BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78578_g1_i1 len=4567 path=[4545:0-4566]

Length=4567
                                                                      Score     E

ref|XP_004240884.1|  PREDICTED: SNF2 domain-containing protein CL...   1804   0.0      
ref|XP_006353420.1|  PREDICTED: SNF2 domain-containing protein CL...   1798   0.0      
ref|XP_009775827.1|  PREDICTED: SNF2 domain-containing protein CL...   1793   0.0      
ref|XP_009594370.1|  PREDICTED: SNF2 domain-containing protein CL...   1789   0.0      
emb|CDP13967.1|  unnamed protein product                               1572   0.0      
ref|XP_011093440.1|  PREDICTED: LOW QUALITY PROTEIN: SNF2 domain-...   1550   0.0      
ref|XP_011093441.1|  PREDICTED: SNF2 domain-containing protein CL...   1540   0.0      
ref|XP_011093444.1|  PREDICTED: SNF2 domain-containing protein CL...   1387   0.0      
gb|EYU20066.1|  hypothetical protein MIMGU_mgv1a000446mg               1320   0.0      
ref|XP_010658218.1|  PREDICTED: SNF2 domain-containing protein CL...   1311   0.0      
ref|XP_010658217.1|  PREDICTED: SNF2 domain-containing protein CL...   1310   0.0      
emb|CBI25419.3|  unnamed protein product                               1308   0.0      
emb|CAN75315.1|  hypothetical protein VITISV_024158                    1256   0.0      Vitis vinifera
gb|KDP44698.1|  hypothetical protein JCGZ_01198                        1235   0.0      
ref|XP_002520793.1|  ATP-dependent helicase, putative                  1219   0.0      Ricinus communis
ref|XP_007008852.1|  Chromatin remodeling complex subunit isoform 1    1204   0.0      
gb|KHG14659.1|  DNA repair rhp54                                       1200   0.0      
ref|XP_007218889.1|  hypothetical protein PRUPE_ppa000332mg            1200   0.0      
ref|XP_008233817.1|  PREDICTED: SNF2 domain-containing protein CL...   1198   0.0      
ref|XP_006595851.1|  PREDICTED: SNF2 domain-containing protein CL...   1196   0.0      
ref|XP_010087542.1|  DNA repair protein rhp54                          1195   0.0      
ref|XP_008454843.1|  PREDICTED: SNF2 domain-containing protein CL...   1186   0.0      
ref|XP_006435819.1|  hypothetical protein CICLE_v10033966mg            1186   0.0      
gb|KGN50700.1|  hypothetical protein Csa_5G217680                      1180   0.0      
ref|XP_004146461.1|  PREDICTED: uncharacterized protein LOC101215377   1179   0.0      
ref|XP_004171552.1|  PREDICTED: uncharacterized LOC101215377           1178   0.0      
ref|XP_002312184.2|  hypothetical protein POPTR_0008s07350g            1173   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN38546.1|  Helicase ARIP4                                         1164   0.0      
ref|XP_008369294.1|  PREDICTED: SNF2 domain-containing protein CL...   1156   0.0      
ref|XP_009369221.1|  PREDICTED: SNF2 domain-containing protein CL...   1147   0.0      
gb|KEH28290.1|  chromatin remodeling complex subunit                   1133   0.0      
gb|AES99655.2|  chromatin remodeling complex subunit                   1132   0.0      
ref|XP_003616697.1|  DNA repair and recombination protein RAD54-l...   1127   0.0      
gb|EPS74404.1|  hypothetical protein M569_00351                         989   0.0      
ref|XP_010692922.1|  PREDICTED: SNF2 domain-containing protein CL...    970   0.0      
ref|XP_004307689.1|  PREDICTED: uncharacterized protein LOC101291094    930   0.0      
ref|XP_007141730.1|  hypothetical protein PHAVU_008G220500g             929   0.0      
ref|XP_006576108.1|  PREDICTED: SNF2 domain-containing protein CL...    928   0.0      
gb|KCW50427.1|  hypothetical protein EUGRSUZ_J00168                     920   0.0      
ref|XP_010031162.1|  PREDICTED: SNF2 domain-containing protein CL...    920   0.0      
ref|XP_010031159.1|  PREDICTED: SNF2 domain-containing protein CL...    918   0.0      
ref|XP_010535836.1|  PREDICTED: SNF2 domain-containing protein CL...    917   0.0      
ref|XP_011003589.1|  PREDICTED: SNF2 domain-containing protein CL...    917   0.0      
ref|XP_011003947.1|  PREDICTED: SNF2 domain-containing protein CL...    915   0.0      
ref|XP_010535825.1|  PREDICTED: SNF2 domain-containing protein CL...    914   0.0      
ref|XP_006281920.1|  hypothetical protein CARUB_v10028127mg             912   0.0      
ref|XP_009108311.1|  PREDICTED: SNF2 domain-containing protein CL...    909   0.0      
ref|XP_006414244.1|  hypothetical protein EUTSA_v10024231mg             908   0.0      
gb|KFK33843.1|  hypothetical protein AALP_AA5G067200                    906   0.0      
ref|XP_002877253.1|  hypothetical protein ARALYDRAFT_484766             905   0.0      
ref|XP_010496657.1|  PREDICTED: SNF2 domain-containing protein CL...    900   0.0      
ref|XP_010496660.1|  PREDICTED: SNF2 domain-containing protein CL...    884   0.0      
ref|XP_010454346.1|  PREDICTED: SNF2 domain-containing protein CL...    902   0.0      
ref|XP_010454347.1|  PREDICTED: SNF2 domain-containing protein CL...    901   0.0      
ref|NP_189853.1|  chromatin remodeling 38                               901   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420881.1|  PREDICTED: SNF2 domain-containing protein CL...    900   0.0      
