BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78626_g1_i1 len=1087 path=[1065:0-1086]

Length=1087
                                                                      Score     E

ref|XP_009591672.1|  PREDICTED: histone H2B.2-like                      203   6e-59   
ref|XP_009790638.1|  PREDICTED: histone H2B.2-like                      194   2e-55   
ref|XP_006347210.1|  PREDICTED: histone H2B.2-like isoform X2           179   3e-50   
ref|XP_004241294.1|  PREDICTED: histone H2B.1-like                      174   6e-48   
gb|EYU36118.1|  hypothetical protein MIMGU_mgv1a011789mg                172   5e-47   
ref|XP_006347209.1|  PREDICTED: histone H2B.2-like isoform X1           167   4e-45   
ref|XP_011089975.1|  PREDICTED: histone H2B-like                        166   7e-45   
ref|XP_006424424.1|  hypothetical protein CICLE_v10029880mg             158   8e-42   
gb|KDO60308.1|  hypothetical protein CISIN_1g048093mg                   158   8e-42   
gb|KDP43947.1|  hypothetical protein JCGZ_05414                         156   4e-41   
ref|XP_009770842.1|  PREDICTED: late histone H2B.L4-like                152   9e-41   
ref|XP_006487988.1|  PREDICTED: histone H2B.2-like                      152   5e-39   
emb|CDP07013.1|  unnamed protein product                                149   4e-38   
ref|XP_004295898.1|  PREDICTED: uncharacterized protein LOC101307192    147   3e-37   
ref|XP_010109928.1|  Histone H2B.2                                      146   4e-37   
ref|XP_002892444.1|  hypothetical protein ARALYDRAFT_470878             142   1e-36   
emb|CAN78957.1|  hypothetical protein VITISV_025691                     142   3e-36   Vitis vinifera
ref|XP_008462313.1|  PREDICTED: histone H2B type 1-A-like               142   3e-36   
ref|XP_002272312.1|  PREDICTED: histone H2B                             141   4e-36   Vitis vinifera
gb|KEH38901.1|  core histone H2A/H2B/H3/H4                              141   7e-36   
ref|NP_172295.1|  histone H2B                                           141   8e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356953.1|  PREDICTED: probable histone H2B.3                  141   1e-35   
ref|XP_010267330.1|  PREDICTED: late histone H2B.2.2-like               140   2e-35   
ref|XP_009148076.1|  PREDICTED: histone H2B.2                           140   3e-35   
ref|XP_004487735.1|  PREDICTED: histone H2B.2-like                      139   3e-35   
ref|XP_010940500.1|  PREDICTED: histone H2B.11-like                     139   5e-35   
ref|XP_009387659.1|  PREDICTED: histone H2B.3-like                      140   5e-35   
ref|XP_007132352.1|  hypothetical protein PHAVU_011G087500g             139   6e-35   
ref|XP_006306103.1|  hypothetical protein CARUB_v10011530mg             138   6e-35   
ref|XP_003539797.1|  PREDICTED: histone H2B.2-like                      138   6e-35   
ref|XP_007208559.1|  hypothetical protein PRUPE_ppa024155mg             140   9e-35   
ref|XP_008228022.1|  PREDICTED: histone H2B.2                           139   2e-34   
emb|CDX95087.1|  BnaC05g05840D                                          139   2e-34   
ref|XP_008780187.1|  PREDICTED: histone H2B.1, embryonic-like           135   3e-34   
ref|XP_008359166.1|  PREDICTED: histone H2B.2-like                      137   3e-34   
gb|KFK43131.1|  hypothetical protein AALP_AA1G084200                    136   4e-34   
ref|XP_010475607.1|  PREDICTED: histone H2B.2-like                      134   1e-33   
ref|XP_010458048.1|  PREDICTED: histone H2B.2-like                      134   1e-33   
ref|XP_010488523.1|  PREDICTED: histone H2B.2-like                      133   4e-33   
ref|XP_006417719.1|  hypothetical protein EUTSA_v10008775mg             131   2e-32   
ref|XP_010239460.1|  PREDICTED: histone H2B-like                        132   2e-32   
ref|XP_002736940.1|  PREDICTED: late histone H2B.L3-like isoform X1     128   3e-32   Saccoglossus kowalevskii
ref|XP_002462010.1|  hypothetical protein SORBIDRAFT_02g012500          132   4e-32   Sorghum bicolor [broomcorn]
gb|KHN38694.1|  Histone H2B.2                                           128   4e-32   
ref|XP_006819186.1|  PREDICTED: late histone H2B.L3-like isoform X2     127   5e-32   
gb|EYC33910.1|  hypothetical protein Y032_0001g157                      127   6e-32   
gb|EYC33915.1|  hypothetical protein Y032_0001g161                      127   6e-32   
ref|XP_003145586.1|  hypothetical protein LOAG_10011                    127   8e-32   
ref|XP_005430619.1|  PREDICTED: histone H2B, gonadal-like               126   9e-32   
gb|EYB97092.1|  hypothetical protein Y032_0143g2381                     126   1e-31   
gb|EYB97097.1|  hypothetical protein Y032_0143g2386                     126   1e-31   
gb|EYB97104.1|  hypothetical protein Y032_0143g2392                     126   1e-31   
ref|XP_003146042.1|  hypothetical protein LOAG_10470                    126   1e-31   
emb|CDQ04389.1|  Protein Bm2874, isoform b                              126   1e-31   
emb|CEG72832.1|  Putative Histone H2B                                   126   1e-31   
ref|XP_007126742.1|  PREDICTED: late histone H2B.2.2-like               126   2e-31   
ref|XP_010989727.1|  PREDICTED: late histone H2B.L4-like                126   2e-31   
gb|ETN87290.1|  core histone H2A/H2B/H3/H4                              126   2e-31   
ref|XP_010950778.1|  PREDICTED: late histone H2B.L4-like                125   2e-31   
ref|XP_009202496.1|  PREDICTED: late histone H2B.L4-like                125   2e-31   
emb|CEJ01207.1|  Putative Histone H2B                                   125   2e-31   
gb|EIE91736.1|  histone H2B                                             125   2e-31   
gb|ACD37587.1|  histone H2B                                             125   2e-31   Philodina roseola
gb|AAC15915.1|  histone H2B                                             125   3e-31   Chaetopterus variopedatus
gb|KHJ80430.1|  core histone H2A/H2B/H3/H4                              125   3e-31   
gb|EYC33906.1|  hypothetical protein Y032_0001g153                      127   3e-31   
gb|ACD37544.1|  histone H2B                                             125   3e-31   Adineta vaga
gb|EIE83419.1|  histone H2B                                             125   3e-31   
emb|CEG72837.1|  Putative Histone H2B                                   125   3e-31   
emb|CEG72769.1|  Putative Histone H2B                                   125   3e-31   
gb|EIE83508.1|  histone H2B                                             125   3e-31   
ref|XP_005369963.1|  PREDICTED: histone H2B type 1-M-like               125   3e-31   
emb|CAX71745.1|  Histone H2B                                            125   3e-31   
ref|XP_005369959.1|  PREDICTED: histone H2B type 1-P-like               125   3e-31   
emb|CEI96848.1|  Putative Histone H2B                                   125   3e-31   
gb|EYB95536.1|  hypothetical protein Y032_0158g3224                     125   3e-31   
gb|ACD37576.1|  histone H2B                                             125   3e-31   Philodina roseola
ref|XP_006211360.1|  PREDICTED: late histone H2B.2.2-like               125   4e-31   
ref|XP_007165545.1|  PREDICTED: histone H2B-like                        125   4e-31   
ref|XP_001892004.1|  histone H2B 2                                      125   4e-31   Brugia malayi [agent of lymphatic filariasis]
gb|ACF75502.1|  histone H2B                                             125   4e-31   Philodina roseola
gb|EPB84099.1|  histone H2B.2                                           125   4e-31   
gb|EPB84094.1|  histone H2B                                             125   4e-31   
emb|CDJ97864.1|  Histone core domain containing protein                 125   4e-31   
ref|XP_004312221.1|  PREDICTED: histone H2B 7-like                      125   4e-31   
gb|AAH66243.1|  HIST1H2BA protein                                       125   5e-31   Homo sapiens [man]
ref|XP_008686827.1|  PREDICTED: late histone H2B.L4-like                125   5e-31   
ref|XP_001854001.1|  histone H2B.3                                      125   5e-31   Culex quinquefasciatus
gb|EHH52824.1|  Histone H2B.e                                           125   5e-31   
ref|XP_005609614.1|  PREDICTED: histone H2B, gonadal-like               125   5e-31   
ref|XP_005788746.1|  putative histone H2B                               124   5e-31   
ref|XP_005679744.1|  PREDICTED: late histone H2B.2.2-like               124   5e-31   
gb|EPB86449.1|  histone H2B.1                                           124   5e-31   
gb|KHN75679.1|  Histone H2B 1                                           124   5e-31   
ref|XP_007883036.1|  PREDICTED: late histone H2B.L4-like isoform X1     126   6e-31   
ref|XP_005812320.1|  PREDICTED: histone H2B 1/2-like                    124   6e-31   
ref|XP_007485417.1|  PREDICTED: histone H2B type 1-F/J/L-like iso...    125   6e-31   
ref|XP_005553794.1|  PREDICTED: histone H2B type 1-F/J/L-like iso...    124   6e-31   
gb|ETN87292.1|  core histone H2A/H2B/H3/H4                              125   6e-31   
gb|AAH66241.1|  HIST1H2BA protein                                       124   6e-31   Homo sapiens [man]
ref|XP_003192480.1|  histone h2b                                        125   6e-31   
ref|XP_004043408.1|  PREDICTED: histone H2B type 1-A-like               124   6e-31   
ref|XP_007981698.1|  PREDICTED: late histone H2B.L4-like                125   6e-31   
gb|ACD37559.1|  histone H2B                                             124   6e-31   Adineta vaga
ref|NP_733759.1|  histone H2B type 1-A                                  124   7e-31   Homo sapiens [man]
ref|XP_002044885.1|  GM18809                                            124   7e-31   Drosophila sechellia
gb|EYB97109.1|  hypothetical protein Y032_0143g2397                     126   7e-31   
ref|XP_005768681.1|  hypothetical protein EMIHUDRAFT_66183              124   7e-31   
ref|XP_002298166.2|  hypothetical protein POPTR_0001s21970g             128   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002816540.1|  PREDICTED: histone H2B type 1-A                    124   7e-31   
ref|XP_009241717.1|  PREDICTED: late histone H2B.L4-like                125   7e-31   
ref|XP_005817709.1|  PREDICTED: histone H2B 1/2-like                    124   7e-31   
gb|ETN72913.1|  core histone H2A/H2B/H3/H4                              124   7e-31   
ref|XP_008311574.1|  PREDICTED: histone H2B 1/2-like                    124   7e-31   
ref|XP_009098006.1|  PREDICTED: late histone H2B.L4-like                124   7e-31   
ref|XP_008331666.1|  PREDICTED: histone H2B 1/2-like                    124   7e-31   
emb|CBM82447.1|  histone H2B-II protein                                 124   7e-31   
ref|XP_003976987.1|  PREDICTED: histone H2B 1/2-like                    124   7e-31   
ref|XP_008326606.1|  PREDICTED: histone H2B 1/2                         124   7e-31   
ref|XP_005198229.2|  PREDICTED: late histone H2B.L4-like                125   7e-31   
ref|XP_006008791.1|  PREDICTED: histone H2B 7-like                      124   7e-31   
ref|XP_001862652.1|  histone H2B.1/H2B.2                                124   7e-31   Culex quinquefasciatus
pdb|3WKJ|D  Chain D, The Nucleosome Containing Human Tsh2b              124   7e-31   
ref|XP_009980137.1|  PREDICTED: histone H2B 8                           124   7e-31   
ref|XP_007574089.1|  PREDICTED: histone H2B 1/2-like                    124   8e-31   
ref|XP_001895510.1|  Probable histone H2B 3                             127   8e-31   Brugia malayi [agent of lymphatic filariasis]
sp|P83863.2|H2B_LITVA  RecName: Full=Histone H2B                        124   8e-31   Litopenaeus vannamei [white Pacific shrimp]
ref|XP_008670031.1|  PREDICTED: histone H2B.5-like                      128   8e-31   
gb|ETE56555.1|  Histone H2B 1/2/3/4/6                                   124   8e-31   
ref|XP_006920675.1|  PREDICTED: histone H2B-like                        124   8e-31   
gb|EMP24768.1|  Histone H2B 7                                           124   8e-31   
gb|ACG23906.1|  histone H2B                                             128   8e-31   Zea mays [maize]
ref|XP_007574074.1|  PREDICTED: histone H2B 1/2-like                    124   8e-31   
ref|XP_004387130.1|  PREDICTED: histone H2B type 1-F/J/L-like           124   8e-31   
emb|CBM82450.1|  histone H2B-I protein                                  124   8e-31   
emb|CBM82449.1|  histone H2B-III protein                                124   8e-31   
ref|XP_005899072.1|  PREDICTED: late histone H2B.2.2-like               124   8e-31   
ref|XP_005194087.1|  PREDICTED: late histone H2B.L4-like                125   8e-31   
ref|XP_006661574.1|  PREDICTED: histone H2B.3-like                      126   8e-31   
ref|XP_001865496.1|  late histone H2B.L4                                124   9e-31   Culex quinquefasciatus
ref|XP_002422651.1|  histone H2B.3, putative                            124   9e-31   Pediculus humanus corporis [human body lice]
gb|KIH43801.1|  core histone H2A/H2B/H3/H4                              124   9e-31   
gb|KFH66463.1|  histone H2B                                             124   9e-31   
emb|CBM82445.1|  histone H2B-I protein                                  124   9e-31   
ref|XP_010034182.1|  PREDICTED: histone H2B.5-like                      128   9e-31   
ref|XP_001657158.1|  histone H2B                                        124   1e-30   Aedes aegypti
ref|XP_005951561.1|  PREDICTED: histone H2B 1/2-like                    123   1e-30   
ref|XP_003088435.1|  hypothetical protein CRE_15218                     124   1e-30   
gb|EGT35281.1|  hypothetical protein CAEBREN_22435                      124   1e-30   
ref|NP_001180726.1|  histone H2B type 1-A                               124   1e-30   
ref|XP_005230966.1|  PREDICTED: histone H2B, gonadal-like               124   1e-30   
ref|XP_008326383.1|  PREDICTED: histone H2B 1/2-like                    124   1e-30   
ref|XP_008533333.1|  PREDICTED: histone H2B type 3-A-like               124   1e-30   
sp|P21897.2|H2B_CHITH  RecName: Full=Histone H2B                        124   1e-30   Chironomus thummi thummi
ref|XP_001964819.1|  GF22593                                            124   1e-30   Drosophila ananassae
ref|XP_005403366.1|  PREDICTED: histone H2B type 1-B-like               124   1e-30   
ref|XP_003214299.2|  PREDICTED: late histone H2B.L4-like                124   1e-30   
ref|XP_007071493.1|  PREDICTED: histone H2B 1/2/3/4/6-like              125   1e-30   
ref|XP_009235253.1|  PREDICTED: histone H2B type 2-F isoform X4         125   1e-30   
gb|EGT34517.1|  hypothetical protein CAEBREN_13824                      124   1e-30   
ref|XP_004566500.1|  PREDICTED: histone H2B-like                        124   1e-30   
ref|XP_005542113.1|  PREDICTED: histone H2B type 2-F-like isoform X1    125   1e-30   
ref|XP_423715.2|  PREDICTED: histone H2B, gonadal                       124   1e-30   Gallus gallus [bantam]
gb|EGT38822.1|  hypothetical protein CAEBREN_29113                      124   1e-30   
ref|XP_002633141.1|  Hypothetical protein CBG05840                      124   1e-30   Caenorhabditis briggsae
ref|NP_496897.1|  Protein HIS-44                                        124   1e-30   Caenorhabditis elegans [roundworm]
ref|XP_001967906.1|  GF19591                                            123   1e-30   Drosophila ananassae
ref|XP_010378261.1|  PREDICTED: late histone H2B.L4-like                125   1e-30   
gb|KFH73409.1|  histone H2B                                             124   1e-30   
dbj|BAD02422.1|  histone 2B                                             124   1e-30   Drosophila yakuba
gb|EFX86920.1|  hypothetical protein DAPPUDRAFT_312357                  124   1e-30   
gb|EFX86889.1|  hypothetical protein DAPPUDRAFT_97043                   124   1e-30   
ref|NP_505197.1|  Protein HIS-8                                         124   1e-30   Caenorhabditis elegans [roundworm]
emb|CAG12685.1|  unnamed protein product                                124   1e-30   Tetraodon nigroviridis
ref|XP_002639990.1|  Hypothetical protein CBG10818                      124   1e-30   Caenorhabditis briggsae
ref|XP_003451196.1|  PREDICTED: histone H2B 1/2-like                    124   1e-30   
ref|XP_010557373.1|  PREDICTED: histone H2B.2                           128   1e-30   
ref|XP_003087543.1|  hypothetical protein CRE_01514                     124   1e-30   
gb|AAP94661.1|  histone H2B                                             124   1e-30   Mytilus edulis [blue mussel]
gb|KHJ96893.1|  core histone H2A/H2B/H3/H4                              124   1e-30   
ref|XP_002012692.1|  GI17569                                            123   1e-30   Drosophila mojavensis
ref|XP_569066.1|  histone h2b                                           124   1e-30   Cryptococcus neoformans var. neoformans JEC21
ref|XP_008564219.1|  PREDICTED: late histone H2B.L4-like                124   1e-30   
ref|XP_008313560.1|  PREDICTED: histone H2B 1.1-like                    124   1e-30   
ref|XP_003438147.1|  PREDICTED: histone H2B-like                        123   1e-30   
ref|XP_005553885.1|  PREDICTED: histone H2B type 1-A-like               124   1e-30   
emb|CDS08165.1|  Putative Histone H2B                                   124   1e-30   
ref|XP_008201473.1|  PREDICTED: histone H2B                             124   1e-30   
ref|XP_005312549.1|  PREDICTED: histone H2B 7-like                      123   1e-30   
ref|XP_003149647.1|  histone H2B 2                                      124   1e-30   
ref|XP_004991141.1|  histone H2B                                        124   1e-30   
ref|XP_007429385.1|  PREDICTED: histone H2B 1/2/3/4/6-like              124   1e-30   
ref|XP_003226698.1|  PREDICTED: histone H2B 5-like                      124   1e-30   
ref|XP_003227270.1|  PREDICTED: histone H2B 5-like                      124   1e-30   
emb|CBY43004.1|  unnamed protein product                                123   1e-30   
emb|CDH50262.1|  histone h2b                                            124   1e-30   
ref|XP_005812308.1|  PREDICTED: histone H2B 1/2-like                    124   1e-30   
ref|XP_004542871.1|  PREDICTED: histone H2B-like                        123   1e-30   
pdb|3C9K|B  Chain B, Model Of Histone Octamer Tubular Crystals          124   1e-30   
emb|CDQ04387.1|  Protein Bm2874, isoform a                              126   1e-30   
emb|CDH60910.1|  histone h2b                                            123   1e-30   
gb|KFQ95962.1|  hypothetical protein Y956_07258                         122   1e-30   
gb|KHN75686.1|  Histone H2B 1                                           123   1e-30   
ref|XP_003224522.1|  PREDICTED: histone H2B 5                           124   1e-30   
gb|KDD76445.1|  hypothetical protein H632_c224p3                        123   1e-30   
ref|XP_008432497.1|  PREDICTED: late histone H2B.L4                     123   1e-30   
gb|AAW26007.1|  unknown                                                 123   1e-30   Schistosoma japonicum
sp|P35067.1|H2B_ACRFO  RecName: Full=Histone H2B                        123   1e-30   Acropora formosa
ref|XP_003227271.1|  PREDICTED: histone H2B 5-like                      123   1e-30   
ref|XP_007555238.1|  PREDICTED: histone H2B 1/2-like                    125   1e-30   
ref|XP_005817716.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
ref|XP_002045030.1|  GM11714                                            123   2e-30   Drosophila sechellia
ref|XP_008420768.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
ref|XP_009235250.1|  PREDICTED: histone H2B type 2-F isoform X2         124   2e-30   
ref|NP_505464.1|  Protein HIS-41                                        123   2e-30   Caenorhabditis elegans [roundworm]
ref|XP_002192994.1|  PREDICTED: histone H2B 7-like                      123   2e-30   Taeniopygia guttata
emb|CAF98801.1|  unnamed protein product                                123   2e-30   Tetraodon nigroviridis
ref|XP_004776891.1|  PREDICTED: histone H2B type 2-F-like isoform X2    124   2e-30   
gb|KDR07171.1|  Histone H2B                                             123   2e-30   
gb|AEE63232.1|  unknown                                                 123   2e-30   
ref|XP_002045748.1|  GM12965                                            123   2e-30   Drosophila sechellia
ref|XP_306255.2|  AGAP012894-PA                                         123   2e-30   Anopheles gambiae str. PEST
gb|ETN61964.1|  histone H2B                                             123   2e-30   
emb|CBY36200.1|  unnamed protein product                                123   2e-30   
emb|CAF91303.1|  unnamed protein product                                123   2e-30   Tetraodon nigroviridis
ref|XP_009489258.1|  PREDICTED: histone H2B 7                           123   2e-30   
ref|XP_001967857.1|  GF20679                                            123   2e-30   Drosophila ananassae
gb|KHJ83288.1|  core histone H2A/H2B/H3/H4                              123   2e-30   
ref|XP_005532149.1|  PREDICTED: histone H2B, gonadal-like               123   2e-30   
emb|CDS05339.1|  Putative Histone H2B                                   123   2e-30   
ref|XP_009462250.1|  PREDICTED: histone H2B 1/2/3/4/6-like              123   2e-30   
ref|XP_003227275.1|  PREDICTED: histone H2B 5-like                      123   2e-30   
ref|XP_001964801.1|  GF22516                                            123   2e-30   Drosophila ananassae
gb|ELK02685.1|  Histone H2B type 1                                      126   2e-30   
gb|AAI15793.1|  Hist1h2bj protein                                       123   2e-30   Mus musculus [mouse]
pdb|2PYO|D  Chain D, Drosophila Nucleosome Core                         123   2e-30   
ref|XP_004988971.1|  histone H2B                                        123   2e-30   
ref|XP_002637571.1|  Hypothetical protein CBG19304                      123   2e-30   Caenorhabditis briggsae
gb|KFP23798.1|  Histone H2B 7                                           123   2e-30   
ref|NP_783595.1|  histone H2B type 1-B                                  123   2e-30   Mus musculus [mouse]
ref|XP_004847604.1|  PREDICTED: histone H2B type 1-M-like               123   2e-30   
ref|XP_003110319.1|  hypothetical protein CRE_05743                     124   2e-30   
ref|XP_006760036.1|  PREDICTED: histone H2B type 1-like                 123   2e-30   
