BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78597_g1_i1 len=1054 path=[1:0-987 989:988-1020 989:1021-1053]

Length=1054
                                                                      Score     E

ref|XP_004240436.1|  PREDICTED: uncharacterized protein LOC101250804    275   1e-86   
ref|XP_009590525.1|  PREDICTED: uncharacterized protein LOC104087688    275   1e-86   
ref|XP_009767700.1|  PREDICTED: uncharacterized protein LOC104218813    274   6e-86   
ref|XP_009778866.1|  PREDICTED: uncharacterized protein LOC104228160    271   4e-85   
ref|XP_006344092.1|  PREDICTED: uncharacterized protein LOC102584365    271   5e-85   
ref|XP_009608592.1|  PREDICTED: uncharacterized protein LOC104102561    270   1e-84   
ref|XP_009619286.1|  PREDICTED: uncharacterized protein LOC104111312    270   1e-84   
ref|XP_006352824.1|  PREDICTED: uncharacterized protein LOC102585280    269   3e-84   
ref|XP_011089036.1|  PREDICTED: uncharacterized protein LOC105170116    260   7e-81   
ref|XP_004242542.1|  PREDICTED: uncharacterized protein LOC101264...    257   1e-79   
ref|XP_010323098.1|  PREDICTED: uncharacterized protein LOC101264...    256   3e-79   
ref|XP_009803540.1|  PREDICTED: uncharacterized protein LOC104248884    255   1e-78   
ref|XP_011089640.1|  PREDICTED: uncharacterized protein LOC105170537    252   1e-77   
ref|XP_007049639.1|  Sulfate/thiosulfate import ATP-binding prote...    248   3e-76   
gb|EYU21094.1|  hypothetical protein MIMGU_mgv1a010707mg                238   4e-72   
ref|XP_010247442.1|  PREDICTED: uncharacterized protein LOC104590465    237   1e-71   
gb|EYU40643.1|  hypothetical protein MIMGU_mgv1a018130mg                234   8e-71   
gb|KDP45271.1|  hypothetical protein JCGZ_15136                         230   2e-69   
ref|XP_006484811.1|  PREDICTED: uncharacterized protein LOC102616317    229   9e-69   
ref|XP_002265575.1|  PREDICTED: uncharacterized protein LOC100250319    228   2e-68   Vitis vinifera
ref|XP_006437238.1|  hypothetical protein CICLE_v10033970mg             228   2e-68   
emb|CAN71484.1|  hypothetical protein VITISV_025338                     226   6e-68   Vitis vinifera
emb|CDP08557.1|  unnamed protein product                                226   1e-67   
ref|XP_011044961.1|  PREDICTED: uncharacterized protein LOC105140000    221   6e-66   
ref|XP_002313669.2|  hypothetical protein POPTR_0009s14690g             219   7e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002305559.1|  hypothetical protein POPTR_0004s19550g             216   6e-64   Populus trichocarpa [western balsam poplar]
ref|XP_011046274.1|  PREDICTED: uncharacterized protein LOC105140927    213   2e-62   
ref|XP_002533502.1|  conserved hypothetical protein                     209   3e-61   Ricinus communis
ref|XP_004290157.1|  PREDICTED: uncharacterized protein LOC101303288    207   3e-60   
ref|XP_002527250.1|  conserved hypothetical protein                     206   4e-60   Ricinus communis
ref|XP_006298220.1|  hypothetical protein CARUB_v10014278mg             204   4e-59   
ref|XP_010100796.1|  hypothetical protein L484_015825                   204   5e-59   
ref|XP_002882522.1|  hypothetical protein ARALYDRAFT_478057             204   5e-59   
ref|XP_008245959.1|  PREDICTED: uncharacterized protein LOC103344110    202   3e-58   
ref|XP_010451469.1|  PREDICTED: uncharacterized protein LOC104733574    201   4e-58   
ref|XP_010685113.1|  PREDICTED: uncharacterized protein LOC104899597    202   7e-58   
ref|XP_006407845.1|  hypothetical protein EUTSA_v10021229mg             200   1e-57   
ref|NP_566303.1|  uncharacterized protein                               200   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464355.1|  PREDICTED: uncharacterized protein LOC104744922    200   2e-57   
gb|EPS70244.1|  hypothetical protein M569_04516                         199   3e-57   
ref|XP_010036764.1|  PREDICTED: uncharacterized protein LOC104425692    199   5e-57   
gb|AAM63439.1|  unknown                                                 198   7e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486283.1|  PREDICTED: uncharacterized protein LOC104764448    198   8e-57   
ref|XP_009147084.1|  PREDICTED: uncharacterized protein LOC103870677    197   3e-56   
emb|CDY28060.1|  BnaC05g44620D                                          195   1e-55   
ref|XP_009334278.1|  PREDICTED: uncharacterized protein LOC103927106    193   9e-55   
emb|CDY35924.1|  BnaA05g30260D                                          192   2e-54   
ref|XP_010069610.1|  PREDICTED: uncharacterized protein LOC104456503    192   2e-54   
ref|XP_009381313.1|  PREDICTED: uncharacterized protein LOC103969497    192   2e-54   
ref|XP_009372237.1|  PREDICTED: uncharacterized protein LOC103961421    192   3e-54   
ref|XP_008372544.1|  PREDICTED: uncharacterized protein LOC103435893    191   4e-54   
emb|CDY52283.1|  BnaA03g57760D                                          190   4e-54   
ref|XP_008384612.1|  PREDICTED: uncharacterized protein LOC103447207    191   5e-54   
emb|CDY15101.1|  BnaC03g44620D                                          189   9e-54   
gb|KGN44644.1|  hypothetical protein Csa_7G354530                       189   1e-53   
ref|XP_008458063.1|  PREDICTED: uncharacterized protein LOC103497602    189   2e-53   
gb|KFK39834.1|  hypothetical protein AALP_AA3G294100                    188   3e-53   
ref|XP_003548628.1|  PREDICTED: uncharacterized protein LOC100805677    189   3e-53   
ref|XP_004154430.1|  PREDICTED: uncharacterized protein LOC101232147    188   5e-53   
ref|NP_189161.1|  uncharacterized protein                               187   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626934.1|  hypothetical protein MTR_8g012240                  187   1e-52   
ref|XP_007134175.1|  hypothetical protein PHAVU_010G025800g             187   1e-52   
ref|XP_004510230.1|  PREDICTED: uncharacterized protein LOC101513106    186   2e-52   
gb|KFK38193.1|  hypothetical protein AALP_AA3G081300                    186   2e-52   
ref|XP_010926661.1|  PREDICTED: uncharacterized protein LOC105048883    185   8e-52   
ref|XP_010905163.1|  PREDICTED: uncharacterized protein LOC105032414    185   1e-51   
gb|KHN10055.1|  hypothetical protein glysoja_048200                     181   1e-51   
emb|CDY60822.1|  BnaAnng17250D                                          184   2e-51   
ref|XP_006850288.1|  hypothetical protein AMTR_s00020p00161780          183   6e-51   
ref|XP_009136110.1|  PREDICTED: uncharacterized protein LOC103860277    182   6e-51   
ref|XP_010547135.1|  PREDICTED: uncharacterized protein LOC104818986    183   8e-51   
emb|CDY34904.1|  BnaA01g32350D                                          182   1e-50   
ref|XP_002883595.1|  hypothetical protein ARALYDRAFT_899148             181   2e-50   
ref|XP_007200524.1|  hypothetical protein PRUPE_ppa009442mg             181   3e-50   
ref|XP_010552020.1|  PREDICTED: uncharacterized protein LOC104822476    179   3e-49   
ref|XP_010488635.1|  PREDICTED: uncharacterized protein LOC104766445    177   2e-48   
ref|XP_006299312.1|  hypothetical protein CARUB_v10015467mg             175   3e-48   
ref|XP_008792958.1|  PREDICTED: uncharacterized protein LOC103709418    175   6e-48   
ref|XP_009383138.1|  PREDICTED: uncharacterized protein LOC103970954    174   8e-48   
ref|XP_010466945.1|  PREDICTED: uncharacterized protein LOC104747073    174   1e-47   
ref|XP_010527297.1|  PREDICTED: uncharacterized protein LOC104804654    173   1e-47   
ref|XP_010913111.1|  PREDICTED: uncharacterized protein LOC105038887    173   2e-47   
ref|XP_008778742.1|  PREDICTED: uncharacterized protein LOC103698490    172   6e-47   
ref|XP_008799562.1|  PREDICTED: uncharacterized protein LOC103714174    172   7e-47   
ref|XP_009410611.1|  PREDICTED: uncharacterized protein LOC103992576    169   9e-46   
ref|XP_006418642.1|  hypothetical protein EUTSA_v10002988mg             167   4e-45   
ref|XP_003530848.2|  PREDICTED: uncharacterized protein LOC100814756    164   3e-44   
ref|XP_001781040.1|  predicted protein                                  162   5e-44   
ref|XP_009405539.1|  PREDICTED: uncharacterized protein LOC103988661    164   6e-44   
gb|KGN58383.1|  hypothetical protein Csa_3G634350                       164   9e-44   
ref|XP_009408763.1|  PREDICTED: uncharacterized protein LOC103991129    164   1e-43   
ref|XP_007140695.1|  hypothetical protein PHAVU_008G134000g             160   1e-42   
ref|XP_008458966.1|  PREDICTED: uncharacterized protein LOC103498221    161   1e-42   
emb|CDM84922.1|  unnamed protein product                                159   5e-42   
ref|XP_010514073.1|  PREDICTED: uncharacterized protein LOC104790070    158   5e-42   
ref|XP_004492292.1|  PREDICTED: uncharacterized protein LOC101514428    158   9e-42   
gb|ABR17293.1|  unknown                                                 162   9e-42   Picea sitchensis
gb|EYU33859.1|  hypothetical protein MIMGU_mgv1a011572mg                157   1e-41   
ref|XP_008460403.1|  PREDICTED: uncharacterized protein LOC103499228    157   2e-41   
gb|KEH22542.1|  DUF506 family protein                                   156   4e-41   
ref|XP_003594199.1|  hypothetical protein MTR_2g025520                  155   2e-40   
ref|XP_006302608.1|  hypothetical protein CARUB_v10020728mg             154   4e-40   
ref|XP_002458976.1|  hypothetical protein SORBIDRAFT_03g043660          153   9e-40   Sorghum bicolor [broomcorn]
ref|XP_010040765.1|  PREDICTED: uncharacterized protein LOC104429610    153   2e-39   
gb|KCW44943.1|  hypothetical protein EUGRSUZ_L01464                     153   2e-39   
ref|XP_010252609.1|  PREDICTED: uncharacterized protein LOC104594140    152   3e-39   
ref|XP_010090963.1|  hypothetical protein L484_013622                   152   3e-39   
gb|EMT13556.1|  hypothetical protein F775_19134                         147   1e-38   
ref|XP_009759363.1|  PREDICTED: uncharacterized protein LOC104211916    150   2e-38   
ref|XP_008227493.1|  PREDICTED: uncharacterized protein LOC103327003    149   3e-38   
ref|XP_004486208.1|  PREDICTED: uncharacterized protein LOC101490516    149   3e-38   
gb|AES92702.2|  DUF506 family protein                                   149   3e-38   
gb|KGN65077.1|  hypothetical protein Csa_1G194720                       149   3e-38   
ref|XP_003610505.1|  hypothetical protein MTR_4g132940                  149   3e-38   
ref|XP_010042775.1|  PREDICTED: uncharacterized protein LOC104431954    149   6e-38   
ref|XP_009617385.1|  PREDICTED: uncharacterized protein LOC104109739    148   9e-38   
ref|XP_006839039.1|  hypothetical protein AMTR_s00090p00038710          146   9e-38   
ref|XP_008798832.1|  PREDICTED: uncharacterized protein LOC103713613    148   9e-38   
ref|XP_001758005.1|  predicted protein                                  145   1e-37   
ref|XP_006352464.1|  PREDICTED: uncharacterized protein LOC102605315    148   1e-37   
emb|CDY31234.1|  BnaC08g15290D                                          147   1e-37   
ref|XP_003610508.1|  hypothetical protein MTR_4g132970                  147   1e-37   
ref|XP_006352465.1|  PREDICTED: uncharacterized protein LOC102605651    147   1e-37   
gb|KHN40836.1|  hypothetical protein glysoja_015203                     147   2e-37   
ref|XP_001763177.1|  predicted protein                                  145   2e-37   
ref|XP_006586767.1|  PREDICTED: uncharacterized protein LOC100811764    147   3e-37   
ref|XP_002967161.1|  hypothetical protein SELMODRAFT_67158              144   5e-37   
emb|CDY30048.1|  BnaC05g09720D                                          145   5e-37   
ref|NP_176432.2|  uncharacterized protein                               145   5e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY21027.1|  BnaA08g24980D                                          145   7e-37   
ref|XP_007147662.1|  hypothetical protein PHAVU_006G143800g             146   9e-37   
ref|XP_004295306.1|  PREDICTED: uncharacterized protein LOC101309232    145   1e-36   
ref|XP_010270077.1|  PREDICTED: uncharacterized protein LOC104606524    145   1e-36   
ref|XP_009110678.1|  PREDICTED: uncharacterized protein LOC103836193    144   2e-36   
gb|EYU40926.1|  hypothetical protein MIMGU_mgv1a024946mg                143   2e-36   
ref|XP_007036591.1|  Uncharacterized protein isoform 1                  144   3e-36   
ref|XP_002960853.1|  hypothetical protein SELMODRAFT_437313             147   3e-36   
ref|XP_011086229.1|  PREDICTED: uncharacterized protein LOC105168020    144   3e-36   
ref|XP_004250255.1|  PREDICTED: uncharacterized protein LOC101253249    143   5e-36   
emb|CDP04473.1|  unnamed protein product                                143   8e-36   
ref|XP_003547277.1|  PREDICTED: uncharacterized protein LOC100807096    142   9e-36   
ref|XP_010430296.1|  PREDICTED: uncharacterized protein LOC104714581    142   1e-35   
ref|XP_010038726.1|  PREDICTED: uncharacterized protein LOC104427313    144   1e-35   
ref|XP_001751444.1|  predicted protein                                  140   1e-35   
gb|KFK40602.1|  hypothetical protein AALP_AA2G016900                    141   2e-35   
ref|XP_007211670.1|  hypothetical protein PRUPE_ppa009086mg             142   2e-35   
gb|ABK25349.1|  unknown                                                 144   2e-35   Picea sitchensis
ref|XP_008440059.1|  PREDICTED: uncharacterized protein LOC103484651    141   2e-35   
ref|XP_001776493.1|  predicted protein                                  139   2e-35   
emb|CDY53353.1|  BnaA06g38280D                                          140   3e-35   
ref|XP_006305473.1|  hypothetical protein CARUB_v10009904mg             140   4e-35   
ref|XP_004507645.1|  PREDICTED: uncharacterized protein LOC101513838    140   5e-35   
ref|XP_009392399.1|  PREDICTED: uncharacterized protein LOC103978357    142   5e-35   
ref|XP_009376010.1|  PREDICTED: uncharacterized protein LOC103964...    142   6e-35   
ref|XP_009348989.1|  PREDICTED: uncharacterized protein LOC103940569    142   6e-35   
ref|XP_009376009.1|  PREDICTED: uncharacterized protein LOC103964...    142   7e-35   
gb|KFK43469.1|  hypothetical protein AALP_AA1G129000                    140   7e-35   
ref|XP_009418930.1|  PREDICTED: uncharacterized protein LOC103999026    142   7e-35   
ref|XP_009616342.1|  PREDICTED: uncharacterized protein LOC104108895    140   7e-35   
ref|XP_009391132.1|  PREDICTED: uncharacterized protein LOC103977363    139   9e-35   
ref|XP_009148619.1|  PREDICTED: uncharacterized protein LOC103872035    139   1e-34   
ref|XP_009357600.1|  PREDICTED: uncharacterized protein LOC103948319    139   1e-34   
gb|KFK39579.1|  hypothetical protein AALP_AA3G262600                    140   1e-34   
ref|XP_004971035.1|  PREDICTED: uncharacterized protein LOC101782991    139   2e-34   
gb|KHN15392.1|  hypothetical protein glysoja_039049                     137   2e-34   
ref|XP_010476157.1|  PREDICTED: uncharacterized protein LOC104755466    139   2e-34   
ref|XP_011091082.1|  PREDICTED: uncharacterized protein LOC105171616    140   2e-34   
ref|XP_009381920.1|  PREDICTED: uncharacterized protein LOC103970020    138   2e-34   
ref|XP_002987613.1|  hypothetical protein SELMODRAFT_25560              133   2e-34   
ref|NP_172667.1|  uncharacterized protein                               138   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311650.1|  hypothetical protein POPTR_0008s15960g             140   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004134790.1|  PREDICTED: uncharacterized protein LOC101205314    138   3e-34   
ref|XP_002886470.1|  hypothetical protein ARALYDRAFT_475101             138   3e-34   
ref|XP_002892671.1|  hypothetical protein ARALYDRAFT_471352             138   3e-34   
ref|NP_193198.2|  uncharacterized protein                               139   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341032.1|  PREDICTED: uncharacterized protein LOC103403963    140   3e-34   
ref|XP_010473460.1|  PREDICTED: uncharacterized protein LOC104752901    138   3e-34   
ref|XP_009417107.1|  PREDICTED: uncharacterized protein LOC103997570    140   4e-34   
ref|XP_010108179.1|  hypothetical protein L484_014504                   138   4e-34   
ref|XP_010458625.1|  PREDICTED: uncharacterized protein LOC104739853    138   4e-34   
ref|XP_009775142.1|  PREDICTED: uncharacterized protein LOC104225076    138   4e-34   
emb|CDY29750.1|  BnaA01g19160D                                          139   5e-34   
ref|XP_009396480.1|  PREDICTED: uncharacterized protein LOC103981466    137   6e-34   
gb|ABK27021.1|  unknown                                                 139   6e-34   Picea sitchensis
ref|XP_003519060.1|  PREDICTED: uncharacterized protein LOC100780...    139   6e-34   
ref|XP_008775235.1|  PREDICTED: uncharacterized protein LOC103695641    139   6e-34   
emb|CDY16266.1|  BnaC01g23010D                                          139   6e-34   
gb|EMT03225.1|  hypothetical protein F775_30094                         139   8e-34   
ref|XP_009413911.1|  PREDICTED: uncharacterized protein LOC103995119    138   8e-34   
ref|XP_009148494.1|  PREDICTED: uncharacterized protein LOC103871913    138   8e-34   
gb|KHG21883.1|  hypothetical protein F383_04758                         138   1e-33   
ref|XP_010274246.1|  PREDICTED: uncharacterized protein LOC104609584    139   1e-33   
ref|XP_002317118.2|  hypothetical protein POPTR_0011s00710g             137   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_009354682.1|  PREDICTED: uncharacterized protein LOC103945794    137   1e-33   
ref|XP_008228999.1|  PREDICTED: uncharacterized protein LOC103328386    136   1e-33   
ref|XP_011027386.1|  PREDICTED: uncharacterized protein LOC105127700    138   1e-33   
ref|XP_010917637.1|  PREDICTED: uncharacterized protein LOC105042213    138   1e-33   
ref|XP_010440433.1|  PREDICTED: uncharacterized protein LOC104723736    137   1e-33   
gb|KHN02542.1|  hypothetical protein glysoja_002566                     135   1e-33   
ref|XP_008358764.1|  PREDICTED: uncharacterized protein LOC103422480    135   2e-33   
ref|XP_002868272.1|  predicted protein                                  137   2e-33   
ref|XP_010493642.1|  PREDICTED: uncharacterized protein LOC104770875    136   2e-33   
ref|XP_007222776.1|  hypothetical protein PRUPE_ppa006575mg             138   2e-33   
ref|XP_007036590.1|  Uncharacterized protein TCM_012425                 136   2e-33   
ref|XP_002283882.1|  PREDICTED: uncharacterized protein LOC100251040    137   3e-33   Vitis vinifera
gb|EPS71668.1|  hypothetical protein M569_03091                         136   3e-33   
ref|XP_006447294.1|  hypothetical protein CICLE_v10016109mg             135   3e-33   
ref|XP_002317198.2|  hypothetical protein POPTR_0011s00710g             136   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007198935.1|  hypothetical protein PRUPE_ppa009489mg             135   3e-33   
ref|XP_010923500.1|  PREDICTED: uncharacterized protein LOC105046575    137   3e-33   
ref|XP_008802272.1|  PREDICTED: uncharacterized protein LOC103716163    137   4e-33   
ref|XP_010679147.1|  PREDICTED: uncharacterized protein LOC104894580    137   4e-33   
emb|CBI26338.3|  unnamed protein product                                136   4e-33   
gb|KFK23657.1|  hypothetical protein AALP_AAs70636U000200               136   4e-33   
ref|XP_006417274.1|  hypothetical protein EUTSA_v10009327mg             135   4e-33   
ref|XP_010932848.1|  PREDICTED: uncharacterized protein LOC105053...    137   5e-33   
ref|XP_009145248.1|  PREDICTED: uncharacterized protein LOC103868952    136   5e-33   
ref|XP_009769679.1|  PREDICTED: uncharacterized protein LOC104220...    135   5e-33   
gb|KHG04385.1|  hypothetical protein F383_28528                         137   6e-33   
ref|XP_002883389.1|  hypothetical protein ARALYDRAFT_479805             136   6e-33   
ref|XP_009769678.1|  PREDICTED: uncharacterized protein LOC104220...    135   6e-33   
dbj|BAD93802.1|  hypothetical protein                                   135   7e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011000665.1|  PREDICTED: uncharacterized protein LOC105108166    135   7e-33   
ref|XP_008775344.1|  PREDICTED: uncharacterized protein LOC103695730    136   7e-33   
ref|XP_006383826.1|  hypothetical protein POPTR_0004s00300g             134   8e-33   
ref|XP_011015003.1|  PREDICTED: uncharacterized protein LOC105118693    134   8e-33   
ref|XP_009349771.1|  PREDICTED: uncharacterized protein LOC103941304    136   8e-33   
ref|XP_008674671.1|  PREDICTED: uncharacterized protein LOC103650854    134   8e-33   
ref|XP_011011083.1|  PREDICTED: uncharacterized protein LOC105115767    134   9e-33   
ref|XP_010924640.1|  PREDICTED: uncharacterized protein LOC105047424    133   1e-32   
ref|XP_006467346.1|  PREDICTED: uncharacterized protein LOC102630800    134   1e-32   
ref|XP_006838902.1|  hypothetical protein AMTR_s00002p00269120          136   1e-32   
ref|XP_009337300.1|  PREDICTED: uncharacterized protein LOC103929788    135   1e-32   
ref|XP_003554275.1|  PREDICTED: uncharacterized protein LOC100796...    135   1e-32   
ref|XP_002315743.2|  hypothetical protein POPTR_0010s09080g             135   1e-32   Populus trichocarpa [western balsam poplar]
gb|KEH31061.1|  plant-specific domain TIGR01615 family protein          134   1e-32   
gb|EPS57683.1|  hypothetical protein M569_17134                         133   2e-32   
ref|XP_009769676.1|  PREDICTED: uncharacterized protein LOC104220...    135   2e-32   
ref|XP_010552453.1|  PREDICTED: uncharacterized protein LOC104822802    135   2e-32   
gb|EAY75803.1|  hypothetical protein OsI_03718                          132   2e-32   Oryza sativa Indica Group [Indian rice]
dbj|BAD86962.1|  unknown protein                                        132   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009592039.1|  PREDICTED: uncharacterized protein LOC104088953    135   2e-32   
gb|KDO78418.1|  hypothetical protein CISIN_1g021546mg                   133   2e-32   
ref|XP_011030607.1|  PREDICTED: uncharacterized protein LOC105130002    133   2e-32   
ref|XP_010435101.1|  PREDICTED: uncharacterized protein LOC104718968    134   3e-32   
ref|XP_006449847.1|  hypothetical protein CICLE_v10016018mg             133   3e-32   
ref|XP_009608943.1|  PREDICTED: uncharacterized protein LOC104102810    135   3e-32   
ref|XP_004294015.1|  PREDICTED: uncharacterized protein LOC101293076    133   3e-32   
ref|XP_010932847.1|  PREDICTED: uncharacterized protein LOC105053...    134   3e-32   
ref|XP_006859026.1|  hypothetical protein AMTR_s00068p00173710          132   3e-32   
ref|XP_010054617.1|  PREDICTED: uncharacterized protein LOC104442943    131   3e-32   
ref|XP_008384123.1|  PREDICTED: uncharacterized protein LOC103446768    132   3e-32   
emb|CDY10330.1|  BnaC05g29490D                                          134   3e-32   
gb|KDO75986.1|  hypothetical protein CISIN_1g045136mg                   133   3e-32   
ref|XP_006467793.1|  PREDICTED: uncharacterized protein LOC102625397    133   3e-32   
ref|XP_004241036.1|  PREDICTED: uncharacterized protein LOC101256680    134   4e-32   
ref|XP_009135840.1|  PREDICTED: uncharacterized protein LOC103859987    133   4e-32   
ref|XP_002517042.1|  conserved hypothetical protein                     134   4e-32   Ricinus communis
ref|XP_004140037.1|  PREDICTED: uncharacterized protein LOC101208067    132   4e-32   
ref|XP_010546504.1|  PREDICTED: uncharacterized protein LOC104818570    132   4e-32   
emb|CDX92970.1|  BnaA03g36920D                                          133   4e-32   
ref|XP_003536613.1|  PREDICTED: uncharacterized protein LOC100778...    134   5e-32   
ref|XP_002461551.1|  hypothetical protein SORBIDRAFT_02g004630          134   5e-32   Sorghum bicolor [broomcorn]
ref|XP_003528702.1|  PREDICTED: uncharacterized protein LOC100800496    132   5e-32   
dbj|BAJ91106.1|  predicted protein                                      134   5e-32   
emb|CDY10329.1|  BnaC05g29500D                                          134   5e-32   
ref|XP_004495150.1|  PREDICTED: uncharacterized protein LOC101488851    133   6e-32   
ref|NP_001030743.1|  uncharacterized protein                            131   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002983336.1|  hypothetical protein SELMODRAFT_36433              127   6e-32   
ref|XP_008809638.1|  PREDICTED: uncharacterized protein LOC103721275    131   6e-32   
emb|CDX94877.1|  BnaC03g43110D                                          133   6e-32   
ref|XP_006284017.1|  hypothetical protein CARUB_v10005138mg             133   7e-32   
dbj|BAJ95655.1|  predicted protein                                      133   7e-32   
gb|KCW77043.1|  hypothetical protein EUGRSUZ_D013892                    128   7e-32   
ref|XP_011027822.1|  PREDICTED: uncharacterized protein LOC105128027    132   7e-32   
ref|XP_008786071.1|  PREDICTED: uncharacterized protein LOC103704518    133   7e-32   
ref|XP_009398560.1|  PREDICTED: uncharacterized protein LOC103983117    133   7e-32   
ref|XP_010412937.1|  PREDICTED: uncharacterized protein LOC104699313    131   8e-32   
ref|XP_010279309.1|  PREDICTED: uncharacterized protein LOC104613266    134   8e-32   
ref|XP_004146604.1|  PREDICTED: uncharacterized protein LOC101209953    131   9e-32   
gb|KDP20676.1|  hypothetical protein JCGZ_21147                         132   1e-31   
ref|XP_008235339.1|  PREDICTED: uncharacterized protein LOC103334177    133   1e-31   
gb|KEH41039.1|  DUF506 family protein                                   132   1e-31   
ref|XP_002305794.2|  hypothetical protein POPTR_0004s04420g             131   1e-31   
ref|XP_006651904.1|  PREDICTED: uncharacterized protein LOC102719373    133   1e-31   
ref|XP_010488332.1|  PREDICTED: uncharacterized protein LOC104766196    133   1e-31   
gb|KEH23844.1|  DUF506 family protein                                   132   1e-31   
ref|XP_010511972.1|  PREDICTED: uncharacterized protein LOC104788000    132   1e-31   
gb|EYU41426.1|  hypothetical protein MIMGU_mgv1a027149mg                130   1e-31   
ref|XP_010935920.1|  PREDICTED: uncharacterized protein LOC105055693    132   1e-31   
ref|XP_011073616.1|  PREDICTED: uncharacterized protein LOC105158531    133   1e-31   
ref|XP_002280916.1|  PREDICTED: uncharacterized protein LOC100245954    133   1e-31   
ref|XP_007199911.1|  hypothetical protein PRUPE_ppa006774mg             132   1e-31   
ref|XP_001771595.1|  predicted protein                                  129   1e-31   
emb|CBI25063.3|  unnamed protein product                                132   1e-31   
ref|XP_009803807.1|  PREDICTED: uncharacterized protein LOC104249132    133   2e-31   
ref|XP_008438600.1|  PREDICTED: uncharacterized protein LOC103483661    132   2e-31   
ref|XP_010911802.1|  PREDICTED: uncharacterized protein LOC105037884    129   2e-31   
ref|XP_010087119.1|  hypothetical protein L484_012551                   131   2e-31   
ref|XP_010509112.1|  PREDICTED: uncharacterized protein LOC104785569    130   2e-31   
ref|XP_009415278.1|  PREDICTED: uncharacterized protein LOC103996153    131   2e-31   
ref|XP_008358680.1|  PREDICTED: uncharacterized protein LOC103422396    130   2e-31   
gb|EYU27714.1|  hypothetical protein MIMGU_mgv1a021776mg                130   3e-31   
ref|XP_006449349.1|  hypothetical protein CICLE_v10015955mg             130   3e-31   
ref|XP_009412352.1|  PREDICTED: uncharacterized protein LOC103993865    132   3e-31   
ref|XP_007211750.1|  hypothetical protein PRUPE_ppa009430mg             130   3e-31   
ref|XP_002456349.1|  hypothetical protein SORBIDRAFT_03g034430          130   3e-31   
ref|XP_008371017.1|  PREDICTED: uncharacterized protein LOC103434439    130   3e-31   
ref|XP_004134108.1|  PREDICTED: uncharacterized protein LOC101220013    132   3e-31   
ref|XP_010665740.1|  PREDICTED: uncharacterized protein LOC104882998    130   3e-31   
ref|XP_007145925.1|  hypothetical protein PHAVU_007G279300g             131   3e-31   
gb|KDP21383.1|  hypothetical protein JCGZ_21854                         131   3e-31   
ref|XP_002520970.1|  conserved hypothetical protein                     131   3e-31   
ref|XP_009611522.1|  PREDICTED: uncharacterized protein LOC104104...    128   4e-31   
ref|XP_010507618.1|  PREDICTED: uncharacterized protein LOC104784264    130   4e-31   
gb|ACN33661.1|  unknown                                                 128   4e-31   
ref|XP_004493733.1|  PREDICTED: uncharacterized protein LOC101501573    130   4e-31   
gb|KDO58354.1|  hypothetical protein CISIN_1g023044mg                   129   4e-31   
ref|XP_006427800.1|  hypothetical protein CICLE_v10026207mg             129   4e-31   
ref|XP_008355415.1|  PREDICTED: uncharacterized protein LOC103419070    132   4e-31   
ref|XP_010532592.1|  PREDICTED: uncharacterized protein LOC104808...    131   5e-31   
gb|KHN18844.1|  hypothetical protein glysoja_028213                     130   5e-31   
ref|NP_188937.1|  uncharacterized protein                               131   5e-31   
ref|XP_006297914.1|  hypothetical protein CARUB_v10013956mg             131   5e-31   
gb|KDP20978.1|  hypothetical protein JCGZ_21449                         129   5e-31   
ref|XP_004247620.1|  PREDICTED: uncharacterized protein LOC101261455    131   5e-31   
gb|AAT76408.1|  expressed protein                                       131   5e-31   
ref|XP_010554460.1|  PREDICTED: uncharacterized protein LOC104824178    130   6e-31   
ref|XP_011037350.1|  PREDICTED: uncharacterized protein LOC105134588    129   6e-31   
ref|XP_010915985.1|  PREDICTED: uncharacterized protein LOC105040923    129   6e-31   
gb|ACG47470.1|  plant-specific domain TIGR01615 family protein          129   6e-31   
ref|XP_008449297.1|  PREDICTED: uncharacterized protein LOC103491...    131   6e-31   
ref|XP_010466594.1|  PREDICTED: uncharacterized protein LOC104746771    131   6e-31   
ref|XP_009141765.1|  PREDICTED: uncharacterized protein LOC103865688    129   6e-31   
ref|XP_008442621.1|  PREDICTED: uncharacterized protein LOC103486438    129   6e-31   
ref|XP_010260212.1|  PREDICTED: uncharacterized protein LOC104599397    129   7e-31   
ref|XP_006449350.1|  hypothetical protein CICLE_v10015955mg             129   7e-31   
ref|XP_008449296.1|  PREDICTED: uncharacterized protein LOC103491...    131   7e-31   
ref|XP_002509467.1|  conserved hypothetical protein                     129   7e-31   
ref|NP_001276176.1|  uncharacterized protein LOC100797510               129   7e-31   
gb|AAP44687.1|  unknown protein                                         130   8e-31   
ref|XP_009370740.1|  PREDICTED: uncharacterized protein LOC103960075    130   8e-31   
ref|XP_007200341.1|  hypothetical protein PRUPE_ppa010463mg             127   8e-31   
ref|NP_001051556.1|  Os03g0796600                                       130   8e-31   
ref|XP_011002886.1|  PREDICTED: uncharacterized protein LOC105109777    129   8e-31   
gb|KHG05775.1|  Phosphoenolpyruvate carboxylase                         128   8e-31   
emb|CDY18366.1|  BnaA04g22210D                                          129   8e-31   
ref|XP_002307481.1|  hypothetical protein POPTR_0005s21050g             127   8e-31   
ref|XP_004969935.1|  PREDICTED: uncharacterized protein LOC101765...    127   8e-31   
ref|XP_010999817.1|  PREDICTED: uncharacterized protein LOC105107551    127   8e-31   
gb|KEH42803.1|  DUF506 family protein                                   130   8e-31   
ref|XP_007132722.1|  hypothetical protein PHAVU_011G119300g             129   8e-31   
gb|AAO29954.1|  unknown protein                                         130   8e-31   
ref|NP_001132364.1|  uncharacterized protein LOC100193809               128   9e-31   
emb|CDX93300.1|  BnaC04g45960D                                          129   9e-31   
ref|XP_002518400.1|  conserved hypothetical protein                     129   9e-31   
ref|XP_008792271.1|  PREDICTED: uncharacterized protein LOC103708935    128   1e-30   
ref|XP_004150569.1|  PREDICTED: uncharacterized protein LOC101219203    130   1e-30   
ref|XP_003567109.1|  PREDICTED: uncharacterized protein LOC100820998    128   1e-30   
ref|XP_006575047.1|  PREDICTED: uncharacterized protein LOC100781835    130   1e-30   
ref|XP_006294631.1|  hypothetical protein CARUB_v10023669mg             129   1e-30   
ref|XP_010272436.1|  PREDICTED: uncharacterized protein LOC104608217    129   1e-30   
ref|XP_002302081.1|  hypothetical protein POPTR_0002s04710g             129   1e-30   
emb|CDM83992.1|  unnamed protein product                                128   1e-30   
ref|XP_006644698.1|  PREDICTED: uncharacterized protein LOC102712863    127   1e-30   
ref|XP_011042444.1|  PREDICTED: uncharacterized protein LOC105138132    130   1e-30   
ref|XP_010553458.1|  PREDICTED: uncharacterized protein LOC104823541    128   1e-30   
gb|KHG10973.1|  hypothetical protein F383_14727                         128   1e-30   
ref|XP_004961480.1|  PREDICTED: uncharacterized protein LOC101776...    128   2e-30   
ref|XP_006420066.1|  hypothetical protein CICLE_v10005172mg             129   2e-30   
ref|NP_973636.1|  uncharacterized protein                               128   2e-30   
emb|CDO99131.1|  unnamed protein product                                130   2e-30   
ref|XP_006362156.1|  PREDICTED: uncharacterized protein LOC102581927    130   2e-30   
ref|XP_006386249.1|  hypothetical protein POPTR_0002s04710g             129   2e-30   
ref|XP_008225105.1|  PREDICTED: uncharacterized protein LOC103324776    128   2e-30   
ref|XP_007034917.1|  Uncharacterized protein TCM_020740                 129   2e-30   
ref|XP_002309896.1|  hypothetical protein POPTR_0007s03800g             127   2e-30   
ref|XP_009352911.1|  PREDICTED: uncharacterized protein LOC103944203    127   2e-30   
ref|XP_011026075.1|  PREDICTED: uncharacterized protein LOC105126790    129   2e-30   
gb|KHN08517.1|  hypothetical protein glysoja_014282                     128   2e-30   
gb|KDP40258.1|  hypothetical protein JCGZ_02256                         129   2e-30   
ref|XP_001755430.1|  predicted protein                                  123   2e-30   
gb|KFK36783.1|  hypothetical protein AALP_AA4G170300                    128   2e-30   
gb|KDO53956.1|  hypothetical protein CISIN_1g016918mg                   129   2e-30   
ref|XP_009798451.1|  PREDICTED: uncharacterized protein LOC104244...    126   2e-30   
ref|XP_006489485.1|  PREDICTED: uncharacterized protein LOC102607201    129   3e-30   
ref|XP_006376477.1|  hypothetical protein POPTR_0013s13350g             127   3e-30   
ref|XP_008342899.1|  PREDICTED: uncharacterized protein LOC103405656    127   3e-30   
ref|XP_006349734.1|  PREDICTED: uncharacterized protein LOC102605085    129   3e-30   
ref|XP_004955657.1|  PREDICTED: uncharacterized protein LOC101770761    129   3e-30   
ref|XP_004495406.1|  PREDICTED: uncharacterized protein LOC101515...    129   3e-30   
ref|XP_002466297.1|  hypothetical protein SORBIDRAFT_01g005190          129   4e-30   
ref|XP_004241077.2|  PREDICTED: uncharacterized protein LOC101243792    125   4e-30   
ref|XP_002306808.1|  hypothetical protein POPTR_0005s23830g             129   4e-30   
emb|CBI23968.3|  unnamed protein product                                126   4e-30   
ref|XP_004969934.1|  PREDICTED: uncharacterized protein LOC101765...    126   4e-30   
ref|XP_001772596.1|  predicted protein                                  124   4e-30   
ref|NP_001241955.1|  uncharacterized protein LOC100803860               127   4e-30   
emb|CAB10241.1|  hypothetical protein                                   128   4e-30   
ref|XP_011079933.1|  PREDICTED: uncharacterized protein LOC105163323    128   5e-30   
ref|XP_004247206.1|  PREDICTED: uncharacterized protein LOC101268222    129   5e-30   
ref|XP_011095969.1|  PREDICTED: uncharacterized protein LOC105175280    127   5e-30   
ref|XP_010054620.1|  PREDICTED: uncharacterized protein LOC104442946    127   5e-30   
gb|KCW75197.1|  hypothetical protein EUGRSUZ_E03952                     126   5e-30   
ref|XP_004981432.1|  PREDICTED: uncharacterized protein LOC101769052    128   6e-30   
ref|XP_010109565.1|  hypothetical protein L484_018300                   122   6e-30   
ref|XP_003593582.1|  hypothetical protein MTR_2g013780                  127   6e-30   
ref|XP_007162481.1|  hypothetical protein PHAVU_001G155900g             127   6e-30   
ref|XP_002263191.1|  PREDICTED: uncharacterized protein LOC100261530    127   6e-30   
ref|XP_002274226.1|  PREDICTED: uncharacterized protein LOC100248895    126   7e-30   
ref|XP_006443944.1|  hypothetical protein CICLE_v10020512mg             128   7e-30   
ref|XP_010526513.1|  PREDICTED: uncharacterized protein LOC104804059    126   7e-30   
ref|XP_006472931.1|  PREDICTED: uncharacterized protein LOC102620620    125   8e-30   
ref|XP_008386403.1|  PREDICTED: uncharacterized protein LOC103448920    128   8e-30   
ref|XP_004485787.1|  PREDICTED: uncharacterized protein LOC101496996    126   8e-30   
ref|XP_009137779.1|  PREDICTED: uncharacterized protein LOC103861824    126   8e-30   
ref|XP_008237674.1|  PREDICTED: uncharacterized protein LOC103336415    124   9e-30   
ref|XP_011022995.1|  PREDICTED: uncharacterized protein LOC105124606    125   9e-30   
ref|XP_007148155.1|  hypothetical protein PHAVU_006G184800g             126   9e-30   
ref|XP_008377146.1|  PREDICTED: uncharacterized protein LOC103440258    126   9e-30   
ref|XP_010059574.1|  PREDICTED: uncharacterized protein LOC104447549    126   9e-30   
ref|XP_008448302.1|  PREDICTED: uncharacterized protein LOC103490536    125   9e-30   
ref|XP_008799042.1|  PREDICTED: uncharacterized protein LOC103713792    124   9e-30   
ref|XP_006350726.1|  PREDICTED: uncharacterized protein LOC102580193    128   1e-29   
ref|XP_010432713.1|  PREDICTED: uncharacterized protein LOC104716932    125   1e-29   
ref|XP_009394838.1|  PREDICTED: uncharacterized protein LOC103980237    125   1e-29   
ref|XP_002989602.1|  hypothetical protein SELMODRAFT_428171             131   1e-29   
emb|CDX92863.1|  BnaC07g41210D                                          125   1e-29   
gb|KDO68588.1|  hypothetical protein CISIN_1g016256mg                   127   1e-29   
gb|AAX95310.1|  Protein of unknown function (DUF506)                    125   1e-29   
ref|XP_004232882.1|  PREDICTED: uncharacterized protein LOC101251439    125   1e-29   
ref|XP_010686492.1|  PREDICTED: uncharacterized protein LOC104900698    125   1e-29   
gb|ACA04867.1|  protein of unknown function DUF506                      122   1e-29   
ref|XP_008455311.1|  PREDICTED: uncharacterized protein LOC103495506    125   1e-29   
gb|AGV54169.1|  hypothetical protein                                    127   1e-29   
ref|XP_004296601.1|  PREDICTED: uncharacterized protein LOC101304761    127   1e-29   
ref|XP_007149843.1|  hypothetical protein PHAVU_005G103100g             125   1e-29   
gb|EEC79539.1|  hypothetical protein OsI_20652                          125   1e-29   
gb|AFK33555.1|  unknown                                                 125   1e-29   
ref|XP_004289090.1|  PREDICTED: uncharacterized protein LOC101298943    126   1e-29   
ref|NP_001056062.1|  Os05g0519300                                       125   2e-29   
gb|KDP26141.1|  hypothetical protein JCGZ_22242                         124   2e-29   
ref|XP_006347033.1|  PREDICTED: uncharacterized protein LOC102589652    125   2e-29   
ref|XP_007144680.1|  hypothetical protein PHAVU_007G176100g             126   2e-29   
gb|KDP24117.1|  hypothetical protein JCGZ_25774                         125   2e-29   
ref|XP_003590545.1|  hypothetical protein MTR_1g070970                  126   2e-29   
ref|XP_007154007.1|  hypothetical protein PHAVU_003G083200g             125   2e-29   
dbj|BAJ99500.1|  predicted protein                                      124   2e-29   
ref|XP_002517904.1|  conserved hypothetical protein                     125   2e-29   
ref|XP_010091499.1|  hypothetical protein L484_010341                   124   2e-29   
ref|XP_006377369.1|  hypothetical protein POPTR_0011s05310g             125   2e-29   
ref|XP_007025603.1|  Uncharacterized protein TCM_029854                 125   3e-29   
ref|XP_011043393.1|  PREDICTED: uncharacterized protein LOC105138873    125   3e-29   
gb|AES60796.2|  DUF506 family protein                                   125   3e-29   
ref|XP_008371375.1|  PREDICTED: uncharacterized protein LOC103434801    124   3e-29   
ref|XP_006298234.1|  hypothetical protein CARUB_v10014295mg             124   3e-29   
gb|EPS70582.1|  hypothetical protein M569_04176                         125   4e-29   
ref|XP_003556392.1|  PREDICTED: uncharacterized protein LOC100812376    126   4e-29   
ref|XP_010489008.1|  PREDICTED: uncharacterized protein LOC104766760    124   4e-29   
ref|XP_006371552.1|  hypothetical protein POPTR_0019s13100g             124   4e-29   
ref|XP_003529329.1|  PREDICTED: uncharacterized protein LOC100783925    124   4e-29   
dbj|BAO45888.1|  hypothetical protein                                   126   4e-29   
gb|KGN49062.1|  hypothetical protein Csa_6G511780                       123   4e-29   
ref|XP_010521283.1|  PREDICTED: uncharacterized protein LOC104800...    124   4e-29   
ref|XP_009611520.1|  PREDICTED: uncharacterized protein LOC104104...    122   4e-29   
emb|CDP04738.1|  unnamed protein product                                123   4e-29   
gb|KFK40439.1|  hypothetical protein AALP_AA3G373400                    124   5e-29   
ref|XP_006382839.1|  hypothetical protein POPTR_0005s05950g             122   5e-29   
gb|EEE64386.1|  hypothetical protein OsJ_19228                          124   5e-29   
ref|XP_010244018.1|  PREDICTED: uncharacterized protein LOC104587937    123   5e-29   
ref|XP_010437907.1|  PREDICTED: uncharacterized protein LOC104721584    123   6e-29   
ref|XP_009628874.1|  PREDICTED: uncharacterized protein LOC104119151    124   6e-29   
ref|XP_010521127.1|  PREDICTED: uncharacterized protein LOC104800...    124   7e-29   
ref|NP_194974.1|  uncharacterized protein                               123   7e-29   
ref|XP_003536200.1|  PREDICTED: uncharacterized protein LOC100780943    125   7e-29   
emb|CAN65796.1|  hypothetical protein VITISV_006560                     124   7e-29   
tpg|DAA42544.1|  TPA: plant-specific domain TIGR01615 family protein    125   8e-29   
ref|XP_003536790.2|  PREDICTED: uncharacterized protein LOC100782749    124   8e-29   
ref|XP_010521057.1|  PREDICTED: uncharacterized protein LOC104800...    124   8e-29   
gb|KHG17705.1|  Fidgetin-like protein 1                                 122   9e-29   
ref|XP_010521203.1|  PREDICTED: uncharacterized protein LOC104800...    124   9e-29   
ref|XP_006382840.1|  hypothetical protein POPTR_0005s05950g             122   1e-28   
ref|XP_010228398.1|  PREDICTED: uncharacterized protein LOC100837119    124   1e-28   
ref|XP_002517235.1|  conserved hypothetical protein                     122   1e-28   
ref|XP_009339366.1|  PREDICTED: uncharacterized protein LOC103931571    124   1e-28   
ref|XP_004505573.1|  PREDICTED: uncharacterized protein LOC101507941    123   1e-28   
ref|XP_004137025.1|  PREDICTED: uncharacterized protein LOC101216632    123   1e-28   
gb|EYU46541.1|  hypothetical protein MIMGU_mgv1a008406mg                124   1e-28   
dbj|BAJ87411.1|  predicted protein                                      123   1e-28   
ref|XP_010228288.1|  PREDICTED: uncharacterized protein LOC100832408    124   1e-28   
emb|CDY05782.1|  BnaC07g00210D                                          123   1e-28   
ref|XP_002886297.1|  hypothetical protein ARALYDRAFT_480901             123   1e-28   
ref|XP_009394166.1|  PREDICTED: uncharacterized protein LOC103979709    122   1e-28   
ref|XP_010534499.1|  PREDICTED: uncharacterized protein LOC104810030    123   1e-28   
ref|XP_010447381.1|  PREDICTED: uncharacterized protein LOC104730025    122   1e-28   
ref|XP_009589727.1|  PREDICTED: uncharacterized protein LOC104087042    123   1e-28   
ref|XP_002300937.1|  hypothetical protein POPTR_0002s07230g             121   1e-28   
ref|XP_007148154.1|  hypothetical protein PHAVU_006G184800g             122   1e-28   
ref|XP_009340283.1|  PREDICTED: uncharacterized protein LOC103932388    122   1e-28   
ref|NP_001176518.1|  Os11g0437600                                       122   2e-28   