ref|XP_010420880.1|  PREDICTED: SNF2 domain-containing protein CL...    900   0.0      
ref|XP_002873997.1|  hypothetical protein ARALYDRAFT_351139             896   0.0      
ref|XP_010483428.1|  PREDICTED: SNF2 domain-containing protein CL...    895   0.0      
ref|XP_010443568.1|  PREDICTED: SNF2 domain-containing protein CL...    894   0.0      
ref|XP_010493147.1|  PREDICTED: SNF2 domain-containing protein CL...    893   0.0      
ref|XP_006400609.1|  hypothetical protein EUTSA_v10012460mg             894   0.0      
gb|ABA18099.1|  SNF2 domain-containing protein                          893   0.0      Olimarabidopsis pumila
ref|NP_197542.1|  chromatin remodeling 42                               890   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496658.1|  PREDICTED: SNF2 domain-containing protein CL...    892   0.0      
ref|XP_006286914.1|  hypothetical protein CARUB_v10000058mg             885   0.0      
emb|CDX92463.1|  BnaA10g15020D                                          877   0.0      
emb|CDY56857.1|  BnaC09g54090D                                          877   0.0      
ref|XP_009120806.1|  PREDICTED: SNF2 domain-containing protein CL...    876   0.0      
ref|XP_010271708.1|  PREDICTED: SNF2 domain-containing protein CL...    853   0.0      
gb|AET79246.1|  chromatin remodeling 38                                 846   0.0      
ref|XP_006603095.1|  PREDICTED: SNF2 domain-containing protein CL...    843   0.0      
ref|XP_002315134.2|  hypothetical protein POPTR_0010s19110g             840   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003600991.1|  DNA repair and recombination protein RAD54-l...    825   0.0      
gb|AES78270.2|  chromatin remodeling complex subunit                    821   0.0      
ref|XP_003622052.1|  DNA repair and recombination protein RAD54-l...    820   0.0      
ref|XP_007163582.1|  hypothetical protein PHAVU_001G246400g             818   0.0      
gb|KEH43046.1|  chromatin remodeling complex subunit                    793   0.0      
gb|KHN31310.1|  DNA repair and recombination protein RAD54-like         756   0.0      
ref|XP_009412628.1|  PREDICTED: SNF2 domain-containing protein CL...    691   0.0      
ref|XP_010937952.1|  PREDICTED: SNF2 domain-containing protein CL...    683   0.0      
ref|XP_010937951.1|  PREDICTED: SNF2 domain-containing protein CL...    683   0.0      
ref|XP_008776285.1|  PREDICTED: SNF2 domain-containing protein CL...    681   0.0      
ref|XP_004958789.1|  PREDICTED: uncharacterized protein LOC101783851    636   0.0      
tpg|DAA64243.1|  TPA: hypothetical protein ZEAMMB73_472688              633   0.0      
ref|XP_008653528.1|  PREDICTED: SNF2 domain-containing protein CL...    633   0.0      
ref|XP_008653529.1|  PREDICTED: SNF2 domain-containing protein CL...    632   0.0      
ref|XP_002461267.1|  hypothetical protein SORBIDRAFT_02g043870          630   0.0      Sorghum bicolor [broomcorn]
ref|XP_010229549.1|  PREDICTED: SNF2 domain-containing protein CL...    626   0.0      
ref|XP_011004020.1|  PREDICTED: SNF2 domain-containing protein CL...    613   0.0      
ref|XP_006828119.1|  hypothetical protein AMTR_s00023p00029140          588   0.0      
ref|XP_006658997.1|  PREDICTED: SNF2 domain-containing protein CL...    601   0.0      
gb|EEE67867.1|  hypothetical protein OsJ_25679                          600   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAC79886.1|  putative DNA repair protein rhp54                      566   1e-180   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82733.1|  hypothetical protein OsI_27432                          597   6e-180   Oryza sativa Indica Group [Indian rice]
gb|EMT24130.1|  DNA repair protein rhp54                                571   2e-175   
ref|XP_006293059.1|  hypothetical protein CARUB_v10019346mg             547   2e-173   
ref|XP_006435813.1|  hypothetical protein CICLE_v10030786mg             486   5e-149   
ref|NP_001060723.1|  Os07g0692600                                       452   1e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003622049.1|  Chromatin remodeling complex subunit               379   2e-111   
ref|XP_006375169.1|  hypothetical protein POPTR_0014s04910g             381   3e-107   
ref|XP_010055396.1|  PREDICTED: SNF2 domain-containing protein CL...    381   1e-106   
ref|XP_009378410.1|  PREDICTED: SNF2 domain-containing protein CL...    361   8e-105   
gb|EPS60956.1|  hypothetical protein M569_13845                         359   1e-104   
ref|XP_010274543.1|  PREDICTED: SNF2 domain-containing protein CL...    374   2e-104   
ref|XP_011032462.1|  PREDICTED: SNF2 domain-containing protein CL...    373   2e-104   
ref|XP_006844384.1|  hypothetical protein AMTR_s00142p00081110          371   3e-103   
ref|XP_002517508.1|  ATP-dependent helicase, putative                   365   4e-102   Ricinus communis
ref|XP_007019904.1|  Chromatin remodeling 31, putative                  361   8e-102   
emb|CDX93009.1|  BnaA03g37310D                                          356   2e-100   
ref|XP_009135889.1|  PREDICTED: SNF2 domain-containing protein CL...    358   2e-100   
ref|XP_008342502.1|  PREDICTED: SNF2 domain-containing protein CL...    356   9e-100   