ref|XP_001996801.1|  GH23347                                            123   2e-30   Drosophila grimshawi
ref|XP_008114645.1|  PREDICTED: histone H2B 5-like                      123   2e-30   
gb|EGT36342.1|  hypothetical protein CAEBREN_24845                      123   2e-30   
gb|KHN71353.1|  Histone H2B 1                                           123   2e-30   
emb|CDS11876.1|  Putative Histone H2B                                   123   2e-30   
ref|XP_004065519.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
ref|XP_005817564.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
sp|Q8I1N0.3|H2B_DROYA  RecName: Full=Histone H2B                        123   2e-30   Drosophila yakuba
ref|XP_003251626.1|  PREDICTED: histone H2B-like                        123   2e-30   
ref|XP_003977937.1|  PREDICTED: histone H2B 3-like                      123   2e-30   
emb|CBM82454.1|  histone H2B-III protein                                123   2e-30   
ref|XP_008433491.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
ref|XP_008433488.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
emb|CAF98838.1|  unnamed protein product                                123   2e-30   Tetraodon nigroviridis
emb|CBY33243.1|  unnamed protein product                                123   2e-30   
gb|KDR14716.1|  Histone H2B                                             123   2e-30   
ref|XP_006136034.1|  PREDICTED: histone H2B 1/2/3/4/6-like              124   2e-30   
gb|EYC41368.1|  hypothetical protein Y032_0571g114                      125   2e-30   
ref|XP_006013598.1|  PREDICTED: histone H2B type 1-M-like               123   2e-30   
ref|XP_001862657.1|  histone H2B.3                                      123   2e-30   Culex quinquefasciatus
ref|XP_006007163.1|  PREDICTED: histone H2B-like                        123   2e-30   
ref|XP_002045193.1|  GM16942                                            123   2e-30   Drosophila sechellia
ref|NP_724342.1|  histone H2B                                           123   2e-30   Drosophila melanogaster
ref|XP_002087255.1|  GE14634                                            123   2e-30   Drosophila yakuba
ref|XP_002044758.1|  GM19699                                            123   2e-30   Drosophila sechellia
gb|EZA53714.1|  Histone H2B.3                                           123   2e-30   
ref|XP_001657148.1|  histone H2B                                        123   2e-30   Aedes aegypti
ref|NP_505279.1|  Protein HIS-54                                        124   2e-30   Caenorhabditis elegans [roundworm]
ref|XP_004065579.1|  PREDICTED: histone H2B 1/2-like isoform 2          123   2e-30   
ref|XP_003703728.1|  PREDICTED: histone H2B.3-like                      123   2e-30   
gb|EFN62819.1|  Histone H2B                                             123   2e-30   
ref|XP_011068000.1|  PREDICTED: histone H2B                             123   2e-30   
ref|XP_001120889.1|  PREDICTED: histone H2B-like                        123   2e-30   Apis mellifera [bee]
ref|XP_005751310.1|  PREDICTED: histone H2B 1/2-like                    123   2e-30   
ref|NP_502132.1|  Protein HIS-48                                        123   2e-30   Caenorhabditis elegans [roundworm]
ref|XP_003707916.1|  PREDICTED: histone H2B.3-like                      123   2e-30   
ref|XP_003110404.1|  hypothetical protein CRE_05547                     124   2e-30   
gb|ESA16700.1|  hypothetical protein GLOINDRAFT_77155                   124   2e-30   
ref|XP_003114026.1|  hypothetical protein CRE_27395                     124   2e-30   
ref|XP_009057167.1|  hypothetical protein LOTGIDRAFT_233239             123   2e-30   
ref|XP_006665103.1|  PREDICTED: histone H2B-like                        123   2e-30   
ref|XP_008825242.1|  PREDICTED: histone H2B type 3-A                    123   2e-30   
ref|XP_008311571.1|  PREDICTED: histone H2B type 2-F-like               123   2e-30   
gb|KFV00485.1|  Histone H2B 7                                           123   2e-30   
ref|XP_008055800.1|  PREDICTED: histone H2B type 1-F/J/L                123   2e-30   
ref|NP_835505.1|  histone H2B type 1-F/J/L                              123   2e-30   
ref|XP_001997413.1|  GH23769                                            123   2e-30   
sp|P35069.2|H2B3_TIGCA  RecName: Full=Histone H2B.3                     123   2e-30   
ref|XP_008217274.1|  PREDICTED: late histone H2B.L4-like                123   2e-30   
ref|XP_002045832.1|  GM19289                                            123   2e-30   
ref|XP_010114038.1|  PREDICTED: histone H2B 7-like                      123   2e-30   
ref|XP_003115647.1|  hypothetical protein CRE_18971                     124   2e-30   
gb|AGN29607.1|  histone H2B                                             123   2e-30   
gb|ACQ58362.1|  Histone H2B 1.2                                         123   2e-30   
emb|CDJ97046.1|  Histone core domain containing protein                 123   2e-30   
sp|P19374.2|H2B_PLADU  RecName: Full=Histone H2B                        123   2e-30   
ref|XP_006048073.1|  PREDICTED: histone H2B type 1-like                 123   2e-30   
dbj|BAK52369.1|  histone H2B                                            122   2e-30   
ref|XP_005902820.1|  PREDICTED: late histone H2B.2.2-like               123   2e-30   
sp|P35068.2|H2B1_TIGCA  RecName: Full=Histone H2B.1/H2B.2               123   2e-30   
ref|XP_001120014.1|  PREDICTED: histone H2B-like                        123   2e-30   
ref|XP_008825243.1|  PREDICTED: histone H2B type 3-B                    123   2e-30   
ref|XP_603865.1|  PREDICTED: histone H2B type 1-B                       123   2e-30   
ref|NP_003510.1|  histone H2B type 1-L                                  123   2e-30   
ref|NP_001180754.1|  histone H2B type 1-H                               123   2e-30   
gb|EFX87063.1|  hypothetical protein DAPPUDRAFT_127284                  123   2e-30   
gb|EFX86943.1|  hypothetical protein DAPPUDRAFT_312397                  123   2e-30   
ref|XP_007955075.1|  PREDICTED: histone H2B type 1-F/J/L-like           123   2e-30   
ref|XP_004384832.1|  PREDICTED: histone H2B type 2-F-like               123   2e-30   
ref|XP_004959252.1|  PREDICTED: histone H2B.2-like                      127   2e-30   
ref|XP_006903272.1|  PREDICTED: histone H2B type 1-M-like               123   3e-30   
ref|XP_003421153.1|  PREDICTED: histone H2B type 1-F/J/L-like           123   3e-30   
gb|EGT42703.1|  hypothetical protein CAEBREN_16781                      123   3e-30   
ref|XP_003702158.1|  PREDICTED: histone H2B.3-like                      123   3e-30   
ref|XP_003927338.1|  PREDICTED: histone H2B type 1-A                    123   3e-30   
ref|XP_002045358.1|  GM11161                                            123   3e-30   
gb|ACO11025.1|  Histone H2B                                             123   3e-30   
gb|KFQ53052.1|  hypothetical protein N333_07555                         122   3e-30   
ref|XP_004821250.1|  PREDICTED: histone H2B type 2-F-like isoform X1    123   3e-30   
gb|EGT47778.1|  hypothetical protein CAEBREN_15210                      123   3e-30   
emb|CEF66522.1|  Histone H2B family and Histone core domain and H...    122   3e-30   
emb|CBM82452.1|  histone H2B-II protein                                 122   3e-30   
ref|XP_007069885.1|  PREDICTED: histone H2B, gonadal-like               122   3e-30   
ref|XP_006013202.1|  PREDICTED: histone H2B 7-like                      122   3e-30   
gb|ABW86652.1|  histone H2B                                             122   3e-30   
ref|XP_005289783.1|  PREDICTED: late histone H2B.L4-like                122   3e-30   
gb|EYC41369.1|  hypothetical protein Y032_0571g114                      125   3e-30   
ref|XP_010363005.1|  PREDICTED: histone H2B type 1-F/J/L-like           123   3e-30   
ref|NP_001277395.1|  histone H2B type 1-P isoform 2                     123   3e-30   
gb|EMT05219.1|  Histone H2B type 1-A                                    127   3e-30   
ref|XP_003769950.1|  PREDICTED: histone H2B type 1-F/J/L-like           123   3e-30   
gb|KGN64870.1|  hypothetical protein Csa_1G136770                       126   3e-30   
ref|XP_008560100.1|  PREDICTED: histone H2B                             122   3e-30   
ref|XP_002156085.2|  PREDICTED: histone H2B-like                        123   3e-30   
ref|XP_002045874.1|  GM17446                                            122   3e-30   
ref|XP_007105889.1|  PREDICTED: histone H2B type 1-like                 123   3e-30   
ref|XP_010614644.1|  PREDICTED: histone H2B type 2-F isoform X2         123   3e-30   
ref|XP_008560083.1|  PREDICTED: histone H2B                             122   3e-30   
ref|XP_003227273.1|  PREDICTED: histone H2B 1/2/3/4/6                   122   3e-30   
ref|XP_010207604.1|  PREDICTED: histone H2B 7-like                      123   3e-30   
ref|XP_009053399.1|  hypothetical protein LOTGIDRAFT_147373             122   3e-30   
gb|EJT46198.1|  histone H2B                                             123   3e-30   
ref|XP_006012958.1|  PREDICTED: histone H2B 8-like                      122   3e-30   
ref|NP_783594.1|  histone H2B type 1-A                                  122   3e-30   
ref|XP_006198654.1|  PREDICTED: histone H2B type 1-A-like               122   3e-30   
ref|XP_005982835.1|  PREDICTED: histone H2B type 1-A-like               122   3e-30   
gb|KHN83088.1|  Histone H2B 1                                           122   3e-30   
ref|XP_003744733.1|  PREDICTED: histone H2B.3-like                      122   3e-30   
ref|XP_004019141.1|  PREDICTED: histone H2B type 1-A-like               122   3e-30   
dbj|BAG61164.1|  unnamed protein product                                124   3e-30   
gb|EMS64247.1|  Histone H2B.3                                           127   3e-30   
gb|EMS53441.1|  Histone H2B.2                                           122   3e-30   
ref|XP_004776892.1|  PREDICTED: histone H2B type 2-F-like isoform X3    122   3e-30   
gb|KHN76008.1|  Histone H2B 1                                           122   3e-30   
ref|XP_009026763.1|  hypothetical protein HELRODRAFT_186003             122   3e-30   
ref|XP_008691244.1|  PREDICTED: histone H2B type 1 isoform X1           125   3e-30   
ref|XP_008691165.1|  PREDICTED: histone H2B type 1-A                    122   3e-30   
ref|XP_005665702.1|  PREDICTED: histone H2B type 1-A-like               123   3e-30   
ref|XP_003975305.1|  PREDICTED: histone H2B.1/H2B.2-like                122   3e-30   
ref|XP_008580152.1|  PREDICTED: histone H2B type 1-N-like isoform X1    122   3e-30   
ref|XP_005665720.1|  PREDICTED: histone H2B type 1-K-like isoform X2    123   3e-30   
ref|XP_008332584.1|  PREDICTED: late histone H2B.L4-like                122   3e-30   
gb|AAH67485.1|  HIST1H2BM protein                                       123   3e-30   
ref|XP_001925460.1|  PREDICTED: histone H2B type 1-A-like               122   3e-30   
ref|XP_003392967.1|  PREDICTED: histone H2B.3-like                      122   3e-30   
pdb|4INM|D  Chain D, Crystal Structure Of Cenp-c In Complex With ...    121   3e-30   
ref|XP_003746451.1|  PREDICTED: histone H2B.3-like                      123   3e-30   
ref|XP_008145290.1|  PREDICTED: histone H2B type 1-A isoform X2         122   3e-30   
ref|XP_007179132.1|  PREDICTED: histone H2B type 2-F-like               122   3e-30   
ref|XP_002422629.1|  histone H2B.3, putative                            124   3e-30   
emb|CAA36808.1|  histone H2b                                            122   3e-30   
ref|XP_008281242.1|  PREDICTED: late histone H2B.L4-like                122   3e-30   
ref|XP_007548720.1|  PREDICTED: late histone H2B.L4 isoform X2          122   3e-30   
sp|Q75VN4.3|H2B_RHASC  RecName: Full=Histone H2B                        122   3e-30   
gb|EFX89003.1|  hypothetical protein DAPPUDRAFT_191199                  122   3e-30   
ref|XP_010774194.1|  PREDICTED: histone H2B 1.2                         122   3e-30   
ref|XP_008145289.1|  PREDICTED: histone H2B type 1-A isoform X1         122   3e-30   
ref|XP_007074563.1|  PREDICTED: histone H2B type 1-like                 122   3e-30   
gb|KFM06031.1|  Histone H2B type 1-L                                    122   3e-30   
sp|P02284.2|H2B_PATGR  RecName: Full=Histone H2B, gonadal               122   3e-30   
ref|XP_006271484.1|  PREDICTED: histone H2B, gonadal-like               122   3e-30   
pdb|1S32|D  Chain D, Molecular Recognition Of The Nucleosomal 'su...    122   3e-30   
ref|XP_005183776.1|  PREDICTED: histone H2B.1/H2B.2-like                122   3e-30   
sp|P30757.2|H2B_SIPNU  RecName: Full=Histone H2B                        122   3e-30   
ref|XP_006218985.1|  PREDICTED: histone H2B type 1-like                 122   3e-30   
ref|XP_004917048.1|  PREDICTED: histone H2B 1.1-like                    122   3e-30   
ref|XP_003788840.1|  PREDICTED: histone H2B type 1-like                 122   3e-30   
ref|XP_006872894.1|  PREDICTED: histone H2B type 1-like                 123   3e-30   
ref|XP_002666976.1|  PREDICTED: histone H2B 1/2-like                    122   3e-30   
ref|XP_008560149.1|  PREDICTED: histone H2B-like                        122   4e-30   
ref|XP_004043409.1|  PREDICTED: histone H2B type 1-A-like               122   4e-30   
ref|XP_006014612.1|  PREDICTED: histone H2B type 1-O-like               122   4e-30   
ref|XP_006735993.1|  PREDICTED: histone H2B type 1-like                 122   4e-30   
emb|CBM82456.1|  histone H2B-IV protein                                 122   4e-30   
ref|XP_006037126.1|  PREDICTED: histone H2B, gonadal-like               122   4e-30   
ref|XP_008550839.1|  PREDICTED: histone H2B-like                        122   4e-30   
gb|AAH66240.1|  Histone cluster 1, H2ba                                 122   4e-30   
ref|XP_008830093.1|  PREDICTED: histone H2B type 1-N-like               122   4e-30   
ref|XP_008482745.1|  PREDICTED: histone H2B                             121   4e-30   
ref|XP_004407127.1|  PREDICTED: histone H2B type 1-F/J/L-like           122   4e-30   
ref|NP_001017251.1|  histone cluster 1, H2bj                            122   4e-30   
pdb|1P34|D  Chain D, Crystallographic Studies Of Nucleosome Core ...    122   4e-30   
gb|KFO78240.1|  Histone H2B.3                                           121   4e-30   
ref|XP_005355004.1|  PREDICTED: histone H2B type 1-N-like               122   4e-30   
gb|AAI06900.1|  HIST1H2BC protein                                       122   4e-30   
gb|KDR03941.1|  Histone H2B                                             123   4e-30   
gb|KHN71867.1|  Histone H2B 1                                           122   4e-30   
ref|XP_010822975.1|  PREDICTED: late histone H2B.L4                     122   4e-30   
pdb|1ZLA|D  Chain D, X-Ray Structure Of A Kaposi's Sarcoma Herpes...    122   4e-30   
ref|XP_007634691.1|  PREDICTED: histone H2B type 1-N isoform X2         122   4e-30   
ref|XP_007634683.1|  PREDICTED: histone H2B type 2-F-like               122   4e-30   
gb|AAH67487.1|  Histone cluster 1, H2bm                                 122   4e-30   
pdb|1AOI|D  Chain D, Complex Between Nucleosome Core Particle (H3...    121   4e-30   
ref|XP_009047519.1|  hypothetical protein LOTGIDRAFT_176431             122   4e-30   
ref|XP_003391252.1|  PREDICTED: histone H2B, gonadal-like               122   4e-30   
gb|ELU17537.1|  hypothetical protein CAPTEDRAFT_213180                  122   4e-30   
ref|XP_006931496.1|  PREDICTED: histone H2B 1/2/3/4/6-like              122   4e-30   
ref|XP_001656983.1|  histone H2B                                        122   4e-30   
ref|XP_008570084.1|  PREDICTED: histone H2B type 1-A                    122   4e-30   
ref|XP_225384.1|  PREDICTED: histone H2B type 1                         122   4e-30   
ref|XP_004853990.1|  PREDICTED: histone H2B type 2-E-like               122   4e-30   
ref|NP_001086753.1|  histone H2B 1.1                                    122   4e-30   
ref|NP_783596.1|  histone H2B type 1-K                                  122   4e-30   
ref|XP_005163278.1|  PREDICTED: histone H2B 1/2-like                    122   4e-30   
ref|XP_004406555.1|  PREDICTED: histone H2B type 1-A-like               122   4e-30   
ref|XP_009099325.1|  PREDICTED: histone H2B 5-like                      122   4e-30   
ref|XP_004273524.1|  PREDICTED: histone H2B type 1-L-like               122   4e-30   
ref|XP_009892675.1|  PREDICTED: histone H2B 7                           123   4e-30   
ref|XP_009556892.1|  PREDICTED: LOW QUALITY PROTEIN: histone H2B ...    123   4e-30   
ref|XP_001745389.1|  hypothetical protein                               122   4e-30   
pdb|1KX3|D  Chain D, X-Ray Structure Of The Nucleosome Core Parti...    122   4e-30   
ref|XP_009462068.1|  PREDICTED: late histone H2B.L4-like                122   4e-30   
ref|XP_002045933.1|  GM23415                                            122   4e-30   
ref|XP_006222459.1|  PREDICTED: histone H2B type 1-B                    122   4e-30   
gb|AAT68209.1|  putative histone H2B                                    121   4e-30   
gb|AAB48832.1|  cleavage stage histone H2B                              122   4e-30   
pdb|2F8N|H  Chain H, 2.9 Angstrom X-Ray Structure Of Hybrid Macro...    122   4e-30   
ref|XP_006993209.1|  PREDICTED: histone H2B type 1-N-like               122   4e-30   
ref|NP_003511.1|  histone H2B type 1-N                                  122   4e-30   
ref|XP_004273542.1|  PREDICTED: histone H2B type 1-like                 122   4e-30   
ref|XP_007628955.1|  PREDICTED: histone H2B type 1-like                 122   4e-30   
pdb|3C1B|D  Chain D, The Effect Of H3 K79 Dimethylation And H4 K2...    122   4e-30   
ref|XP_002045035.1|  GM11716                                            122   4e-30   
ref|XP_010841744.1|  PREDICTED: histone H2B type 1-B                    122   4e-30   
ref|XP_009320600.1|  PREDICTED: histone H2B 1/2/3/4/6-like              122   4e-30   
ref|XP_004285169.1|  PREDICTED: histone H2B type 2-E-like               122   4e-30   
gb|KHN72896.1|  Histone H2B 1                                           122   4e-30   
ref|XP_010621305.1|  PREDICTED: histone H2B type 1-N-like isoform X2    122   4e-30   
ref|XP_004670958.1|  PREDICTED: histone H2B type 1-H-like               124   4e-30   
ref|XP_007971680.1|  PREDICTED: histone H2B type 1-B                    123   4e-30   
ref|XP_010371584.1|  PREDICTED: histone H2B type 2-F isoform X1         124   4e-30   
ref|XP_008145277.1|  PREDICTED: histone H2B type 1-like                 122   4e-30   
sp|P06900.2|H2B12_XENLA  RecName: Full=Histone H2B 1.2; Short=H2B1.2    122   4e-30   
ref|NP_001180974.1|  histone H2B type 1-M                               122   4e-30   
gb|EMC86806.1|  Histone H2B 8                                           122   4e-30   
sp|P27326.2|H2B_URECA  RecName: Full=Histone H2B                        122   4e-30   
ref|XP_003241030.1|  PREDICTED: histone H2B-like                        122   4e-30   
ref|XP_006268903.1|  PREDICTED: histone H2B 5-like                      122   4e-30   
ref|XP_004874791.1|  PREDICTED: histone H2B type 3-B-like               122   4e-30   
ref|XP_006711398.1|  PREDICTED: histone H2B type 2-F isoform X1         123   4e-30   
ref|XP_004847594.1|  PREDICTED: histone H2B type 1-C/E/G-like           122   4e-30   
ref|XP_005910268.1|  PREDICTED: histone H2B type 1-like                 122   4e-30   
ref|XP_003502223.1|  PREDICTED: histone H2B type 1-B                    122   4e-30   
ref|XP_002940832.1|  PREDICTED: histone H2B 1.1-like                    122   4e-30   
emb|CAA50512.1|  histone H2B                                            122   4e-30   
ref|XP_001923636.1|  PREDICTED: histone H2B 1/2-like                    122   4e-30   
ref|NP_001096102.1|  uncharacterized protein LOC100124605               122   4e-30   
ref|XP_008691166.1|  PREDICTED: histone H2B type 1-A                    122   4e-30   
ref|XP_005982836.1|  PREDICTED: histone H2B type 1-A-like               122   4e-30   
ref|XP_005326783.1|  PREDICTED: histone H2B-like                        122   4e-30   
ref|XP_008533331.1|  PREDICTED: histone H2B type 3-B                    122   4e-30   
tpg|DAA31681.1|  TPA: histone cluster 2, H2be                           122   4e-30   
ref|XP_004286153.1|  PREDICTED: histone H2B type 1-L-like               122   4e-30   
ref|XP_002940881.1|  PREDICTED: histone H2B 1.1-like                    122   4e-30   
ref|XP_004076756.1|  PREDICTED: histone H2B 1/2-like                    123   4e-30   
gb|EOA95192.1|  Histone H2B 1/2/3/4/6                                   122   4e-30   
ref|XP_009288340.1|  PREDICTED: histone H2B 7-like                      122   4e-30   
ref|XP_004787912.1|  PREDICTED: histone H2B type 1-K-like               122   4e-30   
ref|XP_004432105.1|  PREDICTED: histone H2B type 1-M-like               122   4e-30   
ref|XP_009976859.1|  PREDICTED: histone H2B 7                           122   4e-30   
gb|EMC89186.1|  Histone H2B 8                                           122   5e-30   
ref|XP_001608287.1|  PREDICTED: histone H2B                             122   5e-30   
sp|Q00729.2|H2B1A_RAT  RecName: Full=Histone H2B type 1-A; AltNam...    122   5e-30   
ref|XP_002187034.1|  PREDICTED: histone H2B 5-like                      122   5e-30   
ref|XP_010778406.1|  PREDICTED: histone H2B 1.2-like                    122   5e-30   
ref|XP_008481588.1|  PREDICTED: histone H2B-like                        122   5e-30   
ref|XP_004019142.1|  PREDICTED: histone H2B type 1-A-like               122   5e-30   
ref|XP_003985786.1|  PREDICTED: histone H2B type 1-A-like               122   5e-30   
gb|KFO33881.1|  Histone H2B type 1-N                                    122   5e-30   
ref|XP_008070423.1|  PREDICTED: histone H2B type 1-N-like               122   5e-30   
ref|XP_004611558.1|  PREDICTED: histone H2B type 3-B-like               122   5e-30   
gb|EGT39024.1|  hypothetical protein CAEBREN_25282                      122   5e-30   
sp|P07795.2|H2BL2_PSAMI  RecName: Full=Late histone H2B.2.2             122   5e-30   
gb|EMC86808.1|  Histone H2B 8                                           122   5e-30   
ref|XP_008824847.1|  PREDICTED: histone H2B type 1-M-like               122   5e-30   
ref|XP_004432101.1|  PREDICTED: histone H2B type 1-L-like               122   5e-30   
emb|CAB02545.1|  histone H2B                                            122   5e-30   