>ref|XP_004240436.1| PREDICTED: uncharacterized protein LOC101250804 [Solanum lycopersicum]
Length=299

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/297 (54%), Positives = 193/297 (65%), Gaps = 20/297 (7%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPC  827
             MKRVTDPL+D+VKA+IV    +        S  S            +G   G   DL   
Sbjct  7     MKRVTDPLNDKVKARIVGADLRELGYISSGSEHSADADTDVASPSFSGLVFGFPDDLDQN  66

Query  826   ------NSDGELEDEVETINCGE-------DSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
                   NSD EL DE    N  E       D FRNVL S V +A+E+  SCL  +KS  +
Sbjct  67    QSSENDNSDTEL-DESSVDNVPEMIFQSDTDLFRNVLCSHVFKALEVY-SCLKLNKS--V  122

Query  685   LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             LRR+VM  LRDFGYNA VCKAKWE S G+TAG++EFIDV+RSD+ N   RY VDL+F++E
Sbjct  123   LRRNVMLCLRDFGYNAAVCKAKWESSGGLTAGNYEFIDVVRSDAVNCQTRYFVDLDFAAE  182

Query  505   FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
             FEIARPTN ++ L +SLPKVFVGKSEELK+I++ MS AA+RS KSR LHLPPWRK RFM+
Sbjct  183   FEIARPTNSYERLSQSLPKVFVGKSEELKQILRTMSDAARRSLKSRDLHLPPWRKHRFMQ  242

Query  325   NKWFGSYRRSTNFRPASME---LLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             NKW G Y+R++N  P++     LL P +QA  VKCRSVGFD AV+  L  P  TRTR
Sbjct  243   NKWLGPYKRTSNITPSTNTPAFLLPPSNQAYTVKCRSVGFDTAVHGGLWLPAATRTR  299



>ref|XP_009590525.1| PREDICTED: uncharacterized protein LOC104087688 [Nicotiana tomentosiformis]
Length=306

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 210/301 (70%), Gaps = 24/301 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIV-----------SHRAQVAeddddlssssfseilfdFPEHEAGDY  857
             KRVTDPLD++VKAQI+           S     A  D D++S SFS+++F +PE+   + 
Sbjct  9     KRVTDPLDEKVKAQIIGRDKYELGYFSSGSEHSAHADYDVTSPSFSDLVFGYPENNGQNE  68

Query  856   S-----GSDSDLPPCNSDGELEDEVETINCGE-DSFRNVLASRVSEAVELLSSCLNSSKS  695
             S      S++D+    S   +ED  + I   + DS+RNVLAS V++A E+ S C  S+KS
Sbjct  69    SPENDSDSETDVSMYESTDTIEDTPKPIFQSDLDSYRNVLASCVAKAWEVFS-CAKSNKS  127

Query  694   PEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRI-QRYIVDLE  518
               IL+R+VMAYLR+FGYNA VCK KWE S G+ AG++EFID+LR DS NRI  RY VDL+
Sbjct  128   --ILQRNVMAYLRNFGYNAAVCKMKWESSGGLAAGNYEFIDILRLDSANRIVTRYFVDLD  185

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F++EFEIARPTN ++ L +SLPKVFVGKSEELK+I++VMS AA+RS KSRGLH+PPWRK 
Sbjct  186   FAAEFEIARPTNQYEKLQQSLPKVFVGKSEELKQILRVMSDAARRSLKSRGLHIPPWRKH  245

Query  337   RFMENKWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFD-DAVNRRLLFPVVTRT  167
             RFM+NKW GSY+R+TN  P+  S   L+P      VKCR+VGF   AVN  LLFP  T T
Sbjct  246   RFMQNKWLGSYKRTTNIMPSANSTAWLSPSKDTNGVKCRTVGFHAAAVNGGLLFPATTCT  305

Query  166   R  164
             R
Sbjct  306   R  306



>ref|XP_009767700.1| PREDICTED: uncharacterized protein LOC104218813 [Nicotiana sylvestris]
Length=306

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 159/301 (53%), Positives = 212/301 (70%), Gaps = 24/301 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIV-----------SHRAQVAeddddlssssfseilfdFPEHEAGDY  857
             KRVTDPLD++VKAQI+           S     A  D D++S SFS+++F +PE+   + 
Sbjct  9     KRVTDPLDEKVKAQIIGCDKHELGYFSSGSEHSAHADYDVASPSFSDLVFGYPENNGQNE  68

Query  856   S-----GSDSDLPPCNSDGELEDEVETINCGE-DSFRNVLASRVSEAVELLSSCLNSSKS  695
             S      S++D+    S   +ED  ++I   + D +RNVLAS +++A+E+ S C  S+KS
Sbjct  69    SPENDSDSETDVSRYESTDTIEDTPKSIFQSDLDLYRNVLASCIAKALEVFS-CAKSNKS  127

Query  694   PEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRI-QRYIVDLE  518
               IL+R+VMAYL +FGYNA VCKAKWE S G+ AG++EFID++R DS NRI  RY VDL+
Sbjct  128   --ILQRNVMAYLTNFGYNAAVCKAKWESSGGLAAGNYEFIDIIRLDSANRIVTRYFVDLD  185

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F++EFEIARPTN ++ L++SLPKVFVGK E+LK+I++VMS AA+RS KSRGLH+PPWRK 
Sbjct  186   FAAEFEIARPTNQYEKLLQSLPKVFVGKIEDLKQILRVMSDAARRSLKSRGLHIPPWRKH  245

Query  337   RFMENKWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFD-DAVNRRLLFPVVTRT  167
             RFM+NKW GSY+R+TN  P+  S   L+P      +KCR+VGF   AVN  LLFP  TRT
Sbjct  246   RFMQNKWLGSYKRTTNIMPSANSPAWLSPSKDTSGIKCRTVGFHAAAVNGGLLFPATTRT  305

Query  166   R  164
             R
Sbjct  306   R  306



>ref|XP_009778866.1| PREDICTED: uncharacterized protein LOC104228160 [Nicotiana sylvestris]
Length=305

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 198/309 (64%), Gaps = 38/309 (12%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDL---  836
             MKRVTDPLDD+VKA+IV        +  +L   S         ++++   S S SDL   
Sbjct  7     MKRVTDPLDDKVKARIVG-----GCNLRELGYLSSGSEHSADTDYDSASVSPSFSDLIFG  61

Query  835   ----------PPCNSDGELEDEVETINCGE-----------DSFRNVLASRVSEAVELLS  719
                       P  +SD + E   E++   E           DSFRN+L S V +A+E+ S
Sbjct  62    FPDDVVLNQWPENDSDSD-ESVRESVVFDENLPPVIFQSDTDSFRNMLCSHVYKALEMFS  120

Query  718   SCLNSSKSPEIL-RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRI  542
                  SKS  +L RR VM YLRD GYNA +CKAKWE S G+TAG +E+IDVLRSDS NR 
Sbjct  121   C----SKSNVLLFRRSVMMYLRDLGYNAAICKAKWESSGGLTAGSYEYIDVLRSDSVNRQ  176

Query  541   QRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGL  362
              RY VDL+F+ EFEIARPTN ++ L +SLPKVFVGKSEELK I++ MS AA+RS KSRGL
Sbjct  177   TRYFVDLDFAVEFEIARPTNFYERLSQSLPKVFVGKSEELKHILRTMSDAARRSLKSRGL  236

Query  361   HLPPWRKQRFMENKWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFDDA-VNRRL  191
             HLPPWRK RFM+NK+ G Y+R+ N  P+  +  LL PL QA AVKCRSVGFD A VN  L
Sbjct  237   HLPPWRKHRFMQNKYLGPYKRTANLIPSANTPALLPPLKQAYAVKCRSVGFDSASVNGGL  296

Query  190   LFPVVTRTR  164
              FP VT+TR
Sbjct  297   WFPAVTQTR  305



>ref|XP_006344092.1| PREDICTED: uncharacterized protein LOC102584365 [Solanum tuberosum]
Length=299

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 155/297 (52%), Positives = 192/297 (65%), Gaps = 20/297 (7%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPC  827
             +KRVTDPL+D+VKA+IV    +        S  S            +G   G   DL   
Sbjct  7     LKRVTDPLNDKVKARIVGADLRELGYVSSGSEHSADADSDVVSPSFSGLVFGFSDDLDQN  66

Query  826   ------NSDGELEDEVETINCGE-------DSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
                   NSD EL DE    N  E       D FRNVL S V +A+E+  SC+ SSKS  +
Sbjct  67    QSSENDNSDTEL-DESSVDNVPEMIFQSDTDLFRNVLCSHVFKALEVY-SCMKSSKS--V  122

Query  685   LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             LRR+VM  LRDFGYNA VCKAKWE S G+TAG++EFIDV+R D+ N   RY +DL+F++E
Sbjct  123   LRRNVMMCLRDFGYNAAVCKAKWESSGGLTAGNYEFIDVVRLDAVNSQTRYFIDLDFAAE  182

Query  505   FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
             FEIARPTN ++ L + LPKVFVGKSEELK+I++ MS AA+RS KSR LHLPPWRK RFM+
Sbjct  183   FEIARPTNFYERLSQLLPKVFVGKSEELKQILRTMSDAARRSLKSRELHLPPWRKHRFMQ  242

Query  325   NKWFGSYRRSTNFRPASME---LLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             NKW G Y+R++N  P++      L P +QA  VKCRSVGF+ AV+  L  P VTRTR
Sbjct  243   NKWLGPYKRTSNITPSTNTPALFLPPSNQAYTVKCRSVGFETAVHGGLWLPAVTRTR  299



>ref|XP_009608592.1| PREDICTED: uncharacterized protein LOC104102561 [Nicotiana tomentosiformis]
Length=305

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 192/307 (63%), Gaps = 34/307 (11%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLP--  833
             MKRVTDPLDD+VKA+IV        D  +L   S         + ++   S S SDL   
Sbjct  7     MKRVTDPLDDKVKARIVG-----GCDLRELGYLSSGSEHSADADFDSASVSPSFSDLVFG  61

Query  832   ----------PCNSDGELEDEVETINCGE-----------DSFRNVLASRVSEAVELLSS  716
                       P N     E   E+++  E           D FRN+L S V +AVE+ S 
Sbjct  62    FPDDVALNQRPENDSESDESVRESVDFDENMPPVIFQSDTDLFRNMLCSHVYKAVEVFSC  121

Query  715   CLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQR  536
                S  +  + RR+VM YLRD GYNA +CKAKWE S G+ AG +E+IDVLRSDS NR  R
Sbjct  122   ---SKSNILLFRRNVMMYLRDLGYNAAICKAKWESSGGLAAGSYEYIDVLRSDSSNRQTR  178

Query  535   YIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHL  356
             Y VDL+F++EFEIARPT  ++ L +SLPKVFVGKSEELK I++ MS AA+RS K RGLHL
Sbjct  179   YFVDLDFAAEFEIARPTLFYERLSQSLPKVFVGKSEELKHILRTMSDAARRSLKIRGLHL  238

Query  355   PPWRKQRFMENKWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFDD-AVNRRLLF  185
             PPWRK RFM+NKWFG Y+R+ N  P+  +  LL PL QA AVKCRSVGFD  AVN  L F
Sbjct  239   PPWRKHRFMQNKWFGPYKRTANLIPSANTPSLLPPLKQAYAVKCRSVGFDSAAVNGGLWF  298

Query  184   PVVTRTR  164
             P VTRTR
Sbjct  299   PAVTRTR  305



>ref|XP_009619286.1| PREDICTED: uncharacterized protein LOC104111312 [Nicotiana tomentosiformis]
Length=305

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 155/302 (51%), Positives = 206/302 (68%), Gaps = 24/302 (8%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIV----------SHRAQVAeddddlssssfseilfdFPEHEAGDY  857
             MKRVTDPLDD+VKA+I+          S  ++ +   DD +S SFS ++F  P+  A + 
Sbjct  7     MKRVTDPLDDKVKARIIGRDQQELGYLSSGSEHSAHADDDASCSFSTLIFGLPDDVAAEN  66

Query  856   SGSDSDLPPCNSDGELEDEVETIN--------CGEDSFRNVLASRVSEAVELLSSCLNSS  701
               S++D    + D  + +  + I            D FRN LA+++++A+E+ S   + S
Sbjct  67    MSSENDSDSDDGDVSMYESTDVIEDLPKPVFYSDLDLFRNSLATKITKALEMFS--FSKS  124

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
               P ILRR+VM YLRDFGYNA +CK KWE S G+ AG++EF+DV+RSDS NRI RY +DL
Sbjct  125   NKP-ILRRNVMTYLRDFGYNAAICKTKWESSGGLKAGNYEFLDVIRSDSGNRITRYFIDL  183

Query  520   EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
             +F++EFEIARPTNH++ L +SLP+VFVGKSEELKK++KVMS A +RS KS+ L +PPWRK
Sbjct  184   DFAAEFEIARPTNHYERLSQSLPRVFVGKSEELKKMLKVMSDAGRRSLKSKDLSIPPWRK  243

Query  340   QRFMENKWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFDD-AVNRRLLFPVVTR  170
              RFM+NKW G+Y+R+TN  P+  S  LL+P  Q    KCRSVGF   AVN RLLFP  TR
Sbjct  244   HRFMQNKWLGAYKRTTNVLPSANSSALLSPSKQTNVAKCRSVGFSAVAVNGRLLFPAATR  303

Query  169   TR  164
             TR
Sbjct  304   TR  305



>ref|XP_006352824.1| PREDICTED: uncharacterized protein LOC102585280 [Solanum tuberosum]
Length=297

 Score =   269 bits (687),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 153/296 (52%), Positives = 200/296 (68%), Gaps = 20/296 (7%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVS-----HRAQVAeddddlssssfseilfdFPEHEAGDY-----  857
             MKRVTDPLD+++KA+IV      H A   +DD    S S         E+ AGD      
Sbjct  7     MKRVTDPLDEKMKARIVGSSGSEHSAHADDDDVASPSFSDLVFGDL--ENNAGDEIPEND  64

Query  856   SGSDSDLPPCNSDGELEDEVETINCGE-DSFRNVLASRVSEAVELLSSCLNSSKSPEILR  680
             S S+ D+  C+S   +E     + C E D +RNV+ S V++ +E+ S C  S+KS  +L+
Sbjct  65    SDSELDVSMCDSIDRIEIMPSPVFCSELDLYRNVIVSCVAKGLEVFS-CFKSNKS--MLQ  121

Query  679   RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEF  503
             R+VMAYLR+FGYNA VCK KWE S G++AG++EFID+ +SDS NRI  RY +DL+F +EF
Sbjct  122   RNVMAYLRNFGYNAAVCKTKWESSGGLSAGNYEFIDITKSDSANRITTRYFIDLDFKAEF  181

Query  502   EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
             EI RPT  ++ L++SLP +FVGKSEELK+I++ MS AA+RS KSRGL  PPWRK RFM+N
Sbjct  182   EIVRPTIQYERLLQSLPNIFVGKSEELKQILRAMSDAARRSLKSRGLTFPPWRKHRFMQN  241

Query  322   KWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFD-DAVNRRLLFPVVTRTR  164
             KWF SY+R+TN  P   S   L+P  +  AVKCR+VGF+  AVN  LLFP  TRTR
Sbjct  242   KWFSSYKRTTNIIPTANSPAWLSPSKETNAVKCRTVGFNTTAVNNCLLFPATTRTR  297



>ref|XP_011089036.1| PREDICTED: uncharacterized protein LOC105170116 [Sesamum indicum]
Length=301

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 151/302 (50%), Positives = 193/302 (64%), Gaps = 28/302 (9%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSH-RAQVAeddddlssssfseilfdFPEHEAGDYS-----GSD  845
             MKRVTDPLDDRVKA+IV   R            S+ ++     P      +      G+D
Sbjct  7     MKRVTDPLDDRVKARIVGRDRTDPGYVSSGSEHSAHADDDLASPSLSELFFGFAVDDGAD  66

Query  844   SDLPPCNSDGELE-------------DEVETINCGE-DSFRNVLASRVSEAVELLSSCLN  707
             S  P  N+D + E             D ++ I     D FRNVL ++V +A ++ S CL 
Sbjct  67    S-YPESNNDSDSEAGRFMCDSSFRNVDFIKPILLDRTDEFRNVLLAQVLKAEQVFS-CLK  124

Query  706   SSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIV  527
             S K  +I+RR+VMA+LR +GYNA +CK KWE S G+TAG++EFIDVLR DS  R   Y+V
Sbjct  125   SDK--QIMRRNVMAFLRGYGYNAAICKTKWESSGGLTAGNYEFIDVLRKDSSTR---YLV  179

Query  526   DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
             DL+F+SEFEIARPTN +  L+  LP+VFVGKSE+LK+I+K +S AAK S KSRGLHLPPW
Sbjct  180   DLDFASEFEIARPTNSYGRLLECLPRVFVGKSEDLKQILKAVSDAAKGSLKSRGLHLPPW  239

Query  346   RKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVN-RRLLFPVVTR  170
             RK RFM+NKW GSYRR+ N  PAS    +P +++  V+CR+VGFD AVN  RLL     R
Sbjct  240   RKHRFMQNKWLGSYRRTGNLFPASFSSPSPENRSYTVECRAVGFDTAVNGGRLLLQATAR  299

Query  169   TR  164
             TR
Sbjct  300   TR  301



>ref|XP_004242542.1| PREDICTED: uncharacterized protein LOC101264023 isoform X1 [Solanum 
lycopersicum]
Length=293

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 151/297 (51%), Positives = 195/297 (66%), Gaps = 22/297 (7%)
 Frame = -1

Query  1012  RTMKRVTDPLDDRVKAQIVS-----HRAQVAeddddlssssfseilfdFPEHEAGDY---  857
             R MKRVTDPLD+++KA+IV      H A   +DD    S S         E+ AGD    
Sbjct  5     RRMKRVTDPLDEKMKARIVGSSGSEHSAHADDDDIASPSFSDLVFGDL--ENTAGDETPE  62

Query  856   --SGSDSDLPPCNSDGELEDEVETINCGE-DSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
               S S+ D+  C+S   +E     +   E D FRNV+ S  ++ +E+ S C  S+KS  +
Sbjct  63    NDSDSELDVSMCDSIDRIEIMPSPVFRSEFDLFRNVIVSCATKGLEVFS-CFKSNKS--M  119

Query  685   LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             L+R+VMAYLR+FGYNA VCK KWE+S G+ AG++EFID+ +SDS  R   Y VDL+F +E
Sbjct  120   LQRNVMAYLRNFGYNAAVCKTKWEKSGGLAAGNYEFIDITKSDSTTR---YFVDLDFKAE  176

Query  505   FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
             FEIARPT  ++ L++SLP +FVGKSEELK+I++ MS AA+RS KSRGL  PPWRK RFM+
Sbjct  177   FEIARPTIQYERLLQSLPNIFVGKSEELKQILRAMSDAARRSLKSRGLTFPPWRKHRFMQ  236

Query  325   NKWFGSYRRSTNFRP--ASMELLAPLDQALAVKCRSVGF-DDAVNRRLLFPVVTRTR  164
             NKWF SYRR+TN  P  +S    +P  +  A KCR+VGF   AVN  LLFP  TRTR
Sbjct  237   NKWFSSYRRTTNIIPTASSPAWFSPSKETNAAKCRTVGFHTTAVNGCLLFPATTRTR  293



>ref|XP_010323098.1| PREDICTED: uncharacterized protein LOC101264023 isoform X2 [Solanum 
lycopersicum]
Length=287

 Score =   256 bits (653),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/295 (51%), Positives = 194/295 (66%), Gaps = 22/295 (7%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVS-----HRAQVAeddddlssssfseilfdFPEHEAGDY-----  857
             MKRVTDPLD+++KA+IV      H A   +DD    S S         E+ AGD      
Sbjct  1     MKRVTDPLDEKMKARIVGSSGSEHSAHADDDDIASPSFSDLVFGDL--ENTAGDETPEND  58

Query  856   SGSDSDLPPCNSDGELEDEVETINCGE-DSFRNVLASRVSEAVELLSSCLNSSKSPEILR  680
             S S+ D+  C+S   +E     +   E D FRNV+ S  ++ +E+ S C  S+KS  +L+
Sbjct  59    SDSELDVSMCDSIDRIEIMPSPVFRSEFDLFRNVIVSCATKGLEVFS-CFKSNKS--MLQ  115

Query  679   RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFE  500
             R+VMAYLR+FGYNA VCK KWE+S G+ AG++EFID+ +SDS  R   Y VDL+F +EFE
Sbjct  116   RNVMAYLRNFGYNAAVCKTKWEKSGGLAAGNYEFIDITKSDSTTR---YFVDLDFKAEFE  172

Query  499   IARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENK  320
             IARPT  ++ L++SLP +FVGKSEELK+I++ MS AA+RS KSRGL  PPWRK RFM+NK
Sbjct  173   IARPTIQYERLLQSLPNIFVGKSEELKQILRAMSDAARRSLKSRGLTFPPWRKHRFMQNK  232

Query  319   WFGSYRRSTNFRP--ASMELLAPLDQALAVKCRSVGF-DDAVNRRLLFPVVTRTR  164
             WF SYRR+TN  P  +S    +P  +  A KCR+VGF   AVN  LLFP  TRTR
Sbjct  233   WFSSYRRTTNIIPTASSPAWFSPSKETNAAKCRTVGFHTTAVNGCLLFPATTRTR  287



>ref|XP_009803540.1| PREDICTED: uncharacterized protein LOC104248884 [Nicotiana sylvestris]
Length=305

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/302 (50%), Positives = 203/302 (67%), Gaps = 24/302 (8%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIV----------SHRAQVAeddddlssssfseilfdFPEHEAGDY  857
             +KRVTDPLDD+VKA+I+          S  ++ +   DD +S SFS ++F  P+  A + 
Sbjct  7     VKRVTDPLDDKVKARIIGRDQQELGYLSSGSEHSAHADDDASCSFSSLIFGLPDDVAAEN  66

Query  856   SGSDSDLPPCNSDGELEDEVETIN--------CGEDSFRNVLASRVSEAVELLSSCLNSS  701
               S++D    + D  + D  + I+           D FR  LA++V++A+E+ S  L S+
Sbjct  67    VSSENDSDSDDGDVSMYDSTDMIDDLPKPVFYSDLDLFRISLATKVTKALEMFS-FLKSN  125

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
             K   ILRR+VM YLRDFGYNA +CK KWE S G+ AG++EF+DV+RS+S NRI RY +DL
Sbjct  126   K--PILRRNVMTYLRDFGYNAAICKTKWESSGGLKAGNYEFLDVIRSESGNRITRYFIDL  183

Query  520   EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
             +F++EFEIARPTN+++ L  SLPK+FVGKSEELK+++KVMS A +RS KS+ L +PPWRK
Sbjct  184   DFAAEFEIARPTNYYERLSHSLPKIFVGKSEELKQMLKVMSDAGRRSLKSKDLSIPPWRK  243

Query  340   QRFMENKWFGSYRRSTNFRPA--SMELLAPLDQALAVKCRSVGFDDA-VNRRLLFPVVTR  170
              RFM+NKW G+Y+R+TN  PA  S  LL+P  Q   VKCRSVGF     N  LLFP  + 
Sbjct  244   HRFMQNKWLGAYKRTTNVLPAANSSALLSPSKQTNVVKCRSVGFSAVDANGHLLFPAASG  303

Query  169   TR  164
             TR
Sbjct  304   TR  305



>ref|XP_011089640.1| PREDICTED: uncharacterized protein LOC105170537 [Sesamum indicum]
Length=302

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 193/301 (64%), Gaps = 26/301 (9%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSH-RAQVAeddddlssssfseilfdFPE----------HEAGD  860
             MKRVTDPLDD+ KA+IV   R  +         S+ ++     P           H+AGD
Sbjct  8     MKRVTDPLDDKAKARIVGRDRIGLGYLSSGSEYSAQADDDVASPSLSELFFGFNVHDAGD  67

Query  859   YS----GSDSD----LPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNS  704
              S    GSD +    +   N    ++     +    D+F+ VLA+ V +AV++ S  L S
Sbjct  68    ESPESGGSDCERDRSMCEMNECASVDLIKPILEDQRDAFKRVLAAHVWKAVQVFSG-LRS  126

Query  703   SKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVD  524
             +K  +++RR+VMAYLR+ GY A +CK KW+ S G+TAG++EFIDVLR +   R   Y+VD
Sbjct  127   NK--QMMRRNVMAYLRNCGYYAAICKTKWDSSGGLTAGNYEFIDVLRKEYSTR---YLVD  181

Query  523   LEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWR  344
             L+F+SEF IARPTN ++ L++ +P+VFVG SE+LK+I+K++S +A+RS KSRGLHLPPWR
Sbjct  182   LDFASEFAIARPTNSYERLLQHVPRVFVGTSEDLKQILKLVSDSARRSLKSRGLHLPPWR  241

Query  343   KQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVN-RRLLFPVVTRT  167
             K RFM+NKW G YRR+TN  PAS    +   Q   VKCR+VGFD AVN  +LLFP   RT
Sbjct  242   KHRFMQNKWLGPYRRTTNLFPASFSSPSAAKQGYGVKCRAVGFDAAVNGGQLLFPATART  301

Query  166   R  164
             R
Sbjct  302   R  302



>ref|XP_007049639.1| Sulfate/thiosulfate import ATP-binding protein cysA, putative 
[Theobroma cacao]
 gb|EOX93796.1| Sulfate/thiosulfate import ATP-binding protein cysA, putative 
[Theobroma cacao]
Length=295

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/299 (49%), Positives = 190/299 (64%), Gaps = 25/299 (8%)
 Frame = -1

Query  1012  RTMKRVTDPLDDRVKAQIVS---------HRAQVAeddddlssssfseilfdFPEHEAGD  860
             R +KRVTDPLDDRVKA++V          H A  AEDD    S      L D  + +A +
Sbjct  6     RRIKRVTDPLDDRVKARLVGVSYVSSGSEHSAAAAEDDSPCLSELVHSFLED--DKDAAE  63

Query  859   YSGSDSDLPPCNSDGELEDEVETINCGE-----DSFRNVLASRVSEAVELLSSCLNSSKS  695
              +G +SD    +S+ +    +E I         DS+RN+L + V +A+E+LS     +  
Sbjct  64    QTGYNSDPDRVDSNLDTTVSIEIIIKSSAFDNADSYRNLLMAHVLKAMEMLSFFKTDT--  121

Query  694   PEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEF  515
               I RR +MAYLR+ G+NA +CK KW  S G+TAG++EFIDVL+S S     RY +DL+F
Sbjct  122   -SIFRRKIMAYLREIGHNAAICKTKWSSSGGLTAGNYEFIDVLQSVSSTWQNRYFIDLDF  180

Query  514   SSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQR  335
             +SEFEIARPT+ +  L++ LP+VFVGK+EELKKIVKVMS +AKRS KS+ L LPPWRK R
Sbjct  181   ASEFEIARPTSEYSRLLQYLPRVFVGKNEELKKIVKVMSDSAKRSLKSKELSLPPWRKNR  240

Query  334   FMENKWFGSYRRSTNFRPASMELLAP--LDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             +M+NKWFGSYRR+TN   A    L P  +     VKCR VGFDDAVN RL      RTR
Sbjct  241   YMQNKWFGSYRRTTNQISACASSLTPAKIHPVNVVKCRYVGFDDAVNGRLF----VRTR  295



>gb|EYU21094.1| hypothetical protein MIMGU_mgv1a010707mg [Erythranthe guttata]
Length=304

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 183/303 (60%), Gaps = 29/303 (10%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSH-RAQVAeddddlssssfseilfdFPEHEAGDY---SGSDSDL  836
             KRVTDPLDD+VKA+I    RA+ A      S  S +    D       D     G D + 
Sbjct  8     KRVTDPLDDKVKARIFGRDRAEPAGYVSSGSDHSSAHADDDVTSSSLSDIFFGFGIDGEA  67

Query  835   PP-----CNSDGELEDEVETINCGE------------DSFRNVLASRVSEAVELLSSCLN  707
              P       +D E +  +   N G             D FRN+L + V +AV+   SC+ 
Sbjct  68    APERDEYSAADSERDPSMYEFNLGNVDLIKPIVVDRTDVFRNMLEAHVLKAVQAF-SCVK  126

Query  706   SSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIV  527
             S +   +LRR+VMA+LR +GYNA +CK KWE   G+TAG++EF+DVL  DS     RY V
Sbjct  127   SDQ--RVLRRNVMAFLRGYGYNAAICKTKWESCGGLTAGNYEFVDVLEKDSS---ARYFV  181

Query  526   DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
             DL+F+SEFEIARPTN ++ L++ LP+VFVGK+E LK I++ +S AA+RS KSR LHLPPW
Sbjct  182   DLDFASEFEIARPTNSYERLVQCLPRVFVGKTESLKLILRAVSDAARRSLKSRDLHLPPW  241

Query  346   RKQRFMENKWFGSYRRSTNFRPASMELLAPL-DQALAVKCRSVGFDDAVN-RRLLFPVVT  173
             RK RFM+NKW G YRR+TN  PA+    + +  Q  AVKCR+VGFD AV+    + P   
Sbjct  242   RKHRFMQNKWLGPYRRTTNLFPATFSTPSQVKSQNNAVKCRAVGFDAAVDGGSFMLPAAA  301

Query  172   RTR  164
             RTR
Sbjct  302   RTR  304



>ref|XP_010247442.1| PREDICTED: uncharacterized protein LOC104590465 [Nelumbo nucifera]
Length=300

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 184/319 (58%), Gaps = 65/319 (20%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS--HRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPP  830
             KRVTDPL+D V+  +    HR               +  +    EHE     G DS   P
Sbjct  8     KRVTDPLNDEVRNCLCGRDHR--------------NTSYVSSGSEHE-----GDDS---P  45

Query  829   CNSD---GELEDEVET-----------------------------INCGEDSFRNVLASR  746
             C SD   G LED  E                              +  G DSFR +L S 
Sbjct  46    CLSDLVYGFLEDNAEVRQQEDRSDSDHDFSGSERTDVIEDLENAMMVDGGDSFRLLLVST  105

Query  745   VSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL  566
             VS+AVE+ S CL  +K+    RR VM YLRD GYNAG+CK KW+ S G+TAG +EFIDV+
Sbjct  106   VSKAVEMFS-CLRPNKAA--FRRQVMVYLRDSGYNAGICKTKWDSSGGVTAGSYEFIDVV  162

Query  565   RSD--SQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKA  392
             RS+  +  + QRY VD++F+ EFEIARPT H++ L+  LP+V+VG+SE++++IV++M  A
Sbjct  163   RSEGSASQQQQRYFVDVDFAGEFEIARPTAHYEKLLELLPRVYVGRSEQMRRIVRLMCDA  222

Query  391   AKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
             AKRS KS+GLHLPPWRK R+M+ KWFG Y+R+ N  PAS    A  ++  A +CRSVGFD
Sbjct  223   AKRSLKSKGLHLPPWRKNRYMQAKWFGPYKRTVNQVPASAAFPAGFEK-FAAQCRSVGFD  281

Query  211   ---DAVNRRLLFPVVTRTR  164
                D    R + P  TRTR
Sbjct  282   AVSDGTGGRFVRPATTRTR  300



>gb|EYU40643.1| hypothetical protein MIMGU_mgv1a018130mg [Erythranthe guttata]
Length=305

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 130/304 (43%), Positives = 188/304 (62%), Gaps = 28/304 (9%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSHRA----------------------QVAeddddlssssfsei  893
             MKRVTDPLD   +A+IV   +                       ++E    L++   S  
Sbjct  7     MKRVTDPLDAEARARIVGRGSDYFSSGGGGNCSPQSDDDDAFSSLSELFLGLNADDDSGG  66

Query  892   lfdFPEHEAGDYSGSDSDLPPCNSDGELEDEVETINCG-EDSFRNVLASRVSEAVELLSS  716
                  + E GD + S  +    ++ G  E  ++++     D+++  L + V +AV++ S 
Sbjct  67    GSSPDDCEGGDTTSSMHEFGGGSACGAAECLIKSVVLDLRDAYKKALMAHVWKAVQVFS-  125

Query  715   CLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQR  536
             C  SS+  EI+RR+VMAYLR+ GYNA +C  KWE S G++AG++EFIDVLR+  +N   R
Sbjct  126   CARSSR--EIVRRNVMAYLRNCGYNAAICSTKWEGSGGLSAGNYEFIDVLRA--ENNSAR  181

Query  535   YIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHL  356
             Y +DL+F++EFEIARPT  ++ L++ +P+VFVG  E+LK+I K +S AA+RS KSRGLHL
Sbjct  182   YFIDLDFAAEFEIARPTEPYERLMQHMPRVFVGTGEDLKQISKAVSDAARRSLKSRGLHL  241

Query  355   PPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLFPVV  176
             PPWRK RFM+NKW G +RR+T+  PA+     P++++  VKCR+VGFD AVN   L    
Sbjct  242   PPWRKNRFMQNKWLGPFRRTTHVFPATFASAQPVNRSYGVKCRAVGFDAAVNGGRLLLST  301

Query  175   TRTR  164
             TRTR
Sbjct  302   TRTR  305



>gb|KDP45271.1| hypothetical protein JCGZ_15136 [Jatropha curcas]
Length=285

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/293 (45%), Positives = 181/293 (62%), Gaps = 28/293 (10%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGS----DSDL  836
             KRVTDPLDD  KA+IV  R        + S      +          D+       DSD 
Sbjct  8     KRVTDPLDDEAKARIVGVRFSYVSSGSEHSVDDSPCLSELVHGFLEDDFETQPLSYDSDS  67

Query  835   PPCNSDGELEDEVETI-------NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRR  677
                +S  +  D  E         N  +DS+RN+L + V +A+E+ S CL + K+  +LRR
Sbjct  68    DNIDSVSDCTDMAEDTLRSATSNNISKDSYRNLLFAHVLKAMEVFS-CLQNQKA--VLRR  124

Query  676   HVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEI  497
              VM++LR+ G+NA +CK KWE S G++AG++EFIDV++S       RY +DL+F+S+FEI
Sbjct  125   KVMSFLRELGHNAAICKTKWESSGGLSAGNYEFIDVVQSQ-----HRYFLDLDFASQFEI  179

Query  496   ARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKW  317
             ARPT+H+   ++SLP+VFVGK+E+LK+I+K MS AAKRS K R L LPPWRK R+M+NKW
Sbjct  180   ARPTSHYSKQLQSLPRVFVGKNEDLKRIIKAMSDAAKRSLKCRELSLPPWRKNRYMQNKW  239

Query  316   FGSYRRSTNFRP--ASMELLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
              G YRR++N  P  +S +++ P+     V CR VGFDDAVN RL      RTR
Sbjct  240   LGPYRRTSNPIPVSSSTQVIQPVS---GVTCRFVGFDDAVNGRLF----VRTR  285



>ref|XP_006484811.1| PREDICTED: uncharacterized protein LOC102616317 [Citrus sinensis]
 gb|KDO60875.1| hypothetical protein CISIN_1g022485mg [Citrus sinensis]
Length=296

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 182/296 (61%), Gaps = 23/296 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPE--HEAGDYSGSDSDLPP  830
             KRVTDPL+++VKAQ++ H+        + S+++  +      E  H+  ++  S +  P 
Sbjct  8     KRVTDPLNEKVKAQLIGHQLSYVSSGSEYSAAAVDDDSPSLSELVHDFLEHELSQAQPPG  67

Query  829   CNSDGELEDEV------------ETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
              +SD E  D V             T N   D +RN+L + V +A+E+ S  L   KS  +
Sbjct  68    YDSDSERVDTVADSTELIEDILKSTANGNVDLYRNLLLTHVLKAMEVFSR-LRQQKS--V  124

Query  685   LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSS  509
              RR VM+ LR+ G+NA +CK KW  S G+TAG++E+IDV++SDS    Q RY VDL+F++
Sbjct  125   FRRQVMSLLRELGHNAAICKTKWSSSGGLTAGNYEYIDVVQSDSYTSTQNRYFVDLDFAA  184

Query  508   EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
             EFEIARPT+ +  L  +LP+V+VGK EELK+IVKV   AAK+S KS+ L LPPWRK R+M
Sbjct  185   EFEIARPTSAYTRLSATLPRVYVGKGEELKRIVKVTCDAAKKSLKSKDLTLPPWRKNRYM  244

Query  328   ENKWFGSYRRSTNFRPA-SMELLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             +NKWFG Y+R+ N  PA S+        +  VKCR +GFDD VN RL      RTR
Sbjct  245   QNKWFGPYKRTVNPIPAGSLSPAVGPSVSNGVKCRCIGFDDGVNGRLF----VRTR  296



>ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250319 [Vitis vinifera]
 emb|CBI40915.3| unnamed protein product [Vitis vinifera]
Length=282

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/283 (48%), Positives = 174/283 (61%), Gaps = 23/283 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPE---HEAGDYSGSDSDLP  833
             KRVTDPLDDRVKA+IV   +          +   S  L D       +  +   S+ +L 
Sbjct  8     KRVTDPLDDRVKARIVGRGSVPVSSGSSSDAGEESPCLSDLVYGFLEDCAEAQPSEMELG  67

Query  832   PCNSDGELE--DEVETI------NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRR  677
               N D +    D  E +          D +R +L S VS+AV  LS C  S+K+   +RR
Sbjct  68    SENDDDDTSPFDPTEVVASLLYPKANVDRYRTLLFSHVSKAVGSLS-CPRSNKA--AIRR  124

Query  676   HVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEI  497
             +V A LRD G+NA VC+ KW+ S G+TAG+HEFIDVLRS+     +RYIVDL+F+ EFEI
Sbjct  125   NVAAVLRDLGHNAAVCRTKWDGSGGLTAGNHEFIDVLRSE-----KRYIVDLDFAGEFEI  179

Query  496   ARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKW  317
             ARPT+ ++ LI++LP+VF+GKSE+LKKIVK+   AAKRS KSRGLHLPPWRK R+M+NKW
Sbjct  180   ARPTDQYKRLIQTLPRVFIGKSEDLKKIVKLTCDAAKRSLKSRGLHLPPWRKNRYMQNKW  239

Query  316   FGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
             FG  RR+    P     LAP      VKCRSVGFD   + R  
Sbjct  240   FGPCRRTATPSPP----LAPASTEFTVKCRSVGFDAVSDGRFF  278



>ref|XP_006437238.1| hypothetical protein CICLE_v10033970mg [Citrus clementina]
 gb|ESR50478.1| hypothetical protein CICLE_v10033970mg [Citrus clementina]
Length=296

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/296 (44%), Positives = 182/296 (61%), Gaps = 23/296 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPE--HEAGDYSGSDSDLPP  830
             KRVTDPL+++VKAQ++ H+        + S+++  +      E  H+  ++  S +  P 
Sbjct  8     KRVTDPLNEKVKAQLIGHQLSYVSSGSEYSAAAVDDDSPSLSELVHDFLEHELSQAQPPG  67

Query  829   CNSDGELEDEV------------ETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
              +SD E  D V             T N   D +RN+L + V +A+E+ S  L   KS  +
Sbjct  68    YDSDSERVDTVADSTELIEDILKSTANGNVDLYRNLLLTHVLKAMEVFSR-LRQQKS--V  124

Query  685   LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSS  509
              RR VM+ LR+ G+NA +CK KW  S G+TAG++E+IDV++SDS    Q RY VDL+F++
Sbjct  125   FRRQVMSLLRELGHNAAICKTKWSSSGGLTAGNYEYIDVVQSDSYPSTQNRYFVDLDFAA  184

Query  508   EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
             EFEIARPT+ +  L  +LP+V+VGK EELK+IVKV   AAK+S KS+ L LPPWRK R+M
Sbjct  185   EFEIARPTSAYTRLSATLPRVYVGKGEELKRIVKVTCDAAKKSLKSKDLTLPPWRKNRYM  244

Query  328   ENKWFGSYRRSTNFRPA-SMELLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             +NKWFG Y+R+ N  PA S+        +  VKCR +GFDD VN RL      RTR
Sbjct  245   QNKWFGPYKRTVNPIPAGSLSPAVGPSVSNGVKCRCIGFDDGVNGRLF----VRTR  296



>emb|CAN71484.1| hypothetical protein VITISV_025338 [Vitis vinifera]
Length=282

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 173/305 (57%), Gaps = 67/305 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDDRVKA+IV   +                        +AG+ S       PC 
Sbjct  8     KRVTDPLDDRVKARIVGRXSVPVSSGS---------------SSDAGEES-------PCL  45

Query  823   SD---GELEDEVET----INCGE--------------------------DSFRNVLASRV  743
             SD   G LED  E     +  G                           D +R +L S V
Sbjct  46    SDLVYGFLEDCAEAQPSEMELGSENDDDDXSPFDPTEVVASLLYPKANVDRYRTLLFSHV  105

Query  742   SEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLR  563
             S+AV  LS C  S+K+   +RR+V A LRD G+NA VC+ KW+ S G+TAG+HEFIDVLR
Sbjct  106   SKAVGSLS-CPRSNKA--AIRRNVAAVLRDLGHNAAVCRTKWDGSGGLTAGNHEFIDVLR  162

Query  562   SDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKR  383
             S+     +RYIVDL+F+ EFEIARPT+ ++ LI++LP+VF+GKSE+LKKIVK+   AAKR
Sbjct  163   SE-----KRYIVDLDFAGEFEIARPTDQYKRLIQTLPRVFIGKSEDLKKIVKLTCDAAKR  217

Query  382   SFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAV  203
             S KSRGLHLPPWRK R+M+NKWFG  RR     P     LAP      VKCRSVGFD   
Sbjct  218   SLKSRGLHLPPWRKNRYMQNKWFGPCRRXATPSPP----LAPASTEFTVKCRSVGFDAVS  273

Query  202   NRRLL  188
             + R  
Sbjct  274   DGRFF  278



>emb|CDP08557.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 141/188 (75%), Gaps = 4/188 (2%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            DS   +L + V++A+E+ S     S  P +LRR+VMA+LR  GYNA +CK KWE S G++
Sbjct  106  DSLEKMLCADVTKAMEVFSGV--KSNMP-VLRRNVMAFLRKLGYNAAICKTKWESSGGLS  162

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            +G++EFIDVLR    NR  RYIVDL+F+ EFEIARPT  +++ +RS+P+VF+G+SEELK+
Sbjct  163  SGNYEFIDVLRFHPPNRSTRYIVDLDFAKEFEIARPTARYEHAVRSIPRVFIGRSEELKQ  222

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
            ++KVMS AAKRS KSRGL LPPWRK R+M++KW G+Y+R+TN  P       PL Q L V
Sbjct  223  VLKVMSDAAKRSLKSRGLLLPPWRKHRYMQSKWLGAYKRTTNIAPV-FPQPPPLMQKLTV  281

Query  235  KCRSVGFD  212
            KCRSVGFD
Sbjct  282  KCRSVGFD  289



>ref|XP_011044961.1| PREDICTED: uncharacterized protein LOC105140000 [Populus euphratica]
Length=289

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 136/287 (47%), Positives = 182/287 (63%), Gaps = 24/287 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS-----------HRAQVAeddddlssssfseilfdFPEHEAGDY  857
             KRVTDPLDD+ KA++V            H A   +    LS      +  D  +      
Sbjct  8     KRVTDPLDDKAKARLVGRQLSYVSSGSEHSADDDDGLPCLSGLVHGFLESDDSDLTHDSV  67

Query  856   SGSDSDLPPCNSDGELEDEVETI--NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEIL  683
             +G +SD    +S  + +D VE I  +   DS+RN+L++ VS+A+E  S  +N      +L
Sbjct  68    NGYESDSDRVDSVADCKDFVEGILRSGSRDSYRNLLSAHVSKAMEAFSCFINQR---PVL  124

Query  682   RRHVMAYLRDFGYNAGVCKAKWERS--DGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
             RR VM++LR+ G+NA +CK KWE S   G+TAG +EFIDV++S+S     RY+VDL+F+S
Sbjct  125   RRKVMSFLRELGHNAAICKTKWESSGGGGLTAGGYEFIDVVQSESSTLQNRYVVDLDFAS  184

Query  508   EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
             +FEIARPT+ F  L+ SLP+VFVG+SE+LK IVK +S A+KRS KSR L LPPWRK R+M
Sbjct  185   QFEIARPTSQFLKLLHSLPRVFVGRSEDLKTIVKSISDASKRSLKSRELSLPPWRKNRYM  244

Query  328   ENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
             +NKWFG YRR+ N  PA+   +       AVKCR VGFDDAVN RL 
Sbjct  245   QNKWFGPYRRTVNPSPATPPSVD------AVKCRRVGFDDAVNGRLF  285



>ref|XP_002313669.2| hypothetical protein POPTR_0009s14690g [Populus trichocarpa]
 gb|EEE87624.2| hypothetical protein POPTR_0009s14690g [Populus trichocarpa]
Length=289

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 181/287 (63%), Gaps = 24/287 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFP------EHEAGDYS----  854
             KRVTDPLDD+ KA++V  +        + S+    ++           E++  D +    
Sbjct  8     KRVTDPLDDKAKARLVGRQLSYVSSGSEHSADDDDDLPCLSELVHGFLENDDSDLTDDSV  67

Query  853   -GSDSDLPPCNSDGELEDEVETI--NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEIL  683
              G +SD    +S  + +D VE I  +   DS+RN+L++ VS+A+E  S  +N      +L
Sbjct  68    NGYESDSDRVDSVADCKDFVEGILRSGSRDSYRNLLSAHVSKAMEAFSCLINQR---PVL  124

Query  682   RRHVMAYLRDFGYNAGVCKAKWERS--DGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
             RR VM++LR+ G+NA +CK KWE S   G+TAG +EFIDV++S S     RY+VDL+F+S
Sbjct  125   RRKVMSFLRELGHNAAICKTKWESSGGGGLTAGGYEFIDVVQSKSSTLQNRYVVDLDFAS  184

Query  508   EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
             +FEIARPT+ F  L  SLP+VFVG+SE+LK IVK +S A+KRS KSR L LPPWRK R+M
Sbjct  185   QFEIARPTSQFLKLQHSLPRVFVGRSEDLKTIVKSISDASKRSLKSRELSLPPWRKNRYM  244

Query  328   ENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
             +NKWFG YRR+ N  PA+   +        VKCR VGFDDAVN RL 
Sbjct  245   QNKWFGPYRRTVNPSPATPPSVD------VVKCRCVGFDDAVNGRLF  285



>ref|XP_002305559.1| hypothetical protein POPTR_0004s19550g [Populus trichocarpa]
 gb|EEE86070.1| hypothetical protein POPTR_0004s19550g [Populus trichocarpa]
Length=289

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 171/304 (56%), Gaps = 57/304 (19%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD+ KA+++  +                          +G    +D D  PC 
Sbjct  8     KRVTDPLDDKAKARLIGCQLSC---------------------FSSGSEHSADHDDSPCL  46

Query  823   SD---GELEDE------VETINCGEDSFR---------------------NVLASRVSEA  734
             SD   G LE+E        T   G DS R                     N+L + VS+A
Sbjct  47    SDLVHGFLEEEDSGFAHASTNGHGSDSERVDLVADCTDFVVDMIRSSSNDNLLFAHVSKA  106