ref|XP_001773860.1|  SNF2 family DNA-dependent ATPase                   362   1e-99    
emb|CDX94823.1|  BnaC03g43650D                                          353   2e-99    
ref|XP_010919917.1|  PREDICTED: SNF2 domain-containing protein CL...    357   3e-99    
ref|XP_006586199.1|  PREDICTED: SNF2 domain-containing protein CL...    357   5e-99    
ref|XP_006655286.1|  PREDICTED: SNF2 domain-containing protein CL...    355   1e-98    
ref|XP_007210413.1|  hypothetical protein PRUPE_ppa000588mg             353   2e-98    
ref|XP_008794871.1|  PREDICTED: SNF2 domain-containing protein CL...    354   2e-98    
gb|KHN01842.1|  DNA repair and recombination protein RDH54              355   3e-98    
ref|XP_007140761.1|  hypothetical protein PHAVU_008G139600g             352   8e-98    
gb|KHN01841.1|  DNA repair and recombination protein RAD54-like         348   9e-98    
gb|KFK39738.1|  hypothetical protein AALP_AA3G281500                    350   1e-97    
ref|XP_004962180.1|  PREDICTED: uncharacterized protein LOC101781575    355   1e-97    
ref|XP_006593004.1|  PREDICTED: SNF2 domain-containing protein CL...    351   1e-97    
ref|XP_008229682.1|  PREDICTED: SNF2 domain-containing protein CL...    352   2e-97    
ref|XP_011086198.1|  PREDICTED: SNF2 domain-containing protein CL...    356   2e-97    
ref|XP_007140762.1|  hypothetical protein PHAVU_008G139700g             352   3e-97    
gb|KHN32424.1|  DNA repair and recombination protein RAD54-like         351   3e-97    
gb|ABV80237.2|  required to maintain repression 1                       353   5e-97    Zea mays [maize]
ref|XP_010664213.1|  PREDICTED: SNF2 domain-containing protein CL...    347   5e-97    
gb|KEH22459.1|  SNF2 family amino-terminal protein                      350   9e-97    
gb|ABV80241.2|  mutant required to maintain repression 1                352   1e-96    Zea mays [maize]
gb|ABV80240.2|  mutant required to maintain repression 1                352   1e-96    Zea mays [maize]
emb|CDX77430.1|  BnaA07g05680D                                          337   1e-96    
ref|XP_010231441.1|  PREDICTED: SNF2 domain-containing protein CL...    351   2e-96    
ref|XP_007211028.1|  hypothetical protein PRUPE_ppa019972mg             349   3e-96    
ref|XP_008229511.1|  PREDICTED: SNF2 domain-containing protein CL...    348   3e-96    
gb|KEH22070.1|  SNF2 family amino-terminal protein                      350   3e-96    
ref|XP_008649609.1|  PREDICTED: SNF2 domain-containing protein CL...    351   3e-96    
ref|XP_006586198.1|  PREDICTED: SNF2 domain-containing protein CL...    347   4e-96    
ref|XP_009102516.1|  PREDICTED: SNF2 domain-containing protein CL...    342   5e-96    
gb|ABV80243.2|  mutant required to maintain repression 1                350   8e-96    Zea mays [maize]
gb|KDP45991.1|  hypothetical protein JCGZ_11894                         335   1e-95    
ref|XP_006418756.1|  hypothetical protein EUTSA_v10002375mg             345   1e-95    
ref|XP_002439747.1|  hypothetical protein SORBIDRAFT_09g019410          349   1e-95    Sorghum bicolor [broomcorn]
ref|XP_003566883.1|  PREDICTED: SNF2 domain-containing protein CL...    344   1e-95    
ref|XP_009102515.1|  PREDICTED: SNF2 domain-containing protein CL...    342   3e-95    
gb|EYU40331.1|  hypothetical protein MIMGU_mgv1a002243mg                334   3e-95    
gb|EEE63616.1|  hypothetical protein OsJ_18433                          346   5e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011098998.1|  PREDICTED: SNF2 domain-containing protein CL...    339   5e-95    
ref|XP_009102514.1|  PREDICTED: SNF2 domain-containing protein CL...    342   6e-95    
ref|NP_189077.1|  chromatin remodeling 40                               343   7e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008465909.1|  PREDICTED: SNF2 domain-containing protein CL...    343   2e-94    
gb|EMT24776.1|  DNA repair protein rhp54                                343   3e-94    
ref|XP_009408709.1|  PREDICTED: LOW QUALITY PROTEIN: SNF2 domain-...    342   3e-94    
gb|KGN60451.1|  hypothetical protein Csa_3G912350                       342   5e-94    
emb|CDY66441.1|  BnaCnng50860D                                          337   2e-93    
ref|XP_002885641.1|  hypothetical protein ARALYDRAFT_342596             337   8e-93    
gb|KHG04884.1|  DNA repair and recombination protein RAD54-like p...    333   8e-93    
gb|KEH22457.1|  SNF2 family amino-terminal protein                      337   8e-92    
ref|XP_006648888.1|  PREDICTED: SNF2 domain-containing protein CL...    335   2e-91    
gb|KEH22453.1|  SNF2 family amino-terminal protein                      332   1e-90    
gb|EYU38298.1|  hypothetical protein MIMGU_mgv1a000457mg                330   2e-90    
ref|XP_011085870.1|  PREDICTED: SNF2 domain-containing protein CL...    332   3e-90    
ref|XP_011093983.1|  PREDICTED: SNF2 domain-containing protein CL...    333   3e-90    
ref|XP_010488536.1|  PREDICTED: SNF2 domain-containing protein CL...    328   7e-90    
ref|XP_010513389.1|  PREDICTED: SNF2 domain-containing protein CL...    327   7e-90    
gb|KEH22460.1|  SNF2 family amino-terminal protein                      329   1e-89    