>ref|XP_009591672.1| PREDICTED: histone H2B.2-like [Nicotiana tomentosiformis]
Length=281

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 139/269 (52%), Positives = 177/269 (66%), Gaps = 34/269 (13%)
 Frame = +3

Query  90   MAPRKRRGR-LSAVVTSRKvveet--------vqvvvtaaageteYQSQPNVDAFASQVS  242
            MAP+KR GR  + VVT+RKVVEET             T     T+ QSQP V+ F+S   
Sbjct  1    MAPKKRGGRPRTTVVTARKVVEETVSVVVTSPAGETETETQTLTQSQSQPTVEIFSSSTK  60

Query  243  DNGTEQVEVSTPPAQEEPPIVKRTIPVEDKSG--------DESPPPLQNQ---ENEEDET  389
                E  ++ TPP  EEP I KRTI VEDKS         +  P  L+ Q   + +EDET
Sbjct  61   ----ESFDILTPPPSEEP-IPKRTISVEDKSTPQRKKKEQERQPQELEEQRVQQQDEDET  115

Query  390  QPASEPEQIPApplpkkkeeeQTKR-----STRSAPRDggggkrkrkrrwgrSAGSG---  545
            QPASEPE++P PP  +++++ + ++      T  A       ++++++R     G G   
Sbjct  116  QPASEPEEMPTPPKMQEEKKAKKRKPEAAKKTTQAKGGTEEERKRKRKRKRAKVGGGVGP  175

Query  546  -EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSRE  722
             EGY+RYVF+VMKQVHPD+ ISSKAMT++NNLMGDMFERIA EAATLSKY+ RATL+S +
Sbjct  176  SEGYRRYVFRVMKQVHPDMGISSKAMTILNNLMGDMFERIAGEAATLSKYVGRATLASVD  235

Query  723  IQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            IQDAVKLVLPG+LGKHAIAEGTKAVTTY+
Sbjct  236  IQDAVKLVLPGELGKHAIAEGTKAVTTYV  264



>ref|XP_009790638.1| PREDICTED: histone H2B.2-like [Nicotiana sylvestris]
Length=279

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 175/269 (65%), Gaps = 34/269 (13%)
 Frame = +3

Query  90   MAPRKRRGR-LSAVVTSRKvveetv------qvvvtaaageteYQSQPNVDAFASQVSDN  248
            MAP+KR GR  + VVT+RKVVEETV          T    +T  QSQP VD  +S     
Sbjct  1    MAPKKRGGRPRTTVVTARKVVEETVSVVVTPAADETETDTQTLTQSQPTVDILSSSTK--  58

Query  249  GTEQVEVSTPPAQEEPPIVKRTIPVEDKSGDESPPPLQN---------------QENEED  383
              E  ++ TPP  E+P   KRTI VED+S  +     Q                Q+ +ED
Sbjct  59   --ESFDILTPPPSEDP-TPKRTISVEDRSTPQRKKKEQQKEQEKQPQELEEQRVQQQDED  115

Query  384  ETQPASEPEQIPApplpkkkeeeQTKRSTRS-------APRDggggkrkrkrrwgrSAGS  542
            ETQPASEP+++P PP  +++++ Q ++   +          + GG +++++ + G   G 
Sbjct  116  ETQPASEPDEMPTPPKMQEEKKAQKRKPEAAKKAAQAKGGTEEGGKRKRKRAKVGGGVGP  175

Query  543  GEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSRE  722
             EGY+RYVF+VMKQVHPD+ ISSKAMT++NNLMGDMFERIA EAATLSKY+ RATL+S +
Sbjct  176  SEGYRRYVFRVMKQVHPDMGISSKAMTILNNLMGDMFERIAGEAATLSKYVGRATLASVD  235

Query  723  IQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            IQDAVKLVLPG+LGKHAIAEGTKAVTTY+
Sbjct  236  IQDAVKLVLPGELGKHAIAEGTKAVTTYV  264



>ref|XP_006347210.1| PREDICTED: histone H2B.2-like isoform X2 [Solanum tuberosum]
Length=243

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 165/256 (64%), Gaps = 21/256 (8%)
 Frame = +3

Query  90   MAPRKRRGRLSA-VVTSRKvveetvqvvvtaaageteYQSQPNVDAFASQVSDNGTEQVE  266
            MAP+KR GR  A VVT+RKVVEETV VVV+                  SQ      +  E
Sbjct  1    MAPKKRGGRARATVVTARKVVEETVSVVVSGETETE------------SQTLTEENQSFE  48

Query  267  VSTPPAQEEPPIVKRTIPVEDKSGDESP---PPLQNQENEEDETQPASEPEQIPApplpk  437
            + TP   EEP   KRTI V+DKS  +      P   Q+ +E ETQPA EPE++P+PP  +
Sbjct  49   ILTPLPYEEP-TPKRTINVQDKSEGKKAQQRKPDPAQQVDEVETQPADEPEEMPSPPKKE  107

Query  438  kkeeeQTKRSTRSAPRDggggkrkrkrrwgrSAGSG--EGYKRYVFKVMKQVHPDLAISS  611
               ++  KR    A +  GGG  ++K+R     G G  EGY+RYVF+VMKQVHPD+ ISS
Sbjct  108  AVRKKAQKRKPDPAQKAKGGGGERKKKRAKVGGGVGPSEGYRRYVFRVMKQVHPDMGISS  167

Query  612  KAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQDAVKLVLPGDLGKHAIAEGTK  791
            KAM ++NNLMGDMFERIA EAA L+KY  RATL+S +IQDAVKLVLPG+LGKHAIAEGTK
Sbjct  168  KAMMILNNLMGDMFERIANEAAILTKYAGRATLASVDIQDAVKLVLPGELGKHAIAEGTK  227

Query  792  AVTTYLGT--KSNPKP  833
            AV  Y+ +  KS  KP
Sbjct  228  AVANYVTSVEKSKSKP  243



>ref|XP_004241294.1| PREDICTED: histone H2B.1-like [Solanum lycopersicum]
Length=283

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 140/293 (48%), Positives = 174/293 (59%), Gaps = 55/293 (19%)
 Frame = +3

Query  90   MAPRKRRGRLSA-VVTSRKvveetvqvvvtaaageteYQSQPNVDAFASQVSDNGTEQVE  266
            MAP+KR GR+ A VVT+RKVVEETV VVVT  AGETE +SQ      A +      +  E
Sbjct  1    MAPKKRGGRVRATVVTARKVVEETVSVVVTPVAGETETESQ----TLAEE-----NQSFE  51

Query  267  VSTPPAQEEPPIVKRTIPVEDKSGDESPP---PLQNQENEEDETQPASEPEQIPApplpk  437
            + TP   EEP   KRTI V+D S  +  P   P   Q+ +EDETQPA EPE++P+PP  +
Sbjct  52   ILTPAPSEEP-TPKRTINVQDISEGKKAPRRKPDPAQQVDEDETQPADEPEEMPSPPKKE  110

Query  438  kkeeeQTKRSTRSAPR-----------------------DggggkrkrkrrwgrSAGSGE  548
              +++  KR    A R                       D    ++++     ++ G GE
Sbjct  111  SGQKKTQKRKPEPAQRGDEDETQPSEEPEEMPTPPKMEADQRKAQKRKPDPAQKAKGGGE  170

Query  549  ----------------GYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAAT  680
                            GY+RYVF+VMKQVHPD+ ISSKAMTV+NNLMGDMFERIA EAA 
Sbjct  171  RKKKRAKVGGGVGPSEGYRRYVFRVMKQVHPDMGISSKAMTVLNNLMGDMFERIANEAAI  230

Query  681  LSKYISRATLSSREIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGT--KSNPKP  833
            L+KY+ R TL+S +IQDAVKLVLPG+LGKHAIAEGT AV  Y+    KS  KP
Sbjct  231  LTKYVGRTTLASVDIQDAVKLVLPGELGKHAIAEGTNAVANYVTNVEKSKSKP  283



>gb|EYU36118.1| hypothetical protein MIMGU_mgv1a011789mg [Erythranthe guttata]
Length=270

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 155/267 (58%), Gaps = 30/267 (11%)
 Frame = +3

Query  90   MAPRKRRGRLS-AVVTSRKvveetvqvvvtaaageteYQSQPN---VDAFASQVSDNGTE  257
            MAP+KR GR    VVTS KVVEETV+VVVT      E     N   V+  +S    N TE
Sbjct  1    MAPKKRPGRAKKTVVTSTKVVEETVKVVVTPGGSGGEDDDNDNNESVEMISSSTKQN-TE  59

Query  258  QVEVSTPPAQEEPPIVKRTIPVEDKSGDESPPPLQNQENEEDETQPASEPEQI-------  416
             VE+ T   ++E   V RTIPVEDK      P +  QE +EDETQP SEPE         
Sbjct  60   NVEIFTSSPEKE--HVLRTIPVEDKEEQIPAPDIVPQEQDEDETQPYSEPETASTPPRKE  117

Query  417  ---PApplpkkkeeeQTKRSTRSAPRDggggkrkrkrrwgr-------------SAGSGE  548
               P    P +      KR TR         +  ++++                 AG+GE
Sbjct  118  APPPKSSEPLETPPPAEKRETRKKKFQEKAKEAGQEKKATTEKLRPKRRRRSVAGAGAGE  177

Query  549  GYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQ  728
             YKRYVFKVMKQVHP++ ISSKAMT++NNLM DMFER A EAA L KY  R T+SSRE+Q
Sbjct  178  SYKRYVFKVMKQVHPEMGISSKAMTIVNNLMTDMFERFAEEAARLQKYTGRKTMSSREVQ  237

Query  729  DAVKLVLPGDLGKHAIAEGTKAVTTYL  809
             AVKLVLPG+LGKHA+AEG KAVT Y+
Sbjct  238  GAVKLVLPGELGKHAVAEGAKAVTNYV  264



>ref|XP_006347209.1| PREDICTED: histone H2B.2-like isoform X1 [Solanum tuberosum]
Length=273

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 135/286 (47%), Positives = 166/286 (58%), Gaps = 51/286 (18%)
 Frame = +3

Query  90   MAPRKRRGRLSA-VVTSRKvveetvqvvvtaaageteYQSQPNVDAFASQVSDNGTEQVE  266
            MAP+KR GR  A VVT+RKVVEETV VVV+                  SQ      +  E
Sbjct  1    MAPKKRGGRARATVVTARKVVEETVSVVVSGETETE------------SQTLTEENQSFE  48

Query  267  VSTPPAQEEPPIVKRTIPVEDKSGDESP---PPLQNQENEEDETQPASEPEQIPApplpk  437
            + TP   EEP   KRTI V+DKS  +      P   Q+ +E ETQPA EPE++P+PP  +
Sbjct  49   ILTPLPYEEP-TPKRTINVQDKSEGKKAQQRKPDPAQQVDEVETQPADEPEEMPSPPKKE  107

Query  438  kkeeeQTKR------------------------------STRSAPRDggggkrkrkrrwg  527
               ++  KR                                + A +  GGG  ++K+R  
Sbjct  108  AVRKKAQKRKPDPAQRVDEDETQPAEEPEEMPTPPKMEADQKKAQKAKGGGGERKKKRAK  167

Query  528  rSAGSG--EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISR  701
               G G  EGY+RYVF+VMKQVHPD+ ISSKAM ++NNLMGDMFERIA EAA L+KY  R
Sbjct  168  VGGGVGPSEGYRRYVFRVMKQVHPDMGISSKAMMILNNLMGDMFERIANEAAILTKYAGR  227

Query  702  ATLSSREIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGT--KSNPKP  833
            ATL+S +IQDAVKLVLPG+LGKHAIAEGTKAV  Y+ +  KS  KP
Sbjct  228  ATLASVDIQDAVKLVLPGELGKHAIAEGTKAVANYVTSVEKSKSKP  273



>ref|XP_011089975.1| PREDICTED: histone H2B-like [Sesamum indicum]
Length=248

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 139/220 (63%), Gaps = 27/220 (12%)
 Frame = +3

Query  213  NVDAFASQVSDNGTEQVEVSTPPAQEEPPIVKRTIPVEDKSGDESPPPLQNQENEEDETQ  392
            NV+  +S   +   + VEV T    ++ PIVK T PVE+KS +E      +QE +EDETQ
Sbjct  39   NVEVVSSSTKEK--KDVEVLT---VDKEPIVK-TFPVEEKSPEEP-----HQEQDEDETQ  87

Query  393  PASEPEQIPA----------------pplpkkkeeeQTKRSTRSAPRDggggkrkrkrrw  524
            PASEPE  PA                    K+K +EQ K     A +      ++R++R 
Sbjct  88   PASEPENAPAPPRKPVQSPPKKVEEKGGTRKRKAQEQAKIGEEKAQKAERTPAKRRRKRG  147

Query  525  grSAGSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRA  704
              +   GEGYK YV++VMKQVHP++ ISSKAMT+INNLM DMFER+A EAA L KY  R 
Sbjct  148  AAAGVGGEGYKTYVYRVMKQVHPEMGISSKAMTIINNLMSDMFERLAEEAARLQKYTGRR  207

Query  705  TLSSREIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSN  824
            T+SSREIQ AVKLVLPGDLGKHAIAEGTKAV+ Y+   SN
Sbjct  208  TMSSREIQGAVKLVLPGDLGKHAIAEGTKAVSNYVSHVSN  247



>ref|XP_006424424.1| hypothetical protein CICLE_v10029880mg [Citrus clementina]
 gb|ESR37664.1| hypothetical protein CICLE_v10029880mg [Citrus clementina]
Length=260

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  537  GSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSS  716
            G+GE YK YVF+V+KQVHP +AISSKAMTVINNLM DMFERIA EAATLSK+  R T+SS
Sbjct  161  GTGEEYKTYVFRVLKQVHPGMAISSKAMTVINNLMNDMFERIAGEAATLSKHCHRTTMSS  220

Query  717  REIQDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            REIQ AVKLVLPG+LGKHA+AEGTKAVT Y
Sbjct  221  REIQGAVKLVLPGELGKHAVAEGTKAVTNY  250



>gb|KDO60308.1| hypothetical protein CISIN_1g048093mg [Citrus sinensis]
Length=261

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  537  GSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSS  716
            G+GE YK YVF+V+KQVHP +AISSKAMTVINNLM DMFERIA EAATLSK+  R T+SS
Sbjct  162  GTGEEYKTYVFRVLKQVHPGMAISSKAMTVINNLMNDMFERIAGEAATLSKHCHRTTMSS  221

Query  717  REIQDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            REIQ AVKLVLPG+LGKHA+AEGTKAVT Y
Sbjct  222  REIQGAVKLVLPGELGKHAVAEGTKAVTNY  251



>gb|KDP43947.1| hypothetical protein JCGZ_05414 [Jatropha curcas]
Length=259

 Score =   156 bits (394),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            EGYKRYVFKV+KQVHP+L ISS AM++INNLM DMFERI  EAA LS YI R TLSSREI
Sbjct  163  EGYKRYVFKVLKQVHPELKISSMAMSIINNLMKDMFERIVYEAAKLSDYIHRTTLSSREI  222

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            QDAVKLVLPG+LG+HAIAEG+KAVT Y+  K
Sbjct  223  QDAVKLVLPGELGRHAIAEGSKAVTNYMSYK  253



>ref|XP_009770842.1| PREDICTED: late histone H2B.L4-like [Nicotiana sylvestris]
Length=174

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 68/87 (78%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  549  GYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQ  728
            GY RY++KVMKQVHPD+ ISSKAMT+++NLMGDMFERIA  AATLSKY+ R TLSSREIQ
Sbjct  76   GYGRYIYKVMKQVHPDMGISSKAMTILDNLMGDMFERIAEAAATLSKYVGRTTLSSREIQ  135

Query  729  DAVKLVLPGDLGKHAIAEGTKAVTTYL  809
             AVK+VLPG+LGKHAIAEGTKAV  Y+
Sbjct  136  GAVKMVLPGELGKHAIAEGTKAVVIYV  162



>ref|XP_006487988.1| PREDICTED: histone H2B.2-like [Citrus sinensis]
Length=328

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 113/185 (61%), Gaps = 23/185 (12%)
 Frame = +3

Query  264  EVSTPPAQEEPPIVKRTIPVEDK----SGDESPPPLQNQENEEDETQPASEPEQIPAppl  431
            E +TP  +EE      T P  ++    S ++  PP Q++  E+++   A +  Q  A   
Sbjct  153  EAATPAKKEEKKTSIETSPEPEQDVAASAEQEEPPEQSKNKEKEKPNEAQKTAQQEASAA  212