Query  733   VELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG-ITAGDHEFIDVLRSD  557
             +E  S CL + + P +LRR VM +LR+ G+NA +CK KWE S G +TAG +EFIDV+   
Sbjct  107   MEEFS-CLRNHQRP-VLRRKVMLFLRELGHNAAICKTKWESSGGGLTAGSYEFIDVVVQS  164

Query  556   SQNRIQ-RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRS  380
               + +Q RY+VDL+F+S+FEIARPT+ +  L+  LP+VFVGKSE+LK IV+ +S AAKRS
Sbjct  165   KSSALQNRYVVDLDFASQFEIARPTSQYLKLLHHLPRVFVGKSEDLKTIVRSISDAAKRS  224

Query  379   FKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVN  200
              KSR L LPPWRK R+M+NKWFG Y R+ N  P       P      VKCR VGF+DAVN
Sbjct  225   LKSRELSLPPWRKNRYMQNKWFGPYLRTVN--PLPTNSFTPPPSVNVVKCRRVGFEDAVN  282

Query  199   RRLL  188
              RL 
Sbjct  283   GRLF  286



>ref|XP_011046274.1| PREDICTED: uncharacterized protein LOC105140927 [Populus euphratica]
Length=288

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/303 (43%), Positives = 169/303 (56%), Gaps = 56/303 (18%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD+ KA+++  +                          +G    +D D  PC 
Sbjct  8     KRVTDPLDDKAKARLIGCQLSC---------------------FSSGSEHSADHDDSPCL  46

Query  823   SD---GELEDE------VETINCGEDSFR--------------------NVLASRVSEAV  731
             SD   G LE+E        T   G DS                      N+L + VS+A+
Sbjct  47    SDLVHGFLEEEDSGFAHASTNGHGSDSKSVDLVADCTDFVVDMIRSSNDNLLFAHVSKAM  106

Query  730   ELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG-ITAGDHEFIDVLRSDS  554
             E  S CL + + P +LR+ VM +LR+ G+NA +CK KWE S G +TAG +EFIDV+    
Sbjct  107   EEFS-CLRNHQRPVLLRK-VMLFLRELGHNAAICKTKWESSGGGLTAGSYEFIDVVVQSK  164

Query  553   QNRIQ-RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSF  377
              + +Q RY+VDL+F+S+FEIARPT+ +  L+  LP+VF GKSE+LK IV+ +S AAKRS 
Sbjct  165   SSALQNRYVVDLDFASQFEIARPTSQYLKLLHHLPRVFAGKSEDLKTIVRSISDAAKRSL  224

Query  376   KSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNR  197
             KSR L LPPWRK R+M+NKWFG Y R+ N  P       P      VKCR VGFDDAVN 
Sbjct  225   KSRELSLPPWRKNRYMQNKWFGPYLRTVN--PLPTNSFTPSPSVNVVKCRRVGFDDAVNG  282

Query  196   RLL  188
             RL 
Sbjct  283   RLF  285



>ref|XP_002533502.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28889.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 124/281 (44%), Positives = 174/281 (62%), Gaps = 25/281 (9%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS------------HRAQVAeddddlssssfseilfdFPEHEAGD  860
             KRVTDPLDD  KA+++             H A V           F E+  D  E ++ D
Sbjct  9     KRVTDPLDDDAKARLIGGQQLSYVSSGSEHSADVESPCLSELVHGFLEVDEDV-ETQSYD  67

Query  859   YSGSDSDLPPCNSDGELEDEVETIN-CGEDSFRNVLASRVSEAVELLSSCLNSSKSPEIL  683
             Y  SDS+     SD   ED   ++  C  DS+RN+L S V + +E+LS   N      +L
Sbjct  68    YD-SDSNRVDSVSD-RTEDVARSLCLCERDSYRNLLLSHVLKGIEMLSLWRNQRT---VL  122

Query  682   RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
             RR +M++LR+ G+NA +CK KW+ S G+ AG++EFID +   +     RYI+DL+F+S+F
Sbjct  123   RRKMMSFLRELGHNAAICKTKWDSSGGLNAGNYEFIDAVVLSN-----RYIIDLDFASQF  177

Query  502   EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
             EIARPTN ++  ++SLP+VFVGKSE LK+I+KVMS AAKRS K+R L LPPWRK R+M+N
Sbjct  178   EIARPTNEYRKQVQSLPRVFVGKSENLKRIIKVMSDAAKRSLKTRDLSLPPWRKNRYMQN  237

Query  322   KWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVN  200
             KW G Y R+ N + ++   +     ++ VKCR  GF++AVN
Sbjct  238   KWLGPYHRTCNHQLSANPTMIEASVSV-VKCRLFGFEEAVN  277



>ref|XP_004290157.1| PREDICTED: uncharacterized protein LOC101303288 [Fragaria vesca 
subsp. vesca]
Length=309

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/311 (40%), Positives = 172/311 (55%), Gaps = 67/311 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPC-  827
             KRVT PLDDRVKA++V   +  +                        D+S +D D+ PC 
Sbjct  10    KRVTYPLDDRVKARLVGRESYFS---------------------SGSDHSAADDDVSPCL  48

Query  826   -------------------------------------NSDGELEDEVETINCGEDSFRNV  758
                                                   S G +E  + +     DS+  V
Sbjct  49    SELVYSFLEEEESSSSESRSPHNDDDYDSDPVDSVSDRSSGAVECILRSSAATADSYAKV  108

Query  757   LASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEF  578
             L + V+EAVE  + CL S KS   L+R VM++LR  G+NA +CK KW  + GITAG +EF
Sbjct  109   LLADVAEAVEAFA-CLRSDKS--ALQRSVMSFLRGKGHNAAICKTKWSSAGGITAGHYEF  165

Query  577   IDVLRSDS---QNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVK  407
             IDV+ + S   Q++ +RY VD++F++EFEIARP++ +  L ++LP+ FVG S+ELKKIV+
Sbjct  166   IDVVANPSATWQHQSKRYFVDVDFAAEFEIARPSSQYTRLTQTLPRHFVGGSDELKKIVR  225

Query  406   VMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS-MELLAPL-DQALAVK  233
             VM  AAK+S +SR L +PPWRK R+M+NKWFG Y+R+ N  P + +   +PL  Q    K
Sbjct  226   VMCDAAKKSLRSRELSVPPWRKNRYMQNKWFGPYKRTVNPLPENPLTRTSPLFPQGSGAK  285

Query  232   CRSVGFDDAVN  200
             CR VGFDD V+
Sbjct  286   CRWVGFDDVVS  296



>ref|XP_002527250.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35094.1| conserved hypothetical protein [Ricinus communis]
Length=286

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 128/305 (42%), Positives = 172/305 (56%), Gaps = 52/305 (17%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPP--  830
             KRVTDPLDD  KA+++  +                       EH A D S   S+L    
Sbjct  9     KRVTDPLDDDAKARLIGGQLSYGTSGS---------------EHSADDDSPCLSELVHGF  53

Query  829   CNSDGELE----------DEVETI-NCGEDS------------FRNVLASRVSEAVELLS  719
                D +LE          D V+++ +C  D+            +RN+L S V + VE+ S
Sbjct  54    LEVDEDLETQSYTYDSDSDRVDSVSDCAVDAVKSLCVTTEMDLYRNLLLSHVLKGVEMFS  113

Query  718   SCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ  539
               L  ++ P +LRR VM++LR+ G+NA +CK KW+ S G+ AG++EFID +   +     
Sbjct  114   --LWRNQKP-VLRRKVMSFLRELGHNAAICKTKWDSSGGLNAGNYEFIDAVVLSN-----  165

Query  538   RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLH  359
             RYI+DL+F+S+FEIARPT  +   ++SLP VFVGK+E+LK+I+KVMS AAKRS KSR L 
Sbjct  166   RYIIDLDFASQFEIARPTKEYWKQVQSLPIVFVGKNEDLKRIIKVMSDAAKRSLKSRDLS  225

Query  358   LPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLFPV  179
             LPPWRK R+M+NKW G Y R++N    S            VKCR VGFDDAVN  L    
Sbjct  226   LPPWRKNRYMQNKWLGPYCRTSNHHQISSNPTMIGAAGNGVKCRLVGFDDAVNSGLF---  282

Query  178   VTRTR  164
               RTR
Sbjct  283   -VRTR  286



>ref|XP_006298220.1| hypothetical protein CARUB_v10014278mg [Capsella rubella]
 gb|EOA31118.1| hypothetical protein CARUB_v10014278mg [Capsella rubella]
Length=299

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/314 (38%), Positives = 167/314 (53%), Gaps = 67/314 (21%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL D V+A++V                          EH        + D  PC 
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGDGIEDYEDDDSPCL  48

Query  823   SD---GELEDEVETIN------CG--------------------------------EDSF  767
             SD   G LEDEVE ++      C                                 EDS+
Sbjct  49    SDLVQGFLEDEVEIVDDDESRWCDQDSGSDSDSDSEGVELPDYADDIAKILRNSLREDSY  108

Query  766   RNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGD  587
                +   V+ A+E+LSS  +  +   +L R VM+ LR+ G+NA +CK KW+ S G+TAG+
Sbjct  109   GRTVLVHVARAMEVLSSLGSQHEQRAVLMRKVMSLLRELGHNAAICKTKWKSSGGLTAGN  168

Query  586   HEFIDVLRSDS-QNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIV  410
             HEFIDV+ + S  ++  RYIVDL+F+S F+IARPT  +  +++SLP VFVG+ +ELK+I+
Sbjct  169   HEFIDVMFTPSASSQSARYIVDLDFASRFQIARPTAQYARMLQSLPAVFVGRGDELKRIL  228

Query  409   KVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKC  230
             +++  AA+ S +SRGL LPPWRK R+M+ +W G Y+R+ N  P+S            V C
Sbjct  229   RLVCDAARISLRSRGLTLPPWRKNRYMQTRWLGPYKRTANLTPSS-------SAVNTVVC  281

Query  229   RSVGFDDAVNRRLL  188
             R++GFDDAV  RL 
Sbjct  282   RAIGFDDAVGGRLF  295



>ref|XP_010100796.1| hypothetical protein L484_015825 [Morus notabilis]
 gb|EXB84494.1| hypothetical protein L484_015825 [Morus notabilis]
Length=301

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 169/285 (59%), Gaps = 23/285 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLD RV+ ++V   +         S  S ++      E   G     DS+     
Sbjct  8     KRVTDPLDARVRDRLVGRESSELGYASSGSEHSATDDWPCLSELVHGFLEEDDSETRSPE  67

Query  823   SDGELEDEVETINCGEDS----------------FRNVLASRVSEAVELLSSCLNSSKSP  692
             SD +L D V++++   DS                ++  L + V+EA ELLS  L S+K+ 
Sbjct  68    SDSDL-DRVDSVSERADSTESILRSSAASSNADAYKRRLLAHVTEATELLSH-LRSNKAK  125

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ--RYIVDLE  518
                RR VM+YLR+ G+N  +CK +W+ S G+T G++EFID +   +   +Q  RY VDL+
Sbjct  126   --FRRSVMSYLRESGHNGAICKTRWDSSGGLTTGNYEFIDAVVEPTGTSVQSRRYFVDLD  183

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F++EFEIARP+ H+  L+ SLP+VFVG  +ELK+IV+ M +AAKRS K   L +PPWRK 
Sbjct  184   FAAEFEIARPSVHYSKLLESLPRVFVGSGDELKRIVRAMCEAAKRSLKITDLSIPPWRKN  243

Query  337   RFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAV  203
             R+M+NKWFG YRR+TN  P +    A +    AVKCR VGF+DAV
Sbjct  244   RYMQNKWFGPYRRTTNLVPENSSPAA-ISPPSAVKCRWVGFNDAV  287



>ref|XP_002882522.1| hypothetical protein ARALYDRAFT_478057 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58781.1| hypothetical protein ARALYDRAFT_478057 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/313 (37%), Positives = 170/313 (54%), Gaps = 66/313 (21%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL D V+A++V                          EH        + D  PC 
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGDGIEDYEDDDSPCL  48

Query  823   SD---GELEDEVETI-------------------------------------NCGEDSFR  764
             SD   G LEDEVET+                                     +  EDS+ 
Sbjct  49    SDLVQGFLEDEVETVVDESRWCDQDSGSDSDSDSELVELPDFADDIAKLLRNSLREDSYG  108

Query  763   NVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDH  584
               +   V+ A+E+LSS  +  +   + +R VM++LR+ G+NA +CK KW  S G+TAG+H
Sbjct  109   RTVLVHVARAMEVLSSLESQHEQRAVFQRKVMSFLRELGHNAAICKTKWRSSGGLTAGNH  168

Query  583   EFIDVLRSDS-QNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVK  407
             EFIDV+ + S  ++  RYIVDL+F+S F+IARPT+ +  +++SLP VFVG+ ++LK+I++
Sbjct  169   EFIDVMYTPSASSQPVRYIVDLDFASRFQIARPTSQYARVLQSLPAVFVGRGDDLKRILR  228

Query  406   VMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCR  227
             ++  AA+ S ++RGL LPPWRK R+M+ +W G Y+R+TN  P+S  +         V CR
Sbjct  229   LVCDAARISLRNRGLTLPPWRKNRYMQTRWLGPYKRTTNLTPSSTAV-------NTVICR  281

Query  226   SVGFDDAVNRRLL  188
             ++GFD+AV  RL 
Sbjct  282   AIGFDNAVGGRLF  294



>ref|XP_008245959.1| PREDICTED: uncharacterized protein LOC103344110 [Prunus mume]
Length=307

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/291 (43%), Positives = 168/291 (58%), Gaps = 28/291 (10%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIV-SHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSD---L  836
             KRVT PLDD+V+A++V  + + ++  D    S                D+   DS    L
Sbjct  10    KRVTYPLDDKVRARLVGGYSSDLSIYDVSSGSEHSGAGDSPCLSELVHDFLQDDSSETWL  69

Query  835   PPCNSDGELEDEVE------------TINCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
             P   +D +  D V              ++  EDSF  +L S VSEAVE   SCL S    
Sbjct  70    PDNETDSDRVDSVSDAKAMDSVLRSAAVSGNEDSFAKLLRSHVSEAVEAF-SCLRSGNK-  127

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRI--QRYIVDLE  518
               LRR VM++LR  G+NA +CK  W  S  ITAG +EFIDV+ + S + +   RY VDL+
Sbjct  128   SALRRSVMSFLRARGHNAAICKTNWSSSGNITAGSYEFIDVVCAQSSSSMWQSRYFVDLD  187

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F+++ EIARPT+ +  L++ LPK FVG SE+LK+IV+VMS A KRS +SR L +PPWRK 
Sbjct  188   FAAQLEIARPTSQYSRLLQLLPKDFVGSSEDLKRIVRVMSDAVKRSLRSRELSVPPWRKN  247

Query  337   RFMENKWFGSYRRSTN-----FRPASMELLAPLDQALAVKCRSVGFDDAVN  200
             R+M+NKWFG Y+R+ N         S  + AP+  A   KCR VGFDDAV+
Sbjct  248   RYMQNKWFGPYKRTVNPLTEKSFSISPTVFAPVSGA---KCRWVGFDDAVS  295



>ref|XP_010451469.1| PREDICTED: uncharacterized protein LOC104733574 [Camelina sativa]
Length=300

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 120/315 (38%), Positives = 170/315 (54%), Gaps = 68/315 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEA-GDYSGSDSDLPPC  827
             KRVTDPL D V+A++V                          EH   G     + D  PC
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGDGIEDYEEEDDSPC  48

Query  826   NSD---GELEDEVETIN-----CG--------------------------------EDSF  767
              SD   G LEDEVET++     C                                 EDS+
Sbjct  49    LSDLVQGFLEDEVETVDDDSRWCDQDSGSDSDTDSEGAELPDYADDIAKILRNSLREDSY  108

Query  766   RNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGD  587
                +   V+ A+E LSS  +  +   +L R VM+ LR+ G+NA +CK KW+ S G+TAG+
Sbjct  109   GRTVLVHVARAMEALSSLRSEHEQRAVLLRKVMSLLRELGHNAAICKTKWKSSGGLTAGN  168

Query  586   HEFIDVLRS--DSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKI  413
             HEFIDV+ +   + ++  RYIVDL+F+S F+IARPT  +  +++SLP VFVG+ EELK+I
Sbjct  169   HEFIDVMFTTPSASSQTVRYIVDLDFASRFQIARPTAQYARVLQSLPTVFVGRGEELKRI  228

Query  412   VKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVK  233
             ++++  AA+ S +SRGL LPPWRK R+M+ +W G Y+R+ N  P+S    + +D    V 
Sbjct  229   LRLVCDAARISLRSRGLTLPPWRKNRYMQTRWLGPYKRTANLTPSS----SAVD---TVM  281

Query  232   CRSVGFDDAVNRRLL  188
             CR++GFD AV  RL 
Sbjct  282   CRAIGFDSAVGGRLF  296



>ref|XP_010685113.1| PREDICTED: uncharacterized protein LOC104899597 [Beta vulgaris 
subsp. vulgaris]
Length=335

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 142/207 (69%), Gaps = 8/207 (4%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG--  602
            D FRN L S V++A+E+ S   + ++S  I  R++MAYLR  GYNAG+CK KW+ S G  
Sbjct  134  DPFRNHLISHVTKAIEIFSFFRDKTRS--IFNRNLMAYLRQIGYNAGICKTKWDASAGGT  191

Query  601  ITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEEL  422
            +TAG++EFIDV+     N   RY++D EFS EFEIAR T++++ L  SLP+VFVGK E+L
Sbjct  192  LTAGNYEFIDVI---CPNSTARYVIDAEFSGEFEIARETSNYKKLRSSLPRVFVGKVEDL  248

Query  421  KKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQAL  242
             K++++M   A+RS K  GL LPPWR+ R+M+ KW G YRR+TN  PA+    + +    
Sbjct  249  NKMIRLMCDEARRSMKINGLTLPPWRRNRYMQIKWLGKYRRTTNCLPAAPVSSSAVGTNF  308

Query  241  AVKCRSVGFDDAVNR-RLLFPVVTRTR  164
            AVKCRSVGFD + +  R ++P V RTR
Sbjct  309  AVKCRSVGFDVSGDSGRFVYPPVARTR  335



>ref|XP_006407845.1| hypothetical protein EUTSA_v10021229mg [Eutrema salsugineum]
 gb|ESQ49298.1| hypothetical protein EUTSA_v10021229mg [Eutrema salsugineum]
Length=299

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 167/315 (53%), Gaps = 69/315 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL D V+A++V                          EH        D D  PC 
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGYGIEDDDDD-SPCL  47

Query  823   SD---GELEDEVETIN-----CG--------------------------------EDSFR  764
             SD   G LEDEVET+      C                                 EDS+ 
Sbjct  48    SDLVQGFLEDEVETVKDEPRWCDHDSGSDSDSDSERVELPDFADDIAKHLRNSLREDSYG  107

Query  763   NVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDH  584
               +   V+ A+E+LSS  +  +   +LRR +M+ LR+ G+NA +CK KW+ S G+TAG+H
Sbjct  108   RTVLLHVARAMEMLSSPGSDHEHRAVLRRKLMSLLRELGHNAAICKTKWKSSGGLTAGNH  167

Query  583   EFIDVLRSD---SQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKI  413
             EFIDV+ S    + ++  RYIVD +F+S F+IARPT  +  +++SLP +FVG+ E+LK+I
Sbjct  168   EFIDVVHSPAAATSSQTVRYIVDFDFASHFKIARPTAQYARVLQSLPAIFVGRGEDLKRI  227

Query  412   VKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVK  233
             ++++  AA+ S KSR L LPPWRK R+M+ +W G Y+RS N  P+S  +         V 
Sbjct  228   LRLVCDAARMSLKSRDLTLPPWRKNRYMQTRWLGPYKRSVNLTPSSPAV-------NTVM  280

Query  232   CRSVGFDDAVNRRLL  188
             CRS+GFD+AV  RL 
Sbjct  281   CRSIGFDNAVGGRLF  295



>ref|NP_566303.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF02145.1|AC009853_5 unknown protein [Arabidopsis thaliana]
 gb|AAK76612.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44916.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74531.1| uncharacterized protein AT3G07350 [Arabidopsis thaliana]
Length=298

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/313 (37%), Positives = 173/313 (55%), Gaps = 66/313 (21%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL + V+A++V                          EH        + D  PC 
Sbjct  7     KRVTDPLAEEVRARLVG------------------CSFSSGSEHTGDGIEDYEDDDSPCL  48

Query  823   SD---GELEDEVETIN-----CG--------------------------------EDSFR  764
             SD   G LEDEV+T++     C                                 EDS+ 
Sbjct  49    SDLVQGFLEDEVDTVDDESCWCDQDSGSDSDSDSELGELPDFADDIAKLLRNSLREDSYG  108

Query  763   NVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDH  584
               +   V+ A+E+LSS  +  +   + +R VM+ LR+ G+NA +CK KW+ S G+TAG+H
Sbjct  109   RTVLVHVARAMEMLSSLGSQPEQRAVFQRKVMSLLRELGHNAAICKTKWKSSGGLTAGNH  168

Query  583   EFIDVLRSDS-QNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVK  407
             EFIDV+ + S  ++  R+IVDL+FSS F+IARPT+ +  +++SLP VFVGK ++LK+I++
Sbjct  169   EFIDVVYTPSASSQSVRFIVDLDFSSRFQIARPTSQYARVLQSLPAVFVGKGDDLKRILR  228

Query  406   VMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCR  227
             ++  AA+ S ++RGL LPPWRK R+M+ +W G Y+R+TN  P++    + +D    V CR
Sbjct  229   LVCDAARISLRNRGLTLPPWRKNRYMQTRWLGPYKRTTNLTPST----SGVD---TVMCR  281

Query  226   SVGFDDAVNRRLL  188
             ++GFD+AV  RL 
Sbjct  282   AIGFDNAVGGRLF  294



>ref|XP_010464355.1| PREDICTED: uncharacterized protein LOC104744922 [Camelina sativa]
Length=303

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 167/318 (53%), Gaps = 71/318 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEA-GDYSGSDSDLPPC  827
             KRVTDPL D V+A++V                          EH   G     + D  PC
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGDGIEDYEEEDDSPC  48

Query  826   NSD---GELEDEVETIN------CG--------------------------------EDS  770
              SD   G LEDEVET++      C                                 EDS
Sbjct  49    LSDLVQGFLEDEVETVDDDESRWCDQDSGSDSDSDSEGAELPDYADDIAKILRNSLREDS  108

Query  769   FRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAG  590
             +   +   V+ A+E+LSS  +  +   +L R VM+ LR+ G+NA +CK KW  S G+TAG
Sbjct  109   YGRTVLVHVARAMEVLSSLGSQHEQRAVLLRKVMSILRELGHNAAICKTKWRSSGGLTAG  168

Query  589   DHEFIDVL----RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEEL  422
             +HEFIDV+     S + ++  RYIVDL+F+S F+IARPT  +  +++SLP VFVG+ +EL
Sbjct  169   NHEFIDVMFTTPPSSASSQTVRYIVDLDFASRFQIARPTAQYARVLQSLPAVFVGRGDEL  228

Query  421   KKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQAL  242
             K+I++++  AA+ S +SRGL LPPWRK R+M+ +W G Y+R+ N  P+S           
Sbjct  229   KRILRLVCDAARISLRSRGLTLPPWRKNRYMQTRWLGPYKRTANLTPSS-------SAVN  281

Query  241   AVKCRSVGFDDAVNRRLL  188
              V CR++GFD AV  RL 
Sbjct  282   TVMCRAIGFDSAVGGRLF  299



>gb|EPS70244.1| hypothetical protein M569_04516 [Genlisea aurea]
Length=297

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 142/215 (66%), Gaps = 14/215 (7%)
 Frame = -1

Query  814  ELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI---LRRHVMAYLRDFGY  644
            +LE  V  I+ G D FR VL SRV EA E + S        ++   +RR VMA LRD GY
Sbjct  84   DLESIVMRID-GRDGFREVLKSRVVEAAEKVRSLSIPRTEGDVRRSVRRSVMAILRDGGY  142

Query  643  NAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLI  464
            NA VCK +WE+S GITAG +EFIDV+   S    +RYIV+L+F +EF+IARPT  +Q ++
Sbjct  143  NAAVCKTRWEKSAGITAGSYEFIDVVDESSS---KRYIVELDFCAEFQIARPTAAYQRML  199

Query  463  RSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFR  284
            R LP +FVG  +E+++I+  MS++A+RS +SR L  PPWRK RFM+NKW  +YRR+TN  
Sbjct  200  RLLPPIFVGACDEMRQILAAMSESARRSLRSRDLQRPPWRKLRFMQNKWLAAYRRTTNAH  259

Query  283  -PASMELLAPLDQALAVKCRSVGFDDAVNRRLLFP  182
             P S+E      +   VKCR+VGFD AV    LFP
Sbjct  260  APPSVE------KNSTVKCRTVGFDAAVRGEGLFP  288



>ref|XP_010036764.1| PREDICTED: uncharacterized protein LOC104425692 [Eucalyptus grandis]
Length=306

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 139/204 (68%), Gaps = 11/204 (5%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            DS+R++L S VS+A+E+ S  L S+K    LRR+VM+YLR+ GYNA +CK KW+ S G+T
Sbjct  102  DSYRSLLLSHVSKAIEVFSG-LRSNK--PALRRNVMSYLREIGYNAAICKTKWDSSGGLT  158

Query  595  AGDHEFIDVLRSD--SQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEEL  422
            AG +EFIDV+R +  +     RY VD++F  +F IARP   +  L++ +P+VFVG+ E+L
Sbjct  159  AGSYEFIDVVRPEPSAGGSPSRYFVDVDFDGQFAIARPAPEYTRLLQRVPRVFVGRIEDL  218

Query  421  KKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASM------ELLA  260
            K+IV+ M   A+RS KSRGL LPPWRK R+M+NKW G +RR+TN  PAS        + A
Sbjct  219  KRIVRAMCDGARRSLKSRGLSLPPWRKTRYMQNKWVGPFRRTTNPSPASTFAHAAAGVAA  278

Query  259  PLDQALAVKCRSVGFDDAVNRRLL  188
                  AV CRSVGFD +++ RL 
Sbjct  279  TTSVGTAVMCRSVGFDQSMSGRLF  302



>gb|AAM63439.1| unknown [Arabidopsis thaliana]
Length=298

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 172/313 (55%), Gaps = 66/313 (21%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL + V+A++V                          EH        + D  PC 
Sbjct  7     KRVTDPLAEEVRARLVG------------------CSFSSGSEHTGDGIEDYEDDDSPCL  48

Query  823   SD---GELEDEVETIN-----CG--------------------------------EDSFR  764
             SD   G LEDEV+T++     C                                 EDS+ 
Sbjct  49    SDLVQGFLEDEVDTVDDESCWCDQDSGSDSDSDSELGELPDFADDIAKLLRNSLREDSYG  108

Query  763   NVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDH  584
               +   V+ A++ LSS  +  +   + +R VM+ LR+ G+NA +CK KW+ S G+TAG+H
Sbjct  109   RTVLVHVARAMZXLSSLGSQPEQRAVFQRKVMSLLRELGHNAAICKTKWKSSGGLTAGNH  168

Query  583   EFIDVLRSDS-QNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVK  407
             EFIDV+ + S  ++  R+IVDL+FSS F+IARPT+ +  +++SLP VFVGK ++LK+I++
Sbjct  169   EFIDVVYTPSASSQSVRFIVDLDFSSRFQIARPTSQYARVLQSLPAVFVGKGDDLKRILR  228

Query  406   VMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCR  227
             ++  AA+ S ++RGL LPPWRK R+M+ +W G Y+R+TN  P++    + +D    V CR
Sbjct  229   LVCDAARISLRNRGLTLPPWRKNRYMQTRWLGPYKRTTNLTPST----SGVD---TVMCR  281

Query  226   SVGFDDAVNRRLL  188
             ++GFD+AV  RL 
Sbjct  282   AIGFDNAVGGRLF  294



>ref|XP_010486283.1| PREDICTED: uncharacterized protein LOC104764448 [Camelina sativa]
Length=301

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/316 (37%), Positives = 164/316 (52%), Gaps = 69/316 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL D V+A++V                          EH        + D  PC 
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGDGIEDYEDDDSPCL  48

Query  823   SD-----------------------------------GELEDEVETI------NCGEDSF  767
             SD                                    EL D  + I      +  EDS+
Sbjct  49    SDLVQGFLEDEVETVDDDDSRWCDQDSGSDSDSDSDGAELPDYADDIAKILRNSLIEDSY  108

Query  766   RNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGD  587
                +   V+ A+E+LSS  +  +   +L R VM+ LR+ G+NA +CK KW+ S G+TAG+
Sbjct  109   GRTVLVHVARAMEVLSSLGSQHEQRAVLLRKVMSLLRELGHNAAICKTKWKSSGGLTAGN  168

Query  586   HEFIDVL---RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
             HEFIDV+    S + ++  RYIVDL+F+S F+IARPT  +  +++SLP VFVG+ EELK+
Sbjct  169   HEFIDVMFTTPSSASSQTVRYIVDLDFASRFQIARPTAQYARVLQSLPAVFVGRGEELKR  228

Query  415   IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
             I++++  AA+ S +SRGL LPPWRK R+M+ +W G Y+R+ N  P+S  L         V
Sbjct  229   ILRLVCDAARISLRSRGLTLPPWRKNRYMQTRWLGPYKRTANLTPSSSAL-------NTV  281

Query  235   KCRSVGFDDAVNRRLL  188
              CR++GFD AV  RLL
Sbjct  282   MCRAIGFDSAVGGRLL  297



>ref|XP_009147084.1| PREDICTED: uncharacterized protein LOC103870677 [Brassica rapa]
Length=300

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 170/297 (57%), Gaps = 32/297 (11%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAG---DYSGSDSDLP  833
             KRVTDPL D  KA++V        +        + +          G   D +  D D  
Sbjct  7     KRVTDPLADEAKARLVGCSFSSGSEHTGDGIDDYDDDSPCLSYLVQGFLEDEANQDGDKE  66

Query  832   P--CNSDG-----------ELEDEVETI------NCGEDSFRNVLASRVSEAVELLSSCL  710
             P  C SD            EL D  E I      +  ED++  ++   V+ A+E+L    
Sbjct  67    PRWCESDSESDSDSDSERVELPDFAEDIVKILRNSLSEDNYGRMVLFHVARAMEMLPPLG  126

Query  709   NSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSD---SQNRIQ  539
             +  +   +LRR VM++LR FG+NA +CK KW+ S G+TAG+HEFIDV+ +    + ++  
Sbjct  127   SDQEQRAVLRRKVMSFLRGFGHNAAICKTKWKSSGGLTAGNHEFIDVVYTPAAATSHQTV  186

Query  538   RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLH  359
             RYIVDL+F+S F+IARPT  +  +++SLP VFVG+ ++LK+I++++ +AA+ S +SRGL 
Sbjct  187   RYIVDLDFASRFQIARPTAQYSRVLQSLPAVFVGRGDDLKQILRLVCEAARLSLRSRGLT  246

Query  358   LPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
             LPPWRK R+M+ +W GSY+R+ N  P+S  +         V CR+VGFD+AV  RL 
Sbjct  247   LPPWRKNRYMQTRWLGSYKRTVNLTPSSAAV-------NTVMCRAVGFDNAVGDRLF  296



>emb|CDY28060.1| BnaC05g44620D [Brassica napus]
Length=300

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 168/316 (53%), Gaps = 70/316 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL D V+A++V                          EH        D D  PC 
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTGDGIDNYDDD-SPCL  47

Query  823   SD---GELEDEV-ETIN-------------------------------------CGEDSF  767
             SD   G LE+E  + +N                                      GED++
Sbjct  48    SDLVQGFLENEANQNVNEEPRWCDSDSESYSDSDSERVDLPDFAEDIAKILRNTLGEDNY  107

Query  766   RNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGD  587
               ++   V+ A+E+L S  +  +   +LRR +M+ LR FG+NA +CK KW+ S G+TAG+
Sbjct  108   GRMVLFHVARAMEMLPSLGSDQEQRAVLRRKLMSLLRGFGHNAAICKTKWKSSGGLTAGN  167

Query  586   HEFIDVLRSD---SQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
             HEFIDV+ +    +  +  RYIVDL+F+S F+IARPT  +  +++SLP VFVG+ ++LK+
Sbjct  168   HEFIDVVYTPAAATSPQTVRYIVDLDFASRFQIARPTAQYSRVLQSLPAVFVGRGDDLKR  227

Query  415   IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
             I++++  AA+ S +SRGL LPPWRK R+++ +W GSY+R+ N  P+S  +         V
Sbjct  228   ILRLVCDAARLSLRSRGLTLPPWRKNRYLQTRWLGSYKRTVNLTPSSPAV-------NTV  280

Query  235   KCRSVGFDDAVNRRLL  188
              CR+VGFD+AV  RL 
Sbjct  281   MCRAVGFDNAVGDRLF  296



>ref|XP_009334278.1| PREDICTED: uncharacterized protein LOC103927106 [Pyrus x bretschneideri]
Length=308

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 121/293 (41%), Positives = 168/293 (57%), Gaps = 31/293 (11%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDS-DLPPC  827
             KRVT PLDDRVK ++V   +    D    S             H+   ++ S +   P  
Sbjct  10    KRVTYPLDDRVKDRLVGGYSSGLRDASKGSEHPGDYDSLSELVHDFLHHNESSAVGFPDN  69

Query  826   NSD------GELEDEVET------INCGEDSFRNVLASRVSEAVELLSSCLNSS---KSP  692
              SD      G   D +++      ++   DS+  +L S VS+A E   +CL S+    S 
Sbjct  70    ESDSERVESGSNTDAIDSVLRSVAVSGNADSYLKLLRSHVSQAAEAF-TCLRSNGGGSSE  128

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV--LRSDSQNRIQRYIVDLE  518
               LRR VM++LR  G+NA +CK KW  S  ITAG +EFIDV  + S S     RY VDL+
Sbjct  129   STLRRSVMSFLRGLGHNAAICKTKWTSSGNITAGSYEFIDVVPVPSGSSTWQSRYFVDLD  188

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F++EFEIARP++ +  L++ LP+ FVG SE+LK+IV+V S AAKRS +S  L +PPWRK 
Sbjct  189   FAAEFEIARPSSQYSRLLQLLPRDFVGSSEDLKRIVRVTSDAAKRSLRSTDLSVPPWRKN  248

Query  337   RFMENKWFGSYRRSTNFRPASME-------LLAPLDQALAVKCRSVGFDDAVN  200
             R+M+NKWFG Y+R+ N  P + +       + AP+    A +CR VGFDDAV+
Sbjct  249   RYMQNKWFGPYKRTVN--PMTEKAYSRDSAIFAPVS---AAQCRWVGFDDAVS  296



>emb|CDY35924.1| BnaA05g30260D [Brassica napus]
Length=300

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/218 (44%), Positives = 142/218 (65%), Gaps = 16/218 (7%)
 Frame = -1

Query  814  ELEDEVETI------NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRD  653
            EL D  E I      +  ED++  ++   V+ A+E+L S  +  +   + RR VM+ LR 
Sbjct  86   ELPDFAEDIVKILRNSLSEDNYGRMVLFHVARAMEMLPSLGSDQEQRAVSRRKVMSILRG  145

Query  652  FGYNAGVCKAKWERSDGITAGDHEFIDVLRSD---SQNRIQRYIVDLEFSSEFEIARPTN  482
            FG+NA +CK KW+ S G+TAG+HEFIDV+ +    + ++  RYIVDL+F+S F+IARPT 
Sbjct  146  FGHNAAICKTKWKSSGGLTAGNHEFIDVVYTPAAATSSQTVRYIVDLDFASRFQIARPTP  205

Query  481  HFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYR  302
             +  +++SLP VFVG+ ++LK+I++++  AA+ S +SRGL LPPWRK R+M+ +W GSY+
Sbjct  206  QYSRVLQSLPAVFVGRVDDLKRILRLVCDAARLSLRSRGLTLPPWRKNRYMQTRWLGSYK  265

Query  301  RSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
            R+ N  P+S            V CR+VGFD+AV  RL 
Sbjct  266  RTVNLTPSS-------SAVNTVMCRAVGFDNAVGDRLF  296



>ref|XP_010069610.1| PREDICTED: uncharacterized protein LOC104456503 [Eucalyptus grandis]
Length=308

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 170/315 (54%), Gaps = 69/315 (22%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPC-  827
             KR+T PLD+  +A++++ R Q++                   EH+  D +   S+L  C 
Sbjct  8     KRITGPLDEWARARLLAGRRQLSYVSSGS-------------EHDGEDCTPRLSELVQCF  54

Query  826   --NSDG---------------------ELEDEVETINCG-EDSFRNVLASRVSEAVELLS  719
                 DG                      LED +  ++ G +D +R++L   V  AVE  S
Sbjct  55    LEEGDGGSEVHSPGRDPDSDPADSDSDSLEDALAPVSAGAKDPYRDLLLDHVLRAVEAFS  114

Query  718   SCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL---------  566
               L +S+S  +LRR VM+ LR+ G+NA VCK++WE S G+TAG++EFIDVL         
Sbjct  115   G-LRASQS--LLRRRVMSSLREIGHNAAVCKSRWESSGGLTAGNYEFIDVLGPAPASAPA  171

Query  565   ------------RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEEL  422
                         +   Q +  RY VDL+F+  FEIARPT+ +  L+RSLP+VFVG  +EL
Sbjct  172   SATATATAPAAWQQQQQQQQTRYFVDLDFAGGFEIARPTSRYARLLRSLPEVFVGTGDEL  231

Query  421   KKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQAL  242
             K+I +VM   AKRS KSR L +PPWRK R++ NKW G YRR+ N  PA      P   A 
Sbjct  232   KRIARVMCDEAKRSLKSRELSVPPWRKSRYVTNKWLGPYRRTVNPEPAG----GP--AAA  285

Query  241   AVKCRSVGFDD-AVN  200
              VKCR VGFD+ AVN
Sbjct  286   GVKCRRVGFDEYAVN  300



>ref|XP_009381313.1| PREDICTED: uncharacterized protein LOC103969497 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 131/193 (68%), Gaps = 6/193 (3%)
 Frame = -1

Query  778  EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGI  599
            +DSFR  LA+ VS+A E ++  L SS      RR VMA LR  GYNAG+CKA+W  S G+
Sbjct  108  KDSFRTRLATDVSKAAEGVA-WLRSSCGAAASRRAVMARLRTAGYNAGICKARWNASGGL  166

Query  598  TAGDHEFIDVLRS--DSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEE  425
             AG++E+IDV+ +  D   + +RYIVDL+F++EFE+ARPT  ++ ++  LP+  V   E 
Sbjct  167  AAGNYEYIDVVAAPGDGDGQGRRYIVDLDFAAEFEVARPTEAYKGVVACLPRAAVAGEEA  226

Query  424  LKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQA  245
            ++++V+ ++ AA+RS ++RGLH+PPWRK R+M  KW G YRR+TN  P S+   AP    
Sbjct  227  VRQVVRAVADAARRSLRARGLHVPPWRKSRYMLAKWLGPYRRTTNPVPTSLTATAPGGD-  285

Query  244  LAVKCRSVGFDDA  206
              VKCR+VGF  A
Sbjct  286  --VKCRAVGFPTA  296



>ref|XP_009372237.1| PREDICTED: uncharacterized protein LOC103961421 [Pyrus x bretschneideri]
Length=308

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/293 (42%), Positives = 168/293 (57%), Gaps = 31/293 (11%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFP-----EHEAGDYSG----  851
             KR+T PLDDRVK ++V   +    D    S  S               H+    +G    
Sbjct  10    KRITYPLDDRVKDRLVGGYSSGLPDTSKGSEHSGDYDSLSELVHDFLHHDESSVAGFPDN  69

Query  850   -SDSDLPPCNSDGELEDEV---ETINCGEDSFRNVLASRVSEAVELLSSCLNSS---KSP  692
              SDS+     S+ +  D V     ++   DS+  +L S VS+A E  + CL S+    S 
Sbjct  70    ESDSERVESGSNTDAIDSVLKSVAVSGNADSYLKLLRSHVSQAAEAFA-CLRSNGGGSSE  128

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLR--SDSQNRIQRYIVDLE  518
               LRR VM++LR  G+NA +CK KW  S  ITAG +EFIDV+   S S     RY VDL+
Sbjct  129   STLRRSVMSFLRGLGHNAAICKTKWTSSGNITAGSYEFIDVVPVPSGSSTWQSRYFVDLD  188

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F+++FEIARP++ +  L++ LP+ FVG SE+LK+IV+V S AAKRS +S  L +PPWRK 
Sbjct  189   FAAKFEIARPSSQYSRLLQLLPRDFVGSSEDLKRIVRVTSDAAKRSLRSTDLSVPPWRKN  248

Query  337   RFMENKWFGSYRRSTNFRPASME-------LLAPLDQALAVKCRSVGFDDAVN  200
             R+M+NKWFG Y+R+ N  P + +       L AP+    A +CR VGFDDAV+
Sbjct  249   RYMQNKWFGPYKRTVN--PMTEKAYSRDSALFAPVS---AAQCRWVGFDDAVS  296



>ref|XP_008372544.1| PREDICTED: uncharacterized protein LOC103435893 [Malus domestica]
Length=310

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 124/307 (40%), Positives = 168/307 (55%), Gaps = 57/307 (19%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSG---------  851
             KRVT PLDDRVKA++V   +                 +    EH +GDY+          
Sbjct  10    KRVTYPLDDRVKARLVGGYSS------------GFSDVSSGSEH-SGDYNSPCLSELVHR  56

Query  850   ----------------SDSDLPPCNSDGELEDEV---ETINCGEDSFRNVLASRVSEAVE  728
                             SDSD     SD +  D V     ++   D +  +L S VS+A E
Sbjct  57    FLQDDESSTAGFPDNESDSDRVDSASDADAIDSVLRSVAVSGNADXYLKLLRSHVSQAEE  116

Query  727   LLSSCLNSS---KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV--LR  563
                +CL S+    S   LRR VM++LR  G+NA +CK KW  S  IT+G +EFIDV  ++
Sbjct  117   AF-ACLRSNGGGSSKSALRRSVMSFLRGLGHNAAICKTKWTSSGYITSGSYEFIDVVPVQ  175

Query  562   SDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKR  383
             S S     RY VDL+F+++FEIARP++ +  L++ LP+ FVG SE+LK+IV+V   AAKR
Sbjct  176   SGSSMWQSRYFVDLDFAAQFEIARPSSQYSRLLQLLPRNFVGSSEDLKRIVRVTCDAAKR  235

Query  382   SFKSRGLHLPPWRKQRFMENKWFGSYRRSTN------FRPASMELLAPLDQALAVKCRSV  221
             S KS  L +PPWRK R+++NKWFG Y+R+ N      F   S  + AP+  A   KCR V
Sbjct  236   SLKSTDLSVPPWRKNRYVQNKWFGPYKRTVNPLTERTFSTDSA-IFAPVSGA---KCRCV  291

Query  220   GFDDAVN  200
             GFDDAV+
Sbjct  292   GFDDAVS  298



>emb|CDY52283.1| BnaA03g57760D [Brassica napus]
Length=282

 Score =   190 bits (483),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 120/280 (43%), Positives = 163/280 (58%), Gaps = 16/280 (6%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I S+ +   ED D         +     +     Y  SDSDL   +
Sbjct  8     KRVTDPLDDEAKARIFSNHSSTLEDQDSPEICELEFLEDGLEDRSQTLYD-SDSDLSENS  66

Query  823   SD-------GELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMA  665
             +        GE   ++       D +RN+L S VS AVE  S  +  SK   + +  V +
Sbjct  67    ATERSSEEAGEKILKMALTFSDYDPYRNILLSHVSRAVEAYS--VFRSKRKHVFKDKVAS  124

Query  664   YLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEFEIARP  488
             +LR+ G+NA VC +KW  S  +TAG ++FIDV+     ++   RY VDL+F+SEFEIARP
Sbjct  125   FLRELGHNAAVCVSKWNSSSKLTAGSYDFIDVVYKPPGDKTSVRYFVDLDFASEFEIARP  184

Query  487   TNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGS  308
             T  +  +++ LP+VFVGK E L+ +V+    AAKRS KSRGL LPPWR+  ++++KWFG 
Sbjct  185   TPQYARVLQLLPRVFVGKEENLRTVVREACDAAKRSMKSRGLSLPPWRRFSYLQHKWFGP  244

Query  307   YRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
               R    R  S   +APL++  AV CRSVGFDDAVN RL 
Sbjct  245   CTR----RVGSGLEVAPLNKD-AVSCRSVGFDDAVNARLF  279



>ref|XP_008384612.1| PREDICTED: uncharacterized protein LOC103447207 [Malus domestica]
Length=310

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 171/303 (56%), Gaps = 38/303 (13%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIV----------SHRAQVAeddddlssssfseilfdFPEHEAGDYS  854
             KRVT PLDDRVK ++V          S  ++ + D D    S          E  A  + 
Sbjct  10    KRVTYPLDDRVKDRLVGGYSSGLSDASKGSEHSGDYDSPCLSXLVHDFLHQDESSAAGFP  69

Query  853   GSDSDLPPCNSDGELEDEVET------INCGEDSFRNVLASRVSEAVELLSSCLNSS---  701
              ++SD     S G   D +++      ++   DS+  +L S VS+A E   +CL S+   
Sbjct  70    DNESDSERVES-GSNTDAIDSVLRSVAVSXNADSYLKLLRSHVSQAAEAF-ACLRSNGGG  127

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV--LRSDSQNRIQRYIV  527
              S   LRR VM++LR  G+NA +CK KW  S  ITAG +EFIDV  + S S     RY  
Sbjct  128   SSESTLRRSVMSFLRGLGHNAAICKTKWTSSGNITAGSYEFIDVVPVPSGSSTWQSRYFX  187

Query  526   DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
             D +F++EFEIARP++ +  L++ LP+ FVG SE+LK+IV+V S AAKRS +S  L +PPW
Sbjct  188   DXDFAAEFEIARPSSQYSRLLQHLPRDFVGSSEDLKRIVRVTSDAAKRSLRSTDLSVPPW  247

Query  346   RKQRFMENKWFGSYRRSTN------FRPASMELLAPLDQALAVKCRSVGFDDAV-----N  200
             RK R+M+NKWFG Y+R+ N      F   S  + AP+    A KCR VGFDDAV     N
Sbjct  248   RKNRYMQNKWFGPYKRTVNPMKEKAFSRDSA-IFAPVS---AAKCRWVGFDDAVSGSTIN  303

Query  199   RRL  191
             RRL
Sbjct  304   RRL  306



>emb|CDY15101.1| BnaC03g44620D [Brassica napus]
Length=278

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 124/282 (44%), Positives = 165/282 (59%), Gaps = 22/282 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I S+ + + ED D         +     E  +     SDSDL   N
Sbjct  8     KRVTDPLDDEAKARIFSNHSSILEDQDSPEICELEFL-----EDRSQTLYDSDSDLSE-N  61

Query  823   SDGEL--EDEVETI------NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVM  668
             S  E   E+  E I          D +RN+L S V +AVE  SS    S+   + +  V 
Sbjct  62    SATERSGEEASEKILKMALSFSDYDPYRNILLSHVLKAVEAYSSF--RSRRKHVFKDKVA  119

Query  667   AYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEFEIAR  491
             ++LR+ G+NA VC +KW  S  +TAG ++FIDV+     +R   RY VDL+F+SEFEIAR
Sbjct  120   SFLRELGHNAAVCVSKWNSSSKLTAGSYDFIDVVHKPPGDRTSVRYFVDLDFASEFEIAR  179

