AF370526_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL38620.1|AF446887_1 At1g22990/F19G10_22 [Arabidopsis thaliana]
 gb|AAK96563.1| At1g22990/F19G10_22 [Arabidopsis thaliana]
 gb|AAL66889.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30319.1| heavy-metal-associated domain-containing protein [Arabidopsis 
thaliana]
Length=152

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 113/152 (74%), Gaps = 4/152 (3%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQ--LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDI  614
            G L Y+S+  S+      +K+KK+  +QTV +KV++DCDGCE K+K A+SS+ G K+V++
Sbjct  2    GALNYLSEYFSNHFYVSIRKRKKRKVMQTVNIKVKIDCDGCERKIKNAVSSIKGAKSVEV  61

Query  613  NRKQQKVTVTGYVEANKVLKKAKSTG-KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVR  437
            NRK  KVTV+GYV+  KVLK  +STG KKAE+WPYVPY +VA PYAA AYDK+APPG+VR
Sbjct  62   NRKMHKVTVSGYVDPKKVLKTVQSTGKKKAELWPYVPYTMVAYPYAAGAYDKRAPPGFVR  121

Query  436  RVDNPTTGTAARFDDPYVTIFSDENPNACSVM  341
            + +       +  DD  +++FSDENPNAC+VM
Sbjct  122  KSEQAQAQPGST-DDKLMSLFSDENPNACTVM  152



>ref|XP_009791012.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Nicotiana sylvestris]
Length=148

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 108/154 (70%), Gaps = 12/154 (8%)
 Frame = -3

Query  787  GTLEYISDMMssshghkhkkkkKQLQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINR  608
            G +++ISDM   +   K K+K   +QTVE+KV+MDCDGCE KV  A+SS+ GVK+VD++R
Sbjct  2    GIIDHISDMFEVTSTRKSKRKP--MQTVEIKVKMDCDGCERKVTNAVSSMKGVKSVDVSR  59

Query  607  KQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVD  428
            KQ +VTV+G VE  KVLKK ++TGKKAE WPYV YNLV+ PYA   YDKKAP GYVR V 
Sbjct  60   KQSRVTVSGNVEPKKVLKKVQNTGKKAEFWPYVEYNLVSYPYAPGVYDKKAPSGYVRDVP  119

Query  427  N-----PTTGTAARFDDPYVTIFSDENPNACSVM  341
                  P T T         ++FSDENPNACS+M
Sbjct  120  QAFQIVPNTPTHT-----LTSMFSDENPNACSIM  148



>emb|CDY21408.1| BnaA09g30190D [Brassica napus]
Length=153

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = -3

Query  712  QTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG-  536
            QTV +KV++DCDGCE K+K A+SS+ G K+V++NRK  KVTV+GYV+  KVLKK +STG 
Sbjct  30   QTVNIKVKIDCDGCERKIKNAVSSMKGAKSVEVNRKMHKVTVSGYVDPKKVLKKVQSTGK  89

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            KKAE+WPYVPY +VA PYAA AYDK+APPG+VR+ +          DD  +++FSDENPN
Sbjct  90   KKAELWPYVPYTMVAYPYAAGAYDKRAPPGFVRKSEQAQAQPGGT-DDKLMSLFSDENPN  148

Query  355  ACSVM  341
            AC++M
Sbjct  149  ACTIM  153



>ref|XP_011097135.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Sesamum indicum]
Length=147

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = -3

Query  715  LQTVELKVRMDCDGCELKVKKALSSLSGVKTVDINRKQQKVTVTGYVEANKVLKKAKSTG  536
            +QTVE+KV+MDCDGCE KVK A+ +L GVKTV+INRKQ +VTV+GYV+ NKVLK  K+TG
Sbjct  25   MQTVEIKVKMDCDGCERKVKNAVKNLRGVKTVEINRKQSRVTVSGYVDPNKVLKSVKNTG  84

Query  535  KKAEIWPYVPYNLVAQPYAAQAYDKKAPPGYVRRVDNPTTGTAARFDDPYVTIFSDENPN  356
            K AE WPY+PYN V  P+ +Q YDKKAP GYVR V       A   ++ +  +FSD+NPN
Sbjct  85   KGAEFWPYIPYNRVQYPHVSQVYDKKAPEGYVRNVQAVPVPNAT--EETFAYLFSDDNPN  142

Query  355  ACSVM  341
            ACS+M
Sbjct  143  ACSIM  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2183448245968