Query  432  pkkkeeeQTKRSTRSAPRDggggkrkrkrrwgrSAGSGEGYKRYVFKVMKQVHPDLAISS  611
             +K   ++ KR  R+                    G GE YK YVF+V+KQVHP +AISS
Sbjct  213  HEKPSSKKRKRGKRNE-------------------GIGEEYKTYVFRVLKQVHPGMAISS  253

Query  612  KAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQDAVKLVLPGDLGKHAIAEGTK  791
            KA+TVINNLM DMFERIA EAA LSK+  R T+SSREIQ AVKLVLPG+LGKHA+AEGTK
Sbjct  254  KAVTVINNLMNDMFERIAGEAAMLSKHCHRTTMSSREIQGAVKLVLPGELGKHAVAEGTK  313

Query  792  AVTTY  806
            AVT Y
Sbjct  314  AVTNY  318



>emb|CDP07013.1| unnamed protein product [Coffea canephora]
Length=290

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  534  AGSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLS  713
             G+  G+KRYV +VMKQVHP+ AISSKAMT++NNLM DMFERIA EA+ LS+Y  R TLS
Sbjct  187  GGTNVGFKRYVLRVMKQVHPECAISSKAMTIVNNLMSDMFERIAEEASRLSRYSWRRTLS  246

Query  714  SREIQDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            S EIQDAVKLVLPG+LGKHAIAEG+KAV TY
Sbjct  247  SWEIQDAVKLVLPGELGKHAIAEGSKAVRTY  277



>ref|XP_004295898.1| PREDICTED: uncharacterized protein LOC101307192 [Fragaria vesca 
subsp. vesca]
Length=327

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  543  GEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSRE  722
            G+GYKRYV+KV KQVHP+L +S+KAM V+NN M DMFER+A EAA L+ Y SR TLSSRE
Sbjct  229  GKGYKRYVYKVFKQVHPELGMSAKAMVVLNNYMNDMFERLAGEAAKLTMYTSRKTLSSRE  288

Query  723  IQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            IQ AVKLVLPG+LGKHA+AEGTKAV+ YL
Sbjct  289  IQGAVKLVLPGELGKHAMAEGTKAVSNYL  317



>ref|XP_010109928.1| Histone H2B.2 [Morus notabilis]
 gb|EXC24904.1| Histone H2B.2 [Morus notabilis]
Length=282

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = +3

Query  534  AGSG-EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATL  710
             G+G E YKRYV KV+KQVHP +AIS+KAMTV+NN+M DMFER+A EAA LS Y  RAT+
Sbjct  182  GGTGREEYKRYVHKVLKQVHPGMAISAKAMTVVNNMMIDMFERLAEEAARLSAYSGRATM  241

Query  711  SSREIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSN  824
            SSREIQ AV+LVLPGDLGKHAIAEG+KAVT Y+ +  +
Sbjct  242  SSREIQGAVRLVLPGDLGKHAIAEGSKAVTNYMSSNDH  279



>ref|XP_002892444.1| hypothetical protein ARALYDRAFT_470878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68703.1| hypothetical protein ARALYDRAFT_470878 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 80/97 (82%), Gaps = 0/97 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ Y+RYV+KVMKQVHPDL I+SKAMTV+N  MGDMFERIA EAA LS Y  R TLSSR
Sbjct  108  AGDEYRRYVYKVMKQVHPDLGITSKAMTVVNMFMGDMFERIAQEAARLSDYTKRKTLSSR  167

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNPK  830
            EI+ AV+LVLPG+L +HA+AEG+KAV+ Y+G  S  +
Sbjct  168  EIEAAVRLVLPGELSRHAVAEGSKAVSNYVGYGSRKR  204



>emb|CAN78957.1| hypothetical protein VITISV_025691 [Vitis vinifera]
Length=217

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
             GEGYKRYV++V+KQVHP L +SSKAMTV++  M DMFERIA EAA LSKY  + TLS+R
Sbjct  118  GGEGYKRYVYRVLKQVHPGLGVSSKAMTVLSGFMNDMFERIAEEAAKLSKYTGKTTLSAR  177

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            EIQ AVKLVLPG+L KHA+AEGTKAV+ Y+
Sbjct  178  EIQGAVKLVLPGELQKHAMAEGTKAVSNYM  207



>ref|XP_008462313.1| PREDICTED: histone H2B type 1-A-like [Cucumis melo]
Length=241

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +3

Query  531  SAGSG-EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRAT  707
            S+GSG EGYKRYVFKV+KQVHP++ IS +AM ++NN M DMF+R+A EA  LSKY    T
Sbjct  136  SSGSGREGYKRYVFKVLKQVHPEIGISGQAMLILNNFMNDMFQRLAEEATKLSKYTGGMT  195

Query  708  LSSREIQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            LSSREIQ AV+LVLPG+LGKHAIAEGTKAV+ Y+
Sbjct  196  LSSREIQGAVRLVLPGELGKHAIAEGTKAVSNYV  229



>ref|XP_002272312.1| PREDICTED: histone H2B [Vitis vinifera]
 emb|CBI17119.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
             GEGYKRYV++V+KQVHP L +SSKAMTV++  M DMFERIA EAA LSKY  + TLS+R
Sbjct  117  GGEGYKRYVYRVLKQVHPGLGVSSKAMTVLSGFMNDMFERIAEEAAKLSKYTGKTTLSAR  176

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            EIQ AVKLVLPG+L KHA+AEGTKAV+ Y+
Sbjct  177  EIQGAVKLVLPGELQKHAMAEGTKAVSNYM  206



>gb|KEH38901.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=227

 Score =   141 bits (355),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  543  GEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSRE  722
            GEGY+RYV++V+KQVHP + ISS+AMT++NNLM DMFE++A EAA L+ Y    TL+SRE
Sbjct  135  GEGYQRYVYRVLKQVHPQMGISSQAMTILNNLMNDMFEKLADEAAKLTAYTKHMTLTSRE  194

Query  723  IQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            IQ AVKLVLPG+LGKHAIAEG KAVT Y+
Sbjct  195  IQGAVKLVLPGELGKHAIAEGAKAVTNYV  223



>ref|NP_172295.1| histone H2B  [Arabidopsis thaliana]
 sp|Q9SGE3.1|H2B2_ARATH RecName: Full=Histone H2B.2; AltName: Full=HTB8 [Arabidopsis 
thaliana]
 gb|AAF18256.1|AC011438_18 T23G18.3 [Arabidopsis thaliana]
 gb|AAF79830.1|AC026875_10 T6D22.26 [Arabidopsis thaliana]
 gb|AAY78605.1| histone H2B family protein [Arabidopsis thaliana]
 gb|AEE28257.1| histone H2B [Arabidopsis thaliana]
Length=243

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 0/94 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ Y+RYV+KVMKQVHPDL I+SKAMTV+N  MGDMFERIA EAA LS Y  R TLSSR
Sbjct  147  AGDEYRRYVYKVMKQVHPDLGITSKAMTVVNMFMGDMFERIAQEAARLSDYTKRRTLSSR  206

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            EI+ AV+LVLPG+L +HA+AEG+KAV+ ++G  S
Sbjct  207  EIEAAVRLVLPGELSRHAVAEGSKAVSNFVGYDS  240



>ref|XP_009356953.1| PREDICTED: probable histone H2B.3 [Pyrus x bretschneideri]
Length=253

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E YK YV+KV+KQVHP + +SSKAMTV+NNLM DMFER+A EAA L+ Y +R TLSSREI
Sbjct  157  EEYKIYVYKVLKQVHPGMGVSSKAMTVLNNLMYDMFERLADEAARLTTYTARKTLSSREI  216

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            Q AV+LVLPGDLG+HA+AEGTKAV+TY
Sbjct  217  QGAVRLVLPGDLGRHAMAEGTKAVSTY  243



>ref|XP_010267330.1| PREDICTED: late histone H2B.2.2-like [Nelumbo nucifera]
Length=233

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YKRYVF+V+KQVHP + ISSKAM V+N  M DMFER+A EA  LS+Y  + TLSSREIQ 
Sbjct  138  YKRYVFRVLKQVHPGMGISSKAMAVLNGFMNDMFERLAGEATRLSQYTGKMTLSSREIQG  197

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            AV+LVLPG+LGKHAIAEGTKAVT Y+  K+
Sbjct  198  AVRLVLPGELGKHAIAEGTKAVTNYMSNKT  227



>ref|XP_009148076.1| PREDICTED: histone H2B.2 [Brassica rapa]
 emb|CDX93584.1| BnaA06g04640D [Brassica napus]
Length=257

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ YKRYV+KVMKQVHPDL ISSKAMTVIN  MGDMFER+AVEAA L+ Y  R TLSSR
Sbjct  161  AGDEYKRYVYKVMKQVHPDLGISSKAMTVINMFMGDMFERLAVEAAKLNDYSKRRTLSSR  220

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLG  812
            EI+ AV+LVLPG+L +HA+AEG+KAV+ ++ 
Sbjct  221  EIEAAVRLVLPGELSRHAVAEGSKAVSNFVA  251



>ref|XP_004487735.1| PREDICTED: histone H2B.2-like [Cicer arietinum]
Length=218

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            Y+RYV++V+KQVHPD+ ISS+AMT++NNLM DMFER+A EAA L+ Y    TLSSREIQ 
Sbjct  128  YQRYVYRVLKQVHPDMGISSQAMTILNNLMNDMFERLADEAAKLNTYTGHMTLSSREIQG  187

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYLGT  815
            AVKLVLPG+LGKHAIAEG KAVT Y+ +
Sbjct  188  AVKLVLPGELGKHAIAEGAKAVTNYISS  215



>ref|XP_010940500.1| PREDICTED: histone H2B.11-like [Elaeis guineensis]
Length=258

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YKRYVF+V+KQVHP +A+SS+AM V++ +M DMFER+A EAA LS+Y  +ATLSSREIQD
Sbjct  167  YKRYVFRVLKQVHPGMAVSSRAMAVLDGMMIDMFERLADEAARLSQYAGKATLSSREIQD  226

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AV+LVLPG+LGKHAI+EGTKAV+ Y+
Sbjct  227  AVRLVLPGELGKHAISEGTKAVSKYM  252



>ref|XP_009387659.1| PREDICTED: histone H2B.3-like [Musa acuminata subsp. malaccensis]
Length=286

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = +3

Query  537  GSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSS  716
            G+G GYKRYVF+V+K VHP + ISS+AM V++ +MGDMFER+A EA+ LS Y  +ATLSS
Sbjct  188  GTGRGYKRYVFRVLKHVHPGMGISSRAMVVLDGMMGDMFERLAGEASRLSTYTGKATLSS  247

Query  717  REIQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            REIQ AV+LVLPG+LGK AI+EGTKAV+ Y+
Sbjct  248  REIQGAVRLVLPGELGKRAISEGTKAVSNYM  278



>ref|XP_007132352.1| hypothetical protein PHAVU_011G087500g [Phaseolus vulgaris]
 gb|ESW04346.1| hypothetical protein PHAVU_011G087500g [Phaseolus vulgaris]
Length=227

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            S EGY+RYV++V+KQVHP++ ISSK MT++NNLM DMFER+A EA+ L  Y    TLSSR
Sbjct  134  SAEGYQRYVYRVLKQVHPEMGISSKCMTILNNLMNDMFERLAGEASKLKDYTGHMTLSSR  193

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            EIQ AVKLVLPG+LGKHAIAEG KAV  +
Sbjct  194  EIQGAVKLVLPGELGKHAIAEGVKAVNNF  222



>ref|XP_006306103.1| hypothetical protein CARUB_v10011530mg [Capsella rubella]
 gb|EOA39001.1| hypothetical protein CARUB_v10011530mg [Capsella rubella]
Length=208

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ Y+RYV+KV+KQVHPDL I+SKAMTV+N  MGDMFERIA EAA LS Y  R TLSSR
Sbjct  112  AGDEYRRYVYKVLKQVHPDLGITSKAMTVVNMFMGDMFERIAQEAARLSDYTKRRTLSSR  171

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            EI+ AV+LVLPG+L +HA+AEG+KA++ Y+   S
Sbjct  172  EIESAVRLVLPGELSRHAVAEGSKAISNYVSYDS  205



>ref|XP_003539797.1| PREDICTED: histone H2B.2-like [Glycine max]
 gb|KHN21089.1| Histone H2B.2 [Glycine soja]
Length=225

 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            S EGY+RYV++V+KQVHP++ ISSK MTV+NNLM DMFER+A EA+ L  Y    TLSSR
Sbjct  132  SVEGYQRYVYRVLKQVHPEMGISSKCMTVLNNLMNDMFERLAFEASKLKDYTGHMTLSSR  191

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            EIQ AV+LVLPG+LGKHAIAEG KAV  Y
Sbjct  192  EIQGAVRLVLPGELGKHAIAEGVKAVNNY  220



>ref|XP_007208559.1| hypothetical protein PRUPE_ppa024155mg [Prunus persica]
 gb|EMJ09758.1| hypothetical protein PRUPE_ppa024155mg [Prunus persica]
Length=305

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YK YV +V+KQVHP + +SSK MTV+NNLM DMFER+A EAA L+KY +R TLSSREIQ 
Sbjct  210  YKIYVHRVLKQVHPGMGVSSKGMTVLNNLMNDMFERLADEAARLTKYTARKTLSSREIQA  269

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AVKLVLPG+LG+HA+AEGTKAV+TY+
Sbjct  270  AVKLVLPGELGRHAMAEGTKAVSTYV  295



>ref|XP_008228022.1| PREDICTED: histone H2B.2 [Prunus mume]
Length=301

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YK YV +V+KQVHP + +SSK MTV+NNLM DMFER+A EAA L+KY +R TLS+REIQ 
Sbjct  206  YKIYVHRVLKQVHPGMGVSSKGMTVLNNLMNDMFERLADEAARLTKYTARKTLSAREIQG  265

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AVKLVLPG+LG+HA+AEGTKAV+TY+
Sbjct  266  AVKLVLPGELGRHAMAEGTKAVSTYV  291



>emb|CDX95087.1| BnaC05g05840D [Brassica napus]
Length=319

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ YKRYV+KVMKQVHPDL ISSKAMTVIN  MGDMFER+AVEAA L+ Y  R TLSSR
Sbjct  152  AGDEYKRYVYKVMKQVHPDLGISSKAMTVINMFMGDMFERLAVEAAKLNDYSKRRTLSSR  211

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLG  812
            EI+ AV+LVLPG+L +HA+AEG+KA++ ++ 
Sbjct  212  EIEAAVRLVLPGELSRHAVAEGSKAISNFVA  242



>ref|XP_008780187.1| PREDICTED: histone H2B.1, embryonic-like [Phoenix dactylifera]
Length=198

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +3

Query  555  KRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQDA  734
            KRYVF+V+KQVHP + +SS+AM V++ +M DMFER+A EAA LS+Y  +ATLSSREIQDA
Sbjct  108  KRYVFRVLKQVHPGMGVSSRAMAVLDGMMADMFERLADEAARLSRYSGKATLSSREIQDA  167

Query  735  VKLVLPGDLGKHAIAEGTKAVTTYL  809
            V+LVLPG+LGKHAI+EGTKAV+ Y+
Sbjct  168  VRLVLPGELGKHAISEGTKAVSNYM  192



>ref|XP_008359166.1| PREDICTED: histone H2B.2-like [Malus domestica]
Length=251

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YK YV+KV+KQVHP + +SSKAMTV+NNLM DMFE++A EAA L+ Y +R TLSSREIQ 
Sbjct  157  YKTYVYKVLKQVHPGMGVSSKAMTVLNNLMNDMFEKLADEAARLTTYTARKTLSSREIQG  216

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AVKLVL G+LG+HA+AEGTKAV+TY+
Sbjct  217  AVKLVLTGELGRHAMAEGTKAVSTYV  242



>gb|KFK43131.1| hypothetical protein AALP_AA1G084200 [Arabis alpina]
Length=228

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ YKRYV+KVMKQVHP+L I+SKAM+VIN  M DMFERIA EAA L+ Y  R TLSSR
Sbjct  132  AGDEYKRYVYKVMKQVHPELGITSKAMSVINMFMRDMFERIAEEAARLNDYTKRRTLSSR  191

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLG  812
            EI+ AV+LVLPG+L +HA+AEGTKA++ Y G
Sbjct  192  EIEAAVRLVLPGELSRHAVAEGTKAISNYFG  222



>ref|XP_010475607.1| PREDICTED: histone H2B.2-like [Camelina sativa]
Length=207

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ Y+RYV+KV+KQVHP+L I+SKAMTV+N  MGDMFERIA EAA L  Y  R TLSSR
Sbjct  111  AGDEYRRYVYKVLKQVHPELGITSKAMTVVNMFMGDMFERIAQEAARLGDYTKRRTLSSR  170

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            EI+ AV+LVLPG+L +HA+AEG+KA++ Y+   S
Sbjct  171  EIEAAVRLVLPGELSRHAVAEGSKAISNYVAYDS  204



>ref|XP_010458048.1| PREDICTED: histone H2B.2-like [Camelina sativa]
Length=206

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ Y+RYV+KV+KQVHP+L I+SKAMTV+N  MGDMFERIA EAA L  Y  R TLSSR
Sbjct  108  AGDEYRRYVYKVLKQVHPELGITSKAMTVVNMFMGDMFERIAQEAARLGDYTKRRTLSSR  167

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            EI+ AV+LVLPG+L +HA+AEG+KA+  Y+   S
Sbjct  168  EIESAVRLVLPGELSRHAVAEGSKAINNYVAYDS  201



>ref|XP_010488523.1| PREDICTED: histone H2B.2-like [Camelina sativa]
Length=206

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            +G+ Y+RYV+KV+KQVHP+L I+SKAMTV+N  MGDMFERI+ EAA L  Y  R TLSSR
Sbjct  110  AGDEYRRYVYKVLKQVHPELGITSKAMTVVNMFMGDMFERISQEAARLGDYTKRRTLSSR  169

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            EI+ AV+LVLPG+L +HA+AEG+KA++ Y+   S
Sbjct  170  EIEAAVRLVLPGELSRHAVAEGSKAISNYVAYDS  203



>ref|XP_006417719.1| hypothetical protein EUTSA_v10008775mg [Eutrema salsugineum]
 gb|ESQ36072.1| hypothetical protein EUTSA_v10008775mg [Eutrema salsugineum]
Length=210

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +3

Query  534  AGSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLS  713
            AG  E YKRYV+KVMKQVHP+L I+SKAM+VIN  MGDMFERIA EAA LS +  R TLS
Sbjct  113  AGDHE-YKRYVYKVMKQVHPELGITSKAMSVINTFMGDMFERIAEEAARLSDHTKRRTLS  171

Query  714  SREIQDAVKLVLPGDLGKHAIAEGTKAVTTYLG  812
            SREI+ AV+LVLPG+L +HA++EG KA++ Y+ 
Sbjct  172  SREIEAAVRLVLPGELSRHAVSEGAKAISNYVA  204



>ref|XP_010239460.1| PREDICTED: histone H2B-like [Brachypodium distachyon]
Length=256

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YKRYV++V+KQVHPD+  S +AM V++ +MGDMFER+A EAA L+K   RATLSSRE+Q+
Sbjct  168  YKRYVYRVLKQVHPDMGASGRAMEVLDMMMGDMFERLADEAARLAKVAGRATLSSREVQN  227

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AV+LVLPG+L KHAI+EGTKAVT+Y+
Sbjct  228  AVRLVLPGELAKHAISEGTKAVTSYM  253



>ref|XP_002736940.1| PREDICTED: late histone H2B.L3-like isoform X1 [Saccoglossus 
kowalevskii]
Length=125

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ +SSKAM+++N+ + D+FERIA EAA L++Y  R+T+SSREI
Sbjct  34   ESYNSYIYKVLKQVHPDVGVSSKAMSIMNSFVNDIFERIATEAAKLAQYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            Q AV+L+LPG+L KHA++EGTKAVT Y  + S
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSTS  125



>ref|XP_002462010.1| hypothetical protein SORBIDRAFT_02g012500 [Sorghum bicolor]
 gb|EER98531.1| hypothetical protein SORBIDRAFT_02g012500 [Sorghum bicolor]
Length=299

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YKRYV++V+KQVHPDL +S  AM V++ +M DMFER+A EAA LSK   R TL+SRE+Q 
Sbjct  211  YKRYVWRVLKQVHPDLGVSGHAMQVLDMMMADMFERLADEAARLSKATGRMTLTSREVQS  270

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AV+LVLPGDLGKHAIAEGTKA++ Y+
Sbjct  271  AVRLVLPGDLGKHAIAEGTKAISKYM  296



>gb|KHN38694.1| Histone H2B.2, partial [Glycine soja]
Length=130

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            EGY+RYV+ V+KQVHP++ ISSK MT +NNLM DMFER+  E + L+ Y    TLSSREI
Sbjct  39   EGYQRYVYGVLKQVHPEMGISSKCMTALNNLMNDMFERLTFEVSKLTDYTGHMTLSSREI  98

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            Q  V+LVLPG+L KHAIAEG KAV  Y
Sbjct  99   QGVVRLVLPGELEKHAIAEGVKAVNNY  125



>ref|XP_006819186.1| PREDICTED: late histone H2B.L3-like isoform X2 [Saccoglossus 
kowalevskii]
Length=130