Query  490   PTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFG  311
             PT  +   ++ LP+VFVGK E L+ +V+    AAKRS KSRGL LPPWR+  ++++KWFG
Sbjct  180   PTLQYARALQLLPRVFVGKEENLRTVVREACDAAKRSMKSRGLSLPPWRRFSYLQHKWFG  239

Query  310   SYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLF  185
                R    R  S   +APL++  AV CRSVGFDDAVN RL+ 
Sbjct  240   PCTR----RAGSGLEVAPLNKD-AVSCRSVGFDDAVNARLII  276



>gb|KGN44644.1| hypothetical protein Csa_7G354530 [Cucumis sativus]
Length=301

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 165/300 (55%), Gaps = 26/300 (9%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS--HRAQVAeddddlssssfseilfdFPEH--------------  872
             KRVTDPLDD+ KA++ +  H  Q++        S           H              
Sbjct  8     KRVTDPLDDKAKARLFATHHFQQLSYVSSGSEHSPHGSPCLSELVHGFLHDDHHPHHPSH  67

Query  871   EAGDYSGSDSDLPPCNSDGE--LEDEVETINCG-EDSFRNVLASRVSEAVELLSSCLNSS  701
                    SDSD      D E  L+  + ++N    D +R +L   +S A+   S  L S+
Sbjct  68    APTTSYDSDSDFLDSTPDREKPLDQIISSLNSNIVDPYRELLLHHISNAIHKFS-LLKSN  126

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVD  524
             KS  +L R+VMA+LRD G+NA VCK KW  S  +T+G+HEFIDV+R +   +++ RY V+
Sbjct  127   KS--VLLRNVMAFLRDLGHNAAVCKTKWSSSGTLTSGNHEFIDVVRFNISGKVEVRYFVE  184

Query  523   LEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWR  344
             L+  SEFEIARPT  +  +++ LP+VFVG +EEL +IV+V+   A+RS +SR L + PWR
Sbjct  185   LDLVSEFEIARPTAQYSRMLQCLPRVFVGTAEELMRIVRVLCDGARRSLRSRDLSVSPWR  244

Query  343   KQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             K R+++NKWFG YRR+ N  P      A   + +    R VGF+D    R LF    RTR
Sbjct  245   KNRYVQNKWFGPYRRTVNPVPEKSFAGAGATEGVGAAYRCVGFEDVNMNRQLF---VRTR  301



>ref|XP_008458063.1| PREDICTED: uncharacterized protein LOC103497602 [Cucumis melo]
Length=304

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/296 (39%), Positives = 164/296 (55%), Gaps = 27/296 (9%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS--HRAQVAeddddlssssfseilfdFPEH-------------E  869
             KRVTDPLDD+ KA++    H  Q++        S           H              
Sbjct  8     KRVTDPLDDKAKARLFGTHHFHQLSCVSSGSEHSPHDSPCLSELVHGFLHDHHPHHPSHA  67

Query  868   AGDYSGSDSDL--PPCNSDGELEDEVETINCG-EDSFRNVLASRVSEAVELLSSCLNSSK  698
                   SDSD   P  + +  L+D + ++N    DS+R++L   +  A+   S  L  S 
Sbjct  68    PTTSYDSDSDFLDPTPDRENPLDDIISSLNSNIVDSYRDLLLQHICNAIHKFS--LLKSN  125

Query  697   SPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDL  521
              P +L R+VMA+LR+ G+NA VCK KW  S  +T+G+HEFIDV+R +   ++Q RY V+L
Sbjct  126   KP-VLLRNVMAFLRELGHNAAVCKTKWSSSGTLTSGNHEFIDVVRFNVSGKVQVRYFVEL  184

Query  520   EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
             +  SEFEIARPT  +  +++ LP+VF G +EEL +IV+VM   A+RS +SR L + PWRK
Sbjct  185   DLVSEFEIARPTAQYSRMLQCLPRVFAGTAEELMRIVRVMCDGARRSLRSRDLSVSPWRK  244

Query  340   QRFMENKWFGSYRRSTNFRP----ASMELLAPLDQALAVKCRSVGFDDA-VNRRLL  188
              R+++NKWFG YRR+ N  P         +A   + +    R VGF+D  +NRRL 
Sbjct  245   NRYVQNKWFGPYRRTVNPVPEKSFGGAGAMAVATEGVGAAYRCVGFEDVNMNRRLF  300



>gb|KFK39834.1| hypothetical protein AALP_AA3G294100 [Arabis alpina]
Length=279

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 161/278 (58%), Gaps = 13/278 (5%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSD-SDLPPC  827
             KRVTDPLDD  KA+I  H   + + D           L D PEH +  +S SD S+    
Sbjct  8     KRVTDPLDDDAKARIFGH-GCILDQDSPRLCELVHGFLDDGPEHNSQTFSDSDLSESSVM  66

Query  826   NSDGELEDEVETINCG---EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLR  656
                GE  +E+  I       + ++N+L + V  AVE  S   +  KS  I R  V ++LR
Sbjct  67    ECAGEASEEIVRIAASFSDSEPYQNILLAHVLRAVETHSGLRSRRKS--IFRDKVASFLR  124

Query  655   DFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNR-IQRYIVDLEFSSEFEIARPTNH  479
             + G++A VC +KW  +  +TAG ++FIDV+     +    RY VDL+F+SEFEIARPT  
Sbjct  125   ELGHDAAVCTSKWSSTSKLTAGSYDFIDVVYKPPNDLPAVRYFVDLDFASEFEIARPTRQ  184

Query  478   FQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
             +  +++ LP+VFVGK   L+ IV+    AAKRS KS GL LPPWR+  ++ +KWFG Y+R
Sbjct  185   YARVLQLLPQVFVGKEHNLRTIVRESCDAAKRSLKSCGLSLPPWRRSSYLLHKWFGPYKR  244

Query  298   STNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLF  185
                 +  S   L PL++  AV CRS+GFDDAVN RL  
Sbjct  245   ----KVGSCLGLTPLNKD-AVSCRSMGFDDAVNTRLFI  277



>ref|XP_003548628.1| PREDICTED: uncharacterized protein LOC100805677 [Glycine max]
Length=299

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 166/288 (58%), Gaps = 22/288 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS---HRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLP  833
             KRVTDP DD  KA++V    HR Q++        S   +           D+   + D  
Sbjct  8     KRVTDPFDDEAKARLVGGGDHR-QLSYVSSGSEHSGNGDGHSPCLSELVHDFLEDNGDSE  66

Query  832   PCNSDG-ELEDE-VETINCGEDSFRNVL---ASRVSEAVE--LLSSCLNSSKSPEIL---  683
               NS G E + E V+++    DS   +L   AS VS++ +  LL     +S+  E L   
Sbjct  67    NNNSAGNEFDSERVDSVTDCIDSVEELLMLNASNVSDSYKSLLLEHASEASEKFEFLKEG  126

Query  682   -----RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLE  518
                  RR+ M++LR+ G+NA +CK +W+ S G+TAG++EFIDV++S      +RY VDL+
Sbjct  127   NVSSHRRNAMSFLREKGHNAAICKTRWDSSGGVTAGNYEFIDVVQSGPATWHKRYFVDLD  186

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F ++FEIARPT+ +   +  +P++FVG  EELK+ V+V+   A+R F  RGL LPPWRK 
Sbjct  187   FVAQFEIARPTSEYLEFLNYVPRIFVGTEEELKRTVRVLCGVARRCFGKRGLSLPPWRKN  246

Query  337   RFMENKWFGSYRRSTNFRPASMELLAPLDQALA-VKCRSVGFDDAVNR  197
             R+M+NKWFG YRR+ N  P     +  +  AL+  KCR VGFDDA  R
Sbjct  247   RYMQNKWFGPYRRTAN--PVHGNPVPTVVSALSGAKCRFVGFDDAFRR  292



>ref|XP_004154430.1| PREDICTED: uncharacterized protein LOC101232147 [Cucumis sativus]
Length=301

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 165/300 (55%), Gaps = 26/300 (9%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVS--HRAQVAeddddlssssfseilfdFPEH--------------  872
             KRVTDPLDD+ KA++ +  H  Q++        S           H              
Sbjct  8     KRVTDPLDDKAKARLFATHHFQQLSYVSSGSEHSPHDSPCLSELVHGFLHDDHHPHHPSH  67

Query  871   EAGDYSGSDSDLPPCNSDGE--LEDEVETINCG-EDSFRNVLASRVSEAVELLSSCLNSS  701
                    SDSD      D E  L+  + ++N    D +R++L   +S A+   S  L S+
Sbjct  68    APTTSYDSDSDFLDSTPDREKPLDQIISSLNSNIVDPYRDLLLHHISNAIHKFS-LLKSN  126

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVD  524
             KS   L R+VMA+LRD G+NA VCK KW  S  +T+G+HEFIDV+R +   +++ RY V+
Sbjct  127   KSA--LLRNVMAFLRDLGHNAAVCKTKWSSSGTLTSGNHEFIDVVRFNISGKVEVRYFVE  184

Query  523   LEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWR  344
             L+  SEFEIARPT  +  +++ LP+VFVG +EEL +IV+V+   A+RS +SR L + PWR
Sbjct  185   LDLVSEFEIARPTAQYSRMLQCLPRVFVGTAEELMRIVRVLCDGARRSLRSRDLSVSPWR  244

Query  343   KQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
             K R+++NKWFG YRR+ N  P      A   + +    R VGF+D    R LF    RTR
Sbjct  245   KNRYVQNKWFGPYRRTVNPVPEKSFAGAGATEGVGAAYRCVGFEDVNMNRQLF---VRTR  301



>ref|NP_189161.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB02083.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65488.1| hypothetical protein At3g25240 [Arabidopsis thaliana]
 gb|AEE76999.1| uncharacterized protein AT3G25240 [Arabidopsis thaliana]
Length=281

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 164/282 (58%), Gaps = 19/282 (7%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I+S  + + + D           L D PE    D   SD DL   +
Sbjct  8     KRVTDPLDDDAKARILSSHSYILDQDSPRLCELVHGFLEDGPEESFYD---SDPDLSETS  64

Query  823   S---DGELEDEVETINCG---EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAY  662
             S    GE   E+  +       D +RN+L + V  AVE+ S   + +K+  + R  V ++
Sbjct  65    SAEHSGEASVEIVRMAVSFSDSDPYRNLLLAHVLRAVEVYSGFRSRNKT--VFRDKVASF  122

Query  661   LRDFGYNAGVCKAKWERSDGITAGDHEFIDVLR--SDSQNRIQRYIVDLEFSSEFEIARP  488
             LR+ G++A VC +KW  S  + AG + FIDV+   SD+  +  RY+VDL+F+SEFEIARP
Sbjct  123   LRELGHDAAVCVSKWTSSSKLIAGSYHFIDVVHKPSDNDQKAVRYLVDLDFASEFEIARP  182

Query  487   TNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGS  308
             T  +   ++ LP VFVG  E L+ IV+    AAKRS KSRGL LPPWR+  ++++KWFG 
Sbjct  183   TREYTRGLQLLPNVFVGNEENLRTIVRESCDAAKRSMKSRGLSLPPWRRSSYLQHKWFGP  242

Query  307   YRRSTNFRPASMELLAPLDQALAVKCRSVGFDD-AVNRRLLF  185
             Y+R    +  S   + PL+   AV CRS+GFDD AVN RL  
Sbjct  243   YKR----KVGSSLGVKPLNSD-AVSCRSLGFDDGAVNTRLFI  279



>ref|XP_003626934.1| hypothetical protein MTR_8g012240 [Medicago truncatula]
 gb|AET01410.1| DUF506 family protein [Medicago truncatula]
Length=305

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 164/290 (57%), Gaps = 26/290 (9%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFP----------EHEAG---  863
             KRVTDP +D  KA++V    +   D    S  S +      P          E + G   
Sbjct  8     KRVTDPFNDEAKARLVGADLRRLSDVSSGSEHSGTGECDSSPSLSELVHGFLEEDDGNVC  67

Query  862   DYSGSDSDLPPCNSDGELEDEVETI------NCGEDSFRNVLASRVSEAVELLSSCLNSS  701
             D +G+D D    +S  +  D VE +      N   DS+ N+L   VSEA           
Sbjct  68    DSTGNDFDSERVDSVSDSMDSVEDLLRLSAENANADSYLNMLRLHVSEAAVKFD--FLKK  125

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV--LRSDSQNRIQRYIV  527
             +S  +  R+VM++LR+ G+NA +CK +W+ S G+TAG+HEFIDV  +RS S     RY V
Sbjct  126   QSVSVYNRNVMSFLREKGHNAAICKTRWDSSGGLTAGNHEFIDVVRMRSGSSTWQNRYFV  185

Query  526   DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
             +L+F+ +FEIARPT+ +  ++  +P +FVG SEELK+ V  +  A K   +SRGL +PPW
Sbjct  186   ELDFAVQFEIARPTSRYSEIMSYVPGIFVGNSEELKRTVLALCGAVKLCLRSRGLSIPPW  245

Query  346   RKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALA-VKCRSVGFDDAVN  200
             RK R+M+NKWFG YRR+TN  P     +  +  + + VKCR VGFD+A++
Sbjct  246   RKNRYMQNKWFGPYRRTTN--PVHGNPVPDVVSSFSGVKCRLVGFDNAMS  293



>ref|XP_007134175.1| hypothetical protein PHAVU_010G025800g [Phaseolus vulgaris]
 gb|ESW06169.1| hypothetical protein PHAVU_010G025800g [Phaseolus vulgaris]
Length=299

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 167/296 (56%), Gaps = 20/296 (7%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPE--------HEAGDYSGS  848
             KRVTDP +D  KA++V    ++       S  S         E        ++  D S +
Sbjct  8     KRVTDPFNDEAKARLVGGDRRLLSYISSGSEHSGDGDSPCLSELVHDFLEDNDNSDDSSA  67

Query  847   DSDLPP--CNSDGELEDEVETI-----NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPE  689
              +D+     +S  +  D V+ +     +   DS++N+L +  SEA E  +  L   ++  
Sbjct  68    KNDIDSDRVDSVADCIDSVDELLMLSESNASDSYKNLLLAHASEAAEKFA--LLKEQNIS  125

Query  688   ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
                R+ M++LR  G+NA +CK +W+ S G TAG ++FIDV+RS+     +RY VDL+F  
Sbjct  126   TYLRNAMSFLRQNGHNAAICKTRWDSSGGSTAGSYDFIDVVRSEQSTWHKRYFVDLDFVG  185

Query  508   EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
             +FEIARPT+ +   +  +P++FVG +EELK+ V+++   AKR F+ RGL +PPWRK R+M
Sbjct  186   QFEIARPTSEYLEFLTYVPRIFVGTAEELKRTVRILCGVAKRCFRKRGLTVPPWRKNRYM  245

Query  328   ENKWFGSYRRSTNFRPASMELLAPLDQALA-VKCRSVGFDDAVNRRLLFPVVTRTR  164
             +NKWF  YRR+TN  P     +  +  AL+  KCR VGFDD+V+      VV  TR
Sbjct  246   QNKWFAPYRRTTN--PVQGNPVPTVVSALSGAKCRFVGFDDSVSEARRGSVVVLTR  299



>ref|XP_004510230.1| PREDICTED: uncharacterized protein LOC101513106 [Cicer arietinum]
Length=300

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 161/289 (56%), Gaps = 25/289 (9%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFP---------EHEAGD---  860
             KR+TDP DD  KA++V    +        S  S                  E + G+   
Sbjct  7     KRITDPFDDEAKARLVGGGLRPLSGVSSGSEHSGDSECTSPSLSELVHGFLEDDDGNECY  66

Query  859   YSGSDSDLPPCNSDGELEDEVETI--------NCGEDSFRNVLASRVSEAVELLSSCLNS  704
              SG+D D    +S  +  D VE +        N   DS++N+L + VSEA E  +     
Sbjct  67    SSGNDFDSERVDSVSDSMDSVEDLLRLKLNSENDNVDSYKNLLRAHVSEAAEKFA--FLK  124

Query  703   SKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVD  524
              ++  +  R++M++LR+ G+NA +CK +W+ + G+TAG HEFIDV+RS+S     RY V+
Sbjct  125   ERNVSVYNRNLMSFLREKGHNAAICKTRWDFAGGLTAGSHEFIDVVRSESSTWQTRYFVE  184

Query  523   LEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWR  344
             L F+ +FE+ARPT+ +  ++  +P +FVG SEE+K+IV  M  A KR  +S GL +PPWR
Sbjct  185   LNFAGQFEVARPTSRYTEVLSYVPGIFVGTSEEMKRIVLAMCGAVKRCLRSGGLSVPPWR  244

Query  343   KQRFMENKWFGSYRRSTNFRPA-SMELLAPLDQALAVKCRSVGFDDAVN  200
             K R+M+ KWFG YRR+TN  P     +   +      KCR +GFDDAV+
Sbjct  245   KNRYMQKKWFGPYRRTTN--PVHGNPVPVNVSSYSGTKCRLLGFDDAVS  291



>gb|KFK38193.1| hypothetical protein AALP_AA3G081300 [Arabis alpina]
Length=289

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 165/316 (52%), Gaps = 81/316 (26%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL D V+A++V                          EH   DY   D D  PC 
Sbjct  7     KRVTDPLADEVRARLVG------------------CSFSSGSEHTVEDY---DEDDSPCL  45

Query  823   SD---GELEDEVETIN-----------------------------------------CGE  776
             SD     LEDE E  +                                           +
Sbjct  46    SDLVQSFLEDEEELDHNVKKDESRWCDHDSGSDSDSDSEQFELPDFADDIAKILRNSLKD  105

Query  775   DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
             DS+  ++   V++A+E+LSS  +  +     +R V++ LR+ G+NA +CK KW  S G+T
Sbjct  106   DSYGRMVLLHVAKAMEMLSSLRSDHE-----QRKVISILRELGHNAAICKTKWNSSGGLT  160

Query  595   AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
             AG++EFIDV+ + +     RYIVDLEF+S F+IARPT  +  ++++LP VFVGK ++LK+
Sbjct  161   AGNYEFIDVVHAQTG----RYIVDLEFASRFQIARPTVQYARVLQTLPAVFVGKGDDLKR  216

Query  415   IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
             I++++  AA+ S KSRGL LPPWRK R+M+ +WFG Y+R+TN  P++  +   L      
Sbjct  217   ILRLVCDAARLSLKSRGLTLPPWRKNRYMQTRWFGPYKRTTNLTPSTSAVNTVL------  270

Query  235   KCRSVGFDDAVNRRLL  188
              CR+ GFD+AV  RL 
Sbjct  271   -CRATGFDNAVGGRLF  285



>ref|XP_010926661.1| PREDICTED: uncharacterized protein LOC105048883 [Elaeis guineensis]
Length=305

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 122/322 (38%), Positives = 162/322 (50%), Gaps = 66/322 (20%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPC-  827
             KRVTDPL+D+VKAQ+    A                         A   SGS+ D  PC 
Sbjct  8     KRVTDPLNDKVKAQLRGDDAHPTTGY-------------------ASSSSGSEHDAAPCL  48

Query  826   ----------NSDG----------------------ELEDEVETIN------CGEDSFRN  761
                       N+DG                           VET+         +D  R 
Sbjct  49    SGLVHAFLFENADGTPSAAGDSSDHDAPSDDDDAGDRAAAAVETVRDLLNPLAEKDPLRA  108

Query  760   VLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHE  581
              L   V  A E  S      K     RR VMA LR  GYNAG+CKA+WE S G+TAG +E
Sbjct  109   RLFFDVLAAAEAFSGV---RKYGSAFRRAVMAKLRVAGYNAGICKARWETSGGVTAGTYE  165

Query  580   FIDVLRSDSQNRIQ-RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKV  404
             +IDV+ + ++   + RYIVDLEF++EFE+ARPT  +  ++ +LP+V V ++E ++++V+V
Sbjct  166   YIDVVAASAERGGESRYIVDLEFAAEFEVARPTEEYVRVLAALPQVAVARAEAVRQVVRV  225

Query  403   MSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRS  224
             +  AA+RS +SRGLH+PPWRK R M  KW G YRR+ N  P+S            VKCR+
Sbjct  226   VGDAARRSLRSRGLHVPPWRKSRCMLAKWLGPYRRTVNPVPSSTGAAV-GGGGAEVKCRA  284

Query  223   VGFD--DAVNRRLLFPVVTRTR  164
             VGF   +A   RLL P   RTR
Sbjct  285   VGFPALEAATGRLL-PPAARTR  305



>ref|XP_010905163.1| PREDICTED: uncharacterized protein LOC105032414 [Elaeis guineensis]
Length=305

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 132/204 (65%), Gaps = 5/204 (2%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            D FR  L S V  A E  +      K+    RR VMA LR  GYNAG+CKA+WE S G+T
Sbjct  107  DPFRARLVSDVLAAAEAFAGV---RKNGSAFRRAVMATLRVAGYNAGICKARWETSGGVT  163

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            AG +E+IDV+ +     + RYIVD+EF++EFE+AR T H++ ++ +LP+V V ++E +++
Sbjct  164  AGTYEYIDVVATARAGEV-RYIVDMEFAAEFEVARATEHYRRVLAALPRVAVARTETMRQ  222

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
             V++++ AA+RS +S+GLH+PPWRK R+M  KW G YRR+ N  PAS         +  V
Sbjct  223  AVRLVAVAARRSLRSQGLHVPPWRKSRYMLAKWLGPYRRTGNTLPASAGASVGGGGSAEV  282

Query  235  KCRSVGFDDAVNRRLLFPVVTRTR  164
            KCRSVGF +A    L+ P   RTR
Sbjct  283  KCRSVGFPEAAAGTLV-PPAGRTR  305



>gb|KHN10055.1| hypothetical protein glysoja_048200 [Glycine soja]
Length=205

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/194 (46%), Positives = 127/194 (65%), Gaps = 5/194 (3%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            DS++++L    SEA E        + S    RR+ M++LR+ G+NA +CK +W+ S G+T
Sbjct  9    DSYKSLLLEHASEASEKFEFLKEGNVSSH--RRNAMSFLREKGHNAAICKTRWDSSGGVT  66

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            AG++EFIDV++S      +RY VDL+F ++FEIARPT+ +   +  +P++FVG  EELK+
Sbjct  67   AGNYEFIDVVQSGPATWHKRYFVDLDFVAQFEIARPTSEYLEFLNYVPRIFVGTEEELKR  126

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALA-  239
             V+V+   A+R F  RGL LPPWRK R+M+NKWFG YRR+ N  P     +  +  AL+ 
Sbjct  127  TVRVLCGVARRCFGKRGLSLPPWRKNRYMQNKWFGPYRRTAN--PVHGNPVPTVVSALSG  184

Query  238  VKCRSVGFDDAVNR  197
             KCR VGFDDA  R
Sbjct  185  AKCRFVGFDDAFRR  198



>emb|CDY60822.1| BnaAnng17250D [Brassica napus]
Length=299

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 141/208 (68%), Gaps = 13/208 (6%)
 Frame = -1

Query  778  EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG-  602
            ED++  ++   V++A+E+LSS  +  +   +LRR +M+ LR+ G+NA +CK KW+ S G 
Sbjct  102  EDNYGRMVLFHVAKAMEMLSSSRSDQEQRAVLRRKLMSLLRELGHNAAICKTKWKSSGGG  161

Query  601  ITAGDHEFIDVLRS--DSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSE  428
            +TAG+HEFIDV+ +   + ++  RYIVD++F S F++ARPT  +  +++SLP +FVG+ E
Sbjct  162  LTAGNHEFIDVVYTPVATSSQTVRYIVDIDFKSHFQVARPTVQYARVLQSLPTIFVGRGE  221

Query  427  ELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQ  248
            +LK+I++++  AA+ S KS GL LPPWRK R+M+ +W GSY+R+ N  P+S  +      
Sbjct  222  DLKRILRLVCDAARISLKSCGLTLPPWRKNRYMQTRWLGSYKRTVNLTPSSRAV------  275

Query  247  ALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
               V CR++GFD+AV    LF    RTR
Sbjct  276  -NTVVCRAIGFDNAVGGGRLF---VRTR  299



>ref|XP_006850288.1| hypothetical protein AMTR_s00020p00161780 [Amborella trichopoda]
 gb|ERN11869.1| hypothetical protein AMTR_s00020p00161780 [Amborella trichopoda]
Length=298

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 156/280 (56%), Gaps = 35/280 (13%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGD-------YSGSD  845
             K+VTDPLDDR KA++  +            S           EHE          YS  +
Sbjct  9     KQVTDPLDDRAKARLYGYGWYSGSSSSSSGS-----------EHEPDSESLGRLIYSFME  57

Query  844   SDLPPCNSDGELEDE--VETINCGEDSFRNVLASRVSE----AVELLSSCLNSSKSPE--  689
              D PP   +G  +    VE  +C +     +L   V         L+   L S  S E  
Sbjct  58    DDEPPSPVNGPYDSTTMVEDGDCDDAQIVEMLKGLVQPPDRVVASLVERALQSCSSHEER  117

Query  688   -ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFS  512
              + RR VM  LR  GYNAG+CK+KWE+S G+ AG +E+IDV+++D     QRY++DL+F 
Sbjct  118   SVHRRRVMTDLRQHGYNAGLCKSKWEKSGGLNAGTYEYIDVIKAD-----QRYLIDLDFV  172

Query  511   SEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRF  332
             SEF IARPT ++  ++ +LP VFVGK E+LK +V+++S AAK+S K+  LHLPPWRK R+
Sbjct  173   SEFAIARPTPYYTVVLGALPWVFVGKVEQLKLVVRLVSDAAKKSMKAGDLHLPPWRKNRY  232

Query  331   MENKWFGSYRRSTN-FRPASMELLAPLDQALAVKCRSVGF  215
             M+ KWFG Y+R+ N     + ++ +P + A     RSVGF
Sbjct  233   MQAKWFGPYKRTVNPVAGGATDVRSPPESAQM--ARSVGF  270



>ref|XP_009136110.1| PREDICTED: uncharacterized protein LOC103860277 [Brassica rapa]
Length=282

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 117/281 (42%), Positives = 160/281 (57%), Gaps = 18/281 (6%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLD+  KA+I S+ +   ED D         +     +     Y  SDSDL   N
Sbjct  8     KRVTDPLDEEAKARIFSNHSSTLEDQDSPEICELEFLEDGLEDKSQTLYD-SDSDLSE-N  65

Query  823   SDGELEDE--------VETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVM  668
             S  E   E        +       D ++N+L + VS A E  S+    SK   + +  V 
Sbjct  66    SATERSSEEASEKILKMALTFSDYDPYQNILLAHVSRAAEAYSAF--RSKRKHVFKDKVA  123

Query  667   AYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEFEIAR  491
             ++LR+ G+NA VC +KW  S  +TAG ++FIDV+     ++   RY VDL+F+SEFEIAR
Sbjct  124   SFLRELGHNAAVCVSKWNSSSKLTAGSYDFIDVVYKPPGDKTSVRYFVDLDFASEFEIAR  183

Query  490   PTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFG  311
             PT  +  +++ LP+VFVGK E L+ +V+    AAKRS KSRGL LPPWR+  ++++KWFG
Sbjct  184   PTPQYARVLQLLPRVFVGKEENLRTVVREACDAAKRSMKSRGLSLPPWRRFSYLQHKWFG  243

Query  310   SYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
                R    R  S   + PL++  AV CRSVGFDDAVN RL 
Sbjct  244   PCTR----RVGSGLEVTPLNKD-AVSCRSVGFDDAVNGRLF  279



>ref|XP_010547135.1| PREDICTED: uncharacterized protein LOC104818986 [Tarenaya hassleriana]
Length=318

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 145/238 (61%), Gaps = 33/238 (14%)
 Frame = -1

Query  826  NSDGELEDEVETI-----NC-GEDSFRNVLASRVSEAVELLSSC-----------LNSSK  698
            +S  E  D  E I     NC  +D + + L   V+ A+E+LSS             N + 
Sbjct  85   DSSAERSDAAEEIARLIRNCIRDDPYGHALLVHVTRAMEVLSSNGSHGEHHAVFHPNDTP  144

Query  697  SPE-------ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ  539
            SP+       +LRR VM+ LR+ G+NA +CK +W  S  + AG+HEFID++   S N   
Sbjct  145  SPDSQHERRAVLRRRVMSLLRELGHNAAICKTRWRSSGNLPAGNHEFIDII-VQSNNDTY  203

Query  538  RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLH  359
            RYIV+L+F+S+FEIARPT  + ++++SLP++FVG+ E+LK++V++    A+RS +SRGL 
Sbjct  204  RYIVELDFTSQFEIARPTTQYSFVLQSLPRIFVGRVEDLKRLVRLTCDTARRSLRSRGLT  263

Query  358  LPPWRKQRFMENKWFGSYRRST-NFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLL  188
            +PPWRK R+M+ +W G Y+R+T    P+S       D A  V CR++GFD+ +  RL 
Sbjct  264  VPPWRKNRYMQTRWLGPYKRTTAGLTPSS-------DDANTVVCRAIGFDNTIEGRLF  314



>emb|CDY34904.1| BnaA01g32350D [Brassica napus]
Length=302

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 135/196 (69%), Gaps = 9/196 (5%)
 Frame = -1

Query  778  EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG-  602
            ED++  ++   V++A+E+LSS  +  +   +LRR +M+ LR+ G+NA +CK KW+ S G 
Sbjct  102  EDNYGRMVLFHVAKAMEMLSSSRSDQEQRAVLRRKLMSLLRELGHNAAICKTKWKSSGGG  161

Query  601  ITAGDHEFIDVLR--SDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSE  428
             TAG+HEFIDV+   + + ++  RYIVD++F S F++ARPT  +  +++SLP +FVG+ E
Sbjct  162  FTAGNHEFIDVVYIPTATSSQTVRYIVDIDFKSHFQVARPTVQYARVLQSLPTIFVGRGE  221

Query  427  ELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQ  248
            +LK+I++++  AA+ S KS GL LPPWRK R+++ +W GSY+R+ N  P+S         
Sbjct  222  DLKRILRLVCDAARISLKSCGLTLPPWRKNRYIQTRWLGSYKRTVNLTPSSSR------A  275

Query  247  ALAVKCRSVGFDDAVN  200
            A  V CR++GFD+AV 
Sbjct  276  ANTVMCRAIGFDNAVG  291



>ref|XP_002883595.1| hypothetical protein ARALYDRAFT_899148 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59854.1| hypothetical protein ARALYDRAFT_899148 [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 120/282 (43%), Positives = 160/282 (57%), Gaps = 21/282 (7%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I S    + + D             D PE    D   SDS L   N
Sbjct  8     KRVTDPLDDDAKARIFSSHGCILDQDSPRLYELVHGFFEDGPEETFYD---SDSKLSE-N  63

Query  823   SDGEL--EDEVETINCG-----EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMA  665
             S  E   ED  E +         D ++N+L + V  AVE  S   + +KS  +    V++
Sbjct  64    SVVECPSEDSEEILRMAVSLSDSDPYQNLLLAHVLRAVEAYSGFRSRNKS--VFGDKVVS  121

Query  664   YLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLR--SDSQNRIQRYIVDLEFSSEFEIAR  491
             +LR+ GYNA VC +KW  S  + AG ++FIDV+   SD+     RY VDL+F+SEFEIAR
Sbjct  122   FLRELGYNAAVCVSKWTSSAKLIAGSYQFIDVVYKPSDNDQTAVRYFVDLDFASEFEIAR  181

Query  490   PTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFG  311
             PT  +  +++ LP VFVGK E L+ IV+    AAKRS KSRGL LPPWR+  ++++KWF 
Sbjct  182   PTREYTRVLQLLPNVFVGKEENLRTIVRESCDAAKRSLKSRGLSLPPWRRSSYLQHKWFS  241

Query  310   SYRRSTNFRPASMELLAPLDQALAVKCRSVGFDD-AVNRRLL  188
              Y+R    +  S   + PL+   AV CRS+G+DD AVN RL 
Sbjct  242   PYKR----KVGSSLGVKPLNSD-AVSCRSLGYDDGAVNTRLF  278



>ref|XP_007200524.1| hypothetical protein PRUPE_ppa009442mg [Prunus persica]
 gb|EMJ01723.1| hypothetical protein PRUPE_ppa009442mg [Prunus persica]
Length=292

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 163/292 (56%), Gaps = 45/292 (15%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIV-SHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSD---L  836
             KRVT PLDD+V+A++V  + ++++  D    S    +           D+   DS     
Sbjct  10    KRVTYPLDDKVRARLVGGYSSELSIYDVSSGSEHSGDGDSPCLSELVHDFLQDDSSETRF  69

Query  835   PPCNSDGELEDEVE------------TINCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
             P   +D +  D V              ++  EDSF  +L S VSEAVE   SCL S    
Sbjct  70    PDNETDSDRVDSVSDAKAMDSILRSAAVSGNEDSFAKLLRSHVSEAVEAF-SCLRSGNK-  127

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRI--QRYIVDLE  518
               LRR VM++LR  G+NA +CK  W  S  ITAG +EFIDV+ + S + +   +Y VDL+
Sbjct  128   SALRRSVMSFLRARGHNAAICKTNWSSSGNITAGSYEFIDVVCAQSSSPMWQSQYFVDLD  187

Query  517   FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             F+++FEIARPT+H               SE+LK+IV+VMS A KRS +SR L +PPWRK 
Sbjct  188   FAAQFEIARPTSH---------------SEDLKRIVRVMSDAVKRSLRSRELSVPPWRKN  232

Query  337   RFMENKWFGSYRRSTN------FRPASMELLAPLDQALAVKCRSVGFDDAVN  200
             R+M+NKWFG Y+R+ N      F  +S  + AP+  A   KCR VGFDDAV+
Sbjct  233   RYMQNKWFGPYKRTVNPLTEKSFSISST-VFAPVSGA---KCRRVGFDDAVS  280



>ref|XP_010552020.1| PREDICTED: uncharacterized protein LOC104822476 [Tarenaya hassleriana]
Length=323

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 137/224 (61%), Gaps = 31/224 (14%)
 Frame = -1

Query  787  NC-GEDSFRNVLASRVSEAVELLSS---------CLNSSKSPE---------ILRRHVMA  665
            NC  ED++   L   V+ A+E+LSS           + + +P          +LRR VM+
Sbjct  103  NCLREDAYGRTLLVHVTRAMEVLSSQGPHHEHHAVFHRNATPSLDSQHEHRTVLRRRVMS  162

Query  664  YLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRI----QRYIVDLEFSSEFEI  497
             LR+ G+NA +CK KW  S  +TAG+HEFIDV+     N       RYIVDLEF+S+FEI
Sbjct  163  LLRELGHNAAICKTKWSSSGNLTAGNHEFIDVVVGQPHNATCQPTVRYIVDLEFASQFEI  222

Query  496  ARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKW  317
            ARPT+ +  +++SLP++FVG+ E+LK++V++   AA+RS +SRGL +PPWRK R+++ +W
Sbjct  223  ARPTSQYATVLQSLPRIFVGRGEDLKRLVRLTCDAARRSLRSRGLTVPPWRKNRYLQARW  282

Query  316  FGSYRRSTNFRPASMELLAPLDQAL-AVKCRSVGFDDAVNRRLL  188
             G Y+R+T         L P  QA+     R+VGFD+AV   L 
Sbjct  283  LGPYKRTTTG-------LTPSSQAVXXXXXRAVGFDNAVGGNLF  319



>ref|XP_010488635.1| PREDICTED: uncharacterized protein LOC104766445 [Camelina sativa]
Length=321

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 155/280 (55%), Gaps = 19/280 (7%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I+S    + + D             D   HE   Y  SDSDL   +
Sbjct  52    KRVTDPLDDEAKARILSSHGCILDQDSPRLCELVHGFFDDG--HEETLYDDSDSDLSENS  109

Query  823   SDGELEDEVETINCG-----EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYL  659
                  +   E +         D +RN+L + V  A E  S   + +KS  + +  V ++L
Sbjct  110   IVKRSQASEEILKMAVTFSDSDPYRNLLLAHVLRAAETYSGFRSRNKS--VFQNKVASFL  167

Query  658   RDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNH  479
             R+ G++A VC +KW  S  +TAG +EFIDV+   +     RY VDL+F+SEFEIARPT  
Sbjct  168   RELGHDAAVCVSKWNSSAKLTAGSYEFIDVIYKPTA---VRYFVDLDFASEFEIARPTQE  224

Query  478   FQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
             +  +++ LP VFVGK   L+ IV+ +  A KRS KSRGL LPPWR+  ++++KWFG Y+R
Sbjct  225   YTRVLQLLPNVFVGKEVNLRTIVRELCDATKRSMKSRGLSLPPWRRSSYLQHKWFGPYKR  284

Query  298   STNFRPASMELLAPLDQALAVKCRSVGFD--DAVNRRLLF  185
                 +  S   + PL    AV CRS+GFD   AVN RL  
Sbjct  285   ----KVGSGLGVKPLSSD-AVNCRSLGFDHEGAVNARLFI  319



>ref|XP_006299312.1| hypothetical protein CARUB_v10015467mg [Capsella rubella]
 gb|EOA32210.1| hypothetical protein CARUB_v10015467mg [Capsella rubella]
Length=285

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 154/282 (55%), Gaps = 15/282 (5%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I S    + + D         +  FD    E   +S SD       
Sbjct  8     KRVTDPLDDEAKARIFSSHGCILDQDSSPRLCELVQGFFDDGPEETILFSDSDPSENSSV  67

Query  823   SDGELEDEVETINCG-----EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYL  659
              +   E  VE +         D +RN+L   V  AVE  S C  S ++  ++R  V+++L
Sbjct  68    VERSCEGSVEILKMALSFSDSDPYRNLLLGHVLRAVEAYS-CFRS-RNKSVIRDKVVSFL  125

Query  658   RDFGYNAGVCKAKWERSDGITAGDHEFIDVLR--SDSQNRIQRYIVDLEFSSEFEIARPT  485
             R+ G++A VC +KW  S  + AG +++IDV+   +  Q    RY VDL+F+SEFEIARPT
Sbjct  126   RELGHDAAVCVSKWNSSAKLIAGSYDYIDVVYKPTSDQTIPVRYFVDLDFASEFEIARPT  185

Query  484   NHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSY  305
               +  ++  LP VFVGK E LK IV+    AAKRS KSRGL LPPWR+  ++++KWFG Y
Sbjct  186   QEYTRVLHLLPNVFVGKEESLKTIVRESCDAAKRSMKSRGLSLPPWRRSSYLQHKWFGPY  245

Query  304   RRSTNFRPASMELLAPLDQALAVKCRSVGFD--DAVNRRLLF  185
             +R        ++ L     + AV CR++GFD    VN RL  
Sbjct  246   KRKVMESSLGVKQL----NSEAVSCRALGFDHEGVVNTRLFI  283



>ref|XP_008792958.1| PREDICTED: uncharacterized protein LOC103709418 [Phoenix dactylifera]
Length=307

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 122/323 (38%), Positives = 162/323 (50%), Gaps = 66/323 (20%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD+VKA++    A                         AG  SGS+ D  PC 
Sbjct  8     KRVTDPLDDKVKARLRGDDAHGMTGY-------------------AGSSSGSEHDAAPCL  48

Query  823   SD-----------------GELEDE----------------VETIN------CGEDSFRN  761
             SD                 G+  D                  ET+          D FR 
Sbjct  49    SDLVHAFLFENAAGSPSAAGDASDRDATSDEDDAGDRAAAAAETVRDLLNPPAERDPFRA  108

Query  760   VLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHE  581
              LA  V  A E  S      K+    RR VMA LR  GYNAG+CK +WE S  +TAG +E
Sbjct  109   RLAFDVFSAAEAFSGV---RKNGSAFRRAVMAKLRVAGYNAGICKTRWEASGKVTAGTYE  165

Query  580   FIDVLRSDSQ---NRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIV  410
             +IDV+ + ++   +   RYIVD+EF++EFE+AR T  +  ++  LP+V V ++E ++++V
Sbjct  166   YIDVVAASAERTGDGESRYIVDVEFAAEFEVARATEEYARVLAELPRVAVARAEAVRQVV  225

Query  409   KVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKC  230
             +V++ AA+RSF+SRGLH+PPWRK R+M  KW G YRR+ N  PAS         A  VKC
Sbjct  226   RVVAGAARRSFRSRGLHVPPWRKSRYMLAKWLGPYRRTVNPVPASSGATVGGGGA-EVKC  284

Query  229   RSVGFDD-AVNRRLLFPVVTRTR  164
             R+VGF   A     L P   RTR
Sbjct  285   RAVGFPALAAASGRLVPPAPRTR  307



>ref|XP_009383138.1| PREDICTED: uncharacterized protein LOC103970954 [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 131/212 (62%), Gaps = 18/212 (8%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVE----LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERS  608
            + FR  LA  V E  E    L SSC  S+      RR VMA LRD GYNAG+CKA WE S
Sbjct  97   NQFRRRLAGEVCETAEGFAWLRSSCGGSA-----FRRAVMARLRDAGYNAGICKASWETS  151

Query  607  DGITAGDHEFIDVLRS----DSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFV  440
             G+T G +E+IDV+ +    D   + +RYIVDLEF++EFE+AR T  ++ ++ +LP+V V
Sbjct  152  GGLTGGSYEYIDVVATAGEGDGDEQGRRYIVDLEFAAEFEVARATEAYKEVVAALPRVAV  211

Query  439  GKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLA  260
               E ++  V+ ++ AA+RS ++RGLH+PPWRK R+M  KW G YRR+TN  P S+    
Sbjct  212  AGEEAVRAAVRAVADAARRSLRARGLHVPPWRKSRYMLAKWLGPYRRTTNPVPTSLPAAP  271

Query  259  PLDQALAVKCRSVGFDDAVNRRLLFPVVTRTR  164
            P      VKCR+VGF  A   RLL     RTR
Sbjct  272  PGGD---VKCRAVGFPTAA--RLLAAPTARTR  298



>ref|XP_010466945.1| PREDICTED: uncharacterized protein LOC104747073 [Camelina sativa]
Length=277

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 155/280 (55%), Gaps = 21/280 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPLDD  KA+I+S    + + D             D   HE   Y   DSDL   N
Sbjct  8     KRVTDPLDDEAKARILSSHGCILDQDSPRLCELVHGFFDDG--HEETLYDDPDSDLSE-N  64

Query  823   SDGELEDEVETI------NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAY  662
             S  E     E I          D +RN+L + V  A E  S   + +KS  + +  V ++
Sbjct  65    SVVERSQASEEILKMAVTFSDSDPYRNLLLAHVLRAAEAYSGFRSRNKS--VFQNKVASF  122

Query  661   LRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTN  482
             LR+ G++A VC +KW  S  + AG ++FIDV+   +     RY VDL+F+SEFEIARPT 
Sbjct  123   LRELGHDAAVCVSKWSSSAKLIAGSYDFIDVIYKPTA---VRYFVDLDFASEFEIARPTQ  179

Query  481   HFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYR  302
              +  +++ LP VFVGK E L+ IV+   +A KRS KSRGL LPPWR+  ++++KWFG Y+
Sbjct  180   EYTRVLQLLPNVFVGKEENLRTIVRESCEATKRSMKSRGLSLPPWRRSSYLQHKWFGPYK  239

Query  301   RSTNFRPASMELLAPLDQALAVKCRSVGFD--DAVNRRLL  188
             R    +  S   + PL    AV CRS+GFD   AVN RL 
Sbjct  240   R----KVGSGLGVKPLSSD-AVSCRSLGFDHEGAVNARLF  274



>ref|XP_010527297.1| PREDICTED: uncharacterized protein LOC104804654 [Tarenaya hassleriana]
Length=280

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 134/210 (64%), Gaps = 11/210 (5%)
 Frame = -1

Query  805  DEVETI-NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVC  629
            DEV  I +   D +RN+L + V  AVE  S   +  +S  + ++ + A+LR+ G++A VC
Sbjct  75   DEVVNIRDSDSDRYRNLLFAHVLRAVEAYSDLRSEQRS--VFQQKITAFLRELGHDAAVC  132

Query  628  KAKWERS-DGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEFEIARPTNHFQYLIRSL  455
            K++W  S  G+ +G HEFIDV+   +      RY VD EF S FEIARPT  +  +++SL
Sbjct  133  KSRWRSSATGLPSGSHEFIDVVHHPTPGAPAIRYFVDTEFDSNFEIARPTRQYARVVQSL  192

Query  454  PKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS  275
            P +FVGK ++L+++V+V  +AAK S KSRGL +PPWR++ ++E KWFG Y+R+T      
Sbjct  193  PGIFVGKEDKLRRMVRVACEAAKGSLKSRGLSMPPWRRRSYLEKKWFGPYKRTTG-----  247

Query  274  MELLAPLDQAL-AVKCRSVGFDDAVNRRLL  188
              L A +   + +V CRSVGFDD VN RL 
Sbjct  248  STLTASVPTLISSVSCRSVGFDDNVNGRLF  277



>ref|XP_010913111.1| PREDICTED: uncharacterized protein LOC105038887 [Elaeis guineensis]
Length=296

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 155/279 (56%), Gaps = 21/279 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQI------VSHRAQVAeddddlssssfseilfdFPEHEAGDYSGS--  848
             KRVTDPLDD+VKA+I      V+  A    + D LS    + +  D P       S +  
Sbjct  8     KRVTDPLDDKVKARIRGDDRFVTGYASSGSEHDALSGLVHAFLESDGPNSHGASASAAAA  67

Query  847   -DSDLPPCNSDGELEDEVET-------INCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
              D      + DG+   EV T        +  ED FR  L   VSEA E L+    S    
Sbjct  68    SDGSEESDSEDGDRSVEVATKVKDLLDPSGKEDPFRLRLMVDVSEAAEALAELRWSGSG-  126

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFS  512
                RR VM  LR+ GYNAG+CKA+WE S  +TAG +E+IDV+   ++    RYIVD+ F+
Sbjct  127   --YRRAVMVRLREGGYNAGICKARWESSRRLTAGSYEYIDVVVDAAKEVAARYIVDVGFA  184

Query  511   SEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRF  332
             +EFE+AR T  +  ++ +LP+V V + EE++ +V + ++AA+RS + RG+H+PPWRK ++
Sbjct  185   AEFEVARATEEYGSMVAALPRVMVARPEEVRHVVHIAAEAARRSLRRRGMHVPPWRKGKY  244

Query  331   MENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
             M  KW G YRR+ N  P      A +      KCR+VGF
Sbjct  245   MLAKWLGPYRRTVN--PLPAAAGAAVAGVGEAKCRAVGF  281



>ref|XP_008778742.1| PREDICTED: uncharacterized protein LOC103698490 [Phoenix dactylifera]
Length=296

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 106/280 (38%), Positives = 161/280 (58%), Gaps = 23/280 (8%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQI------VSHRAQVAeddddlssssfseilfdFPEHEA--------  866
             KRVTDPLDD+VKA+I      ++  A    + D LS    + +    P            
Sbjct  8     KRVTDPLDDKVKARIRGDDRFMTGYASSGSEHDALSGLVHAFLESGGPSSPTASAVAAAS  67

Query  865   --GDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
               G+ S S+       +  ++++ ++    GE  FR  L + VSEA E ++  L  S+S 
Sbjct  68    DDGEESDSEDGDRSVEAATKVKELLDPSGKGE-LFRLRLLAGVSEAAEAMAE-LRWSRSA  125