ref|XP_008678890.1|  PREDICTED: uncharacterized protein LOC103653...    330   2e-89    
ref|XP_008678889.1|  PREDICTED: SNF2 domain-containing protein CL...    329   2e-89    
gb|EMS57735.1|  DNA repair and recombination protein RAD54-like p...    320   6e-89    
ref|XP_004516267.1|  PREDICTED: transcriptional regulator ATRX-like     326   1e-88    
ref|XP_004301720.1|  PREDICTED: uncharacterized protein LOC101294670    323   2e-88    
ref|XP_006296863.1|  hypothetical protein CARUB_v10012851mg             323   2e-88    
ref|XP_010319906.1|  PREDICTED: SNF2 domain-containing protein CL...    325   3e-88    
ref|XP_006404471.1|  hypothetical protein EUTSA_v10010079mg             321   2e-87    
ref|XP_010110541.1|  hypothetical protein L484_023375                   322   3e-87    
ref|XP_010519701.1|  PREDICTED: SNF2 domain-containing protein CL...    318   4e-87    
emb|CDY47279.1|  BnaA10g03670D                                          320   1e-86    
gb|EAY97928.1|  hypothetical protein OsI_19844                          321   1e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_004229291.1|  PREDICTED: SNF2 domain-containing protein CL...    317   2e-86    
ref|XP_004246174.1|  PREDICTED: SNF2 domain-containing protein CL...    313   2e-86    
emb|CDP13434.1|  unnamed protein product                                309   2e-86    
gb|KEH31042.1|  SNF2 family amino-terminal protein                      318   3e-86    
ref|XP_009119150.1|  PREDICTED: SNF2 domain-containing protein CL...    321   5e-86    
ref|XP_010235775.1|  PREDICTED: SNF2 domain-containing protein CL...    311   7e-86    
gb|EAZ24021.1|  hypothetical protein OsJ_07744                          318   9e-86    Oryza sativa Japonica Group [Japonica rice]
emb|CDY10115.1|  BnaC05g03580D                                          318   1e-85    
ref|XP_006477564.1|  PREDICTED: SNF2 domain-containing protein CL...    312   2e-85    
ref|XP_009619119.1|  PREDICTED: SNF2 domain-containing protein CL...    315   2e-85    
ref|XP_010532826.1|  PREDICTED: SNF2 domain-containing protein CL...    313   2e-85    
gb|EEC73701.1|  hypothetical protein OsI_08293                          317   3e-85    Oryza sativa Indica Group [Indian rice]
ref|XP_009619118.1|  PREDICTED: SNF2 domain-containing protein CL...    315   6e-85    
ref|XP_009786652.1|  PREDICTED: SNF2 domain-containing protein CL...    313   8e-85    
gb|KDO68851.1|  hypothetical protein CISIN_1g018545mg                   293   9e-85    
gb|EYU44858.1|  hypothetical protein MIMGU_mgv1a024033mg                308   9e-85    
emb|CDP14473.1|  unnamed protein product                                312   1e-84    
dbj|BAD26561.1|  SNF2 domain-containing protein-like                    301   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010485015.1|  PREDICTED: SNF2 domain-containing protein CL...    304   2e-84    
ref|XP_006303135.1|  hypothetical protein CARUB_v10008086mg             315   2e-84    
ref|XP_006440142.1|  hypothetical protein CICLE_v10023697mg             308   3e-84    
ref|NP_172040.2|  chromatin remodeling 31                               311   3e-83    Arabidopsis thaliana [mouse-ear cress]
gb|AAF79734.1|AC005106_15  T25N20.14                                    311   3e-83    Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98499.1|  hypothetical protein                                   311   3e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010695461.1|  PREDICTED: SNF2 domain-containing protein CL...    306   6e-83    
ref|XP_010475242.1|  PREDICTED: SNF2 domain-containing protein CL...    310   1e-82    
ref|XP_010695456.1|  PREDICTED: SNF2 domain-containing protein CL...    306   1e-82    
gb|KEH22456.1|  SNF2 family amino-terminal protein                      308   1e-82    
ref|XP_002892292.1|  hypothetical protein ARALYDRAFT_470549             306   8e-82    
ref|XP_004245838.2|  PREDICTED: SNF2 domain-containing protein CL...    303   1e-81    
gb|KDO36323.1|  hypothetical protein CISIN_1g047478mg                   283   3e-81    
emb|CDP18763.1|  unnamed protein product                                303   3e-81    
gb|EMS64562.1|  DNA repair and recombination protein RAD54-like p...    302   6e-81    
ref|XP_004510995.1|  PREDICTED: transcriptional regulator ATRX ho...    295   4e-80    
dbj|BAC84084.1|  putative SNF2 domain/helicase domain-containing ...    294   5e-80    Oryza sativa Japonica Group [Japonica rice]
gb|KCW73204.1|  hypothetical protein EUGRSUZ_E01664                     287   9e-80    
gb|KDO57017.1|  hypothetical protein CISIN_1g006698mg                   288   1e-79    
gb|EEE65467.1|  hypothetical protein OsJ_20857                          294   3e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EEC80340.1|  hypothetical protein OsI_22411                          293   3e-79    Oryza sativa Indica Group [Indian rice]
gb|EEE67065.1|  hypothetical protein OsJ_24029                          294   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057310.1|  Os06g0255700                                       293   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006358634.1|  PREDICTED: SNF2 domain-containing protein CL...    295   4e-79    