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ +SSKAM+++N+ + D+FERIA EAA L++Y  R+T+SSREI
Sbjct  39   ESYSSYIYKVLKQVHPDVGVSSKAMSIMNSFVNDIFERIATEAAKLAQYNKRSTISSREI  98

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            Q AV+L+LPG+L KHA++EGTKAVT Y  + S
Sbjct  99   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSTS  130



>gb|EYC33910.1| hypothetical protein Y032_0001g157 [Ancylostoma ceylanicum]
 gb|KIH53053.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH66027.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=123

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>gb|EYC33915.1| hypothetical protein Y032_0001g161 [Ancylostoma ceylanicum]
Length=123

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_003145586.1| hypothetical protein LOAG_10011 [Loa loa]
 gb|EFO18484.1| hypothetical protein LOAG_10011 [Loa loa]
Length=122

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIAVEA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSAYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAVEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_005430619.1| PREDICTED: histone H2B, gonadal-like [Geospiza fortis]
Length=118

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E +  Y++KV+KQVHPDLAISSKAM+++N+ + DM ER+A EAA L++Y  RATLSSRE+
Sbjct  28   EAFSVYIYKVLKQVHPDLAISSKAMSIMNSFVNDMLERLAAEAACLAQYGRRATLSSREV  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L +HA++EGTKAVT Y   K
Sbjct  88   QAAVRLLLPGELAQHAVSEGTKAVTKYTSGK  118



>gb|EYB97092.1| hypothetical protein Y032_0143g2381 [Ancylostoma ceylanicum]
 gb|EYB97110.1| hypothetical protein Y032_0143g2397 [Ancylostoma ceylanicum]
 gb|EYC00843.1| hypothetical protein Y032_0112g292 [Ancylostoma ceylanicum]
 gb|EYC41372.1| hypothetical protein Y032_0571g117 [Ancylostoma ceylanicum]
 gb|EYC41376.1| hypothetical protein Y032_0571g121 [Ancylostoma ceylanicum]
 gb|EYC41380.1| hypothetical protein Y032_0571g125 [Ancylostoma ceylanicum]
 gb|EYC41384.1| hypothetical protein Y032_0571g129 [Ancylostoma ceylanicum]
 gb|EYC41388.1| hypothetical protein Y032_0571g133 [Ancylostoma ceylanicum]
Length=123

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>gb|EYB97097.1| hypothetical protein Y032_0143g2386 [Ancylostoma ceylanicum]
Length=123

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>gb|EYB97104.1| hypothetical protein Y032_0143g2392 [Ancylostoma ceylanicum]
 gb|KIH45093.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH46075.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH54219.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=123

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_003146042.1| hypothetical protein LOAG_10470 [Loa loa]
 gb|EFO18028.1| hypothetical protein LOAG_10470 [Loa loa]
 gb|EJW81676.1| hypothetical protein WUBG_07415 [Wuchereria bancrofti]
Length=122

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T+SSREI
Sbjct  32   ESYSAYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAQYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>emb|CDQ04389.1| Protein Bm2874, isoform b [Brugia malayi]
Length=125

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T+SSREI
Sbjct  32   ESYSAYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAQYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>emb|CEG72832.1| Putative Histone H2B [Rhizopus microsporus]
 emb|CEI94528.1| Putative Histone H2B [Rhizopus microsporus]
Length=117

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  27   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIATEASKLAAYNKRSTISSREI  86

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  87   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  117



>ref|XP_007126742.1| PREDICTED: late histone H2B.2.2-like [Physeter catodon]
Length=122

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  RATL+SREI
Sbjct  32   ETYSVYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLAGEAARLAQYSGRATLTSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_010989727.1| PREDICTED: late histone H2B.L4-like [Camelus dromedarius]
Length=124

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPDL ISSKAM+++N+ + D+FE++A EAA L++Y SR TL+SRE+
Sbjct  34   ETYSMYIYKVLKQVHPDLGISSKAMSIMNSFVNDVFEQLAGEAARLAQYSSRTTLTSREV  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>gb|ETN87290.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|ETN87293.1| core histone H2A/H2B/H3/H4 [Necator americanus]
Length=123

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASKLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_010950778.1| PREDICTED: late histone H2B.L4-like [Camelus bactrianus]
 gb|EPY88406.1| histone H2B 7-like protein [Camelus ferus]
Length=123

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPDL ISSKAM+++N+ + D+FE++A EAA L++Y SR TL+SRE+
Sbjct  33   ETYSMYIYKVLKQVHPDLGISSKAMSIMNSFVNDVFEQLAGEAARLAQYSSRTTLTSREV  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_009202496.1| PREDICTED: late histone H2B.L4-like [Papio anubis]
Length=122

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ IS+KAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  32   ESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFERLACEAARLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>emb|CEJ01207.1| Putative Histone H2B [Rhizopus microsporus]
Length=121

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  31   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIATEASKLAAYNKRSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  121



>gb|EIE91736.1| histone H2B [Rhizopus delemar RA 99-880]
Length=118

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  28   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  88   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  118



>gb|ACD37587.1| histone H2B [Philodina roseola]
 gb|ACF75520.1| histone H2B [Philodina roseola]
Length=128

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  R+T+SSREI
Sbjct  38   ETYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKRSTISSREI  97

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y   K
Sbjct  98   QTAVRLLLPGELAKHAVSEGTKAVTKYTSAK  128



>gb|AAC15915.1| histone H2B [Chaetopterus variopedatus]
Length=123

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KVMKQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYSIYVYKVMKQVHPDTGISSKAMSIMNSFVNDLFERIASEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>gb|KHJ80430.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHJ92629.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHJ92630.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
Length=123

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>gb|EYC33906.1| hypothetical protein Y032_0001g153 [Ancylostoma ceylanicum]
Length=169

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  79   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  138

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  139  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  169



>gb|ACD37544.1| histone H2B [Adineta vaga]
 gb|ACF75485.1| histone H2B [Adineta vaga]
Length=128

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  R+T+SSREI
Sbjct  38   ETYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKRSTISSREI  97

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y   K
Sbjct  98   QTAVRLLLPGELAKHAVSEGTKAVTKYTSAK  128



>gb|EIE83419.1| histone H2B [Rhizopus delemar RA 99-880]
Length=123

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>emb|CEG72837.1| Putative Histone H2B [Rhizopus microsporus]
 emb|CEI94534.1| Putative Histone H2B [Rhizopus microsporus]
Length=121

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  31   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIATEASKLAAYNKRSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  121



>emb|CEG72769.1| Putative Histone H2B [Rhizopus microsporus]
 emb|CEI89428.1| Putative Histone H2B [Rhizopus microsporus]
Length=119

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  29   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIATEASKLAAYNKRSTISSREI  88

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  89   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  119



>gb|EIE83508.1| histone H2B [Rhizopus delemar RA 99-880]
 gb|EIE83518.1| histone H2B [Rhizopus delemar RA 99-880]
Length=118

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  28   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  88   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  118



>ref|XP_005369963.1| PREDICTED: histone H2B type 1-M-like [Microtus ochrogaster]
Length=126

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIAVEA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAVEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>emb|CAX71745.1| Histone H2B [Schistosoma japonicum]
Length=122

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV++QVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  ++T+SSRE+
Sbjct  32   ESYAIYIYKVLRQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKKSTISSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPGDL KHA++EGTKAVT Y G+K
Sbjct  92   QTAVRLLLPGDLAKHAVSEGTKAVTKYSGSK  122



>ref|XP_005369959.1| PREDICTED: histone H2B type 1-P-like [Microtus ochrogaster]
Length=126

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIAVEA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAVEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>emb|CEI96848.1| Putative Histone H2B [Rhizopus microsporus]
Length=119

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  29   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIATEASKLAAYNKRSTISSREI  88

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  89   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  119



>gb|EYB95536.1| hypothetical protein Y032_0158g3224 [Ancylostoma ceylanicum]
 gb|EYB95540.1| hypothetical protein Y032_0158g3228 [Ancylostoma ceylanicum]
Length=123

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>gb|ACD37576.1| histone H2B [Philodina roseola]
Length=128

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  R+T+SSREI
Sbjct  38   ETYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKRSTISSREI  97

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y   K
Sbjct  98   QTAVRLLLPGELAKHAVSEGTKAVTKYTSAK  128



>ref|XP_006211360.1| PREDICTED: late histone H2B.2.2-like [Vicugna pacos]
Length=124

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPDL ISSKAM+++N+ + D+FE++A EAA L++Y SR TL+SRE+
Sbjct  34   ETYSMYIYKVLKQVHPDLGISSKAMSIMNSFVNDVFEQLAGEAARLAQYSSRTTLTSREV  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_007165545.1| PREDICTED: histone H2B-like [Balaenoptera acutorostrata scammoni]
Length=122

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SREI
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLAGEAARLAQYSGRTTLTSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_001892004.1| histone H2B 2 [Brugia malayi]
 gb|EJW80940.1| histone H2B [Wuchereria bancrofti]
 emb|CDP93709.1| Protein Bm3206 [Brugia malayi]
 emb|CDQ05465.1| Protein Bm3424 [Brugia malayi]
Length=122

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSAYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>gb|ACF75502.1| histone H2B [Philodina roseola]
Length=128

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  R+T+SSREI
Sbjct  38   ETYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKRSTISSREI  97

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y   K
Sbjct  98   QTAVRLLLPGELAKHAVSEGTKAVTKYTSAK  128



>gb|EPB84099.1| histone H2B.2 [Mucor circinelloides f. circinelloides 1006PhL]
Length=120

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  30   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  89

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  90   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  120



>gb|EPB84094.1| histone H2B [Mucor circinelloides f. circinelloides 1006PhL]
Length=117

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  27   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  86

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  87   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  117



>emb|CDJ97864.1| Histone core domain containing protein [Haemonchus contortus]
 gb|ETN79213.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|EYC03806.1| hypothetical protein Y032_0091g2436 [Ancylostoma ceylanicum]
 gb|KIH47244.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=123

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L++Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAQYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_004312221.1| PREDICTED: histone H2B 7-like [Tursiops truncatus]
Length=122

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SREI
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLAGEAARLAQYSGRTTLTSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>gb|AAH66243.1| HIST1H2BA protein, partial [Homo sapiens]
Length=126

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  36   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_008686827.1| PREDICTED: late histone H2B.L4-like [Ursus maritimus]
Length=122

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLAGEAARLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_001854001.1| histone H2B.3 [Culex quinquefasciatus]
 gb|EDS34375.1| histone H2B.3 [Culex quinquefasciatus]
Length=132

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  RAT+SSREI
Sbjct  42   ESYGMYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAQYNKRATISSREI  101

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  102  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  132



>gb|EHH52824.1| Histone H2B.e [Macaca fascicularis]
Length=126

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            EGY  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   EGYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_005609614.1| PREDICTED: histone H2B, gonadal-like [Equus caballus]
 ref|XP_008537984.1| PREDICTED: late histone H2B.L4-like [Equus przewalskii]
Length=122

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLAGEAAQLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_005788746.1| putative histone H2B [Emiliania huxleyi CCMP1516]
 gb|EOD36317.1| putative histone H2B [Emiliania huxleyi CCMP1516]
Length=119

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D FERIAVEA  L +Y  + TLSSREI
Sbjct  29   ESYSSYIYKVLKQVHPDTGISSKAMSIMNSFINDAFERIAVEAGKLVRYNKKGTLSSREI  88

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            Q AV+L+LPG+L KHA++EGTKAVT Y
Sbjct  89   QTAVRLILPGELAKHAVSEGTKAVTKY  115



>ref|XP_005679744.1| PREDICTED: late histone H2B.2.2-like [Capra hircus]
 ref|XP_010855662.1| PREDICTED: late histone H2B.L4-like [Bison bison bison]
Length=122

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDLFERLAGEAARLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>gb|EPB86449.1| histone H2B.1 [Mucor circinelloides f. circinelloides 1006PhL]
Length=122

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>gb|KHN75679.1| Histone H2B 1 [Toxocara canis]
Length=121

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T+SSREI
Sbjct  31   ESYSVYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAQYNKRSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  121



>ref|XP_007883036.1| PREDICTED: late histone H2B.L4-like isoform X1 [Callorhinchus 
milii]
 ref|XP_007883037.1| PREDICTED: late histone H2B.L4-like isoform X2 [Callorhinchus 
milii]
Length=166

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KVMKQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  76   ESYSIYVYKVMKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAQYNKRSTITSREI  135

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  136  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  166



>ref|XP_005812320.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
Length=124

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_007485417.1| PREDICTED: histone H2B type 1-F/J/L-like isoform X1 [Monodelphis 
domestica]
Length=144

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNPKPN*CISALFYL  863
            Q AV+L+LPG+L KHA++EGTKAVT Y  +KS   P  C + L  L
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSKSAFSP--CSAILARL  139



>ref|XP_005553794.1| PREDICTED: histone H2B type 1-F/J/L-like isoform X1 [Macaca fascicularis]
 ref|XP_005553795.1| PREDICTED: histone H2B type 1-F/J/L-like isoform X2 [Macaca fascicularis]
Length=127

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            Q AV+L+LPG+L KHA++EGTKAVT Y  +KS
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSKS  127



>gb|ETN87292.1| core histone H2A/H2B/H3/H4 [Necator americanus]
Length=144

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASKLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>gb|AAH66241.1| HIST1H2BA protein [Homo sapiens]
Length=127

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  37   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>ref|XP_003192480.1| histone h2b [Cryptococcus gattii WM276]
 gb|ADV20693.1| Histone h2b, putative [Cryptococcus gattii WM276]
 gb|KGB80289.1| histone H2B [Cryptococcus gattii R265]
Length=139

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  49   ESYSSYIYKVLKQVHPDTGISNKAMSILNSFVSDIFERIATEASKLASYNHRSTISSREI  108

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q +V+L+LPG+L KHAI+EGTKAVT Y  +K
Sbjct  109  QTSVRLILPGELSKHAISEGTKAVTKYSSSK  139



>ref|XP_004043408.1| PREDICTED: histone H2B type 1-A-like [Gorilla gorilla gorilla]
Length=127

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  37   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>ref|XP_007981698.1| PREDICTED: late histone H2B.L4-like [Chlorocebus sabaeus]
Length=151

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ IS+KAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  61   ESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFERLACEAARLAQYSGRTTLTSREV  120

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  121  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  151



>gb|ACD37559.1| histone H2B [Adineta vaga]
 gb|ACF75494.1| histone H2B [Adineta vaga]
Length=128

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA E++ LS Y  R+T+SSREI
Sbjct  38   ETYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAESSRLSHYNKRSTISSREI  97

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y   K
Sbjct  98   QTAVRLLLPGELAKHAVSEGTKAVTKYTSAK  128



>ref|NP_733759.1| histone H2B type 1-A [Homo sapiens]
 ref|XP_527247.1| PREDICTED: histone H2B type 1-A [Pan troglodytes]
 ref|XP_003823261.1| PREDICTED: histone H2B type 1-A [Pan paniscus]
 sp|Q96A08.3|H2B1A_HUMAN RecName: Full=Histone H2B type 1-A; AltName: Full=Histone H2B, 
testis; Short=TSH2B.1; AltName: Full=Testis-specific histone 
H2B [Homo sapiens]
 gb|AAK84040.1|AF397301_1 testis-specific histone H2B [Homo sapiens]
 gb|AAN06684.1| histone H2B [Homo sapiens]
 gb|AAH66238.1| Histone cluster 1, H2ba [Homo sapiens]
 gb|AAH66239.1| Histone cluster 1, H2ba [Homo sapiens]
 gb|AAH66242.1| Histone cluster 1, H2ba [Homo sapiens]
 gb|EAW55490.1| histone 1, H2ba [Homo sapiens]
 dbj|BAG34991.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20859.1| histone cluster 1, H2ba [synthetic construct]
 gb|AIC61599.1| HIST1H2BA, partial [synthetic construct]
Length=127

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  37   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>ref|XP_002044885.1| GM18809 [Drosophila sechellia]
 gb|EDW45604.1| GM18809 [Drosophila sechellia]
Length=98

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  8    ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  67

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  68   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  98



>gb|EYB97109.1| hypothetical protein Y032_0143g2397 [Ancylostoma ceylanicum]
Length=170

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  80   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  139

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  140  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  170



>ref|XP_005768681.1| hypothetical protein EMIHUDRAFT_66183 [Emiliania huxleyi CCMP1516]
 ref|XP_005769908.1| hypothetical protein EMIHUDRAFT_65952 [Emiliania huxleyi CCMP1516]
 ref|XP_005770913.1| hypothetical protein EMIHUDRAFT_196782 [Emiliania huxleyi CCMP1516]
 ref|XP_005779253.1| putative histone H2B [Emiliania huxleyi CCMP1516]
 ref|XP_005793618.1| putative histone H2B [Emiliania huxleyi CCMP1516]
 gb|EOD16252.1| hypothetical protein EMIHUDRAFT_66183 [Emiliania huxleyi CCMP1516]
 gb|EOD17479.1| hypothetical protein EMIHUDRAFT_65952 [Emiliania huxleyi CCMP1516]
 gb|EOD18484.1| hypothetical protein EMIHUDRAFT_196782 [Emiliania huxleyi CCMP1516]
 gb|EOD26824.1| putative histone H2B [Emiliania huxleyi CCMP1516]
 gb|EOD41189.1| putative histone H2B [Emiliania huxleyi CCMP1516]
Length=120

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D FERIAVEA  L +Y  + TLSSREI
Sbjct  30   ESYSSYIYKVLKQVHPDTGISSKAMSIMNSFINDAFERIAVEAGKLVRYNKKGTLSSREI  89

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            Q AV+L+LPG+L KHA++EGTKAVT Y
Sbjct  90   QTAVRLILPGELAKHAVSEGTKAVTKY  116



>ref|XP_002298166.2| hypothetical protein POPTR_0001s21970g [Populus trichocarpa]
 gb|EEE82971.2| hypothetical protein POPTR_0001s21970g [Populus trichocarpa]
Length=261

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +3

Query  555  KRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQDA  734
            KRYVFKV+KQVHPDL ISS AM++IN+L+ DMFERIA EAA LS Y  R TLSS EIQ A
Sbjct  172  KRYVFKVLKQVHPDLGISSMAMSMINSLINDMFERIAEEAAKLSDYRKRTTLSSGEIQGA  231

Query  735  VKLVLPGDLGKHAIAEGTKAVTTYL  809
            VKLVLPG+LGKHAIAEG++A   Y+
Sbjct  232  VKLVLPGELGKHAIAEGSEAGPNYI  256



>ref|XP_002816540.1| PREDICTED: histone H2B type 1-A [Pongo abelii]
Length=127

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  37   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTISSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>ref|XP_009241717.1| PREDICTED: late histone H2B.L4-like [Pongo abelii]
Length=151

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ IS+KAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  61   ESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFERLACEAARLAQYSGRTTLTSREV  120

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  121  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  151



>ref|XP_005817709.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
 ref|XP_007541927.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
 ref|XP_007545197.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
 ref|XP_008421089.1| PREDICTED: histone H2B 1/2-like [Poecilia reticulata]
Length=124

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>gb|ETN72913.1| core histone H2A/H2B/H3/H4, partial [Necator americanus]
Length=103

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SS+AM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  13   ESYSVYIYRVLKQVHPDTGVSSRAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  72

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  73   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  103



>ref|XP_008311574.1| PREDICTED: histone H2B 1/2-like [Cynoglossus semilaevis]
Length=125

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  35   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_009098006.1| PREDICTED: late histone H2B.L4-like [Serinus canaria]
Length=118

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E +  Y++KV+KQVHPDLAISSKAM+++N+ + DM ER+A EA+ L++Y  RATL+SRE+
Sbjct  28   EAFSVYIYKVLKQVHPDLAISSKAMSIMNSFVNDMLERLAAEASRLAQYGRRATLTSREV  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q A +L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  88   QAAARLLLPGELAKHAVSEGTKAVTKYTSSK  118



>ref|XP_008331666.1| PREDICTED: histone H2B 1/2-like [Cynoglossus semilaevis]
 ref|XP_008331673.1| PREDICTED: histone H2B 1/2-like [Cynoglossus semilaevis]
Length=125

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  35   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVSDIFERIAGEASRLAQYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>emb|CBM82447.1| histone H2B-II protein [Rhabdopleura compacta]
Length=122

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_003976987.1| PREDICTED: histone H2B 1/2-like [Takifugu rubripes]
Length=125

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+V+N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  35   ESYAIYVYKVLKQVHPDTGISSKAMSVMNSFVNDIFERIASEASRLAQYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_008326606.1| PREDICTED: histone H2B 1/2, partial [Cynoglossus semilaevis]
Length=113

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KVMKQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  23   ESYAIYVYKVMKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  82

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  83   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  113



>ref|XP_005198229.2| PREDICTED: late histone H2B.L4-like [Bos taurus]
 ref|XP_005206017.2| PREDICTED: late histone H2B.L4-like [Bos taurus]
Length=148

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDLFERLAGEAARLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_006008791.1| PREDICTED: histone H2B 7-like [Latimeria chalumnae]
Length=125