Query  691   EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN-RIQRYIVDLEF  515
                RR VM  LR+ GYNAG+CKA+WE S G+TAG +E+IDV+   ++   + RYIVD+ F
Sbjct  126   --YRRAVMVRLREGGYNAGICKARWESSGGLTAGSYEYIDVVVDAAEEVAVARYIVDVGF  183

Query  514   SSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQR  335
             ++EFE+AR T  +  ++ +LP+V V + EE++++V + ++A +RS + RG+H+PPWRK R
Sbjct  184   AAEFEVARATEEYGRMVAALPRVMVARPEEVRQVVLIAAEAVRRSLRRRGMHVPPWRKGR  243

Query  334   FMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
             +M  KW G YRR+ N  PA+             KCR+VGF
Sbjct  244   YMLAKWLGPYRRTVNLIPAAAGAAV--AGVGEAKCRAVGF  281



>ref|XP_008799562.1| PREDICTED: uncharacterized protein LOC103714174 [Phoenix dactylifera]
Length=308

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 133/204 (65%), Gaps = 5/204 (2%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            D FR  L S V  A E  +      K+    RR VMA LR  GYNAG+CKA+WE S G+T
Sbjct  110  DPFRARLVSDVLAAAEAFAGV---RKNGSAFRRAVMATLRVAGYNAGICKARWESSGGVT  166

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            AG +E+IDV+ + +   + RYIVD+EF++EFE+AR T  ++ ++ +LP+V V ++E +++
Sbjct  167  AGTYEYIDVVAAAAAGEV-RYIVDMEFAAEFEVARATKDYRRVLAALPRVAVARTEAVRQ  225

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
            +V+V++ AA+RS +S+GLH+PPWRK R+M  KW G YRR+ N  P+S            V
Sbjct  226  VVRVVADAARRSLRSQGLHVPPWRKSRYMLAKWLGPYRRTVNTLPSSAGARMAGGGGAEV  285

Query  235  KCRSVGFDDAVNRRLLFPVVTRTR  164
            KCR+VGF +A   RL+ P   RTR
Sbjct  286  KCRAVGFPEASAGRLV-PRAGRTR  308



>ref|XP_009410611.1| PREDICTED: uncharacterized protein LOC103992576 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 158/293 (54%), Gaps = 31/293 (11%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHE----AGDY-------  857
             KRVT PLDD  +A++       A       S            H+     G+Y       
Sbjct  8     KRVTGPLDDEARARLRGDDPGRAASCASSGSDHGGATCLSGLVHDFLETGGNYDTPSAAA  67

Query  856   --------------SGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLS  719
                            G D+D        E   E+       DSFR  LA+ VS A E L 
Sbjct  68    DDGGGGGSDRDDSVEGVDADEDRDRVAAETVCELMRAVAELDSFRVRLAADVSRATEGL-  126

Query  718   SCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL--RSDSQNR  545
             + L+SS    + RR VMA LR  GYNAG+CKA+WE S G+ AG+HE+IDV+  R +   +
Sbjct  127   AWLSSSCGASVFRRTVMAQLRAAGYNAGICKARWEASGGLAAGNHEYIDVVAARGNGHGQ  186

Query  544   IQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRG  365
              +RYIVDL F++EFE+AR T  ++ ++ ++P+V V   E ++++V+ ++ AA+RS +++G
Sbjct  187   GRRYIVDLGFAAEFEVARATEAYKGVVAAVPRVAVAGEEAVRQVVRAVADAARRSLRAQG  246

Query  364   LHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALA---VKCRSVGF  215
             LH+PPWRK R+M  KW G YRR+TN  PAS+   A     +    +KCR+VGF
Sbjct  247   LHVPPWRKSRYMLAKWLGPYRRTTNPLPASLVAAATAAATVPEGDIKCRAVGF  299



>ref|XP_006418642.1| hypothetical protein EUTSA_v10002988mg [Eutrema salsugineum]
 gb|ESQ37078.1| hypothetical protein EUTSA_v10002988mg [Eutrema salsugineum]
Length=282

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 106/281 (38%), Positives = 155/281 (55%), Gaps = 16/281 (6%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPPCN  824
             KRVTDPL++  KA+I  H       D D    S     F   +    D S   S     +
Sbjct  8     KRVTDPLEEDAKARIFHHHQSCTIPDQDSPPLSELVHSFLEEDGSPEDTSLQTSHNSDTD  67

Query  823   SDGELEDEVETINCG-----EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYL  659
              + E  DE E +         D +RN+L + V   VE  S  L S K+  +    V ++L
Sbjct  68    ENSECSDE-EIVRMAVSFSDSDPYRNLLLAHVLRTVEAYSG-LRSRKN-SVFVDKVASFL  124

Query  658   RDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ---RYIVDLEFSSEFEIARP  488
             ++ G++A VC +KW  S  + +G +EFIDV+   + +R     RY+VDL+F+S+FEIARP
Sbjct  125   QELGHDAAVCVSKWNSSAKLNSGSYEFIDVVYKPADDRTAVAVRYVVDLDFASKFEIARP  184

Query  487   TNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGS  308
             T  +  + + LP+VFVG+ E L+ +V+   +AA+RS KS GL +PPWR+  +++ KWFG 
Sbjct  185   TRQYTRVFQLLPRVFVGREESLRTVVRESCEAARRSLKSCGLSVPPWRRSSYLQQKWFGP  244

Query  307   YRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVNRRLLF  185
             Y+R      +S+ + A      AV CRS+GFDDAVN RL  
Sbjct  245   YKRRVG---SSLGVTAFSKD--AVSCRSMGFDDAVNARLFI  280



>ref|XP_003530848.2| PREDICTED: uncharacterized protein LOC100814756 [Glycine max]
Length=279

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 113/285 (40%), Positives = 156/285 (55%), Gaps = 35/285 (12%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVS--HRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLP  833
             MKRVTDP D + +A++V   HR   +    D  S S S ++  F E    D +  DSD  
Sbjct  1     MKRVTDPFDHQARARLVGTDHRQITSAAQGDSDSLSLSCLIHGFLEQ---DTTNDDSDSV  57

Query  832   PCNSDGELEDEVETI--------------NCGEDSFRNVLASRVSEAVELLSSCLNSSKS  695
               +SD +  D V+                +   D +RN+L + VSEA+E L+      ++
Sbjct  58    IHDSDWDPVDSVDDSPDSPSNSPSLSFLHSNNADPYRNLLIAHVSEALESLA--FLRERN  115

Query  694   PEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEF  515
               + RR V A+LR+  ++A VC+   + S     G HEFIDV+++ S     RY VDL+F
Sbjct  116   ASLFRRSVAAFLRERRHDAAVCETARDSS----GGSHEFIDVVQTGSAT--CRYFVDLDF  169

Query  514   SSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQR  335
              ++FEIARPT  F   + ++P VFVG +EELK+ V     AA+R F+SRGL +PPWRK R
Sbjct  170   RAQFEIARPTRRFSEALAAVPGVFVGGAEELKRTVSTACDAARRCFRSRGLPVPPWRKNR  229

Query  334   FMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAVN  200
             FM+NKWFG  RR+   R  SM           V CR VGFDD V+
Sbjct  230   FMQNKWFGPCRRTA--RDTSMGFNG------GVSCRVVGFDDVVS  266



>ref|XP_001781040.1| predicted protein [Physcomitrella patens]
 gb|EDQ54149.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   162 bits (410),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 116/175 (66%), Gaps = 0/175 (0%)
 Frame = -1

Query  817  GELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNA  638
            GEL + ++ + C  ++    L + V++A+ +         +   LRR VM YLR+ GY+A
Sbjct  55   GELSEILQNMVCSANATERTLLAEVNKAISMAKDVSVEDDATVCLRRRVMKYLRNGGYSA  114

Query  637  GVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRS  458
             +CK++W+ +     G +E+IDV+   +  + +R I+D++F ++FEIARP++ ++ +++ 
Sbjct  115  AICKSRWDNAGTFPGGVYEYIDVIFEGATGKSERIIIDIDFRTQFEIARPSSSYKAVVQV  174

Query  457  LPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            LP VF+GK+E L +IV ++S A K+S K+RG+HLPPWRK  +M  KWF SYRR+T
Sbjct  175  LPTVFIGKAERLLQIVNILSDAVKQSIKNRGMHLPPWRKPEYMRAKWFSSYRRTT  229



>ref|XP_009405539.1| PREDICTED: uncharacterized protein LOC103988661 [Musa acuminata 
subsp. malaccensis]
Length=298

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 135/225 (60%), Gaps = 26/225 (12%)
 Frame = -1

Query  826  NSDGELEDEVETINCGE---------DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRH  674
            +SDG  + E      GE         D FR  L S  S+A + +++  +S+      RR 
Sbjct  76   DSDGGDQSEKAAAAVGELVGGWRKSDDPFRLRLLSDASKAADAMATLRSSAFG---YRRA  132

Query  673  VMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL--------RSDSQNRIQRYIVDLE  518
            VMA LR+ GY+AG+CKA+WE S  +  G +E+IDV+        +   ++R  RYIVDL 
Sbjct  133  VMALLREMGYDAGICKARWESSGNLVHGSYEYIDVVVPAAAPAGKEGKEDR--RYIVDLG  190

Query  517  FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
            F++EF++AR T  ++ ++ +LP++ V + EE+K++V+++  A +RS KS+GLH+PPWRK 
Sbjct  191  FAAEFKVARATEAYENVVAALPEMMVAQPEEVKQVVRMVGDAGRRSLKSQGLHVPPWRKG  250

Query  337  RFMENKWFGSYRRSTNFRPASMELLAPLDQALA-VKCRSVGFDDA  206
            R++  KW G YRR+ N  PAS    AP     A  KCR+VGF  A
Sbjct  251  RYIMAKWLGPYRRTVNAVPASA---APSGAGGAEAKCRAVGFTAA  292



>gb|KGN58383.1| hypothetical protein Csa_3G634350 [Cucumis sativus]
Length=292

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 122/208 (59%), Gaps = 18/208 (9%)
 Frame = -1

Query  817  GELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNA  638
            GE+   V       + +R VL   V EA EL +    SS    + RR +M  LR+  YNA
Sbjct  77   GEIRRMVSVNGGNVEGYREVLVDNVLEAAELAAG---SSSDGVVSRRRLMLILRELHYNA  133

Query  637  GVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRS  458
             +CK KW  S G+ AGD+EF+D++     N   RY++D  F  +FEIAR T  ++ L++S
Sbjct  134  AICKTKWGSSSGVAAGDYEFVDII----VNGNIRYLIDTNFRGQFEIARATVQYKELLKS  189

Query  457  LPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNF---  287
            LP +F+G  EELKK+V++M  AAK S   R L +PPWRK+ +M+NKW G YRR+ N    
Sbjct  190  LPLIFIGTIEELKKMVRIMCDAAKVSLNHRNLLVPPWRKRIYMKNKWLGPYRRTINSVCD  249

Query  286  -RPASMELLAPLDQALA--VKCRSVGFD  212
              P ++     LD + +  VKCR +GFD
Sbjct  250  KSPTTI-----LDNSTSWPVKCRWIGFD  272



>ref|XP_009408763.1| PREDICTED: uncharacterized protein LOC103991129 [Musa acuminata 
subsp. malaccensis]
Length=311

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 124/198 (63%), Gaps = 2/198 (1%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            D FR  LA+ V   VE +S  L +      LRR VMA LR  GYNAG+CKA+ + S G+ 
Sbjct  104  DRFRVRLAADVYSVVEGVSG-LRTCCGAAGLRRAVMARLRASGYNAGICKARSDSSGGLK  162

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            AG +E+IDV+ + ++    RYIVDLEF++EFE+AR T  ++ ++ +LP+  V   E +++
Sbjct  163  AGSYEYIDVVSAAAEGAGMRYIVDLEFAAEFEVARATEAYKTVLAALPRAAVAGEETMRQ  222

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
            +V+V++ A +RS +++ LH+PPWRK ++M  KW G YRR+TN    +    +       +
Sbjct  223  VVRVVADAVQRSLRAQDLHIPPWRKSQYMIAKWLGPYRRNTN-TVPASPGSSVSSSGAEI  281

Query  235  KCRSVGFDDAVNRRLLFP  182
             CRSVGF  A  RR+  P
Sbjct  282  SCRSVGFTTAAWRRIPPP  299



>ref|XP_007140695.1| hypothetical protein PHAVU_008G134000g [Phaseolus vulgaris]
 gb|ESW12689.1| hypothetical protein PHAVU_008G134000g [Phaseolus vulgaris]
Length=289

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 149/282 (53%), Gaps = 32/282 (11%)
 Frame = -1

Query  1003  KRVTDPLDDRVKAQIVSH---RAQVAeddddlssssfseilfdFPEHEAGDYSGSDS--D  839
             KRVTDP DD+ +A++V                S S     L      E  D    DS  D
Sbjct  8     KRVTDPFDDQARARLVGADHCNFNSGTQSSGDSDSLSLSYLVHGFLEEDADKCREDSVFD  67

Query  838   LPPCNSDGELEDEVET----------INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPE  689
                C+     ED  ++          ++   D FR +L + VSEA E  S      ++P+
Sbjct  68    DSDCDRVDSTEDSGDSMSDSASVAISLSYNADPFRKLLIAHVSEAAEKFS--FLRERNPK  125

Query  688   ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
             + RR+V A+LRD  +NA VC    E +   + G HEFIDV++S +   + RY VDL+F +
Sbjct  126   LFRRNVAAFLRDKRHNAAVC----ETAPDASGGSHEFIDVVQSGAT--MWRYFVDLDFRA  179

Query  508   EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
             +FEIARPT  F  ++  +P VFVG +EELK+ V  +  A +RSFK++GL +PPWRK  FM
Sbjct  180   QFEIARPTRRFSDVLAVVPGVFVGCAEELKRTVSTLCDALRRSFKNKGLPVPPWRKNGFM  239

Query  328   ENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFDDAV  203
             +NKWFG  RR+ +  P  M +         V CR VGFDD V
Sbjct  240   QNKWFGPCRRTAD--PVRMSV-------NGVSCRLVGFDDTV  272



>ref|XP_008458966.1| PREDICTED: uncharacterized protein LOC103498221 [Cucumis melo]
Length=315

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 116/181 (64%), Gaps = 9/181 (5%)
 Frame = -1

Query  745  VSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL  566
            V+EA EL    L    S    +R +M +LR  GY +G+CK KWE+     AGD+E++DV 
Sbjct  98   VAEA-ELACRLLEEKPSSSGFKRKLMTHLRKNGYGSGLCKTKWEKFGQFPAGDYEYVDVT  156

Query  565  RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAK  386
               +     RYIV++    EFEIARPT+ +  L+++ P+++VGK EELKKIVKVM +A +
Sbjct  157  VDGN-----RYIVEVFLVGEFEIARPTSQYVSLLKAFPQIYVGKEEELKKIVKVMCRAMR  211

Query  385  RSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQA---LAVKCRSVGF  215
             S KS+ +H+PPWR+  +M+ KWFGSY+R+TN  P+   LL  L Q+    A K  S+GF
Sbjct  212  ESIKSKDMHIPPWRRNGYMQAKWFGSYKRTTNEVPSKAPLLLKLGQSQNPFAAKRSSLGF  271

Query  214  D  212
            +
Sbjct  272  E  272



>emb|CDM84922.1| unnamed protein product [Triticum aestivum]
Length=299

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 127/201 (63%), Gaps = 8/201 (4%)
 Frame = -1

Query  814  ELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAG  635
            E++D ++      D  R  L   V++A+  L   L  ++S    RR VM+ LR+ G++AG
Sbjct  92   EIKDNLDPTGSSADELRRRLVFAVADAMRGLDD-LRPNQS--AFRRAVMSRLRERGHDAG  148

Query  634  VCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSL  455
            +CK +W++S G+TAG +E+IDV+    + R   YIVD+ F++EFE+AR T  ++ +  +L
Sbjct  149  LCKVRWDKSSGVTAGSYEYIDVIAGGGETR---YIVDVGFAAEFEVARSTEEYEAVRTAL  205

Query  454  PKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS  275
            P+V + + E L+++VK+ + A++RS KS GL +PPWRK+RFM  KW G Y+R+ N  PAS
Sbjct  206  PEVLIARPEHLRQVVKLAASASRRSLKSSGLSVPPWRKRRFMMTKWLGPYKRTVNSIPAS  265

Query  274  MELLAPLDQALAVKCRS-VGF  215
                      +AV CR+ VGF
Sbjct  266  AGTALGGSGVVAV-CRTIVGF  285



>ref|XP_010514073.1| PREDICTED: uncharacterized protein LOC104790070 [Camelina sativa]
Length=271

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 149/283 (53%), Gaps = 27/283 (10%)
 Frame = -1

Query  1009  TMKRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSDLPP  830
             + KRVTDPLDD  KA+I+S    + + D             D   HE   Y  SDSDL  
Sbjct  6     STKRVTDPLDDEAKARILSSHGCILDHDSPRLCELVHGFFDDG--HEETLYDDSDSDLSE  63

Query  829   CNSDGELEDEVETI------NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVM  668
              NS  E     E I          D + N+L + VS A E  S   + +KS  + +  V 
Sbjct  64    -NSVVERSQASEEILKMAVTFSDSDPYWNLLLAHVSRAAEAYSGFRSRNKS--VFQNKVA  120

Query  667   AYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARP  488
             ++LRD  ++A VC +KW  S  +TAG ++FIDV+   +     RY V       FEIARP
Sbjct  121   SFLRDLSHDAAVCVSKWSSSAKLTAGSYDFIDVIYKPTA---VRYFV------MFEIARP  171

Query  487   TNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGS  308
             T  +  +++ LP VFVGK E L+ IV+    A KRS KSRGL LPPWR+  ++++KWFG 
Sbjct  172   TQEYTRVLQLLPNVFVGKEENLRTIVRESCDATKRSMKSRGLSLPPWRRSSYLQHKWFGP  231

Query  307   YRRSTNFRPASMELLAPLDQALAVKCRSVGFD--DAVNRRLLF  185
             Y+R    +  S   + PL    AV CRS+GFD   AVN RL  
Sbjct  232   YKR----KVGSGLGVKPLSND-AVSCRSLGFDHEGAVNARLFI  269



>ref|XP_004492292.1| PREDICTED: uncharacterized protein LOC101514428 [Cicer arietinum]
Length=299

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 117/193 (61%), Gaps = 9/193 (5%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSD--G  602
            D +RN+L   V+EA E  S      ++  I R+ V A+LR+ G++A VC   W+ S   G
Sbjct  100  DCYRNMLLEHVTEASENFS--FLKEQNVSIFRQSVAAFLREKGHDAAVCVTAWDISSVGG  157

Query  601  ITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEEL  422
             TA +HEFIDV++  S     RY VDLEF ++FEIARPT  F  ++ S+P VFVG  +EL
Sbjct  158  ATASNHEFIDVVKIGSAT--WRYFVDLEFRAQFEIARPTPQFSEVLSSVPDVFVGGEKEL  215

Query  421  KKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQAL  242
            K+ V ++  AAK+ F+SR L +PPWRK RFM+NKWF   RR+          +  ++   
Sbjct  216  KRTVLIVCDAAKKCFRSRALSIPPWRKNRFMQNKWFAPCRRTVYTVQGKPVRVTAVN---  272

Query  241  AVKCRSVGFDDAV  203
             V CR +GFDD V
Sbjct  273  GVSCRLLGFDDVV  285



>gb|ABR17293.1| unknown [Picea sitchensis]
Length=486

 Score =   162 bits (411),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LRR VM YLR  GYNAG+CK++WE   G  AG++E+IDV+        +R+ VD++F  +
Sbjct  249  LRRSVMNYLRGLGYNAGICKSRWEHIGGFPAGNYEYIDVIIDG-----ERFFVDIDFRVQ  303

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIARPT  F  L+R LP V+VGK+E LK+++K+M  ++K+S K  G+HLPPWRK R+++
Sbjct  304  FEIARPTTVFDALLRVLPNVYVGKAERLKQVIKIMCDSSKKSLKKMGMHLPPWRKYRYLQ  363

Query  325  NKWFGSYRRSTN  290
             KWFG Y+R++N
Sbjct  364  AKWFGPYKRTSN  375



>gb|EYU33859.1| hypothetical protein MIMGU_mgv1a011572mg [Erythranthe guttata]
Length=277

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/210 (42%), Positives = 129/210 (61%), Gaps = 13/210 (6%)
 Frame = -1

Query  877  EHEAGDYSGSDSDLPPCNSDGELEDEV-ETINCGEDSFRNVLASRVS----EAVELLSSC  713
            EH A D S  D+D      D E  D + + ++CG D+ R  + + V     E V    + 
Sbjct  30   EHSAADLSDLDTD--ENEIDFESRDLLKDLLDCGNDAVRGSIHAAVEKAYREVVGAGGAG  87

Query  712  LNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRY  533
             NSS SP+  RR +MA LR  G++AG+CK+KWE+     AGD+EF+DV+   +     RY
Sbjct  88   SNSSSSPDFKRR-LMARLRSRGFDAGLCKSKWEKIGRCPAGDYEFVDVIAGGT-----RY  141

Query  532  IVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLP  353
            IV +    EF IARP+  F  L+  LP VFVGK+EELK++V++M  A ++S +S G+H+P
Sbjct  142  IVQVLLDGEFTIARPSGGFASLLEILPPVFVGKTEELKQVVRLMCAAVRKSMRSAGIHVP  201

Query  352  PWRKQRFMENKWFGSYRRSTNFRPASMELL  263
            PWR+  +M+NKWF SY+R+TN  P+   L+
Sbjct  202  PWRRLAYMQNKWFASYKRTTNEIPSREALI  231



>ref|XP_008460403.1| PREDICTED: uncharacterized protein LOC103499228 [Cucumis melo]
Length=291

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 112/190 (59%), Gaps = 15/190 (8%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            + +R VL   V  A   L   ++        RR ++  LR+  YNA +CK KW  S G+T
Sbjct  94   EGYREVLVDNVRAAASSLEGVVS--------RRRLVLILRELHYNAAICKTKWGSSRGVT  145

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            AG++EF+DV+  +      RY++D  F ++FEIAR T  ++ L++SLP +F+G  EELKK
Sbjct  146  AGNYEFVDVVNGNI-----RYLIDTNFRAQFEIARATVQYKELLKSLPLIFIGTVEELKK  200

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQ--AL  242
            +V++M  AAK S   R L +PPWRK  +M+NKW G YRR+ N           LD   + 
Sbjct  201  MVRIMCDAAKVSLNHRNLSVPPWRKGIYMKNKWLGPYRRTINPIQEEKSPTTTLDNSTSW  260

Query  241  AVKCRSVGFD  212
            AVKCR +GFD
Sbjct  261  AVKCRWIGFD  270



>gb|KEH22542.1| DUF506 family protein [Medicago truncatula]
Length=289

 Score =   156 bits (395),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 116/191 (61%), Gaps = 9/191 (5%)
 Frame = -1

Query  772  SFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG-IT  596
            S++  L   V+EA E  +      ++  I RR V  +LR+ G++A VC  KWE  DG +T
Sbjct  93   SYKTTLLKHVTEASENFA--FFKERNASIFRRKVAEFLREEGHDAAVCVTKWEPYDGAVT  150

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
            AG HEFIDV+++ S     RY VDL+F ++FEI +PT  +  ++  +P VFVG   ELK+
Sbjct  151  AGSHEFIDVVQTRSATATWRYFVDLDFRAQFEIVKPTRRYSEVLNLVPGVFVGGEIELKR  210

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAV  236
             V ++  A KR FKS+   +PPWRK RFM+NKWFG  +R+ N  P   +   P+ +   V
Sbjct  211  TVSIVCDAVKRCFKSKEASIPPWRKNRFMQNKWFGPSKRTVN--PVQGK---PV-RVNGV  264

Query  235  KCRSVGFDDAV  203
             CR +GFDD V
Sbjct  265  SCRLLGFDDVV  275



>ref|XP_003594199.1| hypothetical protein MTR_2g025520 [Medicago truncatula]
 gb|ABN05810.1| Protein of unknown function DUF506, plant [Medicago truncatula]
 gb|AES64450.1| DUF506 family protein [Medicago truncatula]
Length=321

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 103/153 (67%), Gaps = 6/153 (4%)
 Frame = -1

Query  748  RVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV  569
            R+   VEL    L S   P   +R +M+ LR+ G++AG+CK KWE+   +TAGD+E+IDV
Sbjct  114  RIRREVELAIGLLGSDSFPG-FKRSLMSCLREKGFDAGLCKTKWEKKGKLTAGDYEYIDV  172

Query  568  LRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAA  389
              S      +RYI+++  ++EFEIARPTN +  L+   PK+FVGK EELK+IV++M  A 
Sbjct  173  NLSG-----KRYIIEVSLAAEFEIARPTNQYSSLLNIFPKIFVGKMEELKRIVRLMCSAI  227

Query  388  KRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
            K S K   LH+PPWR+  +M+ KWF SY+R+TN
Sbjct  228  KGSMKKMDLHIPPWRRNLYMQTKWFSSYKRTTN  260



>ref|XP_006302608.1| hypothetical protein CARUB_v10020728mg, partial [Capsella rubella]
 gb|EOA35506.1| hypothetical protein CARUB_v10020728mg, partial [Capsella rubella]
Length=295

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 131/218 (60%), Gaps = 13/218 (6%)
 Frame = -1

Query  880  PEHEAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSS  701
            PE E  + S  D+DL        L   +E ++ GE+  R V A  V+E  E+     ++ 
Sbjct  64   PEEE--ETSSDDNDLGDVKE--RLGKLLEGLSRGEERMRIVAA--VTEVAEMFVG--DNI  115

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
             SP   +R +MA+LR+ G++AG+CK++WERSD  TAG++E++DV + D  +   RYI++ 
Sbjct  116  SSP---KRQLMAFLRNKGFDAGLCKSRWERSDKYTAGEYEYVDV-QCDG-DHCNRYIIET  170

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
              + EFEIARPT  +  ++  +P+VFVG SEELK  V++M    +RS K  G+H+PPWR+
Sbjct  171  NLTGEFEIARPTKRYLAILNQVPRVFVGTSEELKHFVRIMCHEMRRSMKHVGIHVPPWRR  230

Query  340  QRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCR  227
              +M+ KWFG Y+R T+    + E++   D      C+
Sbjct  231  NGYMQAKWFGFYKRITSTTAINYEMVNSNDMTAFKGCK  268



>ref|XP_002458976.1| hypothetical protein SORBIDRAFT_03g043660 [Sorghum bicolor]
 gb|EES04096.1| hypothetical protein SORBIDRAFT_03g043660 [Sorghum bicolor]
Length=296

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 119/195 (61%), Gaps = 11/195 (6%)
 Frame = -1

Query  778  EDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGI  599
            ED FR  LA+ V+ A+E+ ++      S    RR V+  LR  GY+AGVCK++WE S GI
Sbjct  93   EDVFRIRLAAAVATAMEVEAALRAHGAS---FRRAVVRRLRGAGYDAGVCKSRWEASGGI  149

Query  598  TAGDHEFIDV---LRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPK-VFVGKS  431
            TAG +E++DV   L +D + R  RYIVD +F +  E+AR T  +  ++  +P    V + 
Sbjct  150  TAGTYEYVDVVAPLAADGRKR-ARYIVDADFRAGLEVARATPEYAAVVAEVPASAVVARE  208

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFR-PASMELLAPL  254
            E + + V+V S AA+RS ++ GLH+PPWRK R+M  KW G Y+RST    PA+     P+
Sbjct  209  ESVGRAVRVASDAARRSLRAHGLHVPPWRKTRYMLAKWLGPYKRSTATSLPAANAGAMPM  268

Query  253  --DQALAVKCRSVGF  215
                 + +KCR+VGF
Sbjct  269  TGGAGMDIKCRAVGF  283



>ref|XP_010040765.1| PREDICTED: uncharacterized protein LOC104429610 [Eucalyptus grandis]
Length=321

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 122/196 (62%), Gaps = 7/196 (4%)
 Frame = -1

Query  877  EHEAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSK  698
            E E  D+    SD    +  G LE EV   +   D  +  + + V  A E +     ++ 
Sbjct  71   ECEGNDFDDCWSDSDESSVRGTLE-EVFARDYNGDEVKAKIGAEVELAHEFIGRD-RANM  128

Query  697  SPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLE  518
            S +  +R +MA LRD G++AG+CK+KWE++  I AGD+ ++DV  +++     RYI ++ 
Sbjct  129  SSQDFKRRLMARLRDRGFDAGLCKSKWEKTGRIPAGDYHYVDVNVNNT-----RYIAEVS  183

Query  517  FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             + EFEIARPT+    L++S P +FVG+ EELK++V++MS A +RS K R L +PPWRK 
Sbjct  184  LAEEFEIARPTDRIASLLKSFPPIFVGQPEELKQVVRIMSTAIRRSLKKRDLLVPPWRKN  243

Query  337  RFMENKWFGSYRRSTN  290
             +M+NKWF SY+R+TN
Sbjct  244  GYMQNKWFASYKRTTN  259



>gb|KCW44943.1| hypothetical protein EUGRSUZ_L01464, partial [Eucalyptus grandis]
Length=337

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 122/196 (62%), Gaps = 7/196 (4%)
 Frame = -1

Query  877  EHEAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSK  698
            E E  D+    SD    +  G LE EV   +   D  +  + + V  A E +     ++ 
Sbjct  91   ECEGNDFDDCWSDSDESSVRGTLE-EVFARDYNGDEVKAKIGAEVELAHEFIGRD-RANM  148

Query  697  SPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLE  518
            S +  +R +MA LRD G++AG+CK+KWE++  I AGD+ ++DV  +++     RYI ++ 
Sbjct  149  SSQDFKRRLMARLRDRGFDAGLCKSKWEKTGRIPAGDYHYVDVNVNNT-----RYIAEVS  203

Query  517  FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             + EFEIARPT+    L++S P +FVG+ EELK++V++MS A +RS K R L +PPWRK 
Sbjct  204  LAEEFEIARPTDRIASLLKSFPPIFVGQPEELKQVVRIMSTAIRRSLKKRDLLVPPWRKN  263

Query  337  RFMENKWFGSYRRSTN  290
             +M+NKWF SY+R+TN
Sbjct  264  GYMQNKWFASYKRTTN  279



>ref|XP_010252609.1| PREDICTED: uncharacterized protein LOC104594140 [Nelumbo nucifera]
Length=313

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 114/184 (62%), Gaps = 7/184 (4%)
 Frame = -1

Query  826  NSDGELEDEVETI-NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDF  650
             SD E +D ++ +  C        +   + + VEL    L +  S E  +R +M  LR+ 
Sbjct  71   QSDTETKDILQGLLGCDSSDGDEQVKRTIRKEVELACRVLGTRPS-EGFKRQLMCRLRER  129

Query  649  GYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQY  470
            G +AG+CK++WE+     AGD+E+IDV+ + +     RYIV+   S EF IARPTN +  
Sbjct  130  GLDAGLCKSRWEKIGRFPAGDYEYIDVIFAGT-----RYIVEAALSGEFTIARPTNRYLS  184

Query  469  LIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
            L+   P +FVG+ +ELK++VK+M  AAK S KS  +H+PPWR+ R+M+ KWFGSY+R+TN
Sbjct  185  LLEVFPPIFVGEQDELKQVVKLMCAAAKESMKSNEMHVPPWRRSRYMQAKWFGSYKRTTN  244

Query  289  FRPA  278
              PA
Sbjct  245  AVPA  248



>ref|XP_010090963.1| hypothetical protein L484_013622 [Morus notabilis]
 gb|EXB41548.1| hypothetical protein L484_013622 [Morus notabilis]
Length=319

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 124/197 (63%), Gaps = 11/197 (6%)
 Frame = -1

Query  799  VETINCGEDSFRNVLASRVSEAVELLSSCLN-SSKSPEILRRHVMAYLRDFGYNAGVCKA  623
            +  +N G+D   +++  ++ + VE+    +    K  +  +R +M +LR+ G++AG+CK+
Sbjct  102  IGNVNDGDDD--HMIKRKIRDEVEVAYGTIGLVDKGSQGFKRRLMTHLREKGFDAGLCKS  159

Query  622  KWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVF  443
            KWE+S    AGD+E++DV       +  RYIV+     EFEIARPT+H+  L+   P++F
Sbjct  160  KWEKSKRFPAGDYEYVDV-----NVQGTRYIVEAFLVGEFEIARPTDHYASLLEIFPRIF  214

Query  442  VGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELL  263
            VGK  ELK+ V++M  A K+S KSR + +PPWR+  +M+ KWFG YRR+TN  P+     
Sbjct  215  VGKVAELKQTVRLMCTAIKQSMKSREMPMPPWRRNAYMQTKWFGPYRRTTNSLPSKNA--  272

Query  262  APLDQALAVKCRSVGFD  212
            + L++A   K RSVGF+
Sbjct  273  SKLNEAFDAK-RSVGFE  288



>gb|EMT13556.1| hypothetical protein F775_19134 [Aegilops tauschii]
Length=181

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 105/156 (67%), Gaps = 5/156 (3%)
 Frame = -1

Query  679  RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFE  500
            R VM+ LR+ G++AG+CK +W++S G+TAG +E+IDV+    + R   YIVD+ F++EFE
Sbjct  16   RAVMSRLRERGHDAGLCKVRWDKSSGVTAGSYEYIDVIAGGGETR---YIVDVGFAAEFE  72

Query  499  IARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENK  320
            +A  T  ++ +  +LP+V + + E L+++VK+ + AA+RS KS GL +PPWRK+RFM  K
Sbjct  73   VALSTEEYEAVRTALPEVLIARPEHLRQVVKLAASAARRSLKSSGLSVPPWRKRRFMMTK  132

Query  319  WFGSYRRSTNFRPASMELLAPLDQALAVKCRS-VGF  215
            W G Y+R+ N  PAS          + V CR+ VGF
Sbjct  133  WLGPYKRTVNSIPASAGTALGGSGVVPV-CRTIVGF  167



>ref|XP_009759363.1| PREDICTED: uncharacterized protein LOC104211916 [Nicotiana sylvestris]
Length=311

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -1

Query  829  CNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDF  650
            C  + E+++++  +   E++  + L   +S AVE +    N   SPE  +R +M  LRD 
Sbjct  79   CFDELEIKEKLMNLLGIEENSSDDLNKSISVAVENVLLEENDRSSPE-FKRRLMTRLRDR  137

Query  649  GYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQY  470
            G++AG+CK+KWE+S   T+G +E+ID+  +++     RYI+++  + EFEIARPT  +  
Sbjct  138  GFDAGLCKSKWEKSGNRTSGSYEYIDINMANN-----RYIIEISLAEEFEIARPTACYTS  192

Query  469  LIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
            L+   P++FVGK EELK+IVK+MS+A K+S K   +++PPWR+  +M+ KWFGSY+R+ N
Sbjct  193  LLEIYPQIFVGKIEELKQIVKIMSRAMKKSMKKMDIYVPPWRRLAYMQAKWFGSYKRTIN  252



>ref|XP_008227493.1| PREDICTED: uncharacterized protein LOC103327003 [Prunus mume]
Length=306

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 116/179 (65%), Gaps = 9/179 (5%)
 Frame = -1

Query  748  RVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV  569
            R+   VE+        +S    +R +MA+LRD G++AG+CK+KW +S    AG++EF+DV
Sbjct  106  RIFAEVEVAVGGAIGDRSSPGFKRKLMAHLRDKGFDAGLCKSKWVKSSRFPAGEYEFVDV  165

Query  568  LRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAA  389
                +     RYIV+  F  EFEIARPT+ ++ L+   P  FVG+ EELKKIV++M  A 
Sbjct  166  YVEGT-----RYIVEPFFVGEFEIARPTSQYEALLSVFPTTFVGQVEELKKIVRLMCTAI  220

Query  388  KRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
            K+S KS  + +PPWR+  +M++KWFGSY+R+TN  PA  EL    ++++ +K RS GF+
Sbjct  221  KKSMKSVDMPMPPWRRNGYMQSKWFGSYKRTTNAVPAK-EL--EHNESVGLK-RSTGFE  275



>ref|XP_004486208.1| PREDICTED: uncharacterized protein LOC101490516 [Cicer arietinum]
Length=314

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 110/166 (66%), Gaps = 7/166 (4%)
 Frame = -1

Query  709  NSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYI  530
            N S  P+  +R +M+ LRD G++AG+CK KW++   +TAGD+E+ID+  S+     +RYI
Sbjct  121  NDSSFPD-FKRWLMSRLRDKGFDAGLCKTKWDKKGKLTAGDYEYIDINLSE-----KRYI  174

Query  529  VDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPP  350
            V++  +SEFEIARPTN +  L+   P +FVGK E+LK++V++M  A K S K   LH+PP
Sbjct  175  VEVSLASEFEIARPTNQYSSLLNIFPMIFVGKVEDLKQVVRLMCTAIKGSMKKMDLHIPP  234

Query  349  WRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
            WR+  +++ KWF SY+R+TN  P + ++L+          R +GF+
Sbjct  235  WRRNLYVQTKWFSSYKRTTNAVP-TRKVLSHFSNESVFPKRLMGFE  279



>gb|AES92702.2| DUF506 family protein [Medicago truncatula]
 gb|KEH32654.1| DUF506 family protein [Medicago truncatula]
Length=284

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 118/210 (56%), Gaps = 5/210 (2%)
 Frame = -1

Query  820  DGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYN  641
            D E  D  E     ++ F + +  ++    EL    +   KS    +R VM+ LR+ G++
Sbjct  70   DFEWYDYEEKREILKEIFNDTVKEKIRREAELAIEVVGGDKSSPGFKRMVMSRLRERGFD  129

Query  640  AGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIR  461
            AG+CK+KWER+    +GD+E+IDV    +     RYIV+    +EFEIARPTN +  L+ 
Sbjct  130  AGLCKSKWERNRKFPSGDYEYIDVNYGGN-----RYIVETSLMAEFEIARPTNQYTSLLD  184

Query  460  SLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRP  281
              P VFVGK EELK++V++M  A K S K+  +H+PPWR+  +M+ KWF +Y+R+TN   
Sbjct  185  VFPLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKWFNTYKRTTNEVA  244

Query  280  ASMELLAPLDQALAVKCRSVGFDDAVNRRL  191
             +  +        A  C+ V +   +  R+
Sbjct  245  TNKSITFEARPLKAYNCKDVYYGSKIAVRV  274



>gb|KGN65077.1| hypothetical protein Csa_1G194720 [Cucumis sativus]
Length=312

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 114/188 (61%), Gaps = 14/188 (7%)
 Frame = -1

Query  766  RNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGD  587
            RN++A       EL    L    S    +R +M + R  G+ +G+CK KW++     AGD
Sbjct  95   RNIVAE-----AELACRLLEEKPSSSGFKRKLMTHFRKNGFASGLCKTKWDKFGQFPAGD  149

Query  586  HEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVK  407
            +E++DV+   +     RYIV++    EF+IARPT+ +  L+++ P+++VGK EELKKIVK
Sbjct  150  YEYVDVIVDGN-----RYIVEVFLVGEFDIARPTSQYVSLLKAFPQIYVGKEEELKKIVK  204

Query  406  VMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQ---ALAV  236
            VM +A + S KS+ +H+PPWR+  FM+ KWFGSY+R+TN  P     L  L Q     A 
Sbjct  205  VMCRAMRESIKSKDMHIPPWRRNGFMQAKWFGSYKRTTNEVPTKKPSLK-LGQNQNPFAA  263

Query  235  KCRSVGFD  212
            K  S+GF+
Sbjct  264  KRSSLGFE  271



>ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago truncatula]
Length=287

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 118/210 (56%), Gaps = 5/210 (2%)
 Frame = -1

Query  820  DGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYN  641
            D E  D  E     ++ F + +  ++    EL    +   KS    +R VM+ LR+ G++
Sbjct  73   DFEWYDYEEKREILKEIFNDTVKEKIRREAELAIEVVGGDKSSPGFKRMVMSRLRERGFD  132

Query  640  AGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIR  461
            AG+CK+KWER+    +GD+E+IDV    +     RYIV+    +EFEIARPTN +  L+ 
Sbjct  133  AGLCKSKWERNRKFPSGDYEYIDVNYGGN-----RYIVETSLMAEFEIARPTNQYTSLLD  187

Query  460  SLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRP  281
              P VFVGK EELK++V++M  A K S K+  +H+PPWR+  +M+ KWF +Y+R+TN   
Sbjct  188  VFPLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKWFNTYKRTTNEVA  247

Query  280  ASMELLAPLDQALAVKCRSVGFDDAVNRRL  191
             +  +        A  C+ V +   +  R+
Sbjct  248  TNKSITFEARPLKAYNCKDVYYGSKIAVRV  277



>ref|XP_010042775.1| PREDICTED: uncharacterized protein LOC104431954 [Eucalyptus grandis]
Length=319

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/207 (37%), Positives = 122/207 (59%), Gaps = 10/207 (5%)
 Frame = -1

Query  844  SDLPPCNSDGELEDEVETIN--CGEDSFRNVLASRVSEAVELLSSCLNSSK---SPEILR  680
            +D   C SD +     ET+      D + + +  ++   VEL    +   +   S    +
Sbjct  73   NDFDDCWSDSDESSTRETLEDIFVRDYYGDEVKVKIGAEVELACEFIGRGRVNMSSHDFK  132

Query  679  RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFE  500
            R +MA LRD G++AG+CK++WE++  + AGD+++IDV  +D+     RYI ++    EFE
Sbjct  133  RRLMARLRDRGFDAGLCKSRWEKTGRLPAGDYQYIDVNVNDT-----RYITEVSLEGEFE  187

Query  499  IARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENK  320
            IARPT     L++  P +FVG+ EELK++V++MS A ++S K R L +PPWRK  +M+NK
Sbjct  188  IARPTERITSLLKIFPAIFVGRPEELKQVVRIMSTAIRQSLKKRDLLVPPWRKNSYMQNK  247

Query  319  WFGSYRRSTNFRPASMELLAPLDQALA  239
            WF SY+R+TN    +  +  P D+ + 
Sbjct  248  WFSSYKRTTNRVSEASCMAKPQDRQIT  274



>ref|XP_009617385.1| PREDICTED: uncharacterized protein LOC104109739 [Nicotiana tomentosiformis]
Length=308

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 120/186 (65%), Gaps = 6/186 (3%)
 Frame = -1

Query  847  DSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVM  668
            + ++  C  + E+++ +  +   E++  + L   +S AVE +    N   SPE  +R +M
Sbjct  70   NGNVGNCFDELEIKENLRNLLGIEENSSDDLKRSISAAVENVLLEENDRISPE-FKRRLM  128

Query  667  AYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARP  488
              LR  G++AG+CK+KWE+S   T G +E+IDV  +++Q     YI+++  + EFEIARP
Sbjct  129  TRLRGRGFDAGLCKSKWEKSGNCTLGSYEYIDVNVANNQ-----YIIEVSLAGEFEIARP  183

Query  487  TNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGS  308
            T  +  L+   P++FVGK EELK++VK+MS+A K+S K   +++PPWR+  +M+ KWFGS
Sbjct  184  TACYTSLLEIFPQIFVGKIEELKQVVKIMSRAMKKSMKKMDIYVPPWRRLAYMQAKWFGS  243

Query  307  YRRSTN  290
            Y+R+ N
Sbjct  244  YKRTIN  249



>ref|XP_006839039.1| hypothetical protein AMTR_s00090p00038710 [Amborella trichopoda]
 gb|ERN01608.1| hypothetical protein AMTR_s00090p00038710 [Amborella trichopoda]
Length=244

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 136/259 (53%), Gaps = 40/259 (15%)
 Frame = -1

Query  1006  MKRVTDPLDDRVKAQIVSHRAQVAeddddlssssfseilfdFPEHEAGDYSGSDSD----  839
             +K+VTDPL++ VKAQ+     +                     EH+   Y G   D    
Sbjct  5     LKKVTDPLNELVKAQLFESGTESCSGS----------------EHDELFYDGLFVDDEKA  48

Query  838   -------------LPPCNSDGE-LEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSS  701
                          L     DGE ++  +E    G+    ++    +   VE L S   + 
Sbjct  49    GENMRGGKNFGFLLRGEEEDGESVKKTIEGFVLGKICSDDLFQRELILCVEKLESSRETC  108

Query  700   KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
              S     R +M  LRD GYNAG+C ++WER   + AGD+E+IDV+   S +   RYI+DL
Sbjct  109   SS----NRWLMKKLRDKGYNAGLCISRWERLGNLPAGDYEYIDVI--SSIDNTTRYIIDL  162

Query  520   EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
             +  S F+IARPT+HF  + + +P VFVGK + LK I+K++ +  KRS +++ +HLPPWR+
Sbjct  163   DLVSNFDIARPTSHFLGIRQLIPPVFVGKPQILKSIIKLLCEETKRSIRAQEMHLPPWRR  222

Query  340   QRFMENKWFGSYRRSTNFR  284
              R+++ KWFG +RR+ N +
Sbjct  223   YRYIQAKWFGPHRRTINHK  241



>ref|XP_008798832.1| PREDICTED: uncharacterized protein LOC103713613 [Phoenix dactylifera]
Length=298

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R VM++LR+ G++AG+CK+ WER+  + AG H+FIDV+         RYI++++  +EF
Sbjct  118  KRRVMSWLRERGFDAGLCKSSWERAKRVPAGHHDFIDVIAGGGT----RYILEIDLPAEF  173

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT+ +  L+  LP V+VG+ E LK IVK+M  AAK S +S G+H+PPWR+  +++ 
Sbjct  174  EIARPTSDYLTLLGPLPAVYVGRPEVLKGIVKLMCAAAKESMRSAGMHVPPWRRGGYVQM  233

Query  322  KWFGSYRRSTNFRPASME  269
            KWFGSY R+T+  P   E
Sbjct  234  KWFGSYTRTTSRIPVGRE  251



>ref|XP_001758005.1| predicted protein [Physcomitrella patens]
 gb|EDQ77247.1| predicted protein, partial [Physcomitrella patens]
Length=226

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 108/180 (60%), Gaps = 7/180 (4%)
 Frame = -1

Query  826  NSDGELEDEVETINCGEDSFRNVLASRVSEAV----ELLSSCLNSSKSPEILRRHVMAYL  659
            +S GEL + +  +    +    VL + V++A+    EL SS          LRR VM +L
Sbjct  50   SSLGELAELLTGLVSSTNVTERVLLAEVNKAMASARELTSS---EDDVTFCLRRQVMKHL  106

Query  658  RDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNH  479
            R  GYNA +CK++W+ +     GD+E+IDV+        +R I+D++F ++FEIARPT+ 
Sbjct  107  RTVGYNAAICKSRWDHAGSFPGGDYEYIDVVFESEIGNSERIIIDIDFRAQFEIARPTSC  166

Query  478  FQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            +  L+R LP VFVGK++ L ++V  MS A K S K R +HLPPWRK  +M  KWF  Y+R
Sbjct  167  YNALVRVLPTVFVGKADCLLQVVNFMSDAVKTSLKERDMHLPPWRKPAYMRAKWFAFYKR  226



>ref|XP_006352464.1| PREDICTED: uncharacterized protein LOC102605315 [Solanum tuberosum]
Length=303

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 117/183 (64%), Gaps = 14/183 (8%)
 Frame = -1

Query  829  CNSDGELEDEVETI-NCGEDSFRNVLASRVSEAVE--LLSSCLNSSKSPEILRRHVMAYL  659
            C  + E+++ +  + N G+D     L   V  AVE  LL+   N   SPE  +R +M  L
Sbjct  79   CFDESEIKENLRNLLNSGDD-----LKKSVINAVENVLLAEEANDRSSPE-FKRWLMTRL  132