ref|XP_006659282.1|  PREDICTED: transcriptional regulator ATRX ho...    293   4e-79    
gb|EMS50774.1|  DNA repair protein rhp54                                294   4e-79    
gb|EMT12758.1|  DNA repair protein rhp54                                293   9e-79    
gb|EEC81934.1|  hypothetical protein OsI_25800                          292   1e-78    Oryza sativa Indica Group [Indian rice]
gb|KEH19100.1|  chromatin remodeling complex subunit                    291   1e-78    
dbj|BAK00786.1|  predicted protein                                      291   2e-78    
ref|XP_006594408.1|  PREDICTED: transcriptional regulator ATRX-like     291   3e-78    
ref|XP_004229066.1|  PREDICTED: SNF2 domain-containing protein CL...    293   3e-78    
gb|KHN37628.1|  DNA repair protein rhp54                                291   5e-78    
ref|XP_010234551.1|  PREDICTED: SNF2 domain-containing protein CL...    290   6e-78    
ref|XP_010423658.1|  PREDICTED: SNF2 domain-containing protein CL...    289   9e-78    
gb|EMT00894.1|  DNA repair protein rhp54                                289   1e-77    
ref|XP_004987162.1|  PREDICTED: transcriptional regulator ATRX-like     291   1e-77    
ref|XP_003540522.1|  PREDICTED: SNF2 domain-containing protein CL...    287   1e-77    
ref|XP_006592957.1|  PREDICTED: SNF2 domain-containing protein CL...    287   2e-77    
ref|XP_007201415.1|  hypothetical protein PRUPE_ppa001303mg             286   2e-77    
gb|EMS60061.1|  DNA repair protein rhp54                                289   2e-77    
ref|XP_002970267.1|  hypothetical protein SELMODRAFT_441121             289   3e-77    
gb|KHN19463.1|  DNA repair protein rhp54                                286   4e-77    
ref|XP_010275546.1|  PREDICTED: SNF2 domain-containing protein CL...    287   6e-77    
ref|XP_010489214.1|  PREDICTED: SNF2 domain-containing protein CL...    286   7e-77    
ref|XP_008382304.1|  PREDICTED: SNF2 domain-containing protein CL...    285   8e-77    
ref|XP_004983494.1|  PREDICTED: transcriptional regulator ATRX ho...    286   9e-77    
ref|XP_006358635.1|  PREDICTED: SNF2 domain-containing protein CL...    286   1e-76    
ref|NP_179740.1|  chromatin remodeling 34                               283   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010275543.1|  PREDICTED: SNF2 domain-containing protein CL...    286   2e-76    
ref|XP_010058546.1|  PREDICTED: SNF2 domain-containing protein CL...    290   3e-76    
ref|XP_004230870.1|  PREDICTED: SNF2 domain-containing protein CL...    284   4e-76    
ref|XP_008237010.1|  PREDICTED: SNF2 domain-containing protein CL...    283   5e-76    
ref|XP_009372988.1|  PREDICTED: SNF2 domain-containing protein CL...    283   5e-76    
gb|KEH37316.1|  chromatin remodeling complex subunit                    285   6e-76    
ref|XP_006423382.1|  hypothetical protein CICLE_v10027795mg             282   8e-76    
ref|XP_002468452.1|  hypothetical protein SORBIDRAFT_01g046180          283   1e-75    Sorghum bicolor [broomcorn]
ref|XP_008377438.1|  PREDICTED: SNF2 domain-containing protein CL...    283   1e-75    
gb|EMT15271.1|  DNA repair protein rhp54                                287   2e-75    
ref|XP_002445019.1|  hypothetical protein SORBIDRAFT_07g002945          278   2e-75    Sorghum bicolor [broomcorn]
ref|XP_009141303.1|  PREDICTED: transcriptional regulator ATRX ho...    278   3e-75    
ref|XP_011047795.1|  PREDICTED: SNF2 domain-containing protein CL...    280   4e-75    
ref|XP_006838678.1|  hypothetical protein AMTR_s00002p00244460          283   4e-75    
ref|XP_008365006.1|  PREDICTED: LOW QUALITY PROTEIN: SNF2 domain-...    283   4e-75    
ref|XP_006362027.1|  PREDICTED: SNF2 domain-containing protein CL...    281   4e-75    
ref|XP_002313774.2|  hypothetical protein POPTR_0009s12350g             279   6e-75    Populus trichocarpa [western balsam poplar]
gb|KDP41751.1|  hypothetical protein JCGZ_26769                         280   6e-75    
emb|CDP20550.1|  unnamed protein product                                276   7e-75    
ref|XP_006487355.1|  PREDICTED: SNF2 domain-containing protein CL...    280   7e-75    
ref|XP_008662890.1|  PREDICTED: SNF2 domain-containing protein CL...    280   7e-75    
ref|XP_009757870.1|  PREDICTED: SNF2 domain-containing protein CL...    280   1e-74    
ref|XP_002880380.1|  hypothetical protein ARALYDRAFT_481010             277   1e-74    
ref|XP_006379256.1|  hypothetical protein POPTR_0009s12350g             279   1e-74    
ref|XP_008662887.1|  PREDICTED: SNF2 domain-containing protein CL...    280   2e-74    
ref|XP_009757869.1|  PREDICTED: SNF2 domain-containing protein CL...    279   2e-74    
gb|EMS65430.1|  DNA repair protein rhp54                                285   2e-74    
ref|XP_009136303.1|  PREDICTED: SNF2 domain-containing protein CL...    278   2e-74    
ref|XP_006651068.1|  PREDICTED: SNF2 domain-containing protein CL...    279   2e-74    
ref|XP_010472140.1|  PREDICTED: SNF2 domain-containing protein CL...    277   2e-74    
ref|XP_002273814.2|  PREDICTED: SNF2 domain-containing protein CL...    278   3e-74    Vitis vinifera
ref|XP_010932641.1|  PREDICTED: SNF2 domain-containing protein CL...    280   4e-74    
gb|KHG00574.1|  Chromatin remodeling factor mit1                        277   5e-74    