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  35   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_001862652.1| histone H2B.1/H2B.2 [Culex quinquefasciatus]
 gb|EDS37344.1| histone H2B.1/H2B.2 [Culex quinquefasciatus]
Length=124

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = +3

Query  531  SAGSGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATL  710
            SAG  E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+
Sbjct  30   SAGK-ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTI  88

Query  711  SSREIQDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            +SREIQ AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  89   TSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>pdb|3WKJ|D Chain D, The Nucleosome Containing Human Tsh2b
 pdb|3WKJ|H Chain H, The Nucleosome Containing Human Tsh2b
Length=130

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  40   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREI  99

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  100  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  130



>ref|XP_009980137.1| PREDICTED: histone H2B 8 [Tauraco erythrolophus]
 ref|XP_010223169.1| PREDICTED: histone H2B 8 [Tinamus guttatus]
 gb|KFV13535.1| Histone H2B 8 [Tauraco erythrolophus]
 gb|KGL84314.1| Histone H2B 8 [Tinamus guttatus]
Length=126

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+LGKHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELGKHAVSEGTKAVTKYTSSK  126



>ref|XP_007574089.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
Length=124

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAQYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_001895510.1| Probable histone H2B 3 [Brugia malayi]
Length=211

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T+SSREI
Sbjct  121  ESYSAYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAQYNKRSTISSREI  180

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  181  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  211



>sp|P83863.2|H2B_LITVA RecName: Full=Histone H2B, partial [Litopenaeus vannamei]
Length=116

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  26   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  85

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  86   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  116



>ref|XP_008670031.1| PREDICTED: histone H2B.5-like [Zea mays]
 tpg|DAA39593.1| TPA: hypothetical protein ZEAMMB73_689930 [Zea mays]
Length=262

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            Y+RYV++V+KQVHPDL +S  AM V++ +M DMFER+A EAA LSK   RATL+SRE+Q 
Sbjct  173  YRRYVWRVLKQVHPDLGVSGHAMQVLDMMMADMFERLAEEAARLSKATGRATLTSREVQS  232

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AV+LVLPG+LG+HAI+EGTKA++ Y+
Sbjct  233  AVRLVLPGELGRHAISEGTKAISKYM  258



>gb|ETE56555.1| Histone H2B 1/2/3/4/6, partial [Ophiophagus hannah]
Length=126

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_006920675.1| PREDICTED: histone H2B-like [Pteropus alecto]
 gb|ELK05167.1| Histone H2B.3 [Pteropus alecto]
Length=122

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EA+ L++Y  R TL+SRE+
Sbjct  32   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDVFERLASEASRLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>gb|EMP24768.1| Histone H2B 7 [Chelonia mydas]
Length=121

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  31   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVSDLFERIAAEASRLALYNKRSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  121



>gb|ACG23906.1| histone H2B [Zea mays]
Length=272

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            Y+RYV++V+KQVHPDL +S  AM V++ +M DMFER+A EAA LSK   RATL+SRE+Q 
Sbjct  183  YRRYVWRVLKQVHPDLGVSGHAMQVLDMMMADMFERLAEEAARLSKATGRATLTSREVQS  242

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AV+LVLPG+LG+HAI+EGTKA++ Y+
Sbjct  243  AVRLVLPGELGRHAISEGTKAISKYM  268



>ref|XP_007574074.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
Length=124

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAQYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_004387130.1| PREDICTED: histone H2B type 1-F/J/L-like [Trichechus manatus 
latirostris]
Length=126

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTISSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>emb|CBM82450.1| histone H2B-I protein [Balanoglossus clavigerus]
Length=122

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KVMKQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  32   ESYGIYIYKVMKQVHPDTGISSKAMSIMNSFVSDIFERIAAEASRLANYNKRSTITSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>emb|CBM82449.1| histone H2B-III protein [Rhabdopleura compacta]
Length=122

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_005899072.1| PREDICTED: late histone H2B.2.2-like [Bos mutus]
Length=122

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++K++KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  32   ETYSMYIYKLLKQVHPDIGISSKAMSIMNSFVNDLFERLAGEAAWLAQYSGRTTLTSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_005194087.1| PREDICTED: late histone H2B.L4-like [Bos taurus]
 ref|XP_010808826.1| PREDICTED: late histone H2B.L4-like [Bos taurus]
Length=141

 Score =   125 bits (313),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  51   ETYSMYIYKVLKQVHPDIGISSKAMSIMNSFVNDLFERLAGEAARLAQYSGRTTLTSREV  110

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  111  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  141



>ref|XP_006661574.1| PREDICTED: histone H2B.3-like [Oryza brachyantha]
Length=178

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            YKRYV++V+KQVHPD+  S + M V++ +M DMFER+A EA+ LSK   RATL+SRE+Q 
Sbjct  92   YKRYVWRVLKQVHPDMGASGRTMDVLDTMMSDMFERLAEEASRLSKVSGRATLTSREVQS  151

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYL  809
            AV+LVLPGDL  HAI+EGTKAV+ YL
Sbjct  152  AVRLVLPGDLANHAISEGTKAVSNYL  177



>ref|XP_001865496.1| late histone H2B.L4 [Culex quinquefasciatus]
 gb|EDS41768.1| late histone H2B.L4 [Culex quinquefasciatus]
Length=127

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  37   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAQYNKRSTITSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>ref|XP_002422651.1| histone H2B.3, putative [Pediculus humanus corporis]
 ref|XP_002430916.1| histone H2B.3, putative [Pediculus humanus corporis]
 gb|EEB09913.1| histone H2B.3, putative [Pediculus humanus corporis]
 gb|EEB18178.1| histone H2B.3, putative [Pediculus humanus corporis]
Length=123

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>gb|KIH43801.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=120

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIAVEA+ L++Y  R+T+SSREI
Sbjct  30   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAVEASRLAQYNKRSTISSREI  89

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KH ++EGTKAVT Y  +K
Sbjct  90   QTAVRLILPGELAKHDVSEGTKAVTKYNSSK  120



>gb|KFH66463.1| histone H2B [Mortierella verticillata NRRL 6337]
Length=136

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  46   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIAGEASKLAAYNKRSTISSREI  105

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  106  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  136



>emb|CBM82445.1| histone H2B-I protein [Rhabdopleura compacta]
Length=122

 Score =   124 bits (311),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_010034182.1| PREDICTED: histone H2B.5-like [Eucalyptus grandis]
Length=254

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 84/210 (40%), Positives = 112/210 (53%), Gaps = 25/210 (12%)
 Frame = +3

Query  240  SDNGTEQVEVSTPPAQEEPPIVKRTIPVEDKSGDESPP-----PLQNQENEEDETQPASE  404
            ++NG E     T   + E  +VK T+ VEDK  +E+       P++    +E  T+    
Sbjct  36   AENGVE-----TLQQESENEVVKTTVTVEDKLAEEAEQVTVEIPVRQPPQKETATEAPRT  90

Query  405  PEQIPApplpkkkeeeQTKRSTRSAPRDggggkrkrkrrwgrSAGSGEG-----------  551
            P Q  A    ++++  Q  +  R    D     + ++ R       G             
Sbjct  91   PRQPEAKDKTQRQKTAQEAKKDRREQEDVEAKNQPKRAREVDEKARGGRRRRRRRVGEGG  150

Query  552  ----YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
                YKRYVF+V+KQVHP L ISS AM V+N  M DMFER+A EAA LS Y    TLSSR
Sbjct  151  GEEQYKRYVFRVLKQVHPGLGISSAAMEVLNGYMNDMFERLAAEAARLSSYAGIKTLSSR  210

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTYL  809
            +IQ AV+LVLPG+LG+HAIAEG KAVT Y+
Sbjct  211  DIQGAVRLVLPGELGRHAIAEGAKAVTNYM  240



>ref|XP_001657158.1| histone H2B [Aedes aegypti]
 gb|EAT45040.1| AAEL015682-PA [Aedes aegypti]
Length=124

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  34   ESYAIYIYKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIASEASRLAQYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_005951561.1| PREDICTED: histone H2B 1/2-like, partial [Haplochromis burtoni]
Length=108

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  18   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  77

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  78   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  108



>ref|XP_003088435.1| hypothetical protein CRE_15218 [Caenorhabditis remanei]
 ref|XP_003091049.1| hypothetical protein CRE_31558 [Caenorhabditis remanei]
 gb|EFO91235.1| hypothetical protein CRE_15218 [Caenorhabditis remanei]
 gb|EFP02494.1| hypothetical protein CRE_31558 [Caenorhabditis remanei]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>gb|EGT35281.1| hypothetical protein CAEBREN_22435 [Caenorhabditis brenneri]
 gb|EGT35860.1| CBN-HIS-41 protein [Caenorhabditis brenneri]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|NP_001180726.1| histone H2B type 1-A [Macaca mulatta]
 ref|XP_003897191.1| PREDICTED: histone H2B type 1-A [Papio anubis]
 ref|XP_007971708.1| PREDICTED: histone H2B type 1-A [Chlorocebus sabaeus]
 ref|XP_010363379.1| PREDICTED: histone H2B type 1-A [Rhinopithecus roxellana]
 ref|XP_010357833.1| PREDICTED: histone H2B type 1-A [Rhinopithecus roxellana]
 gb|EHH18000.1| Histone H2B, testis [Macaca mulatta]
 gb|EHH52772.1| Histone H2B, testis [Macaca fascicularis]
Length=127

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  37   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTISSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>ref|XP_005230966.1| PREDICTED: histone H2B, gonadal-like [Falco peregrinus]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FER+A EA+ L++Y  R+T++SRE+
Sbjct  32   ENYSLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFERLASEASHLAQYTCRSTITSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_008326383.1| PREDICTED: histone H2B 1/2-like [Cynoglossus semilaevis]
 ref|XP_008336075.1| PREDICTED: histone H2B 1/2-like [Cynoglossus semilaevis]
Length=124

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KVMKQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVMKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_008533333.1| PREDICTED: histone H2B type 3-A-like [Equus przewalskii]
Length=126

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SRE+
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREV  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+LGKHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELGKHAVSEGTKAVTKYTSSK  126



>sp|P21897.2|H2B_CHITH RecName: Full=Histone H2B [Chironomus thummi thummi]
 emb|CAA39774.1| histone H2B [Chironomus thummi]
Length=125

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+FKV+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  35   ESYAIYIFKVLKQVHPDTGVSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_001964819.1| GF22593 [Drosophila ananassae]
 ref|XP_001967750.1| GF18984 [Drosophila ananassae]
 gb|EDV32953.1| GF22593 [Drosophila ananassae]
 gb|EDV44977.1| GF18984 [Drosophila ananassae]
Length=120

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  30   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  89

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  90   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  120



>ref|XP_005403366.1| PREDICTED: histone H2B type 1-B-like [Chinchilla lanigera]
Length=133

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 77/99 (78%), Gaps = 1/99 (1%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNPKPN*C  842
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K NP P  C
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK-NPGPLCC  133



>ref|XP_003214299.2| PREDICTED: late histone H2B.L4-like [Meleagris gallopavo]
Length=118

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FER+AVEA+ L++Y  R+T++SRE+
Sbjct  28   ETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERLAVEASRLAQYNHRSTITSREV  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  88   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  118



>ref|XP_007071493.1| PREDICTED: histone H2B 1/2/3/4/6-like [Chelonia mydas]
Length=165

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  75   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVSDLFERIAAEASRLALYNKRSTISSREI  134

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  135  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  165



>ref|XP_009235253.1| PREDICTED: histone H2B type 2-F isoform X4 [Pongo abelii]
Length=167

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 77/97 (79%), Gaps = 2/97 (2%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNPKPN  836
            Q AV+L+LPG+L KHA++EGTKAVT Y  T SNP+ N
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKY--TSSNPRGN  130



>gb|EGT34517.1| hypothetical protein CAEBREN_13824 [Caenorhabditis brenneri]
 gb|EGT34523.1| hypothetical protein CAEBREN_00264 [Caenorhabditis brenneri]
 gb|EGT34525.1| hypothetical protein CAEBREN_15504 [Caenorhabditis brenneri]
 gb|EGT34526.1| hypothetical protein CAEBREN_21763 [Caenorhabditis brenneri]
 gb|EGT34532.1| hypothetical protein CAEBREN_12681 [Caenorhabditis brenneri]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_004566500.1| PREDICTED: histone H2B-like [Maylandia zebra]
Length=128

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  38   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  97

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  98   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  128



>ref|XP_005542113.1| PREDICTED: histone H2B type 2-F-like isoform X1 [Macaca fascicularis]
Length=156

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNPK  830
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K++ K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSKNDKK  130



>ref|XP_423715.2| PREDICTED: histone H2B, gonadal [Gallus gallus]
Length=118

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FER+AVEA+ L++Y  R+T++SRE+
Sbjct  28   ETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERLAVEASRLAQYNHRSTITSREV  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  88   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  118



>gb|EGT38822.1| hypothetical protein CAEBREN_29113 [Caenorhabditis brenneri]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_002633141.1| Hypothetical protein CBG05840 [Caenorhabditis briggsae]
 ref|XP_002633144.1| Hypothetical protein CBG05843 [Caenorhabditis briggsae]
 ref|XP_002633172.1| Hypothetical protein CBG05884 [Caenorhabditis briggsae]
 ref|XP_002633323.1| Hypothetical protein CBG06060 [Caenorhabditis briggsae]
 ref|XP_002635336.1| Hypothetical protein CBG01507 [Caenorhabditis briggsae]
 ref|XP_002636718.1| Hypothetical protein CBG23437 [Caenorhabditis briggsae]
 ref|XP_002636722.1| Hypothetical protein CBG23441 [Caenorhabditis briggsae]
 ref|XP_002636725.1| Hypothetical protein CBG23444 [Caenorhabditis briggsae]
 emb|CAP39583.1| Protein CBG23444 [Caenorhabditis briggsae]
 emb|CAP39586.1| Protein CBG23441 [Caenorhabditis briggsae]
 emb|CAP39590.1| Protein CBG23437 [Caenorhabditis briggsae]
 emb|CAP26310.1| Protein CBG06060 [Caenorhabditis briggsae]
 emb|CAP26461.1| Protein CBG05884 [Caenorhabditis briggsae]
 emb|CAP26489.1| Protein CBG05843 [Caenorhabditis briggsae]
 emb|CAP26492.1| Protein CBG05840 [Caenorhabditis briggsae]
 emb|CAP22749.1| Protein CBG01507 [Caenorhabditis briggsae]
 emb|CAR98445.1| Protein CBG26907 [Caenorhabditis briggsae]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>ref|NP_496897.1| Protein HIS-44 [Caenorhabditis elegans]
 ref|NP_496892.1| Protein HIS-11 [Caenorhabditis elegans]
 ref|NP_496888.1| Protein HIS-15 [Caenorhabditis elegans]
 ref|NP_501403.1| Protein HIS-29 [Caenorhabditis elegans]
 ref|NP_501409.1| Protein HIS-34 [Caenorhabditis elegans]
 sp|P04255.4|H2B1_CAEEL RecName: Full=Histone H2B 1 [Caenorhabditis elegans]
 emb|CAA33642.1| histone protein [Caenorhabditis elegans]
 emb|CAB04061.1| HIS-44 [Caenorhabditis elegans]
 emb|CAB05830.1| HIS-11 [Caenorhabditis elegans]
 emb|CAB05832.1| HIS-15 [Caenorhabditis elegans]
 gb|EGT34537.1| hypothetical protein CAEBREN_03439 [Caenorhabditis brenneri]
 gb|EGT34564.1| hypothetical protein CAEBREN_07662 [Caenorhabditis brenneri]
 gb|EGT34567.1| hypothetical protein CAEBREN_09238 [Caenorhabditis brenneri]
 gb|EGT34571.1| hypothetical protein CAEBREN_25930 [Caenorhabditis brenneri]
 gb|EGT38939.1| hypothetical protein CAEBREN_26123 [Caenorhabditis brenneri]
 gb|EGT39094.1| hypothetical protein CAEBREN_23334 [Caenorhabditis brenneri]
 gb|EGT39138.1| hypothetical protein CAEBREN_07325 [Caenorhabditis brenneri]
 gb|EGT42379.1| hypothetical protein CAEBREN_32049 [Caenorhabditis brenneri]
 gb|EGT42430.1| hypothetical protein CAEBREN_17507 [Caenorhabditis brenneri]
 gb|EGT42698.1| hypothetical protein CAEBREN_05890 [Caenorhabditis brenneri]
 gb|EGT60004.1| hypothetical protein CAEBREN_21819 [Caenorhabditis brenneri]
 gb|EGT60008.1| hypothetical protein CAEBREN_24531 [Caenorhabditis brenneri]
 gb|EGT60011.1| hypothetical protein CAEBREN_32588 [Caenorhabditis brenneri]
 gb|EGT60014.1| hypothetical protein CAEBREN_03502 [Caenorhabditis brenneri]
 emb|CCD68530.1| HIS-34 [Caenorhabditis elegans]
 emb|CCD69642.1| HIS-29 [Caenorhabditis elegans]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_001967906.1| GF19591 [Drosophila ananassae]
 gb|EDV44888.1| GF19591 [Drosophila ananassae]
Length=101

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  11   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  70

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  71   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  101



>ref|XP_010378261.1| PREDICTED: late histone H2B.L4-like [Rhinopithecus roxellana]
Length=181

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ IS+KAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  91   ESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFERLACEAARLAQYSGRTTLTSREV  150

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  151  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  181



>gb|KFH73409.1| histone H2B [Mortierella verticillata NRRL 6337]
Length=138

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  48   ETYSSYIYKVLKQVHPDTGISNKAMSILNSFVNDIFERIAGEASKLAAYNKRSTISSREI  107

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  108  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  138



>dbj|BAD02422.1| histone 2B [Drosophila yakuba]
 dbj|BAJ06137.1| histone 2B [Drosophila yakuba]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>gb|EFX86920.1| hypothetical protein DAPPUDRAFT_312357 [Daphnia pulex]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAMT++N+ + D+FERIA E++ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMTIMNSFVNDIFERIASESSRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  TK
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSTK  123



>gb|EFX86889.1| hypothetical protein DAPPUDRAFT_97043 [Daphnia pulex]
 gb|EFX86960.1| hypothetical protein DAPPUDRAFT_44131 [Daphnia pulex]
 gb|EFX86976.1| hypothetical protein DAPPUDRAFT_44061 [Daphnia pulex]
 gb|EFX87340.1| hypothetical protein DAPPUDRAFT_97169 [Daphnia pulex]
 gb|EFX87439.1| hypothetical protein DAPPUDRAFT_44134 [Daphnia pulex]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAMT++N+ + D+FERIA E++ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMTIMNSFVNDIFERIASESSRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  TK
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSTK  123



>ref|NP_505197.1| Protein HIS-8 [Caenorhabditis elegans]
 ref|NP_505295.1| Protein HIS-20 [Caenorhabditis elegans]
 ref|NP_505294.1| Protein HIS-22 [Caenorhabditis elegans]
 ref|NP_505278.2| Protein HIS-52 [Caenorhabditis elegans]
 ref|NP_507031.2| Protein HIS-4 [Caenorhabditis elegans]
 sp|Q27894.3|H2B2_CAEEL RecName: Full=Histone H2B 2 [Caenorhabditis elegans]
 emb|CCD70026.1| HIS-8 [Caenorhabditis elegans]
 emb|CCD72362.1| HIS-20 [Caenorhabditis elegans]
 emb|CCD72372.1| HIS-22 [Caenorhabditis elegans]
 emb|CCD68867.2| HIS-52 [Caenorhabditis elegans]
 emb|CAB07654.2| HIS-4 [Caenorhabditis elegans]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>emb|CAG12685.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF98833.1| unnamed protein product [Tetraodon nigroviridis]
Length=124

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_002639990.1| Hypothetical protein CBG10818 [Caenorhabditis briggsae]
 ref|XP_003109438.1| hypothetical protein CRE_08230 [Caenorhabditis remanei]
 ref|XP_003109449.1| hypothetical protein CRE_08032 [Caenorhabditis remanei]
 emb|CAP30121.1| Protein CBG10818 [Caenorhabditis briggsae]
 gb|EFO90803.1| hypothetical protein CRE_08230 [Caenorhabditis remanei]
 gb|EFO90814.1| hypothetical protein CRE_08032 [Caenorhabditis remanei]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_003451196.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003451209.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003451212.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003451219.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003457065.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003459145.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003459574.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003459576.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_003459583.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_005455906.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_005455908.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_005455917.1| PREDICTED: histone H2B 1/2-like [Oreochromis niloticus]
 ref|XP_005921123.1| PREDICTED: histone H2B 1/2-like [Haplochromis burtoni]
 ref|XP_006781037.1| PREDICTED: histone H2B 1/2-like [Neolamprologus brichardi]
 ref|XP_006809851.1| PREDICTED: histone H2B 1/2-like [Neolamprologus brichardi]
Length=124

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_010557373.1| PREDICTED: histone H2B.2 [Tarenaya hassleriana]
Length=267

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  552  YKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREIQD  731
            Y+RYV+KVMK+VHP + IS KAM+V+N  MGDMFERIA EAA L+++  R T+S+REIQ 
Sbjct  175  YRRYVWKVMKEVHPKMGISGKAMSVLNTFMGDMFERIAEEAARLNQHSRRRTMSAREIQA  234