Query  658  RDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNH  479
            RD G++AG+CK KWE++   T+G +E+ID+        + RYI+++  + EFEIAR T  
Sbjct  133  RDHGFDAGLCKLKWEKAGNRTSGSYEYIDI-----NVGVTRYIIEVSLAGEFEIARATPC  187

Query  478  FQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            +  L+ + P+VFVGK EELK++V++MS+A K+S K   +++ PWR+  +ME KWFGSY+R
Sbjct  188  YASLLENFPQVFVGKVEELKQVVRIMSRAMKQSMKKMDIYVAPWRRLAYMEAKWFGSYKR  247

Query  298  STN  290
            +TN
Sbjct  248  TTN  250



>emb|CDY31234.1| BnaC08g15290D [Brassica napus]
Length=294

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 94/131 (72%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +MAYLRD G++AG+CK+KWER    TAG +E++DV R D      R+IV+   +SEF
Sbjct  113  KRLLMAYLRDKGFDAGLCKSKWERFGKNTAGKYEYVDVNRGDKN----RFIVETNLASEF  168

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIA+PT  + YL+  LP+VF+G  EELKK+V++M    +RS K   +H+PPWR+  +M+ 
Sbjct  169  EIAKPTTRYLYLLAQLPRVFMGTPEELKKLVRIMCFEIRRSMKRAEIHVPPWRRNAYMQA  228

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  229  KWFGHYKRTSN  239



>ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago truncatula]
 gb|AES92705.1| DUF506 family protein [Medicago truncatula]
Length=305

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 120/208 (58%), Gaps = 8/208 (4%)
 Frame = -1

Query  814  ELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAG  635
            E +D ++ I  G+  F   +  ++   VEL    +   KS    +R +M+ LR+ G++AG
Sbjct  96   EKKDILKEIFGGDYDF---VKEKIRREVELAIQVVGGDKSSSGFKRIIMSRLRESGFDAG  152

Query  634  VCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSL  455
            +CK+KWER+    +GD+E+IDV    +     RYIV+    +EFEIARPTN +  L+   
Sbjct  153  LCKSKWERNRKFPSGDYEYIDVNYGGN-----RYIVETSLMAEFEIARPTNQYTSLLDVF  207

Query  454  PKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS  275
            P VFVGK EELK++V++M  A K S K+  +H+PPWR+  +M+ KWF +Y+R+TN    +
Sbjct  208  PLVFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKWFNTYKRTTNEVATN  267

Query  274  MELLAPLDQALAVKCRSVGFDDAVNRRL  191
              +        A  C+ V +   +  R+
Sbjct  268  KSITFEARPLKAYNCKDVYYGSKIAVRV  295



>ref|XP_006352465.1| PREDICTED: uncharacterized protein LOC102605651 [Solanum tuberosum]
Length=300

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 120/188 (64%), Gaps = 20/188 (11%)
 Frame = -1

Query  814  ELEDEVETINCGEDS-----FRNVLAS------RVSEAVE--LLSSCLNSSKSPEILRRH  674
            E++  V+T NC ++S      RN+L S       V  AVE  LL+   N   SPE  +R 
Sbjct  67   EIDGNVDT-NCFDESEIKENLRNLLNSGDDLKKSVINAVENALLAEETNDRSSPE-FKRW  124

Query  673  VMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIA  494
            +M  LR+ G++AG+CK KWE++   T+G +E+ID+        + RYI+++  + EFEIA
Sbjct  125  LMTQLRNHGFDAGLCKLKWEKAGNRTSGSYEYIDI-----NVGVTRYIIEVSLAGEFEIA  179

Query  493  RPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWF  314
            R T  +  L+ + P+VFVGK EELK++V++MS+A K+S K   +++ PWR+  +ME KWF
Sbjct  180  RATLCYASLLENFPRVFVGKVEELKQVVRIMSRAMKKSMKKMDIYVAPWRRLAYMEAKWF  239

Query  313  GSYRRSTN  290
            GSY+R+TN
Sbjct  240  GSYKRTTN  247



>gb|KHN40836.1| hypothetical protein glysoja_015203 [Glycine soja]
Length=312

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 112/159 (70%), Gaps = 9/159 (6%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +++ LR+ G++AG+CK+KWE++  +TAGD+E+IDV       + +RYIV++  + EF
Sbjct  126  KRRLISLLREKGFDAGLCKSKWEKNGRLTAGDYEYIDV-----NFKGKRYIVEISLAGEF  180

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT+ +  L+   P +FVGK EE+K++V++M  A K S K   LH+PPWR+  +M+ 
Sbjct  181  EIARPTDQYSSLLDVFPLIFVGKVEEMKQVVRLMCTAIKGSMKRMKLHIPPWRRNVYMQA  240

Query  322  KWFGSYRRSTNFRPASMELLAPL--DQALAVKCRSVGFD  212
            KWFG+Y+R+TN   A+  +  PL  D++L  K RS+GF+
Sbjct  241  KWFGAYKRTTN-AVATKRVSLPLSSDESLFPK-RSIGFE  277



>ref|XP_001763177.1| predicted protein [Physcomitrella patens]
 gb|EDQ72054.1| predicted protein, partial [Physcomitrella patens]
Length=232

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 109/175 (62%), Gaps = 1/175 (1%)
 Frame = -1

Query  817  GELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI-LRRHVMAYLRDFGYN  641
            GEL + +  +     +    LA+ V++A+ + +  +++       + R VM +LR  GYN
Sbjct  58   GELSEILLELVSNPSATERTLAAEVTKAITVANGVVSAEDGDSSNVNRQVMKHLRAAGYN  117

Query  640  AGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIR  461
            A +CK++W+ +     GD+E+IDVL      + +R I+D++F ++FEIARPT+ +  L++
Sbjct  118  AAICKSRWDHAGSFPGGDYEYIDVLFEGPTKKSERIIIDIDFRAQFEIARPTSSYNALVQ  177

Query  460  SLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRS  296
             LP VFVGK++ L ++V V+S A  +S K R +HLPPWR   +M  KWF SY+R+
Sbjct  178  VLPTVFVGKADILLQVVSVVSDAVNQSLKKRDMHLPPWRTVEYMRAKWFSSYKRT  232



>ref|XP_006586767.1| PREDICTED: uncharacterized protein LOC100811764 [Glycine max]
Length=336

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 112/159 (70%), Gaps = 9/159 (6%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +++ LR+ G++AG+CK+KWE++  +TAGD+E+IDV       + +RYIV++  + EF
Sbjct  150  KRRLISLLREKGFDAGLCKSKWEKNGRLTAGDYEYIDV-----NFKGKRYIVEISLAGEF  204

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT+ +  L+   P +FVGK EE+K++V++M  A K S K   LH+PPWR+  +M+ 
Sbjct  205  EIARPTDQYSSLLDVFPLIFVGKVEEMKQVVRLMCTAIKGSMKRMKLHIPPWRRNVYMQA  264

Query  322  KWFGSYRRSTNFRPASMELLAPL--DQALAVKCRSVGFD  212
            KWFG+Y+R+TN   A+  +  PL  D++L  K RS+GF+
Sbjct  265  KWFGAYKRTTN-AVATKRVSLPLSSDESLFPK-RSIGFE  301



>ref|XP_002967161.1| hypothetical protein SELMODRAFT_67158, partial [Selaginella moellendorffii]
 gb|EFJ31760.1| hypothetical protein SELMODRAFT_67158, partial [Selaginella moellendorffii]
Length=227

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 111/199 (56%), Gaps = 21/199 (11%)
 Frame = -1

Query  832  PCNSDGELEDEVETINCGE--DSFRNVLASRVSEAVELLSSCLNS-----SKSPEIL---  683
            PC+S G   DE  +   GE  D  +   A    E + LLS    +     +K+ EI    
Sbjct  30   PCSSKG---DERGSDLGGEVLDYLKGFTACSSEEELALLSDVTAAVTVVKNKAMEICNEG  86

Query  682  --------RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIV  527
                    +R  +  LR  G+NA +CK++W+   G   GD+E+IDVL   S  +++R IV
Sbjct  87   MDCASGCAKRATLRSLRSAGHNAAICKSRWDHGGGFPGGDYEYIDVLIERSDGKLERLIV  146

Query  526  DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
            D++F  +FEIARPT+ +  ++  LP +FVG +E L++IV +M    K S K RG+ LPPW
Sbjct  147  DIDFRGQFEIARPTDRYTAIVHELPAIFVGGAERLQQIVNLMCNGVKESLKKRGMPLPPW  206

Query  346  RKQRFMENKWFGSYRRSTN  290
            RK  +M  KW  +Y+R+TN
Sbjct  207  RKLEYMRAKWLSAYKRTTN  225



>emb|CDY30048.1| BnaC05g09720D [Brassica napus]
Length=295

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +RH+MAYLR+ GY+AG+CK++WER    TAG +E++DV   D      R+IV+   + EF
Sbjct  114  KRHLMAYLRNKGYDAGLCKSRWERFGNNTAGKYEYVDVNGGDKN----RFIVETNLAGEF  169

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT  +  L+  LP+VFVG  EELK++V++MS   +RS K   +H+PPWR+  +M+ 
Sbjct  170  EIARPTTRYISLLAQLPRVFVGTPEELKQLVRIMSLEIRRSMKRAKIHVPPWRRNGYMQA  229

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  230  KWFGHYKRTSN  240



>ref|NP_176432.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF70846.1|AC003113_13 F2401.16 [Arabidopsis thaliana]
 dbj|BAC42408.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43024.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33966.1| uncharacterized protein AT1G62420 [Arabidopsis thaliana]
Length=283

 Score =   145 bits (366),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 121/215 (56%), Gaps = 14/215 (7%)
 Frame = -1

Query  871  EAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
            E  + S  D++L   N    L   +E ++CGE+  R  + S   E        ++SSK  
Sbjct  56   EEEETSSDDNNLEDVNE--RLRKLLEGLSCGEERMR--ILSATMEVAGTFVGDISSSK--  109

Query  691  EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFS  512
                RH+MA+LR+ G++AG+CK+ WER    T G +E++DV      N   RY V+   +
Sbjct  110  ----RHLMAFLRNKGFDAGLCKSSWERFGKNTGGKYEYVDVRCGGDYN--NRYFVETNLA  163

Query  511  SEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRF  332
             EFEIARPT  +  ++  +P+VFVG SEELK +V++M    +RS K  G+H+PPWR+  +
Sbjct  164  GEFEIARPTKRYLSILSQVPRVFVGTSEELKLLVRIMCHEMRRSMKHVGIHVPPWRRNGY  223

Query  331  MENKWFGSYRRSTNFRPASMELLAPLDQALAVKCR  227
            M+ KWFG Y+R++     + E++   D      C+
Sbjct  224  MQAKWFGFYKRTST--TNNYEMVNTYDTTAFKGCK  256



>emb|CDY21027.1| BnaA08g24980D [Brassica napus]
Length=295

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 93/131 (71%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +MAYLRD G++AG+CK+KWER    TAG +E++DV R D      R+IV+   +SEF
Sbjct  113  KRLLMAYLRDKGFDAGLCKSKWERFGKNTAGKYEYVDVNRGDKN----RFIVETNLASEF  168

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIA+PT  +  L+  LP+VFVG  EELKK+V++M    +RS K   +H+PPWR+  +M+ 
Sbjct  169  EIAKPTTRYLSLLAQLPRVFVGTPEELKKLVRIMCFEIRRSMKRAEIHVPPWRRNAYMQA  228

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  229  KWFGHYKRTSN  239



>ref|XP_007147662.1| hypothetical protein PHAVU_006G143800g [Phaseolus vulgaris]
 gb|ESW19656.1| hypothetical protein PHAVU_006G143800g [Phaseolus vulgaris]
Length=329

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 106/157 (68%), Gaps = 6/157 (4%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +RH+M+ +R+ G++AG+CK KWE++  +TAG++E+IDV       + +RY+V++  + EF
Sbjct  143  KRHLMSQMREKGFDAGLCKTKWEKNGRLTAGNYEYIDV-----NLKGKRYVVEICLALEF  197

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPTN +  L+   P +FVGK +ELK++V++M  A K S K   LH+PPWR+  +M+ 
Sbjct  198  EIARPTNQYCDLLNVFPLIFVGKVDELKQVVRLMCTAIKGSMKRMNLHIPPWRRNVYMQA  257

Query  322  KWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
            KWF +Y+R+TN   A+    +PL        RS+GF+
Sbjct  258  KWFSAYKRTTN-AVATKRASSPLSSESLFPNRSIGFE  293



>ref|XP_004295306.1| PREDICTED: uncharacterized protein LOC101309232 [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 127/207 (61%), Gaps = 15/207 (7%)
 Frame = -1

Query  823  SDGELEDEVETI---NCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRD  653
            SD E ++ ++ +   N G D  +  + + V  A  ++   L+        +R +  +LR 
Sbjct  85   SDSETKNTLQQLLHTNGGGDDVKENIVAEVEHACGVIGDRLDRE-----FKRKLTTHLRH  139

Query  652  FGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQ  473
             G++AG+CK+KW +S    AGD+EF+DV  + +     RYIV+  F+ EFEIARPT+ + 
Sbjct  140  KGFDAGLCKSKWVKSSRFPAGDYEFVDVNVNGT-----RYIVEPFFTGEFEIARPTSRYT  194

Query  472  YLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
             L   LP++FVG+ +ELKKIV++M  A K+S KS  + +PPWR+  +M  KWFGSY+R+T
Sbjct  195  SLHNVLPQIFVGELDELKKIVRIMCAAIKKSMKSVDMPMPPWRRNGYMLAKWFGSYKRTT  254

Query  292  NFRPASMELLAPLDQALAVKCRSVGFD  212
            N   +S +     +++ +VK RSVGF+
Sbjct  255  NAVSSSTKAF-EFEESFSVK-RSVGFE  279



>ref|XP_010270077.1| PREDICTED: uncharacterized protein LOC104606524 [Nelumbo nucifera]
Length=305

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 114/178 (64%), Gaps = 8/178 (4%)
 Frame = -1

Query  823  SDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGY  644
            SD E  + ++++  G DS   V  + + E  +  +S ++ ++  E  +R +M  LR+ G 
Sbjct  77   SDSETRETLQSL-LGCDSSDEVKRTVIKEVEQ--ASRISGTRPSEGFKRQLMGRLRERGL  133

Query  643  NAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLI  464
            +AG+CK++WE+     AGD+E+IDV+ S +     RYIV++  S EF IARPTN +  L+
Sbjct  134  DAGLCKSRWEKIGRFPAGDYEYIDVIVSGT-----RYIVEVALSGEFTIARPTNRYLSLL  188

Query  463  RSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
               P VFVG+ EELK ++K+MS AAK S KS  + +PPWR+  +M+ KWF SY+R+TN
Sbjct  189  EVFPPVFVGRQEELKHVMKIMSTAAKESMKSNDMCIPPWRRSGYMKAKWFSSYKRTTN  246



>ref|XP_009110678.1| PREDICTED: uncharacterized protein LOC103836193 [Brassica rapa]
Length=314

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +MAYLRD G++AG+CK+KWER    TAG +E++DV R D      R+IV+   +SEF
Sbjct  132  KRLLMAYLRDKGFDAGLCKSKWERFGKNTAGKYEYVDVNRGDKN----RFIVETNLASEF  187

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIA+PT  +  L+  LP+VFVG  EELKK V++M    +RS K   +H+PPWR+  +M+ 
Sbjct  188  EIAKPTTRYLSLLAQLPRVFVGTPEELKKFVRIMCFEIRRSMKRAEIHVPPWRRNAYMQA  247

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  248  KWFGHYKRTSN  258



>gb|EYU40926.1| hypothetical protein MIMGU_mgv1a024946mg, partial [Erythranthe 
guttata]
Length=275

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R +MA LR  G++AG+CK++WE+S    AGD+E+IDV+   +     RYIV +    E
Sbjct  123  FKRQLMARLRSRGFDAGLCKSRWEKSGRCLAGDYEYIDVIAGGT-----RYIVQVLLDGE  177

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F IARP   +  L+  LP VFVGK EELK++V++M  A ++S    G+HLPPWR+  +++
Sbjct  178  FTIARPCGGYASLLEILPPVFVGKPEELKQVVRLMCTAVRKSMTIAGIHLPPWRRHDYIQ  237

Query  325  NKWFGSYRRSTN  290
            NKWFGSY+R+TN
Sbjct  238  NKWFGSYKRTTN  249



>ref|XP_007036591.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY21092.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=315

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 129/227 (57%), Gaps = 30/227 (13%)
 Frame = -1

Query  826  NSDGELEDEVETINCG----------EDSFRNVLASRVSEAVE--------LLSSCLNSS  701
            N +G++E E E  N G          +D  R ++ + + +  E        LL + L   
Sbjct  59   NDEGKIEQEKENENDGTEAIWSDSETKDMLRRLMVNNICDGNEDDEVKQKILLQTKLACG  118

Query  700  KSPEI----LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRY  533
               ++     +R +M+ LRD G++AG+CK++WE+ +   AG +E++DV  + +     RY
Sbjct  119  SIGDMSSVGFKRQLMSRLRDKGFDAGLCKSRWEKLERHPAGSYEYVDVNVTGT-----RY  173

Query  532  IVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLP  353
            I+++  ++EFEIARPT ++  LI   P++FVGK EELK+IV +M +A + S KS+G+ +P
Sbjct  174  IIEVNLAAEFEIARPTTNYTSLIDVFPRIFVGKPEELKQIVGLMCRAMRESMKSKGMKVP  233

Query  352  PWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
            PWR+ R+++ KWF  Y+R+TN   A     A          RSVGF+
Sbjct  234  PWRQNRYVQAKWFAQYKRTTNEISAKK---ASQKNDAVTTTRSVGFE  277



>ref|XP_002960853.1| hypothetical protein SELMODRAFT_437313 [Selaginella moellendorffii]
 gb|EFJ38392.1| hypothetical protein SELMODRAFT_437313 [Selaginella moellendorffii]
Length=455

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 112/202 (55%), Gaps = 21/202 (10%)
 Frame = -1

Query  832  PCNSDGELEDEVETINCGE--DSFRNVLASRVSEAVELLSSCLNS-----SKSPEIL---  683
            PC+S G   DE  +   GE  D  +   A    E + LLS    +     +K+ EI    
Sbjct  116  PCSSKG---DERGSDLGGEVLDYLKGFTACSSEEELALLSDVTAAVTVVKNKAIEICNEG  172

Query  682  --------RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIV  527
                    +R  +  LR  G+NA +CK++W+   G   GD+E+IDVL   S  +++R IV
Sbjct  173  MDCASGCAKRATLRSLRSAGHNAAICKSRWDHGGGFPGGDYEYIDVLIERSDGKLERLIV  232

Query  526  DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
            D++F  +FEIARPT+ +  ++  LP +FVG +E L++IV +M    K S K RG+ LPPW
Sbjct  233  DIDFRGQFEIARPTDRYTAIVHELPAIFVGGAERLQQIVNLMCNGVKESLKKRGMPLPPW  292

Query  346  RKQRFMENKWFGSYRRSTNFRP  281
            RK  +M  KW  +Y+R+TN  P
Sbjct  293  RKPEYMRAKWLSAYKRTTNESP  314



>ref|XP_011086229.1| PREDICTED: uncharacterized protein LOC105168020 [Sesamum indicum]
Length=300

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 109/166 (66%), Gaps = 8/166 (5%)
 Frame = -1

Query  775  DSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGIT  596
            D+F+  + + V +A   +      S SP+  RR +MA LR  G++AG+CK+KWE+S    
Sbjct  95   DAFKRSVHAEVEKAYGEIGG--GKSSSPDFNRR-LMARLRTAGFDAGLCKSKWEKSGRCP  151

Query  595  AGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKK  416
             G++E+IDV    +     RYI+++  + EF IARPT  +  L+   P++FVGK ++LK+
Sbjct  152  PGNYEYIDVNTGGT-----RYIIEIHLAGEFTIARPTGGYASLLEDFPQIFVGKPDDLKQ  206

Query  415  IVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPA  278
            +V++M +A K S KS G+H+PPWR+  +M++KWFG Y+R+TN  P+
Sbjct  207  VVRIMCRAIKSSMKSVGIHVPPWRRPAYMQSKWFGYYKRTTNEIPS  252



>ref|XP_004250255.1| PREDICTED: uncharacterized protein LOC101253249 [Solanum lycopersicum]
Length=297

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 117/189 (62%), Gaps = 21/189 (11%)
 Frame = -1

Query  814  ELEDEVETINCGEDS-----FRNVLASRVSEAVELLSSCLNS---------SKSPEILRR  677
            E++  VET NC ++S      RN+L    +   +L  + +N+         + SPE  +R
Sbjct  63   EIDGNVET-NCFDESEIKENLRNLLDPDGNSGDDLKKNVINAVENALLAEEASSPE-FKR  120

Query  676  HVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEI  497
             +M  LRD G++AG+CK KWE++   T+G +E+IDV        + RYI+++    EFEI
Sbjct  121  WLMTRLRDQGFDAGLCKLKWEKAVNRTSGSYEYIDV-----NIGVTRYIIEVSLVEEFEI  175

Query  496  ARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKW  317
            AR T  +  L+ + P VFVGK EELK++V++MS+A KRS K   +++ PWR+  +ME KW
Sbjct  176  ARATPCYTSLLENFPHVFVGKVEELKQVVRIMSRAMKRSMKKMNIYVAPWRRLAYMEAKW  235

Query  316  FGSYRRSTN  290
            FGSY+R+TN
Sbjct  236  FGSYKRTTN  244



>emb|CDP04473.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/234 (37%), Positives = 126/234 (54%), Gaps = 22/234 (9%)
 Frame = -1

Query  877  EHEAGDYSGSDSDLPPCNSDGELEDEVETINCGE----DSFRNVLASRVSE-------AV  731
            E E GD  G D      N   E  DE    NC +    DS + +L  +V E       AV
Sbjct  50   EEELGDPRGIDQR----NDGAEDSDESSERNCSDSDIKDSLKRLLNCQVDEVKRQIHTAV  105

Query  730  ELLS-SCLNSSKSPEI-LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSD  557
            E  S   + +  S  +  +R +M  LRD G +AG CK+KWE+     +GD+E+IDV    
Sbjct  106  EKASREVVGAHGSSTVDFKRRLMVRLRDRGLDAGFCKSKWEKVGHCPSGDYEYIDVYVGG  165

Query  556  SQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSF  377
            +     RY V++  + EF IA+PT  +  L+   P++FVGK +ELK++ ++M  A K+S 
Sbjct  166  T-----RYFVEVALAKEFAIAKPTGRYTCLLNIFPQIFVGKEDELKQVTRLMCSAIKKSM  220

Query  376  KSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
            K   +HLPPWR+  +M+ KWFGSY+R+TN    + +     +  L  + RSVGF
Sbjct  221  KKIDIHLPPWRRLGYMQAKWFGSYKRTTNELSPAQKAFDSDEDDLRRRKRSVGF  274



>ref|XP_003547277.1| PREDICTED: uncharacterized protein LOC100807096 [Glycine max]
 gb|KHN32974.1| hypothetical protein glysoja_009965 [Glycine soja]
Length=312

 Score =   142 bits (359),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 119/180 (66%), Gaps = 15/180 (8%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +M+ LR+ G++AG+CK+KWE++  +TAGD+E+IDV       + +RYIV++  + +F
Sbjct  126  KRRLMSLLREKGFDAGLCKSKWEKNGRLTAGDYEYIDV-----NFKGKRYIVEVSLAGKF  180

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT+ +  L+   P +FVGK EE+K++ ++M  A K S K   LH+PPWR+  +M+ 
Sbjct  181  EIARPTDQYSSLLDVFPLIFVGKVEEMKQVARLMCTALKGSMKRMNLHIPPWRRNMYMQA  240

Query  322  KWFGSYRRSTN---FRPASMELLAPLDQALAVKCRSVGFD----DAVNRRLLFPVVTRTR  164
            KWF +Y+R+TN    + AS+ L +  D++L  K RS+GF+     A N R ++  +T  R
Sbjct  241  KWFSAYKRTTNAVATKRASLPLSS--DESLFPK-RSMGFEVRPVKAHNCRDVYATITGFR  297



>ref|XP_010430296.1| PREDICTED: uncharacterized protein LOC104714581 [Camelina sativa]
Length=289

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R +MA+LR+ G++AG+CK++WERS   TAG +E++DV R D  +   RYIV+   + EF
Sbjct  114  KRQLMAFLRNKGFDAGLCKSRWERSGKYTAGKYEYVDV-RCDG-DHCNRYIVETNLAGEF  171

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT  +  ++  +P+VFVG SEELK +V++M    +RS K  G+H+PPWR+  +M+ 
Sbjct  172  EIARPTKRYLSILSQVPRVFVGTSEELKYLVRIMCHEMRRSMKHVGIHVPPWRRNGYMQA  231

Query  322  KWFGSYRRSTNFRPASMELLAPLDQALAVKCR  227
            KWF  Y+R T+    + E++   D A    C+
Sbjct  232  KWFSLYKR-TSTTATNYEMVDSNDTAAFKGCK  262



>ref|XP_010038726.1| PREDICTED: uncharacterized protein LOC104427313 [Eucalyptus grandis]
 ref|XP_010038733.1| PREDICTED: uncharacterized protein LOC104427313 [Eucalyptus grandis]
 gb|KCW84655.1| hypothetical protein EUGRSUZ_B01479 [Eucalyptus grandis]
Length=392

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 112/173 (65%), Gaps = 13/173 (8%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            + C     RN+LA  +R+ E  + +S C + S     + + V   L   GY+A VCK++W
Sbjct  148  VMCATLCERNLLADSARIVEK-QKMSKCEDES-----VLKIVSDELLALGYDACVCKSRW  201

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVG  437
            E+S    AG++E+IDV+      + +R IVD++F SEFEIARPT  ++ ++ +LP +FVG
Sbjct  202  EKSASFPAGEYEYIDVI-----IKGERLIVDIDFRSEFEIARPTKTYKSVLHALPNIFVG  256

Query  436  KSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPA  278
            K E L KI+ ++S+AAK+S KSRG+H+PPWRK  ++E KWF  + RST   P+
Sbjct  257  KPERLGKIIAIVSEAAKQSLKSRGMHIPPWRKAEYIEAKWFAPHARSTLPTPS  309



>ref|XP_001751444.1| predicted protein [Physcomitrella patens]
 gb|EDQ83761.1| predicted protein [Physcomitrella patens]
Length=222

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 2/131 (2%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRS--DSQNRIQRYIVDLEFS  512
            LR  VM +LR  GYNAG+CK+KW+   GI   D+E++DV+     +    +R I+D++F 
Sbjct  91   LRHQVMKHLRRAGYNAGICKSKWDYLGGIPGCDYEYVDVIYEGPSTGEDGERIIIDIDFK  150

Query  511  SEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRF  332
            ++FEIARPT  +  L+R LP VFVGK ++L  I+ +M  A K S K RG+HLPPWRK  +
Sbjct  151  AQFEIARPTAGYDALVRVLPSVFVGKVDQLDWIINLMCDAVKLSLKKRGMHLPPWRKPEY  210

Query  331  MENKWFGSYRR  299
            M  KWF  ++R
Sbjct  211  MRAKWFSDHKR  221



>gb|KFK40602.1| hypothetical protein AALP_AA2G016900 [Arabis alpina]
Length=286

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 120/193 (62%), Gaps = 19/193 (10%)
 Frame = -1

Query  856  SGSDSDLPPCNSDGELEDE-------VETINCGEDSFRNVLASRVSEAVELLSSCLNSSK  698
            +G + ++  C SD +LED        +E +  GE+  R + A+   +A + +    NSS 
Sbjct  62   NGMEEEMDSC-SDNDLEDVKERLRKLLEGLYGGEERMRIMAAT--EDAEKFVGD--NSST  116

Query  697  SPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLE  518
                 +R +MA+LR+ G++AG+CK++WER    TAG +E++DV R D     +RYIV+  
Sbjct  117  -----KRQLMAFLRNKGFDAGLCKSRWERFGKNTAGKYEYVDV-RCDGGEH-KRYIVETN  169

Query  517  FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             S EFEIARPT  +  ++  +P+VFVG  EELK++V++M    +RS K  G+H+PPWR+ 
Sbjct  170  LSGEFEIARPTKRYVSILNQVPRVFVGTPEELKQLVRIMCCEMRRSMKQVGIHVPPWRRN  229

Query  337  RFMENKWFGSYRR  299
             +M+ KWFG Y+R
Sbjct  230  GYMQAKWFGFYKR  242



>ref|XP_007211670.1| hypothetical protein PRUPE_ppa009086mg [Prunus persica]
 gb|EMJ12869.1| hypothetical protein PRUPE_ppa009086mg [Prunus persica]
Length=307

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 130/235 (55%), Gaps = 24/235 (10%)
 Frame = -1

Query  871  EAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLAS---------------RVSE  737
            E GD+ G        N+  +L +E       +   +N L S               R+  
Sbjct  51   ERGDFRGEGDAREDINNKEQLMEEESEGYWSDSETKNTLQSLLDKSDEDDDDDVKQRIFA  110

Query  736  AVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSD  557
             VE+        +S    +R +MA+LR+ G++AG+CK+KW +S    AG++EF+DV    
Sbjct  111  EVEVAVGGAIGDRSSPGFKRKLMAHLREKGFDAGLCKSKWVKSSRFPAGEYEFVDVYVKG  170

Query  556  SQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSF  377
            +     RYIV+  F  EFEIARPT+ ++ L+   P  FV + EELKKIV++M  A K+S 
Sbjct  171  T-----RYIVEPFFVGEFEIARPTSQYEALLSVFPTTFVVQVEELKKIVRLMCTAIKKSM  225

Query  376  KSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
            KS  + +PPWR+  +M++KW GSY+R+TN  PA  EL    ++++ +K RS GF+
Sbjct  226  KSVDMPMPPWRRNGYMQSKWLGSYKRTTNAVPAK-EL--EHNESVGLK-RSTGFE  276



>gb|ABK25349.1| unknown [Picea sitchensis]
Length=427

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 98/136 (72%), Gaps = 2/136 (1%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            RR VM  LR  GYN+ VC ++WE++ G  AG +EFIDV+   S  + +R+ VD++F ++F
Sbjct  195  RRVVMNSLRFAGYNSAVCNSRWEKTIGHPAGYYEFIDVVLERSNLKSERFFVDIDFRAQF  254

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT+ +  ++  LP +FVG++++L  I+K+M  AA+ S K RG+ +PPWRK R+++ 
Sbjct  255  EIARPTDEYNNMLMQLPNLFVGRADKLCGIIKIMCDAARISLKERGMCIPPWRKYRYVQA  314

Query  322  KWFGSYRRSTNFRPAS  275
            KW GSY+R+T  +PA+
Sbjct  315  KWLGSYKRAT--KPAA  328



>ref|XP_008440059.1| PREDICTED: uncharacterized protein LOC103484651 [Cucumis melo]
Length=285

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 97/143 (68%), Gaps = 5/143 (3%)
 Frame = -1

Query  712  LNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRY  533
            L   +S   + R +MA+LR  G++AG+CK+K E+     AGDHE+IDV    +     RY
Sbjct  98   LVGGRSVPGINRQLMAHLRRKGFDAGLCKSKMEKLRAFPAGDHEYIDVNFGGN-----RY  152

Query  532  IVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLP  353
            IV++  + EFEIARPT+ +  L+ + P++FVG  +ELK++VK+M  A K S K R +H+P
Sbjct  153  IVEIFLAREFEIARPTSKYVSLLNTFPEIFVGTLDELKQVVKLMCSAMKESMKKRNMHIP  212

Query  352  PWRKQRFMENKWFGSYRRSTNFR  284
            PWR+  +M+ KWFGSY+R+TN +
Sbjct  213  PWRRNGYMQAKWFGSYKRTTNHK  235



>ref|XP_001776493.1| predicted protein [Physcomitrella patens]
 gb|EDQ58760.1| predicted protein [Physcomitrella patens]
Length=234

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 114/201 (57%), Gaps = 23/201 (11%)
 Frame = -1

Query  829  CNSDGE--LEDEVETINCGED---SFRNVLA-------SRVSEAVELLSSCLNSS-----  701
            CN DG   LEDE+   + G +   + +N++        S + E + +L +    +     
Sbjct  34   CNGDGHACLEDEIAKASLGNELSEALQNLVPCDNEQERSLLGEVIYMLDALTGDTITDGK  93

Query  700  ------KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ  539
                   S    RR V+ YLR  GYNA +CK++W+ +     GD+E+IDV+ +       
Sbjct  94   GEKEDCASNVCRRRSVVKYLRSSGYNAALCKSRWDHAGIFPGGDYEYIDVVFTGLDESAA  153

Query  538  RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLH  359
            R IVD++F  +FEIARPT  ++ + + LP VFVG +  L +I+ V+S+A KRS K +G+ 
Sbjct  154  RVIVDIDFQDQFEIARPTAQYKNVYQMLPAVFVGTANRLLQILNVISEAVKRSLKKKGMF  213

Query  358  LPPWRKQRFMENKWFGSYRRS  296
            LPPWRK  +++ KWF SY+R+
Sbjct  214  LPPWRKPEYVKAKWFASYKRT  234



>emb|CDY53353.1| BnaA06g38280D [Brassica napus]
Length=293

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R++MAYLR  G++AG+CK++WER    TAG +E++DV   D      R+IV+   + EF
Sbjct  115  KRYLMAYLRKKGFDAGLCKSRWERFGKNTAGKYEYVDVNEGDKN----RFIVETNLAGEF  170

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT  +  L+  LP+VFVG  EELK++V++MS   +RS K   +H+PPWR+  +M+ 
Sbjct  171  EIARPTTRYISLLSQLPRVFVGTPEELKQLVRIMSFEVRRSMKRAEIHVPPWRRNGYMQA  230

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  231  KWFGHYKRTSN  241



>ref|XP_006305473.1| hypothetical protein CARUB_v10009904mg [Capsella rubella]
 gb|EOA38371.1| hypothetical protein CARUB_v10009904mg [Capsella rubella]
Length=291

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = -1

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++   +N+S+     +RH++AYLR  G++AG+CK++WE+    TAG +E++DV+  D + 
Sbjct  95   IVDEAVNASRFVVGEKRHLVAYLRGKGFDAGLCKSRWEKFGKNTAGKYEYVDVIAGDKK-  153

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
               RYIV+   + EFEIARPT  +  L+  LP+VFVG  EELK++V++M    +RS K  
Sbjct  154  ---RYIVETNLAGEFEIARPTTRYLSLLAQLPRVFVGTPEELKQLVRIMCFEMRRSMKRA  210

Query  367  GLHLPPWRKQRFMENKWFGSYRRSTN  290
             + +PPWR+  +M+ KWFG Y+R++N
Sbjct  211  EIFVPPWRRNGYMQAKWFGHYKRTSN  236



>ref|XP_004507645.1| PREDICTED: uncharacterized protein LOC101513838 [Cicer arietinum]
Length=295

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 104/174 (60%), Gaps = 19/174 (11%)
 Frame = -1

Query  733  VELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDS  554
            V+L    +   KS    +R  ++ LR+ G++AG+CK++WE++  I  GD+E+IDV    +
Sbjct  105  VQLAFGVVAGDKSEPGFKRLFVSRLRERGFDAGLCKSRWEKNKRIPGGDYEYIDVNYGGN  164

Query  553  QNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFK  374
                 RYIV     SEFEIARPTN +  L+   P VFVGK EELK++V++M  A K S K
Sbjct  165  -----RYIVGTSLMSEFEIARPTNQYTSLLDVFPLVFVGKVEELKRVVRLMCSAIKDSMK  219

Query  373  SRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGFD  212
            +  LH+PPWR+  +M+ KWF  YRR+TN               +A++  ++GFD
Sbjct  220  TMDLHVPPWRRNSYMQAKWFSHYRRTTN--------------EVAIRKSNIGFD  259



>ref|XP_009392399.1| PREDICTED: uncharacterized protein LOC103978357 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 115/195 (59%), Gaps = 20/195 (10%)
 Frame = -1

Query  880  PEHEAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSS  701
            P   AGD        PP  S  E+   +  + C   + RN+LA    +A  ++  C N +
Sbjct  105  PSSNAGD--------PPVVSAAEVIKGL--VVCATLAERNLLA----DASSVVEKCKNCN  150

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
            +  E ++  +   LR  GY+A +CK++WE++    AG+HE+IDV+       ++R +VD+
Sbjct  151  QKDEHMK-AIADGLRSLGYDAAICKSRWEKTPSFPAGEHEYIDVIVG-----LERLLVDV  204

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
            +F SEFEIAR T  +  L++SLP VFVGK + + +IV V+S+AA+ S K +GLH PPWRK
Sbjct  205  DFRSEFEIARSTKSYAALLQSLPSVFVGKVDRVDQIVAVVSEAARHSLKKKGLHFPPWRK  264

Query  340  QRFMENKWFGSYRRS  296
              ++ +KW   Y RS
Sbjct  265  PEYLRSKWLAPYERS  279



>ref|XP_009376010.1| PREDICTED: uncharacterized protein LOC103964762 isoform X2 [Pyrus 
x bretschneideri]
Length=385

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 115/186 (62%), Gaps = 16/186 (9%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I C   S RN+LA  +R+ EA + L       K  + +R++V   L+  GY++  CK+KW
Sbjct  157  IPCVSVSERNLLADTARIVEANKNL-------KQKDDMRKNVADGLQSLGYDSSTCKSKW  209

Query  616  ERSDGITAGDHEFIDVL-RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFV  440
            E+S    AG++E+IDV+  SD      R ++D++F SEFE+AR T  ++ +++SLP +FV
Sbjct  210  EKSSSFPAGEYEYIDVMVESD------RLLIDIDFRSEFEVARSTGAYKAVLQSLPYIFV  263

Query  439  GKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLA  260
            GKS+ L +IV ++S+AAK+S K +G+H PPWRK  +M  KW   Y R+   RP +  L A
Sbjct  264  GKSDRLGQIVSIVSEAAKQSLKKKGMHFPPWRKAEYMSAKWLSPYTRTAVPRPENGTLPA  323

Query  259  PLDQAL  242
               Q +
Sbjct  324  SETQVV  329



>ref|XP_009348989.1| PREDICTED: uncharacterized protein LOC103940569 [Pyrus x bretschneideri]
Length=402

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 111/179 (62%), Gaps = 14/179 (8%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I C   S RN+LA  +R+ EA + L       K  + +R++V   L+  GY++  CK+KW
Sbjct  153  IPCVSVSERNLLADTARIVEANKNL-------KQKDDMRKNVADGLQSLGYDSSTCKSKW  205

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVG  437
            E+S    AG++E+IDV+         R ++D++F SEFE+AR T  ++ +++SLP +FVG
Sbjct  206  EKSSSFPAGEYEYIDVMVEG-----DRLLIDIDFRSEFEVARSTGAYKAVLQSLPYIFVG  260

Query  436  KSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLA  260
            KS+ L +IV ++S+AAK+S K +G+H PPWRK  +M  KW   Y R+   RP +  L A
Sbjct  261  KSDRLGQIVSIVSEAAKQSLKKKGMHFPPWRKAEYMSAKWLSPYTRTAVPRPENGTLPA  319



>ref|XP_009376009.1| PREDICTED: uncharacterized protein LOC103964762 isoform X1 [Pyrus 
x bretschneideri]
Length=386

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 115/186 (62%), Gaps = 16/186 (9%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I C   S RN+LA  +R+ EA + L       K  + +R++V   L+  GY++  CK+KW
Sbjct  157  IPCVSVSERNLLADTARIVEANKNL-------KQKDDMRKNVADGLQSLGYDSSTCKSKW  209

Query  616  ERSDGITAGDHEFIDVL-RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFV  440
            E+S    AG++E+IDV+  SD      R ++D++F SEFE+AR T  ++ +++SLP +FV
Sbjct  210  EKSSSFPAGEYEYIDVMVESD------RLLIDIDFRSEFEVARSTGAYKAVLQSLPYIFV  263

Query  439  GKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLA  260
            GKS+ L +IV ++S+AAK+S K +G+H PPWRK  +M  KW   Y R+   RP +  L A
Sbjct  264  GKSDRLGQIVSIVSEAAKQSLKKKGMHFPPWRKAEYMSAKWLSPYTRTAVPRPENGTLPA  323

Query  259  PLDQAL  242
               Q +
Sbjct  324  SETQVV  329



>gb|KFK43469.1| hypothetical protein AALP_AA1G129000 [Arabis alpina]
Length=293

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 90/131 (69%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +RH+MA+LR+ G++AG+CK++WER    TAG +E++DV   D      R IV+   + EF
Sbjct  112  KRHLMAFLRNKGFDAGLCKSRWERFGKNTAGKYEYVDVKEGDKN----RLIVETNLAGEF  167

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT  +  L+  LP VFVG  EELKK+V++M    +RS K   +H+PPWR+  +M+ 
Sbjct  168  EIARPTTRYLSLLAQLPHVFVGTPEELKKLVRIMCFEIRRSMKRAEIHVPPWRRNGYMQA  227

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  228  KWFGHYKRTSN  238



>ref|XP_009418930.1| PREDICTED: uncharacterized protein LOC103999026 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 120/192 (63%), Gaps = 16/192 (8%)
 Frame = -1

Query  865  GDYSGSDSDLPPCNSDGELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPE  689
            GD+ GS S        G+  + +E  + C   + RN+LA    +A ++L    NS K+ +
Sbjct  119  GDFLGSSS------PTGDAAESIEGLVPCASVAERNLLA----DASKILEKARNS-KNKD  167

Query  688  ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
            + RR V+  LR  GY+A +CK++W++S    AG++E+IDV+  D  +R+   +VD++F S
Sbjct  168  VCRRMVVDGLRSLGYDAAICKSRWDKSPSFPAGEYEYIDVV-VDGGDRL---LVDVDFKS  223

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFE+ARP+  ++ ++  LP VFVG+ E L+ IV + S+A ++S K +GLH+PPWR+  + 
Sbjct  224  EFEVARPSKSYRAVLHHLPSVFVGRPERLQSIVALASEAGRQSLKKKGLHVPPWRQPEYT  283

Query  328  ENKWFGSYRRST  293
              KW   Y+R+T
Sbjct  284  RAKWLSPYQRTT  295



>ref|XP_009616342.1| PREDICTED: uncharacterized protein LOC104108895 [Nicotiana tomentosiformis]
Length=303

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 107/164 (65%), Gaps = 18/164 (11%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R +M  LR+ G++A +CK+KWER+  + +G++E+ID+  +++     RYI+++  + E
Sbjct  120  FKRRLMTRLRNRGFDADLCKSKWERNGQLPSGNYEYIDINMNEN-----RYIIEVYLARE  174

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIARPT ++  L+   P +FVGK EELK++VK+MS+A K+S K   +H+PPWR+  +M+
Sbjct  175  FEIARPTPYYTSLLEIFPSIFVGKVEELKQVVKLMSRATKKSMKKMDIHVPPWRQLSYMQ  234

Query  325  NKWFGSYRRSTNFRPASMELLAPLDQA---LAVKC----RSVGF  215
             KWFGSY+R+ N      E L   D      + KC    R+VGF
Sbjct  235  AKWFGSYKRTIN------EFLLDDDNKNLDFSYKCLAKKRAVGF  272



>ref|XP_009391132.1| PREDICTED: uncharacterized protein LOC103977363 [Musa acuminata 
subsp. malaccensis]
Length=287

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 105/157 (67%), Gaps = 5/157 (3%)
 Frame = -1

Query  763  NVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDH  584
            +++  R+  A E   S +  S + +  +R V+ +LRD G++AG+CK+ WER++ I AG H
Sbjct  85   DMVGHRIRVAAERGVSAV--SPAGDGFKRRVIGWLRDKGFDAGLCKSSWERAERIQAGTH  142

Query  583  EFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKV  404
            E+IDV+    +    RYI++++ ++EFEIARPT  +  L+R+LP VFVG+   L+ IV +
Sbjct  143  EYIDVI---DRGGGTRYILEIDLAAEFEIARPTQDYTALLRALPSVFVGRPGALESIVSL  199

Query  403  MSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            M  A + S +S G+HLPPWR++ ++  KWF S+ R++
Sbjct  200  MCVAMEESIRSSGMHLPPWRRKEYVRAKWFSSFGRNS  236



>ref|XP_009148619.1| PREDICTED: uncharacterized protein LOC103872035 [Brassica rapa]
Length=293

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 103/167 (62%), Gaps = 14/167 (8%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +R++MAYLR  G++AG+CK++WER    TAG +E++DV   D      R+IV+   + EF
Sbjct  115  KRYLMAYLRKKGFDAGLCKSRWERFGKNTAGKYEYVDVNEGDKN----RFIVETNLAGEF  170

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EI RPT  +  L+  LP+VFVG  EELK++V++MS   +RS K   +H+PPWR+  +M+ 
Sbjct  171  EITRPTTRYISLLSQLPRVFVGTPEELKQLVRIMSFEVRRSMKRAEIHVPPWRRNGYMQA  230

Query  322  KWFGSYRRSTNFRPASMELLAPLDQALAVKCRS-VGFDDAVNRRLLF  185
            KWFG Y+R++N           + +  +  C   VGF+++V     F
Sbjct  231  KWFGHYKRTSN---------EVVTRVWSCGCGPRVGFEESVETATFF  268



>ref|XP_009357600.1| PREDICTED: uncharacterized protein LOC103948319 [Pyrus x bretschneideri]
Length=302

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 120/214 (56%), Gaps = 32/214 (15%)
 Frame = -1

Query  877  EHEAGDYSGSDSDLPPCNSDGELEDEVETINC---GEDSFRNVLASRVSEAVELLSSCLN  707
            E E GD+S           D E ++ +E + C   G+D     L   +++ VE+  + + 
Sbjct  67   ESEGGDWS-----------DSETKNSLERL-CEVKGDD-----LKKTIADEVEVALAGIG  109

Query  706  SSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIV  527
              KS    +R +M +LR  G++AG+CK+KW +S    AGD+EF+DV    +     RY+V
Sbjct  110  DDKSSRGFKRRLMTHLRHKGFDAGLCKSKWVKSSRFPAGDYEFVDVNLEGT-----RYVV  164

Query  526  DLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPW  347
            +      FEIARPT  +  L+   P  FVG+ +ELKKIV++M  A K+S KS  + +PPW
Sbjct  165  EPFLVGHFEIARPTTRYTSLLEVFPNTFVGEVDELKKIVRLMCTAIKKSMKSVDMPMPPW  224

Query  346  RKQRFMENKWFGSYRRSTNFRPASMELLAPLDQA  245
            R+  +M+ KWFGSY+R+TN        +APL  A
Sbjct  225  RRNGYMQAKWFGSYKRTTN-------AVAPLAAA  251



>gb|KFK39579.1| hypothetical protein AALP_AA3G262600 [Arabis alpina]
Length=362

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/185 (38%), Positives = 119/185 (64%), Gaps = 12/185 (6%)
 Frame = -1

Query  832  PCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRD  653
            PC++   L+     I C   + RN+LA    +A +++     S K  + +++ V   L  
Sbjct  117  PCDASDHLK---SLIPCTTVAERNLLA----DAAKIVEKNNKSGKRKDDMKKIVNEGLLS  169

Query  652  FGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQ  473
              YN+ +CK+KW++S    AG++E+IDV+  +     +R ++D++F SEF+IAR T+ ++
Sbjct  170  LNYNSSICKSKWDKSPSFPAGEYEYIDVIIGE-----ERLLIDVDFRSEFDIARQTSGYK  224