ref|XP_010429057.1|  PREDICTED: SNF2 domain-containing protein CL...    276   5e-74    
ref|XP_009619238.1|  PREDICTED: SNF2 domain-containing protein CL...    277   9e-74    
ref|XP_009619239.1|  PREDICTED: SNF2 domain-containing protein CL...    277   9e-74    
ref|XP_004170971.1|  PREDICTED: SWI/SNF-related matrix-associated...    276   1e-73    
ref|XP_004150074.1|  PREDICTED: SWI/SNF-related matrix-associated...    276   1e-73    
gb|EPS74542.1|  hypothetical protein M569_00205                         276   1e-73    
ref|XP_010690455.1|  PREDICTED: SNF2 domain-containing protein CL...    275   1e-73    
ref|XP_010690454.1|  PREDICTED: SNF2 domain-containing protein CL...    275   2e-73    
ref|XP_010103355.1|  Helicase ARIP4                                     278   2e-73    
ref|XP_006299964.1|  hypothetical protein CARUB_v10016175mg             276   2e-73    
ref|XP_007133808.1|  hypothetical protein PHAVU_011G210800g             275   2e-73    
ref|XP_010088371.1|  Helicase ARIP4                                     278   2e-73    
ref|XP_008237011.1|  PREDICTED: SNF2 domain-containing protein CL...    276   2e-73    
emb|CDO97016.1|  unnamed protein product                                275   2e-73    
ref|XP_010650785.1|  PREDICTED: SNF2 domain-containing protein CL...    275   2e-73    
ref|XP_002275596.1|  PREDICTED: SNF2 domain-containing protein CL...    276   3e-73    
ref|XP_008460986.1|  PREDICTED: SNF2 domain-containing protein CL...    275   3e-73    
ref|XP_007200834.1|  hypothetical protein PRUPE_ppa026165mg             275   4e-73    
ref|XP_010690825.1|  PREDICTED: SNF2 domain-containing protein CL...    274   4e-73    
ref|XP_004289651.1|  PREDICTED: DNA repair protein rhp54-like           274   5e-73    
emb|CDY02262.1|  BnaA03g39050D                                          279   6e-73    
ref|XP_011037462.1|  PREDICTED: SNF2 domain-containing protein CL...    270   6e-73    
ref|XP_006409440.1|  hypothetical protein EUTSA_v10022532mg             274   7e-73    
ref|XP_001752976.1|  SNF2 family DNA-dependent ATPase                   268   1e-72    
ref|XP_008677014.1|  PREDICTED: uncharacterized protein LOC100277...    274   1e-72    
ref|XP_008794072.1|  PREDICTED: SNF2 domain-containing protein CL...    276   1e-72    
ref|XP_011088450.1|  PREDICTED: SNF2 domain-containing protein CL...    273   1e-72    
gb|EMT02828.1|  Helicase ARIP4                                          274   1e-72    
ref|XP_010467367.1|  PREDICTED: SNF2 domain-containing protein CL...    273   1e-72    
gb|KHG27373.1|  DNA repair rhp54                                        269   2e-72    
ref|XP_008677009.1|  PREDICTED: uncharacterized protein LOC100277...    273   2e-72    
ref|XP_010233184.1|  PREDICTED: SNF2 domain-containing protein CL...    270   3e-72    
ref|XP_010229151.1|  PREDICTED: SNF2 domain-containing protein CL...    273   3e-72    
ref|XP_010229150.1|  PREDICTED: SNF2 domain-containing protein CL...    273   3e-72    
ref|XP_006293671.1|  hypothetical protein CARUB_v10022627mg             271   4e-72    
ref|XP_007133805.1|  hypothetical protein PHAVU_011G210600g             271   4e-72    
ref|XP_007042095.1|  SNF2 domain-containing protein / helicase do...    271   4e-72    
ref|XP_010229149.1|  PREDICTED: SNF2 domain-containing protein CL...    272   5e-72    
ref|XP_007042093.1|  SNF2 domain-containing protein / helicase do...    271   5e-72    
ref|XP_003566103.1|  PREDICTED: SNF2 domain-containing protein CL...    268   6e-72    
ref|XP_011037161.1|  PREDICTED: SNF2 domain-containing protein CL...    270   7e-72    
ref|XP_006404593.1|  hypothetical protein EUTSA_v10000722mg             268   8e-72    
ref|XP_011037461.1|  PREDICTED: SNF2 domain-containing protein CL...    270   9e-72    
ref|NP_179232.1|  putative chromatin remodeling protein                 270   9e-72    
ref|XP_002978425.1|  hypothetical protein SELMODRAFT_109142             261   9e-72    
gb|EYU37828.1|  hypothetical protein MIMGU_mgv1a000946mg                270   1e-71    
ref|XP_010548073.1|  PREDICTED: SNF2 domain-containing protein CL...    269   3e-71    
ref|XP_010548070.1|  PREDICTED: SNF2 domain-containing protein CL...    269   5e-71    
ref|XP_010097536.1|  DNA repair protein rhp54                           272   5e-71    
gb|KHN04789.1|  DNA repair protein rhp54                                254   2e-70    
ref|XP_010917669.1|  PREDICTED: SNF2 domain-containing protein CL...    267   3e-70    
gb|AFW61268.1|  hypothetical protein ZEAMMB73_120769                    268   4e-70    
gb|KFK26942.1|  hypothetical protein AALP_AA8G313700                    265   5e-70    
ref|XP_009403389.1|  PREDICTED: SNF2 domain-containing protein CL...    266   7e-70    
ref|NP_001173279.1|  Os03g0165266                                       266   2e-69    
ref|NP_001059497.2|  Os07g0434500                                       263   2e-69    
gb|AAM15781.1|AC104428_2  Hypothetical protein                          265   7e-69    
ref|XP_010275547.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    261   1e-68    
gb|AFW63228.1|  hypothetical protein ZEAMMB73_593056                    264   2e-68    