Query  732  AVKLVLPGDLGKHAIAEGTKAVTTYLGTKS  821
            AV+LVLPG+L +HA+AEG+KAV+ Y+   S
Sbjct  235  AVRLVLPGELSRHAVAEGSKAVSNYVAFDS  264



>ref|XP_003087543.1| hypothetical protein CRE_01514 [Caenorhabditis remanei]
 ref|XP_003107873.1| hypothetical protein CRE_12685 [Caenorhabditis remanei]
 gb|EFO93772.1| hypothetical protein CRE_12685 [Caenorhabditis remanei]
 gb|EFO98773.1| hypothetical protein CRE_01514 [Caenorhabditis remanei]
Length=122

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>gb|AAP94661.1| histone H2B [Mytilus edulis]
Length=124

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV++QVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ YI R+T++SREI
Sbjct  34   ESYAIYIYKVLRQVHPDTGVSSKAMSIMNSFVNDIFERIAAEASRLAHYIKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>gb|KHJ96893.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_002012692.1| GI17569 [Drosophila mojavensis]
 gb|EDW05349.1| GI17569 [Drosophila mojavensis]
Length=99

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  9    ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  68

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  69   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  99



>ref|XP_569066.1| histone h2b [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_776986.1| hypothetical protein CNBB5140 [Cryptococcus neoformans var. neoformans 
B-3501A]
 sp|P0CO03.1|H2B_CRYNB RecName: Full=Histone H2B [Cryptococcus neoformans var. neoformans 
B-3501A]
 sp|P0CO02.1|H2B_CRYNJ RecName: Full=Histone H2B [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|EAL22339.1| hypothetical protein CNBB5140 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW41759.1| histone h2b, putative [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AFR93054.1| histone H2B [Cryptococcus neoformans var. grubii H99]
Length=139

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  IS+KAM ++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  49   ESYSSYIYKVLKQVHPDTGISNKAMAILNSFVSDIFERIATEASKLASYNHRSTISSREI  108

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q +V+L+LPG+L KHAI+EGTKAVT Y  +K
Sbjct  109  QTSVRLILPGELSKHAISEGTKAVTKYSSSK  139



>ref|XP_008564219.1| PREDICTED: late histone H2B.L4-like [Galeopterus variegatus]
 ref|XP_008592978.1| PREDICTED: late histone H2B.L4-like [Galeopterus variegatus]
Length=126

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ IS+KAM+++N+ + D+FER+A EAA L++Y  R TL+SRE+
Sbjct  36   ETYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFERLAGEAARLAQYSGRTTLTSREV  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_008313560.1| PREDICTED: histone H2B 1.1-like [Cynoglossus semilaevis]
Length=126

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_003438147.1| PREDICTED: histone H2B-like [Oreochromis niloticus]
Length=116

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISS+AM+++N+ + D+FERIA EA+ L++Y  R+T++SRE+
Sbjct  26   ETYAMYIYKVLKQVHPDTGISSRAMSIMNSFVNDLFERIATEASRLAQYNKRSTITSREV  85

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  86   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  116



>ref|XP_005553885.1| PREDICTED: histone H2B type 1-A-like [Macaca fascicularis]
Length=131

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  37   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTISSREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  97   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  127



>emb|CDS08165.1| Putative Histone H2B [Absidia idahoensis var. thermophila]
Length=124

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  34   ETYSSYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_008201473.1| PREDICTED: histone H2B [Tribolium castaneum]
 gb|EFA13239.1| hypothetical protein TcasGA2_TC006935 [Tribolium castaneum]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_005312549.1| PREDICTED: histone H2B 7-like [Chrysemys picta bellii]
Length=121

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  31   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVSDLFERIASEASRLALYNKRSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  121



>ref|XP_003149647.1| histone H2B 2 [Loa loa]
 gb|EFO14422.1| histone H2B 2 [Loa loa]
Length=127

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSK+M+++N+ + D+FER+A EA+ L+ Y  R+T+S+REI
Sbjct  37   ESYSVYIYRVLKQVHPDTGISSKSMSIMNSFVNDVFERVATEASRLAHYSKRSTISAREI  96

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGT  815
            Q AV+L+LPG+L KHA++EGTKAVT Y+ +
Sbjct  97   QTAVRLILPGELAKHAVSEGTKAVTKYMSS  126



>ref|XP_004991141.1| histone H2B [Salpingoeca rosetta]
 gb|EGD76769.1| histone H2B [Salpingoeca rosetta]
Length=123

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FERIA EA+ L+KY +++T+SSREI
Sbjct  31   ESYSIYIYKVLKQVHPDVGISSKAMSILNSFVNDIFERIANEASRLAKYNNKSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            Q A++L+LPG+L KHA++EGTKAVT Y
Sbjct  91   QTAIRLLLPGELAKHAVSEGTKAVTKY  117



>ref|XP_007429385.1| PREDICTED: histone H2B 1/2/3/4/6-like [Python bivittatus]
Length=126

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SRE+
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREV  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_003226698.1| PREDICTED: histone H2B 5-like [Anolis carolinensis]
 ref|XP_003226700.1| PREDICTED: histone H2B 5-like [Anolis carolinensis]
Length=126

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_003227270.1| PREDICTED: histone H2B 5-like [Anolis carolinensis]
Length=126

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>emb|CBY43004.1| unnamed protein product [Oikopleura dioica]
Length=102

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+KY  ++T+SSRE+
Sbjct  12   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVSDIFERIANEASRLAKYNKKSTISSREV  71

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  72   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  102



>emb|CDH50262.1| histone h2b [Lichtheimia corymbifera JMRC:FSU:9682]
Length=124

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  34   ETYSSYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_005812308.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
 ref|XP_005812309.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
Length=124

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_004542871.1| PREDICTED: histone H2B-like [Maylandia zebra]
 ref|XP_005721532.1| PREDICTED: histone H2B-like [Pundamilia nyererei]
 ref|XP_005912651.1| PREDICTED: histone H2B-like [Haplochromis burtoni]
 ref|XP_006786419.1| PREDICTED: histone H2B-like [Neolamprologus brichardi]
Length=116

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISS+AM+++N+ + D+FERIA EA+ L++Y  R+T++SRE+
Sbjct  26   ETYAMYIYKVLKQVHPDTGISSRAMSIMNSFVNDLFERIATEASRLAQYNKRSTITSREV  85

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  86   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  116



>pdb|3C9K|B Chain B, Model Of Histone Octamer Tubular Crystals
 pdb|3C9K|F Chain F, Model Of Histone Octamer Tubular Crystals
Length=125

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  35   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>emb|CDQ04387.1| Protein Bm2874, isoform a [Brugia malayi]
Length=224

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L++Y  R+T+SSREI
Sbjct  134  ESYSAYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAQYNKRSTISSREI  193

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  194  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  224



>emb|CDH60910.1| histone h2b [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH52339.1| histone h2b [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH51909.1| histone h2b [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDH50257.1| histone h2b [Lichtheimia corymbifera JMRC:FSU:9682]
 emb|CDS11881.1| Putative Histone H2B [Absidia idahoensis var. thermophila]
 emb|CDS03072.1| Putative Histone H2B [Absidia idahoensis var. thermophila]
Length=124

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  34   ETYSSYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  124



>gb|KFQ95962.1| hypothetical protein Y956_07258, partial [Nipponia nippon]
Length=98

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FER+A+EA+ L++Y  R+T++SRE+
Sbjct  8    ETYSVYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERLALEASRLAQYNHRSTITSREV  67

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  68   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  98



>gb|KHN75686.1| Histone H2B 1 [Toxocara canis]
Length=121

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R T+SSREI
Sbjct  31   ESYSVYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAHYNKRTTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  121



>ref|XP_003224522.1| PREDICTED: histone H2B 5 [Anolis carolinensis]
 ref|XP_007427784.1| PREDICTED: histone H2B 5-like [Python bivittatus]
Length=126

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>gb|KDD76445.1| hypothetical protein H632_c224p3, partial [Helicosporidium sp. 
ATCC 50920]
Length=106

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  540  SGEGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSR  719
            S E YK Y+FKV+KQVHPD  ISSKA+T++N+ + D FE+IA++AA LS+   + TL+SR
Sbjct  15   SSESYKLYIFKVLKQVHPDTGISSKAITILNSFIVDQFEKIAMQAAQLSRVNKKPTLTSR  74

Query  720  EIQDAVKLVLPGDLGKHAIAEGTKAVTTY  806
            EIQ AV+LVLPG+L KHA++EGTKAVT Y
Sbjct  75   EIQTAVRLVLPGELAKHAVSEGTKAVTKY  103



>ref|XP_008432497.1| PREDICTED: late histone H2B.L4 [Poecilia reticulata]
Length=116

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISS+AM+++N+ + D+FERIA EA+ L++Y  R+T++SRE+
Sbjct  26   ETYAMYIYKVLKQVHPDTGISSRAMSIMNSFVNDLFERIATEASRLAQYNKRSTITSREV  85

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  86   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  116



>gb|AAW26007.1| unknown [Schistosoma japonicum]
 emb|CAX71746.1| Histone H2B [Schistosoma japonicum]
 emb|CAX71747.1| Histone H2B [Schistosoma japonicum]
 emb|CAX71748.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77913.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77914.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77915.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77916.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77917.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77918.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77919.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77920.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77921.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77922.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77923.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77924.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77925.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77926.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77927.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77928.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77929.1| Histone H2B [Schistosoma japonicum]
 emb|CAX77930.1| Histone H2B [Schistosoma japonicum]
 emb|CAY18308.1| histone H2B, putative [Schistosoma mansoni]
 gb|KGB42216.1| Histone H2B, partial [Schistosoma haematobium]
Length=122

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV++QVHPD  ISSKAM+++N+ + D+FERIA EA+ LS Y  ++T+SSRE+
Sbjct  32   ESYAIYIYKVLRQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLSHYNKKSTISSREV  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y G+K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYSGSK  122



>sp|P35067.1|H2B_ACRFO RecName: Full=Histone H2B [Acropora formosa]
 gb|AAC37353.1| histone H2B [Acropora formosa]
 gb|AAB28737.1| histone H2B [Acropora formosa]
 prf||1920342B histone H2B
Length=125

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM ++N+ + D+FERIAVE++ LS Y  +AT+SSREI
Sbjct  35   ESYAIYIYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAVESSRLSLYNKKATISSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q A++L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAIRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_003227271.1| PREDICTED: histone H2B 5-like [Anolis carolinensis]
Length=126

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_007555238.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
Length=163

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  73   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  132

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  133  QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  163



>ref|XP_005817716.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
Length=125

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  35   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_002045030.1| GM11714 [Drosophila sechellia]
 ref|XP_002045890.1| GM13203 [Drosophila sechellia]
 ref|XP_002045946.1| GM19322 [Drosophila sechellia]
 gb|EDW44082.1| GM13203 [Drosophila sechellia]
 gb|EDW44563.1| GM19322 [Drosophila sechellia]
 gb|EDW51459.1| GM11714 [Drosophila sechellia]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYHKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_008420768.1| PREDICTED: histone H2B 1/2-like [Poecilia reticulata]
 ref|XP_008433323.1| PREDICTED: histone H2B 1/2-like [Poecilia reticulata]
Length=125

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  35   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_009235250.1| PREDICTED: histone H2B type 2-F isoform X2 [Pongo abelii]
Length=133

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNP  827
            Q AV+L+LPG+L KHA++EGTKAVT Y  T SNP
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKY--TSSNP  127



>ref|NP_505464.1| Protein HIS-41 [Caenorhabditis elegans]
 sp|Q27484.3|H2B3_CAEEL RecName: Full=Probable histone H2B 3 [Caenorhabditis elegans]
 emb|CAA94740.1| HIS-41 [Caenorhabditis elegans]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  33   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_002192994.1| PREDICTED: histone H2B 7-like [Taeniopygia guttata]
 ref|XP_003202249.1| PREDICTED: histone H2B 7 [Meleagris gallopavo]
 ref|XP_005012222.1| PREDICTED: histone H2B 7-like [Anas platyrhynchos]
 ref|XP_005150325.1| PREDICTED: histone H2B 7-like [Melopsittacus undulatus]
 ref|XP_005421693.1| PREDICTED: histone H2B 7-like [Geospiza fortis]
 ref|XP_008918462.1| PREDICTED: histone H2B 7 [Manacus vitellinus]
 ref|XP_009069014.1| PREDICTED: histone H2B 7 [Acanthisitta chloris]
 ref|XP_009084856.1| PREDICTED: histone H2B 7 [Serinus canaria]
 ref|XP_009929442.1| PREDICTED: histone H2B 7 [Opisthocomus hoazin]
 ref|XP_010295999.1| PREDICTED: histone H2B 7 [Balearica regulorum gibbericeps]
 sp|P0C1H5.2|H2B7_CHICK RecName: Full=Histone H2B 7; AltName: Full=H2B VII [Gallus gallus]
 emb|CAA28750.1| unnamed protein product [Gallus gallus]
 gb|AAC60000.1| histone H2B [Gallus gallus]
 gb|EOB06723.1| Histone H2B 7, partial [Anas platyrhynchos]
 gb|KFO04078.1| Histone H2B 7 [Balearica regulorum gibbericeps]
 gb|KFO74450.1| Histone H2B 7 [Cuculus canorus]
 gb|KFP69851.1| Histone H2B 7 [Acanthisitta chloris]
 gb|KFQ43193.1| Histone H2B 7 [Nestor notabilis]
 gb|KFR05904.1| Histone H2B 7 [Opisthocomus hoazin]
 gb|KFW77913.1| Histone H2B 7 [Manacus vitellinus]
 gb|KGL87478.1| Histone H2B 7 [Charadrius vociferus]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>emb|CAF98801.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_004776891.1| PREDICTED: histone H2B type 2-F-like isoform X2 [Mustela putorius 
furo]
Length=145

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAQYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNP  827
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K  P
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSKHFP  129



>gb|KDR07171.1| Histone H2B [Zootermopsis nevadensis]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>gb|AEE63232.1| unknown [Dendroctonus ponderosae]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_002045748.1| GM12965 [Drosophila sechellia]
 gb|EDW55903.1| GM12965 [Drosophila sechellia]
Length=116

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  26   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  85

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  86   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  116



>ref|XP_306255.2| AGAP012894-PA [Anopheles gambiae str. PEST]
 ref|XP_307082.2| Anopheles gambiae str. PEST AGAP012710-PA [Anopheles gambiae 
str. PEST]
 ref|XP_320329.2| AGAP012202-PA [Anopheles gambiae str. PEST]
 ref|XP_320334.2| AGAP012199-PA [Anopheles gambiae str. PEST]
 ref|XP_001238300.1| AGAP012201-PA [Anopheles gambiae str. PEST]
 sp|Q27442.5|H2B_ANOGA RecName: Full=Histone H2B [Anopheles gambiae]
 gb|EAA00128.2| AGAP012202-PA [Anopheles gambiae str. PEST]
 gb|EAA00131.2| AGAP012199-PA [Anopheles gambiae str. PEST]
 gb|EAA02895.2| AGAP012710-PA [Anopheles gambiae str. PEST]
 gb|EAA02466.3| AGAP012894-PA [Anopheles gambiae str. PEST]
 gb|EAU75797.1| AGAP012201-PA [Anopheles gambiae str. PEST]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>gb|ETN61964.1| histone H2B [Anopheles darlingi]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>emb|CBY36200.1| unnamed protein product [Oikopleura dioica]
 emb|CBY37782.1| unnamed protein product [Oikopleura dioica]
 emb|CBY18901.1| unnamed protein product [Oikopleura dioica]
 emb|CBY12298.1| unnamed protein product [Oikopleura dioica]
 emb|CBY12300.1| unnamed protein product [Oikopleura dioica]
Length=120

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+KY  ++T+SSRE+
Sbjct  30   ESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVSDIFERIANEASRLAKYNKKSTISSREV  89

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  90   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  120



>emb|CAF91303.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_009489258.1| PREDICTED: histone H2B 7 [Pelecanus crispus]
 ref|XP_009675853.1| PREDICTED: histone H2B 7 [Struthio camelus australis]
 gb|KFP16836.1| Histone H2B 7 [Egretta garzetta]
 gb|KFP46981.1| Histone H2B 7 [Cathartes aura]
 gb|KFQ55403.1| Histone H2B 7 [Pelecanus crispus]
 gb|KFQ75241.1| Histone H2B 7 [Phoenicopterus ruber ruber]
 gb|KFQ96130.1| Histone H2B 7 [Nipponia nippon]
 gb|KFU99741.1| Histone H2B 7 [Tauraco erythrolophus]
 gb|KFV82687.1| Histone H2B 7 [Struthio camelus australis]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_001967857.1| GF20679 [Drosophila ananassae]
 ref|XP_002053089.1| GJ23530 [Drosophila virilis]
 gb|EDV44911.1| GF20679 [Drosophila ananassae]
 gb|EDW66609.1| GJ23530 [Drosophila virilis]
Length=122

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  32   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>gb|KHJ83288.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
Length=125

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SS+AM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  35   ESYSVYIYRVLKQVHPDTGVSSRAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  94

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  95   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  125



>ref|XP_005532149.1| PREDICTED: histone H2B, gonadal-like [Pseudopodoces humilis]
Length=118

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E +  Y++KV+KQVHPDLAISSKAM+++N+ + DMFE +A EA+ L++Y  RAT++SRE+
Sbjct  28   EVFSVYIYKVLKQVHPDLAISSKAMSIMNSFVNDMFEHLASEASRLAQYSHRATITSREV  87

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAV+ Y  +K
Sbjct  88   QTAVRLLLPGELAKHAVSEGTKAVSKYTSSK  118