Query  472  YLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
             L++SLP +FVGKS+ L +IV ++S+AAK+S K +G+HLPPWRK  +M +KW  SY R++
Sbjct  225  ALLQSLPFIFVGKSDRLSQIVYLISEAAKQSLKKKGMHLPPWRKAEYMRSKWLSSYIRAS  284

Query  292  NFRPA  278
            + + A
Sbjct  285  SGKKA  289



>ref|XP_004971035.1| PREDICTED: uncharacterized protein LOC101782991 [Setaria italica]
Length=290

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQ--NRIQRYIVDLEFS  512
             RR VM  LR  GY+AGVCK++WE S GITAG +E++DV+   +       RYIVD +F 
Sbjct  120  FRRAVMRRLRGAGYDAGVCKSRWEASGGITAGTYEYVDVVAPPAARGGPRGRYIVDADFR  179

Query  511  SEFEIARPTNHFQYLIRSLPKVFVGKSEE-LKKIVKVMSKAAKRSFKSRGLHLPPWRKQR  335
            +  E+AR T  +  ++ ++P   V   EE + + V+V S +A+RS ++ GLH+PPWRK R
Sbjct  180  AGLEVARATPEYAAVVAAVPASAVVAREESVGRAVRVASDSARRSLRAHGLHVPPWRKTR  239

Query  334  FMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
            +M  KW G Y+RST   PA+M +  P    L VKCR+VGF
Sbjct  240  YMLAKWLGPYKRSTTTSPAAMPM--PGAAGLDVKCRAVGF  277



>gb|KHN15392.1| hypothetical protein glysoja_039049 [Glycine soja]
Length=232

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 110/187 (59%), Gaps = 11/187 (6%)
 Frame = -1

Query  814  ELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAG  635
            +++ E   I C     RN+LA    E   ++     S K  + LR+ V   L   GY++ 
Sbjct  12   DIDSEKSLIPCASVGERNLLA----EVARIVEKNGKSIKRKDDLRKVVAEALSSLGYDSS  67

Query  634  VCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSL  455
            +CK+KWE++    AG++EFID +        +R IVD++F SEFEIAR T  ++ +++SL
Sbjct  68   ICKSKWEKTSSCPAGEYEFIDAIVEG-----ERLIVDVDFRSEFEIARSTGTYKAMLQSL  122

Query  454  PKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWF--GSYRRSTNFRP  281
            P +FVG SE L +I+ ++S AAK+S K +G+H+PPWRK+ +M  KW    S R   N +P
Sbjct  123  PFIFVGNSERLTQILAIVSDAAKQSLKKKGMHVPPWRKRDYMLAKWLSPSSIREKENKQP  182

Query  280  ASMELLA  260
             S  + A
Sbjct  183  PSSSVQA  189



>ref|XP_010476157.1| PREDICTED: uncharacterized protein LOC104755466 [Camelina sativa]
Length=292

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = -1

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++   +N+S+     +RH MAYLR  G++AG+CK++W +    TAG +E++DV   D   
Sbjct  96   IMGVAVNASRFVVGEKRHFMAYLRGKGFDAGLCKSRWVKFGKNTAGKYEYVDVKGGDEN-  154

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
               RYIV+   + EFEIARPT  +  L+  +P+VFVG  EELK++V++MS   +RS K  
Sbjct  155  ---RYIVETNLAGEFEIARPTTRYLSLLAQIPRVFVGTPEELKQLVRIMSFEIRRSMKRA  211

Query  367  GLHLPPWRKQRFMENKWFGSYRRSTN  290
             +++PPWR+  +M+ KWFG Y+R++N
Sbjct  212  EIYVPPWRRNGYMQAKWFGHYKRTSN  237



>ref|XP_011091082.1| PREDICTED: uncharacterized protein LOC105171616 [Sesamum indicum]
Length=388

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 110/172 (64%), Gaps = 9/172 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA    +  +++     + K  + LR+ V   L   GYNA +CK+KWE+
Sbjct  137  IPCASVAERNLLA----DTSKIVEKNNKTCKGKDDLRKIVTDGLIALGYNASLCKSKWEK  192

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S  I AG++E+IDV+        +R ++D++F SEFEIAR T+ ++ +++SLP +FVGKS
Sbjct  193  SSSIPAGEYEYIDVIVEG-----ERVLIDVDFRSEFEIARSTSSYKAILQSLPYIFVGKS  247

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS  275
            + L +IV + S+AA++S K +G+H+ PWRK  +M++KW   + R T  +P +
Sbjct  248  DRLLQIVSIASEAARQSLKKKGMHIAPWRKSEYMKSKWLSPHTRITQLKPTN  299



>ref|XP_009381920.1| PREDICTED: uncharacterized protein LOC103970020 [Musa acuminata 
subsp. malaccensis]
Length=276

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 102/176 (58%), Gaps = 7/176 (4%)
 Frame = -1

Query  757  LASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEF  578
            ++ R+    E     + S+K     +R V++ LR  G +AG+CK+ WER+D +  G HE+
Sbjct  102  MSGRIRATAEGAFEVVGSTKGA---KRRVVSLLRKKGLDAGLCKSSWERADRVPGGYHEY  158

Query  577  IDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMS  398
            IDV+         RYIVD+  ++EFEIARPT  +  L+R LP VFVG  + L+++VK+M 
Sbjct  159  IDVIARGGA----RYIVDINLAAEFEIARPTTDYVMLLRVLPAVFVGSRDLLERVVKLMC  214

Query  397  KAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKC  230
             AA  S +  G+H+PPWR++ ++  KWF SY R+     A    +    +A  V C
Sbjct  215  AAAAESIRGAGMHVPPWRRREYVRAKWFSSYGRTAGGVLAEKGAVWVAGEAAGVSC  270



>ref|XP_002987613.1| hypothetical protein SELMODRAFT_25560, partial [Selaginella moellendorffii]
 gb|EFJ11188.1| hypothetical protein SELMODRAFT_25560, partial [Selaginella moellendorffii]
Length=124

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 86/127 (68%), Gaps = 3/127 (2%)
 Frame = -1

Query  661  LRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTN  482
            LR  GYNA VCK++W +S GI+ G++ +IDVL      R+   I+D +FSS+F IARP++
Sbjct  1    LRSMGYNAAVCKSRWSQSKGISKGEYAYIDVLLDAGSKRV---IIDTDFSSQFVIARPSD  57

Query  481  HFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYR  302
             +Q ++  +P VFVG  +EL K + ++S A KRS K++ L LPPWR+  ++  KWF  YR
Sbjct  58   EYQAILAEIPPVFVGSEDELHKFLHLISLAMKRSLKAQSLTLPPWRRPDYLTAKWFSPYR  117

Query  301  RSTNFRP  281
            R+TN  P
Sbjct  118  RTTNPLP  124



>ref|NP_172667.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC17612.1| Contains similarity to hypothetical protein gb|Z97336 from A. 
thaliana [Arabidopsis thaliana]
 gb|AAR07518.1| At1g12030 [Arabidopsis thaliana]
 dbj|BAD43283.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28828.1| uncharacterized protein AT1G12030 [Arabidopsis thaliana]
Length=295

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = -1

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++   +N+S+     +RH MAYLR+ G++AG+CK++WE+    TAG +E++DV   D   
Sbjct  96   IMDEAVNASRVFAGEKRHFMAYLRNKGFDAGLCKSRWEKFGKNTAGKYEYVDVKAGDKN-  154

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
               RYIV+   + EFEIARPT  +  ++  +P+VFVG  EELK++V++M    +RS K  
Sbjct  155  ---RYIVETNLAGEFEIARPTTRYLSVLAQVPRVFVGTPEELKQLVRIMCFEIRRSMKRA  211

Query  367  GLHLPPWRKQRFMENKWFGSYRRSTN  290
             + +PPWR+  +M+ KWFG Y+R++N
Sbjct  212  DIFVPPWRRNGYMQAKWFGHYKRTSN  237



>ref|XP_002311650.1| hypothetical protein POPTR_0008s15960g [Populus trichocarpa]
 gb|ABK95342.1| unknown [Populus trichocarpa]
 gb|EEE89017.1| hypothetical protein POPTR_0008s15960g [Populus trichocarpa]
Length=388

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 103/164 (63%), Gaps = 9/164 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA    +   +L    N  +  + LR+ V   L   GY++ +CK+KW++
Sbjct  139  IPCASVAERNLLA----DTAMILEKNKNHKQKDDFLRKMVADGLTSLGYHSSICKSKWDK  194

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E++DV+  +     +R I+D++F SEFEIAR T  ++ +++SLP +FVGKS
Sbjct  195  SPSFPAGEYEYVDVIIEE-----ERLIIDIDFKSEFEIARSTGAYKAILQSLPYIFVGKS  249

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            + L +IV V+S+AAK+S K +G+H PPWRK  +M  KW   Y R
Sbjct  250  DRLGQIVSVVSEAAKQSLKKKGMHFPPWRKAEYMRAKWLSPYTR  293



>ref|XP_004134790.1| PREDICTED: uncharacterized protein LOC101205314 [Cucumis sativus]
 ref|XP_004155619.1| PREDICTED: uncharacterized protein LOC101226420 [Cucumis sativus]
Length=285

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 95/143 (66%), Gaps = 5/143 (3%)
 Frame = -1

Query  712  LNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRY  533
            L   +S   + R +MA+LR  G++AG+CK+K E+     AGDHE+IDV    +     RY
Sbjct  98   LVGGRSLPGINRQLMAHLRREGFDAGLCKSKMEKPRAFPAGDHEYIDVNFGGN-----RY  152

Query  532  IVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLP  353
            IV++  + EFEIARPT+ +  L+ + P++FVG  +ELK +VK+M  A K S K   +H+P
Sbjct  153  IVEIFLAREFEIARPTSKYVSLLNTFPEIFVGTLDELKHVVKLMCSAMKESMKKMNMHVP  212

Query  352  PWRKQRFMENKWFGSYRRSTNFR  284
            PWR+  +M+ KWFGSY+R+TN +
Sbjct  213  PWRRNGYMQAKWFGSYKRTTNHK  235



>ref|XP_002886470.1| hypothetical protein ARALYDRAFT_475101 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62729.1| hypothetical protein ARALYDRAFT_475101 [Arabidopsis lyrata subsp. 
lyrata]
Length=282

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 115/193 (60%), Gaps = 13/193 (7%)
 Frame = -1

Query  871  EAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
            E  + S  D+DL        L   +E ++ GE+  R V+A+     +E+  + +    SP
Sbjct  56   EEEETSSDDNDLEDVKE--RLRKLLEGLSGGEER-RRVMAA----MMEVAGTFVGDVSSP  108

Query  691  EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFS  512
               +R +M +LR+ G++AG+CK+ WER    T G +E++D+      NR   +IV+   +
Sbjct  109  ---KRQLMVFLRNKGFDAGLCKSNWERFGKNTGGKYEYVDIRCGGDHNR---FIVETNLA  162

Query  511  SEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRF  332
             EFEIARPT  +  ++  +P+VFVG SEELK +V++M    +RS K  G+H+PPWR+  +
Sbjct  163  GEFEIARPTKRYLSILNQVPRVFVGTSEELKLLVRIMCHEMRRSMKHVGMHVPPWRRNGY  222

Query  331  MENKWFGSYRRST  293
            M+ KWFG Y+R++
Sbjct  223  MQAKWFGFYKRTS  235



>ref|XP_002892671.1| hypothetical protein ARALYDRAFT_471352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68930.1| hypothetical protein ARALYDRAFT_471352 [Arabidopsis lyrata subsp. 
lyrata]
Length=294

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 96/146 (66%), Gaps = 4/146 (3%)
 Frame = -1

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++   +N+S+     +RH M YLR+ G++AG+CK++WE+    TAG +E++DV   D   
Sbjct  95   IMDEAVNASRFVVGEKRHFMTYLRNKGFDAGLCKSRWEKFGKNTAGKYEYVDVKVGDKN-  153

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
               RYIV+   + EFEIARPT  +  L+  LP+VFVG  EELK++V++M    +RS K  
Sbjct  154  ---RYIVETNLAGEFEIARPTTRYLSLLAQLPRVFVGTPEELKQLVRIMCFEIRRSMKRA  210

Query  367  GLHLPPWRKQRFMENKWFGSYRRSTN  290
             + +PPWR+  +M+ KWFG Y+R++N
Sbjct  211  EIFVPPWRRNGYMQAKWFGHYKRTSN  236



>ref|NP_193198.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM91628.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83467.1| uncharacterized protein AT4G14620 [Arabidopsis thaliana]
Length=341

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 112/166 (67%), Gaps = 10/166 (6%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I CG  SF  V  S + EA +++     S K  + LR+ V+  L   GY++ +CK+KW++
Sbjct  113  IQCG--SF--VEKSLLVEATKIIEKN-KSVKRKDELRKIVVDELSSLGYDSSICKSKWDK  167

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            +  I AG++E+IDV+ +      +R I+D++F SEFEIAR T+ ++ L++SLP +FVGKS
Sbjct  168  TRSIPAGEYEYIDVIVNG-----ERLIIDIDFRSEFEIARQTSGYKELLQSLPLIFVGKS  222

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + +++IV ++S+A+K+S K +G+H PPWRK  +M  KW  SY R++
Sbjct  223  DRIRQIVSIVSEASKQSLKKKGMHFPPWRKADYMRAKWLSSYTRNS  268



>ref|XP_008341032.1| PREDICTED: uncharacterized protein LOC103403963 [Malus domestica]
Length=410

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 109/179 (61%), Gaps = 14/179 (8%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I C   S RN+LA  +R+ EA + L       K  + LR+ V   L+  GY++  CK+KW
Sbjct  157  IPCVSVSERNLLADTARIVEANKNL-------KQKDDLRKIVADGLQSLGYDSSTCKSKW  209

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVG  437
            E+S    AG++E+IDV+         R ++D++F SEFE+AR T  ++ +++SLP +FVG
Sbjct  210  EKSSSFPAGEYEYIDVMVEG-----DRLLIDIDFRSEFEVARSTGVYKAVLQSLPYIFVG  264

Query  436  KSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLA  260
            KS+ L +IV ++S+AAK+S K +G+H PPWRK  +M  KW   Y R    RP +  L A
Sbjct  265  KSDRLGQIVSIVSEAAKQSLKKKGMHFPPWRKXEYMXAKWLSPYTRXAVHRPENGTLPA  323



>ref|XP_010473460.1| PREDICTED: uncharacterized protein LOC104752901 [Camelina sativa]
Length=294

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 119/196 (61%), Gaps = 15/196 (8%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEIL  683
            D S +D+DL   N    L   +E ++  E+  R ++A+    A  L    ++SS      
Sbjct  62   DSSSNDNDLEDVNE--RLGKLLEGLSGSEERMR-IVAAVTEVAGTLFVGDISSSS-----  113

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDH-----EFIDVLRSDSQNRIQRYIVDLE  518
            +R +MA+LR+ G++AG+CK++WERS   TAG +     E++DV R D  +   RYIV+  
Sbjct  114  KRQLMAFLRNKGFDAGLCKSRWERSGKYTAGKYTAGKYEYVDV-RCDG-DHCNRYIVETN  171

Query  517  FSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQ  338
             + EFEIARPT  +  ++  +P+VFVG SEELK +V++M    ++S K  G+H+PPWR+ 
Sbjct  172  LAGEFEIARPTRRYLSILSQVPRVFVGTSEELKHLVRIMCHEMRQSMKHVGIHVPPWRRN  231

Query  337  RFMENKWFGSYRRSTN  290
             +M+ KWF  Y+R++ 
Sbjct  232  GYMQAKWFDLYKRTST  247



>ref|XP_009417107.1| PREDICTED: uncharacterized protein LOC103997570 [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 107/166 (64%), Gaps = 9/166 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            + C   + RN+LA    +A ++L    NS K+    RR V   LR  GY+  VC+++W++
Sbjct  139  VLCASMAERNLLA----DASKILEKAKNS-KNKGDWRRMVADGLRSLGYDVAVCRSRWDQ  193

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG+HE+IDV+         R +VD++F SEFE+ARPT  ++ +++ LP VFVG+S
Sbjct  194  SPSFPAGEHEYIDVVVEGGD----RLLVDVDFRSEFEVARPTKSYRAVLQHLPSVFVGRS  249

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + L++IV + S+AA++S K +GLH+PPWR+  +M+ KW   Y R+T
Sbjct  250  DRLQQIVALASEAARQSLKKKGLHVPPWRRPEYMKAKWLSPYHRTT  295



>ref|XP_010108179.1| hypothetical protein L484_014504 [Morus notabilis]
 gb|EXC18104.1| hypothetical protein L484_014504 [Morus notabilis]
Length=318

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSS  509
            L R V   LR+ GYN+ VCK+KW  S  +T+G+H F+DVL + S  + + R I++L F +
Sbjct  143  LMREVSDRLRNDGYNSAVCKSKWRSSPDVTSGEHTFLDVLSNSSSKKGEVRVIIELNFRA  202

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFE+AR +  +  L++ LP+VFVGK E L+ ++K+M  AAK+  K + +HL PWRKQR+M
Sbjct  203  EFEMARASEEYNRLVQKLPEVFVGKVERLQSVIKIMCSAAKKCMKEKKMHLGPWRKQRYM  262

Query  328  ENKWFGSYRRSTNF  287
            + KW G   R+T+ 
Sbjct  263  QAKWLGVCERTTSL  276



>ref|XP_010458625.1| PREDICTED: uncharacterized protein LOC104739853 [Camelina sativa]
Length=292

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 97/146 (66%), Gaps = 4/146 (3%)
 Frame = -1

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++   +N S+     +RH MAYLR  G++AG+CK++W +    TAG +E++DV   D+  
Sbjct  96   IMDVAVNVSRFVVGEKRHFMAYLRGKGFDAGLCKSRWVKFGKNTAGKYEYVDVKGGDNN-  154

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
               RYIV+   + EFEIARPT  +  L+  +P+VFVG  EELK++V++MS   +RS K  
Sbjct  155  ---RYIVETNLAGEFEIARPTTRYLSLLAQIPRVFVGTPEELKQLVRIMSFEIRRSMKRA  211

Query  367  GLHLPPWRKQRFMENKWFGSYRRSTN  290
             +++PPWR+  +M+ KWFG Y+R++N
Sbjct  212  EIYVPPWRRNGYMQAKWFGHYKRTSN  237



>ref|XP_009775142.1| PREDICTED: uncharacterized protein LOC104225076 [Nicotiana sylvestris]
Length=302

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 109/164 (66%), Gaps = 18/164 (11%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R ++  LR+ G++AG+CK+KWER+  + +G++E+ID+  +++     RYI+++  + E
Sbjct  119  FKRRLITRLRNKGFDAGLCKSKWERNGQLPSGNYEYIDINMNEN-----RYIIEVYLARE  173

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIARPT ++  L+   P +FVGK EELK++VK+M++A K+S K   +++PPWR+  +M+
Sbjct  174  FEIARPTPYYTSLLEIFPSIFVGKVEELKQVVKLMTRAMKKSMKKMDIYVPPWRQLSYMQ  233

Query  325  NKWFGSYRRSTNFRPASMELLAPLDQA---LAVKC----RSVGF  215
             KWFGSY+R+ N      E L   D+     + KC    R+VGF
Sbjct  234  AKWFGSYKRTIN------EYLLDDDKKNLDFSYKCLAKKRAVGF  271



>emb|CDY29750.1| BnaA01g19160D [Brassica napus]
Length=354

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 118/192 (61%), Gaps = 20/192 (10%)
 Frame = -1

Query  826  NSDGELEDEVETINCGEDSFRNV------------LASR--VSEAVELLSSCLNSSKSPE  689
            N+D   +DE +   C  +SF +             L  R   ++A ++L     S K  +
Sbjct  95   NNDDSSDDEFDLFGCSVESFNDAYDHFKSLIPCASLMERNLSADAAKILEKN-KSVKRKD  153

Query  688  ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
             LR+ V+  L   GY++ +CK+KW+++  I AG++E+IDV+ +      +R ++D++F S
Sbjct  154  DLRKLVVDGLSSLGYDSSICKSKWDKTRSIPAGEYEYIDVIVNG-----ERVLIDVDFRS  208

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFEIAR TN ++ L++SLP VFVGKS+ + +IV ++S+AA++S K +G+H PPWRK  +M
Sbjct  209  EFEIARQTNAYKALLQSLPFVFVGKSDRISQIVSMVSEAARQSLKKKGMHFPPWRKADYM  268

Query  328  ENKWFGSYRRST  293
              KW  SY R++
Sbjct  269  RAKWLSSYTRNS  280



>ref|XP_009396480.1| PREDICTED: uncharacterized protein LOC103981466 [Musa acuminata 
subsp. malaccensis]
Length=264

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 103/155 (66%), Gaps = 5/155 (3%)
 Frame = -1

Query  745  VSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL  566
            +++A  L+    N  +  E ++  V A LR  GY+A +CK++W+++  + AG++++IDV+
Sbjct  102  LADASNLMEKSRNCKRKEEYIK-AVTAGLRSLGYDASICKSRWKKTSSVAAGEYQYIDVI  160

Query  565  RSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAK  386
                +    R +VD++F SEFEIAR T  ++ +++SLP VFVG+ + + +IV V+S+AA+
Sbjct  161  VGGGE----RLLVDVDFRSEFEIARSTKRYREVLQSLPSVFVGEEDRVNQIVAVVSQAAR  216

Query  385  RSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRP  281
            +S K +GLH+PPWR+  +M  KW  +Y R T  +P
Sbjct  217  KSLKKKGLHVPPWRRPEYMRAKWLSTYSRLTPSKP  251



>gb|ABK27021.1| unknown [Picea sitchensis]
Length=361

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 122/205 (60%), Gaps = 16/205 (8%)
 Frame = -1

Query  880  PEHEAGDYSGSDSDLPPCNS-----DGELEDEVETINCGEDSFRNVLASRVSEAVELLSS  716
            P+HE  D + S+     C S     + +LE     I+C   +  ++LA   ++ +E+   
Sbjct  43   PQHETMDANISED----CQSVLQSEENQLEILKGCISCTCPAELDLLA-ETAQCLEMARK  97

Query  715  CLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSD----GITAGDHEFIDV-LRSDSQ  551
             L   + PE L++ VM +LR+ GY+A +CK+  + +        +G++E++DV ++S + 
Sbjct  98   -LQQQQQPEFLKQSVMCHLRNVGYDAAICKSHPKDNSRSCRSFPSGNYEYMDVIMKSTNS  156

Query  550  NRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKS  371
             R  R IVDL+F ++FEIARPT  +  L+  LPK++VG+   L+ IVK+M +  K S K 
Sbjct  157  RRSIRLIVDLDFKAQFEIARPTREYSTLLGLLPKIYVGRDHRLQSIVKIMCEGVKNSLKK  216

Query  370  RGLHLPPWRKQRFMENKWFGSYRRS  296
             G+HLPPWRK ++M + W GSY+R+
Sbjct  217  IGMHLPPWRKYKYMHSMWLGSYKRT  241



>ref|XP_003519060.1| PREDICTED: uncharacterized protein LOC100780569 isoform 1 [Glycine 
max]
Length=366

 Score =   139 bits (350),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/209 (38%), Positives = 115/209 (55%), Gaps = 26/209 (12%)
 Frame = -1

Query  880  PEHEAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSS  701
            PE    D + S   L PC S GE               RN+LA    E   ++     S 
Sbjct  110  PESSNADATESLKSLIPCASVGE---------------RNLLA----EVARIVEKNGKSI  150

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
            K  + LR+ V   L   GY++ +CK+KWE++    AG++EFID +        +R IVD+
Sbjct  151  KRKDDLRKVVAEALSSLGYDSSICKSKWEKTSSCPAGEYEFIDAIVEG-----ERLIVDV  205

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
            +F SEFEIAR T  ++ +++SLP +FVG SE L +I+ ++S AAK+S K +G+H+PPWRK
Sbjct  206  DFRSEFEIARSTGTYKAMLQSLPFIFVGNSERLTQILAIVSDAAKQSLKKKGMHVPPWRK  265

Query  340  QRFMENKWF--GSYRRSTNFRPASMELLA  260
            + +M  KW    S R   N +P S  + A
Sbjct  266  RDYMLAKWLSPSSIREKENKQPPSSSVQA  294



>ref|XP_008775235.1| PREDICTED: uncharacterized protein LOC103695641 [Phoenix dactylifera]
Length=389

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 114/195 (58%), Gaps = 10/195 (5%)
 Frame = -1

Query  862  DYSGSD-SDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            D+ G D S L P +SD   E     + C   + RN+LA    +A  ++ +     +  E 
Sbjct  106  DFPGGDPSPLIPTSSDA-AEVVKGLVLCTSVAERNLLA----DASNIMENFTKMGRGKED  160

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             RR V   LR  GY+A VCK++WE+     AG++E++DV+ +  +    R +VD++F SE
Sbjct  161  SRRAVADGLRALGYDAAVCKSRWEKCPSFPAGEYEYVDVIVAGGE----RLLVDVDFRSE  216

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIAR T  ++ +++SLP VFVGK + L++IV V  +AA++S K +GLH PPWRK  +M 
Sbjct  217  FEIARSTKTYRVVLQSLPSVFVGKEDRLQQIVSVACEAARQSLKKKGLHFPPWRKLEYMR  276

Query  325  NKWFGSYRRSTNFRP  281
             KW   + R+    P
Sbjct  277  AKWLSPFERTAPIIP  291



>emb|CDY16266.1| BnaC01g23010D [Brassica napus]
Length=357

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 115/191 (60%), Gaps = 18/191 (9%)
 Frame = -1

Query  826  NSDGELEDEVETINCGEDSFRN-------------VLASRVSEAVELLSSCLNSSKSPEI  686
            N+D   +DE +   C  +SF +             V+   +S     +     S K  + 
Sbjct  98   NNDDSSDDEFDLFGCSVESFNDAYDHFKSLIPCASVMERNLSADAAKILEKNKSVKRKDD  157

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR+ V+  L   GY++ +CK+KW+++  I AG++EFIDV+ +      +R ++D++F SE
Sbjct  158  LRKLVVDGLSALGYDSSICKSKWDKTRSIPAGEYEFIDVIVNG-----ERLLIDVDFRSE  212

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F+IAR TN ++ L++SLP VFVGKS+ + +IV ++S+AA++S K +G+H PPWRK  +M 
Sbjct  213  FDIARQTNAYKALLQSLPFVFVGKSDRISQIVSMVSEAARQSLKKKGMHFPPWRKADYMR  272

Query  325  NKWFGSYRRST  293
             KW  SY R++
Sbjct  273  AKWLSSYTRNS  283



>gb|EMT03225.1| hypothetical protein F775_30094 [Aegilops tauschii]
Length=368

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 109/191 (57%), Gaps = 12/191 (6%)
 Frame = -1

Query  856  SGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEIL  683
            SG  S  PP  +   LE     +     + RN+LA  SR++E       C  + K     
Sbjct  111  SGQASAPPPSAAGDTLEALKGLVQSASVAERNLLADASRIAE------RCGRTCKGKAEC  164

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            RR V   LR  GY+A VCK++WE++    AG+HE+ID +  D      R IV++ F SEF
Sbjct  165  RRAVADGLRALGYDAAVCKSRWEKTKSYPAGEHEYIDAVVGDGG----RLIVEVHFRSEF  220

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            E+AR T  ++  +++LP +FVG S+ L KIV V+++AA++S K +GLH PPWRK  +M  
Sbjct  221  EVARSTKAYRAALQALPPLFVGTSDRLGKIVSVVAEAARQSMKKKGLHFPPWRKPEYMRA  280

Query  322  KWFGSYRRSTN  290
            KW   + R+ +
Sbjct  281  KWLSPHVRTGD  291



>ref|XP_009413911.1| PREDICTED: uncharacterized protein LOC103995119 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413912.1| PREDICTED: uncharacterized protein LOC103995119 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413914.1| PREDICTED: uncharacterized protein LOC103995119 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 107/167 (64%), Gaps = 9/167 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            + C     RN+LA    +A ++L    NS    E  RR V   LR  GY+A +CK++W++
Sbjct  138  VLCASVVERNLLA----DASKILEKAKNSKNKGEC-RRMVSDGLRSLGYDAAICKSRWDK  192

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
                 AG++E+IDV+         R++VD+++ SEFE+ARPT  F+ +++ LP+VFVG+S
Sbjct  193  DPSFPAGEYEYIDVVMDGGD----RFLVDVDYRSEFEVARPTKSFRAVLQHLPQVFVGRS  248

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
            + L++IV   S+AA++S K +GLH+PPWR+  +M+ KW   Y+R+ +
Sbjct  249  DRLQQIVAFASEAARQSLKKKGLHVPPWRRPEYMKAKWLSPYQRTAD  295



>ref|XP_009148494.1| PREDICTED: uncharacterized protein LOC103871913 [Brassica rapa]
Length=354

 Score =   138 bits (348),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 118/192 (61%), Gaps = 20/192 (10%)
 Frame = -1

Query  826  NSDGELEDEVETINCGEDSFRNV------------LASR--VSEAVELLSSCLNSSKSPE  689
            N+D   +DE +   C  +SF +             L  R   ++A ++L     S K  +
Sbjct  95   NNDDSSDDEFDLFGCSVESFNDAYDHFKSLIPCASLMERNLSADAAKILEKN-KSVKRKD  153

Query  688  ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
             LR+ V+  L   GY++ +CK+KW+++  I AG++E+IDV+ +      +R ++D++F S
Sbjct  154  DLRKLVVDGLSALGYDSSICKSKWDKTRSIPAGEYEYIDVIVNG-----ERVLIDVDFRS  208

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFEIAR TN ++ L++SLP VFVGKS+ + +IV ++S+AA++S K +G+H PPWRK  +M
Sbjct  209  EFEIARQTNAYKALLQSLPFVFVGKSDRISQIVSMVSEAARQSLKKKGMHFPPWRKADYM  268

Query  328  ENKWFGSYRRST  293
              KW  SY R++
Sbjct  269  RAKWLSSYTRNS  280



>gb|KHG21883.1| hypothetical protein F383_04758 [Gossypium arboreum]
 gb|KHG23671.1| hypothetical protein F383_30082 [Gossypium arboreum]
Length=379

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 113/183 (62%), Gaps = 14/183 (8%)
 Frame = -1

Query  826  NSDGELEDEVET----INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYL  659
            +S+G   D  ET    + C     RN+LA   +  VE   +C    K  + LR+ V   L
Sbjct  127  SSNGSPPDTCETLKSLVQCTTVVERNLLAD-TAVIVEKNKNC----KRKDDLRKIVTDGL  181

Query  658  RDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNH  479
               GYN+ +CK+KW++S    AGD+E+IDV+        +R ++D++F SEFE+AR T  
Sbjct  182  LSLGYNSSICKSKWDKSPSFPAGDYEYIDVVMEG-----ERMLIDVDFRSEFEMARSTGT  236

Query  478  FQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            ++ +++SLP +FVGK + L +IV ++S+AAK+S K++G+HLPPWRK  +M  KW   + R
Sbjct  237  YKAIVQSLPFIFVGKPDRLDRIVTIVSEAAKQSLKNKGMHLPPWRKTEYMRAKWLSQFTR  296

Query  298  STN  290
            +++
Sbjct  297  TSS  299



>ref|XP_010274246.1| PREDICTED: uncharacterized protein LOC104609584 [Nelumbo nucifera]
Length=411

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/209 (37%), Positives = 121/209 (58%), Gaps = 22/209 (11%)
 Frame = -1

Query  850  SDSDLPPCNSDGE------LEDEVETIN----CGEDSFRNVLASRVSEAVELLSSCLNSS  701
            SD +   CN  GE        D  E +     C   + RN+LA   ++ +E   SC    
Sbjct  114  SDDEFDLCNCFGESMSAASCGDACEILKSLVPCASVAERNLLAD-TAKIIEKNKSC----  168

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
            K  +  R+ V   L   GY+A +CK++WE+S    AG++E+IDV+        +R IVD+
Sbjct  169  KLKDDCRKIVTDGLISLGYDASICKSRWEKSPSYPAGEYEYIDVIVEG-----ERLIVDV  223

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
            +F SEFEIAR T  ++ ++++LP +FVGK++ L++IV ++S AA++S K +G+H+PPWRK
Sbjct  224  DFRSEFEIARSTGTYKVVLQALPSIFVGKADRLQQIVGIVSDAARQSLKKKGMHIPPWRK  283

Query  340  QRFMENKWFGSYRRST--NFRPASMELLA  260
              +M +KW   Y R+T  + +P   E  A
Sbjct  284  AEYMNSKWLSPYTRTTSPSVKPVETETQA  312



>ref|XP_002317118.2| hypothetical protein POPTR_0011s00710g [Populus trichocarpa]
 gb|EEE97730.2| hypothetical protein POPTR_0011s00710g [Populus trichocarpa]
Length=300

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R +M++LRD G++AG+CK++WE+     AGD+E++DV  S      +RYIV++  + E
Sbjct  114  FKRGLMSHLRDRGFDAGLCKSRWEKFGRHPAGDYEYVDVNVSG-----KRYIVEVFLAGE  168

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F IARPT+H+  L++  P+V++GK EE+K+IV++M  A + S K  G+ + PWR+  +ME
Sbjct  169  FIIARPTSHYTELLQVFPRVYIGKPEEVKQIVRLMCNAMRESMKGVGMPVAPWRRYGYME  228

Query  325  NKWFGSYRRSTNFRPA  278
             KWFG Y+R+TN  P+
Sbjct  229  AKWFGHYKRTTNGVPS  244



>ref|XP_009354682.1| PREDICTED: uncharacterized protein LOC103945794 [Pyrus x bretschneideri]
Length=308

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 82/222 (37%), Positives = 123/222 (55%), Gaps = 21/222 (9%)
 Frame = -1

Query  871  EAGDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSP  692
            EAGD+S           D E +  +E++    D   + L  ++   VE+  + +    S 
Sbjct  75   EAGDWS-----------DSETKSSMESLF---DVKSDGLKKQIVTEVEVALAGIGDDNSS  120

Query  691  EILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFS  512
               +R +M +LR  G++AG+CK+KW +S    AGD+EF+DV       +  RYIV+    
Sbjct  121  PAFKRRLMTHLRQKGFDAGLCKSKWVKSSRFPAGDYEFVDV-----NLKGTRYIVEPFLV  175

Query  511  SEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRF  332
             EFEIARPT  +  L+   P  FVG+ +ELKKIV++M  A K+S KS  + +PPWR+  +
Sbjct  176  REFEIARPTTRYTSLLDVFPNTFVGEVDELKKIVRLMCTAIKQSMKSVDMSMPPWRRNGY  235

Query  331  MENKWFGSYRRSTNFRPASMELLAPLD--QALAVKCRSVGFD  212
            M+ KWFGSY+R+TN   +S    A L+         RS+GF+
Sbjct  236  MQAKWFGSYKRTTNAVASSAAANATLESNHGFGGVQRSMGFE  277



>ref|XP_008228999.1| PREDICTED: uncharacterized protein LOC103328386 [Prunus mume]
Length=290

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR  +   L DFGYN  +CK+KW  S    AG+H +++VL + S+    R +++L F +E
Sbjct  121  LRNELCNRLIDFGYNCAICKSKWRSSTSTPAGEHTYLEVLDTSSKRGEIRVVIELNFRAE  180

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FE+AR + ++  LI  LP+VFVGK+E L+ ++K++  AAK+  K + +HL PWRK ++M+
Sbjct  181  FEMARASENYNRLISWLPEVFVGKAERLRALIKILCCAAKKCMKEKKMHLGPWRKHKYMQ  240

Query  325  NKWFGSYRRSTNFRPASM  272
             KWFG++ RST   P S+
Sbjct  241  AKWFGTFERST---PGSL  255



>ref|XP_011027386.1| PREDICTED: uncharacterized protein LOC105127700 [Populus euphratica]
Length=388

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 103/164 (63%), Gaps = 9/164 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA    +   +L    N  +  + LR+ V   L   GY++ +CK+KW++
Sbjct  139  IPCASVAERNLLA----DTAMILEKNKNHKQKDDFLRKMVADGLTSLGYHSSICKSKWDK  194

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG+++++DV+  +     +R I+D++F SEFEIAR T  ++ +++SLP +FVGKS
Sbjct  195  SPSFPAGEYKYVDVIIEE-----ERLIIDIDFKSEFEIARSTGAYKAILQSLPYIFVGKS  249

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            + L +IV V+S+AAK+S K +G+H PPWRK  +M  KW   Y R
Sbjct  250  DRLGQIVSVVSEAAKQSLKKKGMHFPPWRKAEYMRAKWLSPYTR  293



>ref|XP_010917637.1| PREDICTED: uncharacterized protein LOC105042213 [Elaeis guineensis]
Length=387

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 110/194 (57%), Gaps = 8/194 (4%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEIL  683
            D+ G D       S    E     + C   + RN+LA    +A  ++ +     K  E  
Sbjct  104  DFPGGDPSPIIATSSDAAEVVKGLVLCTSVAERNLLA----DASNIMENFTKMGKGKEDS  159

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            RR V   LR  GY+A +CK++WE+S    AG++E++DV+ +  +    R +VD++F SEF
Sbjct  160  RRAVADGLRALGYDAAICKSRWEKSPSFPAGEYEYVDVIVAGGE----RLLVDVDFRSEF  215

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIAR T  ++ +++SLP VFVGK + L++IV V  +AA++S K +GLH PPWRK  +M  
Sbjct  216  EIARSTKIYRAVLQSLPSVFVGKEDRLQQIVAVACEAARQSLKKKGLHFPPWRKLEYMRA  275

Query  322  KWFGSYRRSTNFRP  281
            KW   + R+    P
Sbjct  276  KWLSPFERTAPIIP  289



>ref|XP_010440433.1| PREDICTED: uncharacterized protein LOC104723736 [Camelina sativa]
Length=355

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 113/176 (64%), Gaps = 11/176 (6%)
 Frame = -1

Query  799  VETINCGEDSFRNVL-ASRVSEAVELLSSCLNSSKSPEI-----LRRHVMAYLRDFGYNA  638
            V++ N   D F++++  + V E   L  +     K+  I     LR+ ++  L   GY++
Sbjct  113  VDSFNVAYDDFKSLIPCASVVEKTLLTEAAKAIEKNKSIKRKDELRKIIVVQLSSLGYDS  172

Query  637  GVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRS  458
             +CK+KW++S  I AG++E+IDV+ +      +R ++D++F SEFEIAR T++++ L++S
Sbjct  173  SICKSKWDKSRSIPAGEYEYIDVIVNG-----ERILIDVDFRSEFEIARQTSNYKVLLQS  227

Query  457  LPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
            LP +FVGKS+ L +IV ++S+AAK+S K + +H PPWRK  +M  KW  SY R+ +
Sbjct  228  LPLIFVGKSDRLLQIVSMVSEAAKQSLKKKCMHFPPWRKADYMRAKWLSSYTRNNS  283



>gb|KHN02542.1| hypothetical protein glysoja_002566 [Glycine soja]
Length=264

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 110/196 (56%), Gaps = 10/196 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            + C   S RN+LA       +  ++C    +  +  R+ V   L   GY+A VCK++WE+
Sbjct  41   VTCASVSERNLLADTTKIIEKNKTTC---KRKDDCCRKIVTEALLALGYDASVCKSRWEK  97

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E+IDV+        +R +VD++F SEFEIARPT  ++ ++++LP VFVG  
Sbjct  98   STFCPAGEYEYIDVIMGK-----ERVVVDVDFRSEFEIARPTKTYKAILQTLPYVFVGTC  152

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS--MELLAP  257
            E L+ IV + S+AAK S K RG+H+PPWRK  ++  KW   Y  S   +  +   E LA 
Sbjct  153  ERLQSIVAIASEAAKLSLKKRGMHVPPWRKVEYVTAKWLSPYTCSRGVKEETEEKEHLAK  212

Query  256  LDQALAVKCRSVGFDD  209
                L+  C S   DD
Sbjct  213  ELVVLSTSCGSFREDD  228



>ref|XP_008358764.1| PREDICTED: uncharacterized protein LOC103422480 [Malus domestica]
Length=273

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 97/156 (62%), Gaps = 5/156 (3%)
 Frame = -1

Query  757  LASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEF  578
            L   +++ VE+  + +   KS    +R +M +LR  G++AG+CK+KW +S    AGDHEF
Sbjct  112  LKKTIADEVEVALAGIGXDKSSRAFKRRLMTHLRHKGFDAGLCKSKWVKSSRFPAGDHEF  171

Query  577  IDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMS  398
            +DV  + +     RY+V+     +FEIARPT  +  L+   P  FVG+ +ELKKIV++M 
Sbjct  172  VDVNLNGT-----RYVVEPFLVGQFEIARPTTRYTSLLEVFPNTFVGEVDELKKIVRLMC  226

Query  397  KAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
             A K+S KS  + +PPWR+  +M+ KWF SY R+T 
Sbjct  227  TAIKKSMKSVDMPMPPWRRNGYMQAKWFESYNRTTT  262



>ref|XP_002868272.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44531.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=336

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 113/172 (66%), Gaps = 14/172 (8%)
 Frame = -1

Query  790  INCGEDSFRNVL--ASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I CG    +N+L  AS++ E  +       S K  + LR+ V+  L   GY++ +CK+KW
Sbjct  114  IQCGSFVEKNLLVEASKIIEKNK-------SVKRKDELRKIVVDELLFLGYDSSICKSKW  166

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVG  437
            ++S  I AG++E+IDV+ +      +R+++D++F SEFEIAR T+ ++ L++SLP +FVG
Sbjct  167  DKSRSIPAGEYEYIDVIVNG-----ERFLIDVDFRSEFEIARQTSCYKELLQSLPLIFVG  221

Query  436  KSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRP  281
            KS+ +++IV ++S+AAK+S K + +H PPWRK  +M  KW  SY R +  +P
Sbjct  222  KSDRIRQIVSMVSEAAKQSLKKKDMHFPPWRKADYMRAKWLSSYTRDSGKKP  273



>ref|XP_010493642.1| PREDICTED: uncharacterized protein LOC104770875 [Camelina sativa]
Length=292

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 95/146 (65%), Gaps = 4/146 (3%)
 Frame = -1

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++   +N+S+     +RH M YLR  G++AG+CK++W +    TAG +E++DV   D   
Sbjct  96   IMDVAVNASRFVVGEKRHFMGYLRGKGFDAGLCKSRWVKFGKNTAGKYEYVDVKGGDEN-  154

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
               RYIV+   + EFEIARPT  +  L+  +P+VFVG  EELK++V++MS    RS K  
Sbjct  155  ---RYIVETNLAGEFEIARPTTRYLSLLAHIPRVFVGTPEELKQLVRIMSFEISRSMKRA  211

Query  367  GLHLPPWRKQRFMENKWFGSYRRSTN  290
             +++PPWR+  +M+ KWFG Y+R++N
Sbjct  212  EIYVPPWRRNGYMQAKWFGHYKRTSN  237



>ref|XP_007222776.1| hypothetical protein PRUPE_ppa006575mg [Prunus persica]
 gb|EMJ23975.1| hypothetical protein PRUPE_ppa006575mg [Prunus persica]
Length=405

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 92/142 (65%), Gaps = 5/142 (4%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            R+ V   L   GY++ +CK+KWE+S    AG++E+IDV+         R ++D++F SEF
Sbjct  187  RKAVTDGLNSLGYDSSICKSKWEKSSSFPAGEYEYIDVMVEG-----DRLLIDIDFRSEF  241

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            E+AR T  ++ +++SLP +FVGKS+ L +IV ++S+AAK+S K +G+H PPWRK  +M  
Sbjct  242  EVARSTGPYKAVLQSLPYIFVGKSDRLGQIVSIVSEAAKQSLKKKGMHFPPWRKAEYMRA  301

Query  322  KWFGSYRRSTNFRPASMELLAP  257
            KW   Y R+T   P +    AP
Sbjct  302  KWLSPYTRATAINPQNDAAPAP  323



>ref|XP_007036590.1| Uncharacterized protein TCM_012425 [Theobroma cacao]
 gb|EOY21091.1| Uncharacterized protein TCM_012425 [Theobroma cacao]
Length=307

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (57%), Gaps = 25/204 (12%)
 Frame = -1

Query  820  DGELEDEVETINCGEDSFR-NVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGY  644
            DG  EDE++   C E      ++  R+S+                  +R +M+ LRD G+
Sbjct  96   DGNQEDEMKQKICRETELACGIIGDRLSKD----------------FKRQLMSRLRDKGF  139

Query  643  NAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLI  464
            +AG+CK++W++     AG++E++DV  + +      YIV++  + EFEIARPT  +  L+
Sbjct  140  DAGLCKSQWKKLRYYPAGNYEYVDVNVNGTC-----YIVEVNLAREFEIARPTTSYASLL  194

Query  463  RSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFR  284
              LP ++VGKS++LK+IVK+   A + S K R +H+PPWR   +M++KWF SYRR+ N  
Sbjct  195  EVLPPIYVGKSKDLKQIVKLTCTAMRESMKRRDMHMPPWRLSGYMQSKWFASYRRTVNEL  254

Query  283  PASMELLAPLDQALAVKCRSVGFD  212
            PA     AP     A   R VGFD
Sbjct  255  PARD---APEFNDSAPAKRPVGFD  275



>ref|XP_002283882.1| PREDICTED: uncharacterized protein LOC100251040 [Vitis vinifera]
 ref|XP_010649979.1| PREDICTED: uncharacterized protein LOC100251040 [Vitis vinifera]
Length=386

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 11/166 (7%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA   ++ VE      N  K  + L   VM  L   GY+A +CK++WE+
Sbjct  139  IPCASVAERNLLAD-TAKIVEK-----NKIKPKDDLTTIVMDGLSALGYDASICKSRWEK  192

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++EFIDV+        +R ++D++F SEFEIAR T  ++ +++SLP +FVGK 
Sbjct  193  SPSYPAGEYEFIDVIVDG-----ERLLIDIDFRSEFEIARSTGVYKAILQSLPYIFVGKP  247

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + L++IV ++S+AAK+S K +G+H PPWRK  +M  KW   Y R+T
Sbjct  248  DRLQQIVSIVSEAAKQSLKKKGMHFPPWRKSEYMRAKWLSPYTRTT  293



>gb|EPS71668.1| hypothetical protein M569_03091 [Genlisea aurea]
Length=343

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 116/182 (64%), Gaps = 14/182 (8%)
 Frame = -1

Query  838  LPPCNSDGELEDEV--ETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMA  665
            L P +S  +L D +    I C     RN+LA   S+ VE       ++K+   LRR V  
Sbjct  111  LTPTSSFTDLSDTLLKSLIPCASVGERNLLAD-TSKIVE------KNNKAKGDLRRSVAD  163

Query  664  YLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPT  485
             L+  GY+A VC++KWE++  + AG++E+IDV+        +R IVD++F SEFEIAR T
Sbjct  164  GLQSLGYDASVCRSKWEKTPSVPAGEYEYIDVIIEG-----ERVIVDVDFRSEFEIARST  218

Query  484  NHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSY  305
            + ++ +++ LP+VFVGKS+ L +IV V ++AA++S K +G+H+ PWR+  ++++KW G +
Sbjct  219  SSYKAILQILPQVFVGKSDRLLQIVSVATEAARQSLKKKGMHMAPWRRPEYVKSKWLGPH  278