ref|XP_010066188.1|  PREDICTED: SNF2 domain-containing protein CL...    259   4e-68    
ref|XP_010066187.1|  PREDICTED: SNF2 domain-containing protein CL...    259   6e-68    
gb|EEE58380.1|  hypothetical protein OsJ_09537                          263   8e-68    
emb|CDY23754.1|  BnaC04g43680D                                          255   2e-67    
gb|KCW64023.1|  hypothetical protein EUGRSUZ_G01701                     258   3e-67    
emb|CDX89710.1|  BnaC03g46240D                                          256   4e-67    
gb|ADG38555.1|  AT3G42670-like protein                                  234   3e-66    
emb|CAN62867.1|  hypothetical protein VITISV_015925                     254   1e-65    
ref|XP_001757487.1|  predicted protein                                  252   2e-65    
gb|AEN82121.1|  AT3G42670-like protein                                  231   3e-65    
gb|EMT17555.1|  DNA repair protein rhp54                                253   6e-65    
emb|CDY37734.1|  BnaA04g19340D                                          247   8e-65    
gb|ADG38561.1|  AT3G42670-like protein                                  226   1e-63    
ref|XP_002454559.1|  hypothetical protein SORBIDRAFT_04g033300          243   9e-62    
ref|XP_002305447.2|  hypothetical protein POPTR_0004s16640g             239   1e-61    
emb|CDP06211.1|  unnamed protein product                                228   2e-61    
ref|NP_001055451.1|  Os05g0392400                                       225   6e-60    
gb|AAV31264.1|  unknown protein                                         223   4e-59    
ref|XP_008342503.1|  PREDICTED: SNF2 domain-containing protein CL...    223   5e-59    
dbj|BAD05447.1|  putative SNF2 domain/helicase domain-containing ...    221   4e-56    
gb|EEE68305.1|  hypothetical protein OsJ_26567                          221   5e-56    
ref|XP_010531599.1|  PREDICTED: SNF2 domain-containing protein CL...    221   5e-55    
ref|XP_006844380.1|  hypothetical protein AMTR_s00142p00074850          205   2e-53    
gb|EEC83170.1|  hypothetical protein OsI_28396                          212   4e-53    
ref|XP_006659967.1|  PREDICTED: SNF2 domain-containing protein CL...    210   1e-52    
ref|XP_010497254.1|  PREDICTED: SNF2 domain-containing protein CL...    201   2e-52    
emb|CDY50136.1|  BnaCnng18850D                                          204   9e-52    
gb|KHN31311.1|  hypothetical protein glysoja_022965                     192   4e-48    
ref|XP_002878817.1|  hypothetical protein ARALYDRAFT_344097             189   4e-46    
emb|CBI38030.3|  unnamed protein product                                187   3e-45    
ref|XP_006345473.1|  PREDICTED: SNF2 domain-containing protein CL...    180   1e-43    
ref|XP_010315784.1|  PREDICTED: SNF2 domain-containing protein CL...    173   1e-42    
ref|XP_010271737.1|  PREDICTED: SNF2 domain-containing protein CL...    167   9e-42    
ref|XP_010674260.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    178   1e-41    
ref|XP_002884170.1|  defective in RNA-directed DNA methylation 1        176   1e-41    
ref|XP_002965859.1|  hypothetical protein SELMODRAFT_84719              169   4e-41    
ref|XP_010321626.1|  PREDICTED: DNA repair and recombination prot...    172   8e-41    
ref|XP_002983106.1|  hypothetical protein SELMODRAFT_117561             168   9e-41    
emb|CBI33981.3|  unnamed protein product                                165   5e-39    
ref|XP_003600984.1|  DNA repair and recombination protein RAD54-l...    155   2e-38    
ref|XP_004300302.1|  PREDICTED: DNA repair and recombination prot...    156   7e-38    
ref|XP_006295402.1|  hypothetical protein CARUB_v10024498mg             162   1e-37    
ref|XP_010431610.1|  PREDICTED: SNF2 domain-containing protein CL...    161   3e-37    
ref|XP_002530324.1|  ATP-dependent helicase, putative                   162   1e-36    
ref|XP_008193778.1|  PREDICTED: transcriptional regulator ATRX ho...    156   8e-35    
gb|EFA07270.1|  hypothetical protein TcasGA2_TC013301                   155   1e-34    
ref|XP_008193779.1|  PREDICTED: transcriptional regulator ATRX ho...    155   1e-34    
ref|XP_004955112.1|  PREDICTED: uncharacterized protein LOC101779648    154   2e-34    
ref|XP_004997282.1|  serine/threonine protein kinase                    155   3e-34    
emb|CDY16534.1|  BnaA08g02330D                                          142   7e-32    
ref|NP_001175502.1|  Os08g0289300                                       139   1e-31    
ref|XP_002429929.1|  conserved hypothetical protein                     141   3e-30    
ref|XP_010107834.1|  Helicase ARIP4                                     139   5e-30    
ref|XP_004301721.1|  PREDICTED: uncharacterized protein LOC101294955    140   5e-30    
gb|EYU38299.1|  hypothetical protein MIMGU_mgv1a026898mg                139   1e-29    
emb|CAN63899.1|  hypothetical protein VITISV_037125                     134   3e-29    
gb|EEE68406.1|  hypothetical protein OsJ_26763                          125   9e-27    
gb|EMT15434.1|  hypothetical protein F775_42514                         129   1e-26    
ref|XP_003622043.1|  Chromatin remodeling complex subunit               123   4e-26    