>emb|CDS05339.1| Putative Histone H2B [Absidia idahoensis var. thermophila]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  34   ETYSSYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_009462250.1| PREDICTED: histone H2B 1/2/3/4/6-like [Nipponia nippon]
 gb|KFQ96127.1| Histone H2B 1/2/3/4/6 [Nipponia nippon]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+L+ D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMGIMNSLLNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_003227275.1| PREDICTED: histone H2B 5-like [Anolis carolinensis]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_001964801.1| GF22516 [Drosophila ananassae]
 ref|XP_001964809.1| GF22549 [Drosophila ananassae]
 ref|XP_001967676.1| GF15891 [Drosophila ananassae]
 ref|XP_001967772.1| GF19279 [Drosophila ananassae]
 ref|XP_001967776.1| GF19277 [Drosophila ananassae]
 ref|XP_001967785.1| GF20163 [Drosophila ananassae]
 ref|XP_001967796.1| GF23427 [Drosophila ananassae]
 ref|XP_001967817.1| GF22859 [Drosophila ananassae]
 ref|XP_001967821.1| GF18956 [Drosophila ananassae]
 ref|XP_001967891.1| GF20544 [Drosophila ananassae]
 ref|XP_001967901.1| GF16024 [Drosophila ananassae]
 ref|XP_001967926.1| GF23381 [Drosophila ananassae]
 ref|XP_001967935.1| GF19254 [Drosophila ananassae]
 ref|XP_001996373.1| GH25066 [Drosophila grimshawi]
 ref|XP_001996378.1| GH25064 [Drosophila grimshawi]
 ref|XP_001996383.1| GH25060 [Drosophila grimshawi]
 ref|XP_001996388.1| GH25058 [Drosophila grimshawi]
 ref|XP_001996392.1| GH25056 [Drosophila grimshawi]
 ref|XP_001996396.1| GH25054 [Drosophila grimshawi]
 ref|XP_001996401.1| GH25052 [Drosophila grimshawi]
 ref|XP_001996406.1| GH25049 [Drosophila grimshawi]
 ref|XP_001996411.1| GH25047 [Drosophila grimshawi]
 ref|XP_001996416.1| GH25045 [Drosophila grimshawi]
 ref|XP_001996420.1| GH25043 [Drosophila grimshawi]
 ref|XP_001996423.1| GH25041 [Drosophila grimshawi]
 ref|XP_001996428.1| GH25038 [Drosophila grimshawi]
 ref|XP_001996432.1| GH25036 [Drosophila grimshawi]
 ref|XP_001996803.1| GH23348 [Drosophila grimshawi]
 ref|XP_001996808.1| GH23350 [Drosophila grimshawi]
 ref|XP_001996812.1| GH23352 [Drosophila grimshawi]
 ref|XP_001996819.1| GH23357 [Drosophila grimshawi]
 ref|XP_001997183.1| GH23881 [Drosophila grimshawi]
 ref|XP_001997409.1| GH23767 [Drosophila grimshawi]
 ref|XP_001997449.1| GH23781 [Drosophila grimshawi]
 ref|XP_001997738.1| GH13935 [Drosophila grimshawi]
 ref|XP_001997828.1| GH23489 [Drosophila grimshawi]
 ref|XP_001997850.1| GH22492 [Drosophila grimshawi]
 ref|XP_001997923.1| GH22233 [Drosophila grimshawi]
 ref|XP_001997934.1| GH10970 [Drosophila grimshawi]
 ref|XP_001997974.1| GH23546 [Drosophila grimshawi]
 ref|XP_001998009.1| GH12419 [Drosophila grimshawi]
 ref|XP_001998776.1| GI24153 [Drosophila mojavensis]
 ref|XP_001998778.1| GI24154 [Drosophila mojavensis]
 ref|XP_001998782.1| GI24156 [Drosophila mojavensis]
 ref|XP_001998786.1| GI24158 [Drosophila mojavensis]
 ref|XP_002002198.1| GI13923 [Drosophila mojavensis]
 ref|XP_002002202.1| GI13901 [Drosophila mojavensis]
 ref|XP_002002206.1| GI13879 [Drosophila mojavensis]
 ref|XP_002002989.1| GI17678 [Drosophila mojavensis]
 ref|XP_002012534.1| GI16890 [Drosophila mojavensis]
 ref|XP_002012559.1| GI21875 [Drosophila mojavensis]
 ref|XP_002012646.1| GI14522 [Drosophila mojavensis]
 ref|XP_002013116.1| GL23561 [Drosophila persimilis]
 ref|XP_002013127.1| GL23557 [Drosophila persimilis]
 ref|XP_002013132.1| GL23555 [Drosophila persimilis]
 ref|XP_002013137.1| GL23553 [Drosophila persimilis]
 ref|XP_002029057.1| GL17800 [Drosophila persimilis]
 ref|XP_002029101.1| GL15944 [Drosophila persimilis]
 ref|XP_002044748.1| GM19703 [Drosophila sechellia]
 ref|XP_002044753.1| GM19701 [Drosophila sechellia]
 ref|XP_002044763.1| GM19697 [Drosophila sechellia]
 ref|XP_002044767.1| GM19696 [Drosophila sechellia]
 ref|XP_002044957.1| GM13191 [Drosophila sechellia]
 ref|XP_002044962.1| GM13187 [Drosophila sechellia]
 ref|XP_002045038.1| GM10080 [Drosophila sechellia]
 ref|XP_002045043.1| GM13542 [Drosophila sechellia]
 ref|XP_002045044.1| GM13541 [Drosophila sechellia]
 ref|XP_002045048.1| GM13539 [Drosophila sechellia]
 ref|XP_002045052.1| GM22424 [Drosophila sechellia]
 ref|XP_002045057.1| GM22584 [Drosophila sechellia]
 ref|XP_002045094.1| GM19736 [Drosophila sechellia]
 ref|XP_002045098.1| GM19734 [Drosophila sechellia]
 ref|XP_002045125.1| GM26724 [Drosophila sechellia]
 ref|XP_002045158.1| GM19328 [Drosophila sechellia]
 ref|XP_002045248.1| GM24037 [Drosophila sechellia]
 ref|XP_002045260.1| GM13608 [Drosophila sechellia]
 ref|XP_002045365.1| GM11937 [Drosophila sechellia]
 ref|XP_002045371.1| GM23805 [Drosophila sechellia]
 ref|XP_002045381.1| GM19761 [Drosophila sechellia]
 ref|XP_002045481.1| GM19608 [Drosophila sechellia]
 ref|XP_002045551.1| GM18819 [Drosophila sechellia]
 ref|XP_002045580.1| GM26707 [Drosophila sechellia]
 ref|XP_002045588.1| GM11748 [Drosophila sechellia]
 ref|XP_002045618.1| GM15473 [Drosophila sechellia]
 ref|XP_002045623.1| GM19672 [Drosophila sechellia]
 ref|XP_002045704.1| GM13213 [Drosophila sechellia]
 ref|XP_002045708.1| GM17711 [Drosophila sechellia]
 ref|XP_002045758.1| GM19277 [Drosophila sechellia]
 ref|XP_002045777.1| GM13614 [Drosophila sechellia]
 ref|XP_002045784.1| GM19430 [Drosophila sechellia]
 ref|XP_002045792.1| GM23249 [Drosophila sechellia]
 ref|XP_002045808.1| GM13135 [Drosophila sechellia]
 ref|XP_002045814.1| GM13660 [Drosophila sechellia]
 ref|XP_002045839.1| GM23434 [Drosophila sechellia]
 ref|XP_002045841.1| GM17425 [Drosophila sechellia]
 ref|XP_002045872.1| GM16168 [Drosophila sechellia]
 ref|XP_002045908.1| GM16542 [Drosophila sechellia]
 ref|XP_002052268.1| GJ17460 [Drosophila virilis]
 ref|XP_002053093.1| GJ23528 [Drosophila virilis]
 ref|XP_002053098.1| GJ23526 [Drosophila virilis]
 ref|XP_002053103.1| GJ23523 [Drosophila virilis]
 ref|XP_002053111.1| GJ23519 [Drosophila virilis]
 ref|XP_002053115.1| GJ23517 [Drosophila virilis]
 ref|XP_002053119.1| GJ23516 [Drosophila virilis]
 ref|XP_002060407.1| GJ15445 [Drosophila virilis]
 ref|XP_002060425.1| GJ16343 [Drosophila virilis]
 ref|XP_002060428.1| GJ16342 [Drosophila virilis]
 ref|XP_002060474.1| GJ14625 [Drosophila virilis]
 ref|XP_002060498.1| GJ15164 [Drosophila virilis]
 ref|XP_002060507.1| GJ14621 [Drosophila virilis]
 ref|XP_002060544.1| GJ15443 [Drosophila virilis]
 ref|XP_002060632.1| GK23480 [Drosophila willistoni]
 ref|XP_002060811.1| GK13845 [Drosophila willistoni]
 ref|XP_002060842.1| GK18473 [Drosophila willistoni]
 ref|XP_002069212.1| GK10374 [Drosophila willistoni]
 ref|XP_002075764.1| GK23625 [Drosophila willistoni]
 ref|XP_002075988.1| GK21031 [Drosophila willistoni]
 ref|XP_002137581.1| GA27301 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002136580.1| GA27611 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002136581.1| GA27610 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002136582.1| GA27609 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002136583.1| GA27608 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002136584.1| GA27607 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_009794694.1| PREDICTED: histone H2B [Nicotiana sylvestris]
 sp|P17271.2|H2B_DROHY RecName: Full=Histone H2B [Drosophila hydei]
 sp|Q76FD7.3|H2B_DROSE RecName: Full=Histone H2B [Drosophila sechellia]
 emb|CAA34922.1| unnamed protein product [Drosophila hydei]
 dbj|BAD02442.1| histone 2B [Drosophila sechellia]
 dbj|BAF56191.1| histone 2B [Drosophila americana]
 dbj|BAF56196.1| histone 2B [Drosophila americana]
 gb|EDV32935.1| GF22516 [Drosophila ananassae]
 gb|EDV32943.1| GF22549 [Drosophila ananassae]
 gb|EDV33670.1| GF15891 [Drosophila ananassae]
 gb|EDV44883.1| GF18956 [Drosophila ananassae]
 gb|EDV44890.1| GF20544 [Drosophila ananassae]
 gb|EDV44899.1| GF23381 [Drosophila ananassae]
 gb|EDV44906.1| GF16024 [Drosophila ananassae]
 gb|EDV44933.1| GF22859 [Drosophila ananassae]
 gb|EDV44944.1| GF20163 [Drosophila ananassae]
 gb|EDV44954.1| GF23427 [Drosophila ananassae]
 gb|EDV44958.1| GF19279 [Drosophila ananassae]
 gb|EDV44962.1| GF19277 [Drosophila ananassae]
 gb|EDV44980.1| GF19254 [Drosophila ananassae]
 gb|EDV94013.1| GH23348 [Drosophila grimshawi]
 gb|EDV94018.1| GH23350 [Drosophila grimshawi]
 gb|EDV94022.1| GH23352 [Drosophila grimshawi]
 gb|EDV94029.1| GH23357 [Drosophila grimshawi]
 gb|EDV94104.1| GH25066 [Drosophila grimshawi]
 gb|EDV94109.1| GH25064 [Drosophila grimshawi]
 gb|EDV94114.1| GH25060 [Drosophila grimshawi]
 gb|EDV94119.1| GH25058 [Drosophila grimshawi]
 gb|EDV94123.1| GH25056 [Drosophila grimshawi]
 gb|EDV94127.1| GH25054 [Drosophila grimshawi]
 gb|EDV94132.1| GH25052 [Drosophila grimshawi]
 gb|EDV94137.1| GH25049 [Drosophila grimshawi]
 gb|EDV94142.1| GH25047 [Drosophila grimshawi]
 gb|EDV94147.1| GH25045 [Drosophila grimshawi]
 gb|EDV94151.1| GH25043 [Drosophila grimshawi]
 gb|EDV94154.1| GH25041 [Drosophila grimshawi]
 gb|EDV94159.1| GH25038 [Drosophila grimshawi]
 gb|EDV94163.1| GH25036 [Drosophila grimshawi]
 gb|EDV99501.1| GH22492 [Drosophila grimshawi]
 gb|EDW04356.1| GH23546 [Drosophila grimshawi]
 gb|EDW04358.1| GH22233 [Drosophila grimshawi]
 gb|EDW04417.1| GH10970 [Drosophila grimshawi]
 gb|EDW04512.1| GH23767 [Drosophila grimshawi]
 gb|EDW04676.1| GH13935 [Drosophila grimshawi]
 gb|EDW04710.1| GH12419 [Drosophila grimshawi]
 gb|EDW04723.1| GH23489 [Drosophila grimshawi]
 gb|EDW05043.1| GH23881 [Drosophila grimshawi]
 gb|EDW05223.1| GH23781 [Drosophila grimshawi]
 gb|EDW05309.1| GI21875 [Drosophila mojavensis]
 gb|EDW11640.1| GI13923 [Drosophila mojavensis]
 gb|EDW11644.1| GI13901 [Drosophila mojavensis]
 gb|EDW11648.1| GI13879 [Drosophila mojavensis]
 gb|EDW12431.1| GI17678 [Drosophila mojavensis]
 gb|EDW14237.1| GI24153 [Drosophila mojavensis]
 gb|EDW14239.1| GI24154 [Drosophila mojavensis]
 gb|EDW14243.1| GI24156 [Drosophila mojavensis]
 gb|EDW14247.1| GI24158 [Drosophila mojavensis]
 gb|EDW17071.1| GI14522 [Drosophila mojavensis]
 gb|EDW19820.1| GI16890 [Drosophila mojavensis]
 gb|EDW24102.1| GL23561 [Drosophila persimilis]
 gb|EDW24113.1| GL23557 [Drosophila persimilis]
 gb|EDW24118.1| GL23555 [Drosophila persimilis]
 gb|EDW24123.1| GL23553 [Drosophila persimilis]
 gb|EDW26937.1| GL17800 [Drosophila persimilis]
 gb|EDW30235.1| GL15944 [Drosophila persimilis]
 gb|EDW43593.1| GM23434 [Drosophila sechellia]
 gb|EDW43597.1| GM17425 [Drosophila sechellia]
 gb|EDW43648.1| GM16168 [Drosophila sechellia]
 gb|EDW44119.1| GM16542 [Drosophila sechellia]
 gb|EDW48890.1| GM24037 [Drosophila sechellia]
 gb|EDW49038.1| GM13191 [Drosophila sechellia]
 gb|EDW49043.1| GM13187 [Drosophila sechellia]
 gb|EDW49318.1| GM13608 [Drosophila sechellia]
 gb|EDW49750.1| GM19608 [Drosophila sechellia]
 gb|EDW51578.1| GM10080 [Drosophila sechellia]
 gb|EDW51648.1| GM18819 [Drosophila sechellia]
 gb|EDW52629.1| GM13542 [Drosophila sechellia]
 gb|EDW52630.1| GM13541 [Drosophila sechellia]
 gb|EDW52634.1| GM13539 [Drosophila sechellia]
 gb|EDW52668.1| GM22424 [Drosophila sechellia]
 gb|EDW52673.1| GM22584 [Drosophila sechellia]
 gb|EDW52837.1| GM26707 [Drosophila sechellia]
 gb|EDW52842.1| GM19736 [Drosophila sechellia]
 gb|EDW52846.1| GM19734 [Drosophila sechellia]
 gb|EDW53687.1| GM11748 [Drosophila sechellia]
 gb|EDW53838.1| GM15473 [Drosophila sechellia]
 gb|EDW53845.1| GM19672 [Drosophila sechellia]
 gb|EDW53864.1| GM11937 [Drosophila sechellia]
 gb|EDW54686.1| GM23805 [Drosophila sechellia]
 gb|EDW54702.1| GM26724 [Drosophila sechellia]
 gb|EDW55442.1| GM19761 [Drosophila sechellia]
 gb|EDW55448.1| GM13213 [Drosophila sechellia]
 gb|EDW55453.1| GM17711 [Drosophila sechellia]
 gb|EDW55913.1| GM19277 [Drosophila sechellia]
 gb|EDW55918.1| GM19328 [Drosophila sechellia]
 gb|EDW56409.1| GM13614 [Drosophila sechellia]
 gb|EDW56421.1| GM19703 [Drosophila sechellia]
 gb|EDW56426.1| GM19701 [Drosophila sechellia]
 gb|EDW56436.1| GM19697 [Drosophila sechellia]
 gb|EDW56440.1| GM19696 [Drosophila sechellia]
 gb|EDW56448.1| GM19430 [Drosophila sechellia]
 gb|EDW56458.1| GM23249 [Drosophila sechellia]
 gb|EDW56483.1| GM13135 [Drosophila sechellia]
 gb|EDW56489.1| GM13660 [Drosophila sechellia]
 gb|EDW57364.1| GJ15443 [Drosophila virilis]
 gb|EDW57466.1| GJ15445 [Drosophila virilis]
 gb|EDW64423.1| GJ17460 [Drosophila virilis]
 gb|EDW66613.1| GJ23528 [Drosophila virilis]
 gb|EDW66618.1| GJ23526 [Drosophila virilis]
 gb|EDW66623.1| GJ23523 [Drosophila virilis]
 gb|EDW66631.1| GJ23519 [Drosophila virilis]
 gb|EDW66635.1| GJ23517 [Drosophila virilis]
 gb|EDW66639.1| GJ23516 [Drosophila virilis]
 gb|EDW71460.1| GJ15164 [Drosophila virilis]
 gb|EDW71464.1| GJ14621 [Drosophila virilis]
 gb|EDW71535.1| GJ14625 [Drosophila virilis]
 gb|EDW71554.1| GJ16343 [Drosophila virilis]
 gb|EDW71557.1| GJ16342 [Drosophila virilis]
 gb|EDW71618.1| GK23480 [Drosophila willistoni]
 gb|EDW71797.1| GK13845 [Drosophila willistoni]
 gb|EDW71828.1| GK18473 [Drosophila willistoni]
 gb|EDW80198.1| GK10374 [Drosophila willistoni]
 gb|EDW86750.1| GK23625 [Drosophila willistoni]
 gb|EDW86974.1| GK21031 [Drosophila willistoni]
 dbj|BAG68519.1| histone 2B [Drosophila pseudoobscura]
 gb|EDY68139.1| GA27301 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY71581.1| GA27611 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY71582.1| GA27610 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY71583.1| GA27609 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY71584.1| GA27608 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY71585.1| GA27607 [Drosophila pseudoobscura pseudoobscura]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>gb|ELK02685.1| Histone H2B type 1 [Pteropus alecto]
Length=223

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSNP  827
            Q AV+L+LPG+L KHA++EGTKAVT Y  +KS+P
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSKSSP  129



>gb|AAI15793.1| Hist1h2bj protein, partial [Mus musculus]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>pdb|2PYO|D Chain D, Drosophila Nucleosome Core
 pdb|2PYO|H Chain H, Drosophila Nucleosome Core
Length=122

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  32   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  122



>ref|XP_004988971.1| histone H2B [Salpingoeca rosetta]
 gb|EGD79490.1| histone H2B [Salpingoeca rosetta]
Length=130

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD+ ISSKAM+++N+ + D+FERIA EA+ L+KY +++T+SSREI
Sbjct  31   ESYSIYIYKVLKQVHPDVGISSKAMSILNSFVNDIFERIANEASRLAKYNNKSTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTKSN  824
            Q A++L+LPG+L KHA++EGTKAVT Y     N
Sbjct  91   QTAIRLLLPGELAKHAVSEGTKAVTKYTSAGGN  123



>ref|XP_002637571.1| Hypothetical protein CBG19304 [Caenorhabditis briggsae]
 emb|CAP36579.1| Protein CBG19304 [Caenorhabditis briggsae]
Length=122

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>gb|KFP23798.1| Histone H2B 7 [Colius striatus]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|NP_783595.1| histone H2B type 1-B [Mus musculus]
 sp|Q64475.3|H2B1B_MOUSE RecName: Full=Histone H2B type 1-B; AltName: Full=h2B-143 [Mus 
musculus]
 emb|CAA56576.1| histone 2b protein [Mus musculus]
 gb|AAO06248.1| histone protein Hist1h2bb [Mus musculus]
 gb|AAI16854.1| Histone cluster 1, H2bb [Mus musculus]
 gb|AAI16858.1| Histone cluster 1, H2bb [Mus musculus]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_004847604.1| PREDICTED: histone H2B type 1-M-like [Heterocephalus glaber]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L++Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLARYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_003110319.1| hypothetical protein CRE_05743 [Caenorhabditis remanei]
 gb|EFO87612.1| hypothetical protein CRE_05743 [Caenorhabditis remanei]
Length=163

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  73   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIAAEASRLAHYNKRSTISSREI  132

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  133  QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  163



>ref|XP_006760036.1| PREDICTED: histone H2B type 1-like [Myotis davidii]
 gb|ELK33063.1| Histone H2B type 1 [Myotis davidii]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM ++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYTKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>ref|XP_001996801.1| GH23347 [Drosophila grimshawi]
 gb|EDV94011.1| GH23347 [Drosophila grimshawi]
Length=123

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y++KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  33   ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREI  92

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  93   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  123



>ref|XP_008114645.1| PREDICTED: histone H2B 5-like [Anolis carolinensis]
Length=126

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  36   ESYSIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAGEASRLAHYNKRSTITSREI  95

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  96   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  126



>gb|EGT36342.1| hypothetical protein CAEBREN_24845 [Caenorhabditis brenneri]
 gb|EGT47374.1| hypothetical protein CAEBREN_17003 [Caenorhabditis brenneri]
 gb|EGT47692.1| hypothetical protein CAEBREN_29971 [Caenorhabditis brenneri]
 gb|EGT51266.1| hypothetical protein CAEBREN_02289 [Caenorhabditis brenneri]
Length=122

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  +SSKAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  32   ESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVNDVFERIASEASRLAHYNKRSTISSREI  91

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  92   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  122



>gb|KHN71353.1| Histone H2B 1 [Toxocara canis]
Length=121

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R T+SSREI
Sbjct  31   ESYSVYIYRVLKQVHPDTGISSKAMSIMNSFVNDVFERIAAEASRLAHYNRRTTISSREI  90

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  91   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  121



>emb|CDS11876.1| Putative Histone H2B [Absidia idahoensis var. thermophila]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  Y+++V+KQVHPD  IS+KAM+++N+ + D+FERIA EA+ L+ Y  R+T+SSREI
Sbjct  34   ETYSSYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLILPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_004065519.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004065540.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004065576.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004065578.1| PREDICTED: histone H2B 1/2-like isoform 1 [Oryzias latipes]
 ref|XP_004065583.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004076083.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004076084.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004076086.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004084102.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004085096.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_004085991.1| PREDICTED: histone H2B 1/2-like [Oryzias latipes]
 ref|XP_005750282.1| PREDICTED: histone H2B 1/2-like [Pundamilia nyererei]
 ref|XP_005751311.1| PREDICTED: histone H2B 1/2-like [Pundamilia nyererei]
 ref|XP_005811246.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
 ref|XP_006785216.1| PREDICTED: histone H2B 1/2-like [Neolamprologus brichardi]
 ref|XP_006785220.1| PREDICTED: histone H2B 1/2-like [Neolamprologus brichardi]
 ref|XP_006808338.1| PREDICTED: histone H2B 1/2-like [Neolamprologus brichardi]
 ref|XP_007555239.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
 ref|XP_007575251.1| PREDICTED: histone H2B 1/2-like [Poecilia formosa]
 dbj|BAG82657.1| histone H2B [Oryzias latipes]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



>ref|XP_005817564.1| PREDICTED: histone H2B 1/2-like [Xiphophorus maculatus]
 ref|XP_007555953.1| PREDICTED: histone H2B 1/2 [Poecilia formosa]
 ref|XP_007555956.1| PREDICTED: histone H2B 1/2 [Poecilia formosa]
 ref|XP_007561739.1| PREDICTED: histone H2B 1/2 [Poecilia formosa]
Length=124

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  546  EGYKRYVFKVMKQVHPDLAISSKAMTVINNLMGDMFERIAVEAATLSKYISRATLSSREI  725
            E Y  YV+KV+KQVHPD  ISSKAM+++N+ + D+FERIA EA+ L+ Y  R+T++SREI
Sbjct  34   ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIASEASRLAHYNKRSTITSREI  93

Query  726  QDAVKLVLPGDLGKHAIAEGTKAVTTYLGTK  818
            Q AV+L+LPG+L KHA++EGTKAVT Y  +K
Sbjct  94   QTAVRLLLPGELAKHAVSEGTKAVTKYTSSK  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2617454869184