Query  304  RR  299
             R
Sbjct  279  TR  280



>ref|XP_006447294.1| hypothetical protein CICLE_v10016109mg [Citrus clementina]
 ref|XP_006469874.1| PREDICTED: uncharacterized protein LOC102626752 [Citrus sinensis]
 gb|ESR60534.1| hypothetical protein CICLE_v10016109mg [Citrus clementina]
 gb|KDO53899.1| hypothetical protein CISIN_1g022512mg [Citrus sinensis]
Length=296

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            +R+ +   L++ GYN  +CK+KW+ S  I AG+H +++V+    +  + R +++L F +E
Sbjct  114  MRKEISVRLQNVGYNCVICKSKWKSSSEIPAGNHTYLEVVEKSKKGDVIRVVIELNFRAE  173

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FE+AR +  +  L+  LP+VFVGK+E LK ++K+M  AAK+  K + +H+ PWRK ++M+
Sbjct  174  FEMARASEEYNRLVNRLPEVFVGKTERLKAVIKIMCAAAKKCMKEKKMHIAPWRKHKYMQ  233

Query  325  NKWFGSYRRST  293
             KW G Y+R T
Sbjct  234  AKWLGGYQRPT  244



>ref|XP_002317198.2| hypothetical protein POPTR_0011s00710g [Populus trichocarpa]
 gb|EEE97810.2| hypothetical protein POPTR_0011s00710g [Populus trichocarpa]
Length=335

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 96/136 (71%), Gaps = 5/136 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R +M++LRD G++AG+CK++WE+     AGD+E++DV  S      +RYIV++  + E
Sbjct  149  FKRGLMSHLRDRGFDAGLCKSRWEKFGRHPAGDYEYVDVNVSG-----KRYIVEVFLAGE  203

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F IARPT+H+  L++  P+V++GK EE+K+IV++M  A + S K  G+ + PWR+  +ME
Sbjct  204  FIIARPTSHYTELLQVFPRVYIGKPEEVKQIVRLMCNAMRESMKGVGMPVAPWRRYGYME  263

Query  325  NKWFGSYRRSTNFRPA  278
             KWFG Y+R+TN  P+
Sbjct  264  AKWFGHYKRTTNGVPS  279



>ref|XP_007198935.1| hypothetical protein PRUPE_ppa009489mg [Prunus persica]
 gb|EMJ00134.1| hypothetical protein PRUPE_ppa009489mg [Prunus persica]
Length=290

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR  +   L DFGYN  +CK+KW  S    AG+H +++VL + S+    R +++L F +E
Sbjct  121  LRNELCNRLIDFGYNCVICKSKWRSSTSTPAGEHTYLEVLDTSSKRGEIRVVIELNFRAE  180

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FE+AR + ++  LI  LP+VFVGK+E L+ ++K++  AAK+  K + +HL PWRK ++M+
Sbjct  181  FEMARASENYNRLISWLPEVFVGKAERLRALIKILCCAAKKCMKEKKMHLGPWRKHKYMQ  240

Query  325  NKWFGSYRRSTNFRPASM  272
             KWFG++ RST   P S+
Sbjct  241  AKWFGTFERST---PGSL  255



>ref|XP_010923500.1| PREDICTED: uncharacterized protein LOC105046575 [Elaeis guineensis]
Length=375

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 106/166 (64%), Gaps = 13/166 (8%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            + C   + RN+LA          S  L  +K+ +  RR V   L+  GY+A +CK++WE+
Sbjct  132  VPCASVAERNLLAD--------ASRILEKNKNKDDCRRIVTDGLQSLGYDASICKSRWEK  183

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            +    AG++E++DV+ +      +R +VD++F SEFEIAR T  ++ +++SLP +FVGK 
Sbjct  184  TPSFPAGEYEYVDVIVAG-----ERLLVDVDFRSEFEIARSTKTYRAVLQSLPSIFVGKP  238

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + L++IV V+S+AA++S K +GL  PPWRK  +M+ KW   Y+R+T
Sbjct  239  DRLQQIVAVVSEAARQSMKKKGLSFPPWRKPEYMKAKWLSPYQRTT  284



>ref|XP_008802272.1| PREDICTED: uncharacterized protein LOC103716163 [Phoenix dactylifera]
Length=377

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 118/194 (61%), Gaps = 13/194 (7%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVETIN----CGEDSFRNVLASRVSEAVELLSSCLNSSKS  695
            D S  + D+P  ++     D  E +     C   + RN+LA   S+ VE   +  N    
Sbjct  102  DSSDDEFDVPAGDASATSGDAAEILKGLVPCASVAERNLLAD-ASKIVEKNKTWRNK---  157

Query  694  PEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEF  515
             +  RR V   L+  GY+A +CK++WE++    +G++E++DV+ +  +    R +VD++F
Sbjct  158  -DDCRRIVTDDLQFLGYDASICKSRWEKTPSFPSGEYEYLDVIVAGGE----RLLVDVDF  212

Query  514  SSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQR  335
             SEFEIAR T H++ +++SLP VFVGK + L++I+ V+S+AA++S K +GL  PPWRK  
Sbjct  213  RSEFEIARSTKHYRAVLQSLPLVFVGKPDRLQQIIAVVSEAARQSLKKKGLSFPPWRKPE  272

Query  334  FMENKWFGSYRRST  293
            +M+ KW   Y+RST
Sbjct  273  YMKAKWLSPYQRST  286



>ref|XP_010679147.1| PREDICTED: uncharacterized protein LOC104894580 [Beta vulgaris 
subsp. vulgaris]
Length=372

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 102/164 (62%), Gaps = 10/164 (6%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            + C   + RNVLA       E       + K  + LR+ V+  L   GY+A +CK+KWE+
Sbjct  123  VVCASMNERNVLADTAKIVAEK-----KTCKRKDELRKVVIEGLMALGYDAAICKSKWEK  177

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E++DV+        +R I+D++F SEFE+AR T  ++ ++++LP +FVGKS
Sbjct  178  SPSFPAGEYEYVDVIVGG-----ERLIIDIDFRSEFEVARSTKTYKSILQTLPHIFVGKS  232

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            + L KI+ ++S+AAK+S K +GLH+PPWRK  +++ KW     R
Sbjct  233  DRLSKIICILSEAAKQSLKKKGLHIPPWRKADYVQAKWLSPSTR  276



>emb|CBI26338.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 11/166 (7%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA   ++ VE      N  K  + L   VM  L   GY+A +CK++WE+
Sbjct  139  IPCASVAERNLLAD-TAKIVEK-----NKIKPKDDLTTIVMDGLSALGYDASICKSRWEK  192

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++EFIDV+        +R ++D++F SEFEIAR T  ++ +++SLP +FVGK 
Sbjct  193  SPSYPAGEYEFIDVIVDG-----ERLLIDIDFRSEFEIARSTGVYKAILQSLPYIFVGKP  247

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + L++IV ++S+AAK+S K +G+H PPWRK  +M  KW   Y R+T
Sbjct  248  DRLQQIVSIVSEAAKQSLKKKGMHFPPWRKSEYMRAKWLSPYTRTT  293



>gb|KFK23657.1| hypothetical protein AALP_AAs70636U000200 [Arabis alpina]
Length=348

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 106/165 (64%), Gaps = 9/165 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLN----SSKSPEILRRHVMAYLRDFGYNAGVCKA  623
            +N   D F++++         LLS         +KS   L++ V+  L   GY++ +CK+
Sbjct  120  LNDAYDHFKSLIPCESITEKNLLSDTTKILEKKNKSKTDLKKIVVNGLLSLGYDSSICKS  179

Query  622  KWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVF  443
            KW++S  I AG++E+IDV+      + +R+I+D++F SEFEIAR TN ++ LI+SLP +F
Sbjct  180  KWDKSRSIPAGEYEYIDVIV-----KGERFIIDVDFRSEFEIARQTNSYKALIQSLPFIF  234

Query  442  VGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGS  308
            VGKS+ + KIV ++S+AAK+S K +G+H PPWRK  +M  KW  S
Sbjct  235  VGKSDRILKIVSLVSEAAKQSLKKKGMHFPPWRKGDYMRAKWLSS  279



>ref|XP_006417274.1| hypothetical protein EUTSA_v10009327mg [Eutrema salsugineum]
 gb|ESQ35627.1| hypothetical protein EUTSA_v10009327mg [Eutrema salsugineum]
Length=296

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = -1

Query  682  RRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEF  503
            +RH+MA+LR+ G++AG+CK++WER    T G +E++DV   D      R+IV+   + EF
Sbjct  114  KRHMMAFLRNKGFDAGLCKSRWERFGKNTPGRYEYVDVNGEDKN----RFIVETNLAGEF  169

Query  502  EIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMEN  323
            EIARPT  +  L+  LP+VFVG  EELK++V++M    +RS +  G+ +PPWR+  +++ 
Sbjct  170  EIARPTTRYLSLLAQLPRVFVGTPEELKQLVRIMCFEIRRSMRRAGIDVPPWRRNGYLQA  229

Query  322  KWFGSYRRSTN  290
            KWFG Y+R++N
Sbjct  230  KWFGHYKRTSN  240



>ref|XP_010932848.1| PREDICTED: uncharacterized protein LOC105053412 isoform X2 [Elaeis 
guineensis]
Length=377

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 114/199 (57%), Gaps = 18/199 (9%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGE-----LEDEVETIN----CGEDSFRNVLASRVSEAVELLSSCL  710
            D S  D+D P   SD         D  E +     C   + RN+LA    +A +++ +  
Sbjct  100  DSSDVDTDFPATTSDAPPIIPTTSDAAEFVKGLVLCTSVAERNLLA----DASKIVENTR  155

Query  709  NSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYI  530
               K  E  RR V   LR  GY+A VCK++W+++    AG++ ++DV+ +      +R +
Sbjct  156  IGGKGKEDSRRAVADSLRALGYDAAVCKSRWDKAPSFPAGEYVYVDVIVAK-----ERLL  210

Query  529  VDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPP  350
            VD++F SEFEIAR T  ++ +++ LP +FVGK + L++IV V+ +AA++S K +GLH PP
Sbjct  211  VDVDFRSEFEIARSTKSYRAVLQLLPSIFVGKEDRLQQIVAVVCEAARQSLKKKGLHFPP  270

Query  349  WRKQRFMENKWFGSYRRST  293
            WRK  +M  KW  SY R+ 
Sbjct  271  WRKPEYMRAKWLSSYERTA  289



>ref|XP_009145248.1| PREDICTED: uncharacterized protein LOC103868952 [Brassica rapa]
Length=367

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 116/176 (66%), Gaps = 11/176 (6%)
 Frame = -1

Query  817  GELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYN  641
            G+  D +++ + C   + RN+LA    +A +++     S K  E LR+ +   L    Y+
Sbjct  125  GDASDHIKSLVTCVSLAERNLLA----DAAKIVDKN-RSVKRKEDLRKLLNEGLLSLHYD  179

Query  640  AGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIR  461
            + +CK+KWE+S    AG++E+IDV+  +     +R ++D++F SEF+IAR T+ ++ L++
Sbjct  180  SSLCKSKWEKSPSFPAGEYEYIDVIVGE-----ERLLIDVDFRSEFDIARQTSGYKALLQ  234

Query  460  SLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            SLP +FVGKS+ L +IV ++S+AAK+S K RG+HLPPWRK  +M +KW  SY R++
Sbjct  235  SLPFIFVGKSDRLTQIVSLISEAAKQSLKKRGMHLPPWRKAEYMRSKWMSSYTRAS  290



>ref|XP_009769679.1| PREDICTED: uncharacterized protein LOC104220495 isoform X3 [Nicotiana 
sylvestris]
Length=320

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 117/191 (61%), Gaps = 11/191 (6%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            D+S   SD    +S G+  D +++ I C   + RN+LA   S+ VE   SC    K  + 
Sbjct  116  DFSTGFSDSVTNSSFGDSSDTLKSLIPCASVAERNLLAD-TSKIVEKHKSC----KRKDD  170

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR+ V   L   GY A  CK+KWE++  + AG++E+IDV         +R ++DL+F SE
Sbjct  171  LRKVVTDELLALGYKASTCKSKWEKTSSVPAGEYEYIDVTVEG-----ERVMIDLDFRSE  225

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIAR T +++ +++ LP +FVGK++  ++IV ++S+AA++S K +G+H+ PWRK  +M+
Sbjct  226  FEIARSTGNYKAVLQLLPFIFVGKADRTQQIVSIVSEAARQSLKKKGMHIAPWRKPEYMK  285

Query  325  NKWFGSYRRST  293
             KW   Y R T
Sbjct  286  AKWLSPYSRIT  296



>gb|KHG04385.1| hypothetical protein F383_28528 [Gossypium arboreum]
Length=402

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 123/191 (64%), Gaps = 17/191 (9%)
 Frame = -1

Query  859  YSGSDSDLPPCNSDGELEDEVET-INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPE  689
            +  SDS+L   +S  E  + +++ + CG  + RN+LA  +R+ E  ++      S +  +
Sbjct  122  FGFSDSNL---SSSAEASEILKSLVPCGSVNERNLLAHTARIMEKNKI------SKRKDD  172

Query  688  ILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSS  509
            I R+ V+  L  FGY+A +CK++WE+S    AG++E+IDV+        +R ++D++F S
Sbjct  173  ICRKIVIDGLLAFGYDASICKSRWEKSPSYPAGEYEYIDVIIDG-----ERLLIDIDFRS  227

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFEIAR T  ++ +++ LP +FVGK++ L++I+ ++S+AAK+S K +G+H+PPWRK  ++
Sbjct  228  EFEIARSTKTYKSILQMLPFIFVGKADRLQRIIAIVSEAAKQSLKKKGMHIPPWRKAEYV  287

Query  328  ENKWFGSYRRS  296
              KW   Y R+
Sbjct  288  SAKWLSPYNRA  298



>ref|XP_002883389.1| hypothetical protein ARALYDRAFT_479805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59648.1| hypothetical protein ARALYDRAFT_479805 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 122/191 (64%), Gaps = 12/191 (6%)
 Frame = -1

Query  859  YSGSDSDLPPCNSDG-ELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            YS  +SDL   + DG +  D +++ + C     RN+LA    +A +++     S K  + 
Sbjct  111  YSDDESDLFGGSIDGCDASDHLKSLVPCATVDERNLLA----DAAKIVDKN-KSVKRKDD  165

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            +++ V   L    YN+ +CK+KW++S    AG++E+IDV+  +     +R I+D++F SE
Sbjct  166  MKKIVNEGLLSLNYNSSICKSKWDKSPSFPAGEYEYIDVIIGE-----ERLIIDVDFRSE  220

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F+IAR T+ ++ L++SLP +FVGKS+ L +IV ++S+AAK+S K +G+H PPWRK  +M 
Sbjct  221  FDIARQTSGYKALLQSLPFIFVGKSDRLSQIVFLISEAAKQSLKKKGMHFPPWRKAEYMR  280

Query  325  NKWFGSYRRST  293
            +KW  SY R++
Sbjct  281  SKWLSSYTRAS  291



>ref|XP_009769678.1| PREDICTED: uncharacterized protein LOC104220495 isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   135 bits (340),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 117/191 (61%), Gaps = 11/191 (6%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            D+S   SD    +S G+  D +++ I C   + RN+LA   S+ VE   SC    K  + 
Sbjct  116  DFSTGFSDSVTNSSFGDSSDTLKSLIPCASVAERNLLAD-TSKIVEKHKSC----KRKDD  170

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR+ V   L   GY A  CK+KWE++  + AG++E+IDV         +R ++DL+F SE
Sbjct  171  LRKVVTDELLALGYKASTCKSKWEKTSSVPAGEYEYIDVTVEG-----ERVMIDLDFRSE  225

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIAR T +++ +++ LP +FVGK++  ++IV ++S+AA++S K +G+H+ PWRK  +M+
Sbjct  226  FEIARSTGNYKAVLQLLPFIFVGKADRTQQIVSIVSEAARQSLKKKGMHIAPWRKPEYMK  285

Query  325  NKWFGSYRRST  293
             KW   Y R T
Sbjct  286  AKWLSPYSRIT  296



>dbj|BAD93802.1| hypothetical protein [Arabidopsis thaliana]
Length=341

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 111/166 (67%), Gaps = 10/166 (6%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I CG  SF  V  S + EA +++     S K  + LR+ V+  L   GY++ +CK+KW++
Sbjct  113  IQCG--SF--VEKSLLVEATKIIEKN-KSVKRKDELRKIVVDELSSLGYDSSICKSKWDK  167

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            +  I AG++E+IDV+ +      +R I+ ++F SEFEIAR T+ ++ L++SLP +FVGKS
Sbjct  168  TRSIPAGEYEYIDVIVNG-----ERLIIVIDFRSEFEIARQTSGYKELLQSLPLIFVGKS  222

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + +++IV ++S+A+K+S K +G+H PPWRK  +M  KW  SY R++
Sbjct  223  DRIRQIVSIVSEASKQSLKKKGMHFPPWRKADYMRAKWLSSYTRNS  268



>ref|XP_011000665.1| PREDICTED: uncharacterized protein LOC105108166 [Populus euphratica]
Length=335

 Score =   135 bits (340),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 95/136 (70%), Gaps = 5/136 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R +M++LRD G++AG+CK++WE+     AGD+E++DV  S      +RYIV++  + E
Sbjct  149  FKRGLMSHLRDRGFDAGLCKSRWEKFGRHPAGDYEYVDVNFSG-----KRYIVEVFLAGE  203

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F IARPTNH+  L++  P+V++GK EE+K+IV++M  A + S K  G+ + PWR+  ++E
Sbjct  204  FIIARPTNHYTELLQVFPRVYIGKPEEVKQIVRLMCNAMRESMKGVGMPVAPWRRHGYLE  263

Query  325  NKWFGSYRRSTNFRPA  278
             KWFG Y+R+ N  P+
Sbjct  264  AKWFGHYKRTANEVPS  279



>ref|XP_008775344.1| PREDICTED: uncharacterized protein LOC103695730 [Phoenix dactylifera]
Length=382

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 112/196 (57%), Gaps = 22/196 (11%)
 Frame = -1

Query  847  DSDLPPCNSDGE-----LEDEVETIN----CGEDSFRNVLA--SRVSEAVELLSSCLNSS  701
            D+D P    D         D  E +     C   + RN+LA  SR+ E  ++        
Sbjct  103  DTDFPAVTGDAPPIIPTTSDAAEFVKGLVLCTSVAERNLLADASRIVENTKI------GG  156

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
            K  E  RR V   LR  GY+A VCK++WE+S    AG++ ++DV+ +      +R +VD+
Sbjct  157  KWTEDSRRAVADGLRALGYDAAVCKSRWEKSTSFPAGEYVYVDVIVTR-----ERLLVDV  211

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
            +F SEFEIAR T  ++ +++SLP +FVGK + L++IV V+ +AA++S K +GLH PPWRK
Sbjct  212  DFRSEFEIARSTKSYRAVLQSLPCIFVGKEDRLQQIVAVVCEAARQSLKKKGLHFPPWRK  271

Query  340  QRFMENKWFGSYRRST  293
              +M  KW  SY R+ 
Sbjct  272  PEYMRAKWLSSYERTA  287



>ref|XP_006383826.1| hypothetical protein POPTR_0004s00300g [Populus trichocarpa]
 gb|ERP61623.1| hypothetical protein POPTR_0004s00300g [Populus trichocarpa]
Length=301

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 94/131 (72%), Gaps = 5/131 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +  +M+ LRD G++AG+CK++WE+     AGD+E++DV+ S +     RYIV++ F+ E
Sbjct  114  FKHRLMSRLRDRGFDAGLCKSRWEKFGRHPAGDYEYVDVIVSGN-----RYIVEVFFAGE  168

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIARPT+ +  L+   P+V+VG  E++K+IV++M  A + S K+ G+H+PPWR+  +++
Sbjct  169  FEIARPTSRYAELLDVFPRVYVGTPEDVKQIVRLMCNAMRESMKAVGMHVPPWRRNGYLQ  228

Query  325  NKWFGSYRRST  293
             KWFG Y+R+T
Sbjct  229  AKWFGHYKRTT  239



>ref|XP_011015003.1| PREDICTED: uncharacterized protein LOC105118693 [Populus euphratica]
Length=290

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = -1

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
            +S +  +  +M+ LRD G++AG+CK++WE+     AGD+E++DV  S +     RYIV++
Sbjct  110  RSSQSFKHRLMSRLRDRGFDAGLCKSRWEKFGRHPAGDYEYVDVNVSGN-----RYIVEV  164

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
             F+ EFEIARPT+ +  L+   P+V+VG  E++K+IV++M  A + S K+ G+H+PPWR+
Sbjct  165  FFAGEFEIARPTSRYAELLDVFPRVYVGTPEDVKQIVRLMCNAMRESMKAVGMHVPPWRR  224

Query  340  QRFMENKWFGSYRRST  293
            + +++ KWFG Y+R+T
Sbjct  225  EGYLQAKWFGHYKRTT  240



>ref|XP_009349771.1| PREDICTED: uncharacterized protein LOC103941304 [Pyrus x bretschneideri]
Length=404

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 107/172 (62%), Gaps = 12/172 (7%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I C   S RN+LA  +R+ EA +       + K  + LR+ V   L+  GY++  CK+KW
Sbjct  157  IPCVSVSERNLLADTARIVEANKN-----KNIKQKDDLRKMVTDGLQSLGYDSSTCKSKW  211

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVG  437
            E+S    AG++E+IDV         +R ++D++F SEFE+AR T  ++ +++SLP +FVG
Sbjct  212  EKSSSFPAGEYEYIDVTVEG-----ERLLIDIDFRSEFEVARSTGAYKAVLQSLPYIFVG  266

Query  436  KSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRP  281
            KS+ L +IV ++S+AA++S K +G+H PPWRK  +M  KW   Y R+   RP
Sbjct  267  KSDRLAQIVSIVSEAARQSLKKKGMHFPPWRKAEYMRAKWLSPYTRTAVPRP  318



>ref|XP_008674671.1| PREDICTED: uncharacterized protein LOC103650854 [Zea mays]
 tpg|DAA56168.1| TPA: hypothetical protein ZEAMMB73_392643 [Zea mays]
Length=294

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 6/163 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLR----SDSQNRIQRYIVDLE  518
             RR V   LR  GY+AGVC+++WE S GITAG +E++DV+          +  RYIVD +
Sbjct  119  FRRAVAWRLRGAGYDAGVCRSRWEASGGITAGAYEYVDVVAPAPVGPGARQRARYIVDAD  178

Query  517  FSSEFEIARPTNHFQYLIRSLPKVFVGKSEE-LKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
            F +  E+AR T  +  ++ ++P   V   EE +   V+V S AA+RS ++ GLH+PPWRK
Sbjct  179  FRAGLEVARATPEYAAVVAAVPAPAVVAREEAVGHAVRVASDAARRSLRAHGLHVPPWRK  238

Query  340  QRFMENKWFGSYRRSTNFRPASMELLA-PLDQALAVKCRSVGF  215
             R+M  KW G Y+RST   PA++  +  P    L VKCR+VGF
Sbjct  239  TRYMLAKWLGPYKRSTATSPAAVGAMPMPGGAGLDVKCRAVGF  281



>ref|XP_011011083.1| PREDICTED: uncharacterized protein LOC105115767 [Populus euphratica]
Length=302

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = -1

Query  700  KSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDL  521
            +S +  +  +M+ LRD G++AG+CK++WE+     AGD+E++DV  S +     RYIV++
Sbjct  110  RSSQSFKHRLMSRLRDRGFDAGLCKSRWEKFGRHPAGDYEYVDVNVSGN-----RYIVEV  164

Query  520  EFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRK  341
             F+ EFEIARPT+ +  L+   P+V+VG  E++K+IV++M  A + S K+ G+H+PPWR+
Sbjct  165  FFAGEFEIARPTSRYAELLDVFPRVYVGTPEDVKQIVRLMCNAMRESMKAVGMHVPPWRR  224

Query  340  QRFMENKWFGSYRRST  293
            + +++ KWFG Y+R+T
Sbjct  225  EGYLQAKWFGHYKRTT  240



>ref|XP_010924640.1| PREDICTED: uncharacterized protein LOC105047424 [Elaeis guineensis]
Length=278

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = -1

Query  679  RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVL---RSDSQNRIQRYIVDLEFSS  509
            RHV   LR+ GYN+ +CK+KW RS  I +G+H ++DV+   ++  +N I R I++L F +
Sbjct  113  RHVTERLREAGYNSALCKSKWSRSLDIPSGEHSYVDVVMEAKNGKRNPI-RVIIELNFRA  171

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFE+AR +  + +L+  LP+VFVG+SE+LK ++K+M  AAK+  K   +HL PWRK ++M
Sbjct  172  EFEMARASEEYNHLVNCLPEVFVGRSEKLKNVIKIMCTAAKKCMKDNKMHLGPWRKHKYM  231

Query  328  ENKWFGSYRR  299
            ++KW G+  R
Sbjct  232  QSKWLGTPER  241



>ref|XP_006467346.1| PREDICTED: uncharacterized protein LOC102630800 [Citrus sinensis]
Length=311

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 108/178 (61%), Gaps = 11/178 (6%)
 Frame = -1

Query  748  RVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV  569
            R+ E  E   + L  + SP   RR +M++LRD G++AG+CK++WE++     G++EF+DV
Sbjct  107  RIREETEFACTVLGDASSPAFKRR-LMSHLRDKGFDAGLCKSRWEKTAKFPCGNYEFVDV  165

Query  568  LRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAA  389
                      RYI+++  +++FEIAR T+ +  L+   P +FVGK   L++I+++M  AA
Sbjct  166  -----NLGANRYIIEVNLAAQFEIARATDGYMSLVNLFPPIFVGKPGTLRQILRLMCGAA  220

Query  388  KRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
            + S KS  L +PPWR+  +M+ KWF  Y+R+TN   ++++      +      RS+GF
Sbjct  221  RESIKSAELSVPPWRRNGYMQAKWFSPYKRTTNSVASTLKF-----EGGFASNRSIGF  273



>ref|XP_006838902.1| hypothetical protein AMTR_s00002p00269120 [Amborella trichopoda]
 gb|ERN01471.1| hypothetical protein AMTR_s00002p00269120 [Amborella trichopoda]
Length=434

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 107/185 (58%), Gaps = 10/185 (5%)
 Frame = -1

Query  715  CLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSD--SQNRI  542
            C NS      L+  V + L+  GY+A VCK+ W +S    AG++E+IDV+        + 
Sbjct  186  CTNS-----CLKSTVASKLQALGYDACVCKSIWHKSSSHPAGEYEYIDVVTQGVGPNPKP  240

Query  541  QRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGL  362
             R IVD++F SEFEIAR T H+  +++SLP +FVG+ + L +IV ++S+AAK+S K +GL
Sbjct  241  DRLIVDIDFKSEFEIARSTRHYGAVLQSLPSIFVGRPDRLHQIVAIVSEAAKQSLKKKGL  300

Query  361  HLPPWRKQRFMENKWFGSYRRSTNFRPASMELLA---PLDQALAVKCRSVGFDDAVNRRL  191
            H+PPWRK  +M  KW   Y RS     +S   +A   P    +A+K  S G+    +   
Sbjct  301  HVPPWRKPDYMRAKWLSPYLRSPQDEGSSGSCVAETFPDSVMVAIKPGSTGWGSGFSGDF  360

Query  190  LFPVV  176
             F +V
Sbjct  361  EFELV  365



>ref|XP_009337300.1| PREDICTED: uncharacterized protein LOC103929788 [Pyrus x bretschneideri]
Length=402

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 111/185 (60%), Gaps = 14/185 (8%)
 Frame = -1

Query  790  INCGEDSFRNVLA--SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKW  617
            I C   S R +LA  +R+ EA + +       K  + LR+ V   L+  GY++  CK+KW
Sbjct  157  IPCVSVSERTLLADTARIVEANKNI-------KQKDDLRKMVTDGLQSLGYDSSTCKSKW  209

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVG  437
            E+S    AG++E+IDV         +R ++D++F SEFE+AR T  ++ +++SLP +FVG
Sbjct  210  EKSSSFPAGEYEYIDVTVEG-----ERLLIDIDFRSEFEVARSTGAYKAVLQSLPYIFVG  264

Query  436  KSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAP  257
            KS+ L +IV ++S+AA++S K +G+H PPWRK  +M  KW   Y R+   RP +    A 
Sbjct  265  KSDRLGQIVSIVSEAARQSLKKKGMHFPPWRKAEYMRAKWLSPYTRTAVPRPENDTAAAT  324

Query  256  LDQAL  242
              QA+
Sbjct  325  ESQAV  329



>ref|XP_003554275.1| PREDICTED: uncharacterized protein LOC100796711 isoform X1 [Glycine 
max]
 ref|XP_006604475.1| PREDICTED: uncharacterized protein LOC100796711 isoform X2 [Glycine 
max]
 ref|XP_006604476.1| PREDICTED: uncharacterized protein LOC100796711 isoform X3 [Glycine 
max]
Length=361

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 113/203 (56%), Gaps = 10/203 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            + C   S RN+LA       +  ++C    +  +  R+ V   L   GY+A VCK++WE+
Sbjct  138  VTCASVSERNLLADTTKIIEKNKTTC---KRKDDCCRKIVTEALLALGYDASVCKSRWEK  194

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E+IDV+        +R +VD++F SEFEIARPT  ++ ++++LP VFVG  
Sbjct  195  STFCPAGEYEYIDVIMGK-----ERVVVDVDFRSEFEIARPTKTYKAILQTLPYVFVGTC  249

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPAS--MELLAP  257
            E L+ IV + S+AAK S K RG+H+PPWRK  ++  KW   Y  S   +  +   E LA 
Sbjct  250  ERLQSIVAIASEAAKLSLKKRGMHVPPWRKVEYVTAKWLSPYTCSRGVKEETEEKEHLAK  309

Query  256  LDQALAVKCRSVGFDDAVNRRLL  188
                L+  C S   DD  ++  L
Sbjct  310  ELVVLSTSCGSFREDDEKSKSKL  332



>ref|XP_002315743.2| hypothetical protein POPTR_0010s09080g [Populus trichocarpa]
 gb|EEF01914.2| hypothetical protein POPTR_0010s09080g [Populus trichocarpa]
Length=386

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 100/164 (61%), Gaps = 9/164 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA    +   +L    N  +    LR+ V   L   GYN+ +CK+KW++
Sbjct  138  IPCASVAERNLLA----DTAMILEKNKNHKQKDGFLRKIVTDGLASLGYNSSICKSKWDK  193

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E++DV+        +R ++D++F SEFEIAR T  ++ +++SLP +FVGKS
Sbjct  194  SPSFPAGEYEYVDVIVEG-----ERLLIDIDFKSEFEIARSTGAYKAILQSLPYIFVGKS  248

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            E L +IV ++S+AAK+S K +G+H PPWRK  +M  KW     R
Sbjct  249  ERLGQIVSIVSEAAKQSLKKKGMHFPPWRKAEYMRAKWLSPCTR  292



>gb|KEH31061.1| plant-specific domain TIGR01615 family protein [Medicago truncatula]
Length=324

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 101/176 (57%), Gaps = 7/176 (4%)
 Frame = -1

Query  778  EDSFRNVLASRVSEAVELLSSCLNSSKS------PEILRRHVMAYLRDFGYNAGVCKAKW  617
            E S RN     + E       C  S +S      P    R V +YL++ G+N+ +C  KW
Sbjct  112  EISIRNATKEAIEEIDRSKLECCCSRQSGEARSCPNCFMRQVSSYLQNGGFNSAICNTKW  171

Query  616  ERSDGITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFV  440
              S  + +G+H F+DVL S S+ +   R I++L F ++FE+ + +  +  L+R LP+V+V
Sbjct  172  TSSHNLPSGEHTFLDVLHSTSKEKGDIRVIIELNFRAQFEMGKASEDYNRLVRKLPEVYV  231

Query  439  GKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASM  272
            GK+E L  I+K+M  AAKR  K   +H+ PWRK ++M+ KW G ++R+T+    S+
Sbjct  232  GKAERLSNIIKIMCMAAKRCLKENKMHMGPWRKHKYMQAKWLGPFKRNTSTNSLSL  287



>gb|EPS57683.1| hypothetical protein M569_17134 [Genlisea aurea]
Length=293

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
             +R +MA LR  G +AG+CK+KWE+    + G +EF+DV+   S     RYIV++  + E
Sbjct  116  FKRRLMARLRGRGLDAGICKSKWEKRGNCSPGSYEFVDVISGGS-----RYIVEVFLAGE  170

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            F IARPT  +  L+ + P++FVGK E LK++V  M  A + S K+ G+ +PPWR+  +M 
Sbjct  171  FTIARPTPGYASLLENFPEIFVGKPEGLKQLVSKMCSAMRASMKAAGISVPPWRRVAYMN  230

Query  325  NKWFGSYRRSTN  290
            N+WFG+YRR+TN
Sbjct  231  NRWFGTYRRTTN  242



>ref|XP_009769676.1| PREDICTED: uncharacterized protein LOC104220495 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769677.1| PREDICTED: uncharacterized protein LOC104220495 isoform X1 [Nicotiana 
sylvestris]
Length=401

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 117/191 (61%), Gaps = 11/191 (6%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            D+S   SD    +S G+  D +++ I C   + RN+LA   S+ VE   SC    K  + 
Sbjct  116  DFSTGFSDSVTNSSFGDSSDTLKSLIPCASVAERNLLAD-TSKIVEKHKSC----KRKDD  170

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR+ V   L   GY A  CK+KWE++  + AG++E+IDV         +R ++DL+F SE
Sbjct  171  LRKVVTDELLALGYKASTCKSKWEKTSSVPAGEYEYIDVTVEG-----ERVMIDLDFRSE  225

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIAR T +++ +++ LP +FVGK++  ++IV ++S+AA++S K +G+H+ PWRK  +M+
Sbjct  226  FEIARSTGNYKAVLQLLPFIFVGKADRTQQIVSIVSEAARQSLKKKGMHIAPWRKPEYMK  285

Query  325  NKWFGSYRRST  293
             KW   Y R T
Sbjct  286  AKWLSPYSRIT  296



>ref|XP_010552453.1| PREDICTED: uncharacterized protein LOC104822802 [Tarenaya hassleriana]
Length=381

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 107/166 (64%), Gaps = 10/166 (6%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA   +  VE+  S     K  + +R+ V+  L   GY++ +CK+KWE+
Sbjct  144  IPCASVAERNLLAD-AARIVEMNKSL----KRKDDMRKIVVEGLSSLGYDSSICKSKWEK  198

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E+IDV+        +R +VD++F SEFEIAR T  ++ +++SLP +FVGK 
Sbjct  199  SLSSPAGEYEYIDVIVEG-----ERLLVDVDFRSEFEIARQTGSYKAVLQSLPFIFVGKL  253

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRST  293
            + L +I+ V+S+AAK+S K +G+HLPPWRK  +M  KW  SY R+T
Sbjct  254  DRLGQILSVVSEAAKQSLKKKGMHLPPWRKAEYMRAKWHSSYTRAT  299



>gb|EAY75803.1| hypothetical protein OsI_03718 [Oryza sativa Indica Group]
Length=262

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = -1

Query  679  RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFE  500
            RHV   LRD GYN+ +CK+KW RS  I +G+H ++DV+      +  R +V+L F +EFE
Sbjct  99   RHVDERLRDTGYNSAICKSKWTRSPDIPSGEHSYVDVVVQTRSGKAVRVVVELSFRAEFE  158

Query  499  IARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENK  320
            +AR +  ++ L+ +LP+VFVG+++ L+ +VK M  AAK+  K   +H+ PWRK ++M++K
Sbjct  159  VARASAEYRALVTALPEVFVGRADRLRAVVKAMCAAAKQCMKENNMHMGPWRKHKYMQSK  218

Query  319  WFGSYRR  299
            W G+  R
Sbjct  219  WLGTPER  225



>dbj|BAD86962.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ13523.1| hypothetical protein OsJ_03439 [Oryza sativa Japonica Group]
Length=262

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = -1

Query  679  RHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFE  500
            RHV   LRD GYN+ +CK+KW RS  I +G+H ++DV+      +  R +V+L F +EFE
Sbjct  99   RHVDERLRDAGYNSAICKSKWTRSPDIPSGEHSYVDVVVQTRSGKAVRVVVELNFRAEFE  158

Query  499  IARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENK  320
            +AR +  ++ L+ +LP+VFVG+++ L+ +VK M  AAK+  K   +H+ PWRK ++M++K
Sbjct  159  VARASAEYRALVTALPEVFVGRADRLRAVVKAMCAAAKQCMKENNMHMGPWRKHKYMQSK  218

Query  319  WFGSYRR  299
            W G+  R
Sbjct  219  WLGTPER  225



>ref|XP_009592039.1| PREDICTED: uncharacterized protein LOC104088953 [Nicotiana tomentosiformis]
Length=433

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/189 (39%), Positives = 112/189 (59%), Gaps = 25/189 (13%)
 Frame = -1

Query  865  GDYSGSDSDLPPCNSDGELEDEVETINCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            GD+S +   L PC S  E               RN+LA   S+ VE   +C    K  + 
Sbjct  133  GDFSDTLKSLIPCASVAE---------------RNLLAD-TSKIVEKNKAC----KRKDD  172

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR+ V   L   GYNA +CK+KWE++  + AG++E+IDV+        +R +VD++F SE
Sbjct  173  LRKIVTDELSKLGYNASICKSKWEKTSSVPAGEYEYIDVIVEG-----ERVLVDVDFRSE  227

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIAR T  ++ ++ SLP +FVGKS+ L +IV ++S+AA+ S K +G+H+ PWRK  +++
Sbjct  228  FEIARSTGSYKAVLLSLPFIFVGKSDRLLQIVSIVSEAARLSLKKKGMHIAPWRKAEYIK  287

Query  325  NKWFGSYRR  299
            +KW   + R
Sbjct  288  SKWLSPHTR  296



>gb|KDO78418.1| hypothetical protein CISIN_1g021546mg [Citrus sinensis]
Length=311

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 107/178 (60%), Gaps = 11/178 (6%)
 Frame = -1

Query  748  RVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV  569
            R+ E  E   + L  + SP   RR +M++LRD G++AG+CK++WE++     G++EF+DV
Sbjct  107  RIREETEFACTVLGDASSPAFKRR-LMSHLRDKGFDAGLCKSRWEKTAKFPCGNYEFVDV  165

Query  568  LRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAA  389
                      RYI+++  +++FEIAR  + +  L+   P +FVGK   LK+I+++M  AA
Sbjct  166  -----NLGANRYIIEVNLAAQFEIARAADGYMSLVNLFPPIFVGKPGTLKQILRLMCGAA  220

Query  388  KRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
            + S KS  L +PPWR+  +M+ KWF  Y+R+TN   ++++      +      RS+GF
Sbjct  221  RESIKSAELSVPPWRRNGYMQAKWFSPYKRTTNAVASTLKF-----EGGFASNRSIGF  273



>ref|XP_011030607.1| PREDICTED: uncharacterized protein LOC105130002 [Populus euphratica]
Length=310

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 100/164 (61%), Gaps = 9/164 (5%)
 Frame = -1

Query  790  INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWER  611
            I C   + RN+LA    +   +L    N  +    LR+ V   L   GYN+ +CK+KW++
Sbjct  62   IPCASVAERNLLA----DTAMILEKNKNHKQKDGFLRKIVADGLASLGYNSSICKSKWDK  117

Query  610  SDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKS  431
            S    AG++E++DV+        +R ++D++F SEFEIAR T  ++ +++SLP +FVGKS
Sbjct  118  SPSSPAGEYEYVDVIVEG-----ERLLIDIDFRSEFEIARSTGAYKAILQSLPYIFVGKS  172

Query  430  EELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRR  299
            E L +IV V+S+AAK+S K +G+H PPWRK  +M  KW     R
Sbjct  173  ERLGQIVSVVSEAAKQSLKKKGMHFPPWRKAEYMRAKWLSPCTR  216



>ref|XP_010435101.1| PREDICTED: uncharacterized protein LOC104718968 [Camelina sativa]
Length=355

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 116/177 (66%), Gaps = 13/177 (7%)
 Frame = -1

Query  799  VETINCGEDSFRNVLA-------SRVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYN  641
            V++ +   D F++++        + ++EAV+++     S K  + LR+ V+  L   GY+
Sbjct  113  VDSFSDAYDHFKSLIPCASVVEKTLLNEAVKVIEKN-KSIKRKDELRKIVVVELSSLGYD  171

Query  640  AGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIR  461
            + +CK+KW++S    AG++E+IDV+ +      +R ++D++F SEFEIAR T+ ++ L++
Sbjct  172  SSICKSKWDKSRSKPAGEYEYIDVIVNG-----ERILIDVDFRSEFEIARQTSGYKALLQ  226

Query  460  SLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTN  290
            SLP +FVGKS  +++IV ++S+AAK+S K +G+H PPWRK  +M  KW  SY R+ +
Sbjct  227  SLPLIFVGKSNRIRQIVSMVSEAAKQSLKKKGMHFPPWRKADYMRAKWLSSYTRNNS  283



>ref|XP_006449847.1| hypothetical protein CICLE_v10016018mg [Citrus clementina]
 gb|ESR63087.1| hypothetical protein CICLE_v10016018mg [Citrus clementina]
Length=311

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 107/178 (60%), Gaps = 11/178 (6%)
 Frame = -1

Query  748  RVSEAVELLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDV  569
            R+ E  E   + L  + SP   RR +M++LRD G++AG+CK++WE++     G++EF+DV
Sbjct  107  RIREETEFACTVLGDASSPAFKRR-LMSHLRDKGFDAGLCKSRWEKTAKFPCGNYEFVDV  165

Query  568  LRSDSQNRIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAA  389
                      RYI+++  +++FEIAR  + +  L+   P +FVGK   LK+I+++M  AA
Sbjct  166  -----NLGANRYIIEVNLAAQFEIARAADGYMSLVNLFPPIFVGKPGTLKQILRLMCGAA  220

Query  388  KRSFKSRGLHLPPWRKQRFMENKWFGSYRRSTNFRPASMELLAPLDQALAVKCRSVGF  215
            + S KS  L +PPWR+  +M+ KWF  Y+R+TN   ++++      +      RS+GF
Sbjct  221  RESIKSAELTVPPWRRNGYMQAKWFSPYKRTTNAVASTLKF-----EGGFASNRSIGF  273



>ref|XP_009608943.1| PREDICTED: uncharacterized protein LOC104102810 [Nicotiana tomentosiformis]
Length=401

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 116/191 (61%), Gaps = 11/191 (6%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGELEDEVET-INCGEDSFRNVLASRVSEAVELLSSCLNSSKSPEI  686
            D+S   SD    +S G+  D  ++ I C   + RN+LA   S+ VE   SC    K  + 
Sbjct  116  DFSTGFSDSVTNSSFGDSSDTFKSLIPCASVAERNLLAD-TSKIVEKHKSC----KRKDD  170

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNRIQRYIVDLEFSSE  506
            LR+ V   L   GY A  CK+KWE++  + AG++E+IDV         +R ++DL+F SE
Sbjct  171  LRKIVTDELLAIGYKASTCKSKWEKTSSVPAGEYEYIDVTVEG-----ERVMIDLDFRSE  225

Query  505  FEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFME  326
            FEIAR T  ++ +++ LP +FVGK++ +++IV ++S+AA++S K +G+H+ PWRK  +M+
Sbjct  226  FEIARSTGSYKAVLQLLPFIFVGKADRIQQIVSIVSEAARQSLKKKGMHIAPWRKPEYMK  285

Query  325  NKWFGSYRRST  293
             KW   Y R T
Sbjct  286  AKWLSPYTRIT  296



>ref|XP_004294015.1| PREDICTED: uncharacterized protein LOC101293076 [Fragaria vesca 
subsp. vesca]
Length=294

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 101/163 (62%), Gaps = 2/163 (1%)
 Frame = -1

Query  778  EDSFRNVLASRVSEAVELLSSC-LNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDG  602
            E   R+V    V E+ E +  C   SS     L R V   L + GYN+ +CK++W  S  
Sbjct  87   ETKIRSVTKVAVKESGEAVCGCGKESSGCRSCLMREVSGRLCNAGYNSAICKSQWRSSPD  146

Query  601  ITAGDHEFIDVLRSDSQNRIQ-RYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEE  425
            I +G+H F+DV+ + S  + + R I++L F +EFE+AR  + +  L++ LP++FVGK E 
Sbjct  147  IPSGEHTFLDVVDNSSSRKGEVRVIIELNFRAEFEMARANDEYNRLVKRLPEIFVGKVER  206

Query  424  LKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFMENKWFGSYRRS  296
            L+ ++K++  AAK+  K + +H+ PWRKQ++M+ KW G+ +R+
Sbjct  207  LQNLIKILCSAAKKCMKEKKMHMGPWRKQKYMQAKWLGACKRT  249



>ref|XP_010932847.1| PREDICTED: uncharacterized protein LOC105053412 isoform X1 [Elaeis 
guineensis]
Length=383

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 114/205 (56%), Gaps = 24/205 (12%)
 Frame = -1

Query  862  DYSGSDSDLPPCNSDGE-----LEDEVETIN----------CGEDSFRNVLASRVSEAVE  728
            D S  D+D P   SD         D  E +           C   + RN+LA    +A +
Sbjct  100  DSSDVDTDFPATTSDAPPIIPTTSDAAEFVKDRHALQGLVLCTSVAERNLLA----DASK  155

Query  727  LLSSCLNSSKSPEILRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQN  548
            ++ +     K  E  RR V   LR  GY+A VCK++W+++    AG++ ++DV+ +    
Sbjct  156  IVENTRIGGKGKEDSRRAVADSLRALGYDAAVCKSRWDKAPSFPAGEYVYVDVIVAK---  212

Query  547  RIQRYIVDLEFSSEFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSR  368
              +R +VD++F SEFEIAR T  ++ +++ LP +FVGK + L++IV V+ +AA++S K +
Sbjct  213  --ERLLVDVDFRSEFEIARSTKSYRAVLQLLPSIFVGKEDRLQQIVAVVCEAARQSLKKK  270

Query  367  GLHLPPWRKQRFMENKWFGSYRRST  293
            GLH PPWRK  +M  KW  SY R+ 
Sbjct  271  GLHFPPWRKPEYMRAKWLSSYERTA  295



>ref|XP_006859026.1| hypothetical protein AMTR_s00068p00173710 [Amborella trichopoda]
 gb|ERN20493.1| hypothetical protein AMTR_s00068p00173710 [Amborella trichopoda]
Length=271

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 93/140 (66%), Gaps = 3/140 (2%)
 Frame = -1

Query  685  LRRHVMAYLRDFGYNAGVCKAKWERSDGITAGDHEFIDVLRSDSQNR-IQRYIVDLEFSS  509
            +RR V+ YL+   Y++ +CK+KW  S     G+HE+IDV+++ +Q R   R +++L+F +
Sbjct  89   IRRDVVCYLQKAAYDSALCKSKWRSSPSTPPGEHEYIDVVQASTQERRAARVVIELDFRA  148

Query  508  EFEIARPTNHFQYLIRSLPKVFVGKSEELKKIVKVMSKAAKRSFKSRGLHLPPWRKQRFM  329
            EFE+AR  N +  L+  LP+++VGK E L+ IVK +  AAK+  K   +H+ PWR+ ++M
Sbjct  149  EFEMARGNNEYNRLVARLPELYVGKPERLRTIVKAVCSAAKQCMKENKMHIAPWRRHKYM  208

Query  328  ENKWFGSYRRS--TNFRPAS  275
             NKW G Y+R+  + F P+S
Sbjct  209  HNKWLGPYKRTNPSPFSPSS  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2424532346784