ref|XP_010315783.1|  PREDICTED: SNF2 domain-containing protein CL...    122   2e-25    
dbj|BAC79885.1|  unknown protein                                        121   1e-24    
ref|XP_010419326.1|  PREDICTED: SNF2 domain-containing protein CL...    121   2e-24    
ref|XP_001661368.1|  hypothetical protein AaeL_AAEL002341               120   3e-24    
ref|XP_010431612.1|  PREDICTED: uncharacterized protein LOC104715947    118   1e-23    
ref|XP_006828118.1|  hypothetical protein AMTR_s00023p00028640          115   6e-23    
ref|XP_010474450.1|  PREDICTED: SNF2 domain-containing protein CL...    114   3e-22    
gb|EMT33105.1|  Transcriptional regulator ATRX-like protein             106   5e-22    
ref|XP_001844000.1|  DNA repair and recombination protein RAD54         110   4e-21    
gb|EJW01437.1|  hypothetical protein EDEG_00031                         109   1e-20    
ref|XP_007143954.1|  hypothetical protein PHAVU_007G116600g             110   1e-20    
ref|XP_009772279.1|  PREDICTED: transcriptional regulator ATRX is...    110   1e-20    
ref|XP_007143955.1|  hypothetical protein PHAVU_007G116600g             109   1e-20    
ref|XP_010674261.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    109   1e-20    
ref|XP_004030661.1|  snf2 family n-terminal domain protein              108   2e-20    
ref|XP_009772278.1|  PREDICTED: transcriptional regulator ATRX is...    109   2e-20    
ref|XP_011038466.1|  PREDICTED: protein CHROMATIN REMODELING 20-l...    108   3e-20    
ref|XP_002319663.2|  SNF2 domain-containing family protein              108   3e-20    
ref|XP_011038465.1|  PREDICTED: protein CHROMATIN REMODELING 20-l...    108   3e-20    
emb|CBI37698.3|  unnamed protein product                                104   4e-20    
ref|XP_004152865.1|  PREDICTED: uncharacterized protein LOC101218346    108   5e-20    
ref|XP_010528765.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    107   6e-20    
ref|XP_010528764.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    107   6e-20    
ref|XP_010528766.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    107   6e-20    
ref|XP_010319828.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    107   6e-20    
ref|XP_010319829.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    107   7e-20    
ref|XP_004495589.1|  PREDICTED: transcriptional regulator ATRX-like     107   7e-20    
ref|XP_002522001.1|  conserved hypothetical protein                     107   8e-20    
gb|KDP23734.1|  hypothetical protein JCGZ_23567                         107   1e-19    
gb|KHN11681.1|  Putative SWI/SNF-related matrix-associated actin-...    102   1e-19    
ref|XP_002293550.1|  hypothetical protein THAPSDRAFT_263996             106   1e-19    
gb|KHN14826.1|  Transcriptional regulator ATRX                          106   2e-19    
ref|XP_006340466.1|  PREDICTED: transcriptional regulator ATRX-li...    106   2e-19    
ref|XP_006340467.1|  PREDICTED: transcriptional regulator ATRX-li...    106   2e-19    
gb|KEH42995.1|  chromatin remodeling complex subunit                    105   2e-19    
ref|XP_006661831.1|  PREDICTED: transcriptional regulator ATRX-like     105   2e-19    
ref|XP_008441784.1|  PREDICTED: transcriptional regulator ATRX is...    105   2e-19    
gb|EPS71964.1|  hypothetical protein M569_02794                         105   2e-19    
ref|XP_008441785.1|  PREDICTED: transcriptional regulator ATRX is...    105   2e-19    
gb|AES61237.2|  chromatin remodeling complex subunit                    105   2e-19    
ref|XP_008441780.1|  PREDICTED: transcriptional regulator ATRX is...    105   3e-19    
ref|XP_003555577.1|  PREDICTED: transcriptional regulator ATRX-li...    105   3e-19    
ref|XP_008441788.1|  PREDICTED: transcriptional regulator ATRX is...    105   3e-19    
ref|XP_008441786.1|  PREDICTED: transcriptional regulator ATRX is...    105   3e-19    
ref|XP_002112488.1|  hypothetical protein TRIADDRAFT_25002              104   4e-19    
emb|CBI22318.3|  unnamed protein product                                105   4e-19    
ref|XP_011077060.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    104   4e-19    
ref|XP_011077063.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    104   4e-19    
ref|XP_010660170.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    104   5e-19    
ref|XP_010660172.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    104   5e-19    
ref|XP_006606476.1|  PREDICTED: transcriptional regulator ATRX-li...    104   5e-19    
gb|KHN14716.1|  Transcriptional regulator ATRX                          104   6e-19    
emb|CDP18402.1|  unnamed protein product                              97.4    6e-19    
ref|XP_005704592.1|  DNA repair and recombination protein RAD26         101   6e-19    
ref|NP_001064765.1|  Os10g0457700                                       103   7e-19    
ref|XP_003571839.1|  PREDICTED: protein CHROMATIN REMODELING 20         103   8e-19    
ref|XP_010264859.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    103   9e-19    
gb|KFB39025.1|  AGAP009344-PA-like protein                              103   9e-19    
gb|EPB86391.1|  hypothetical protein HMPREF1544_06833                   103   1e-18    
ref|XP_009299692.1|  PREDICTED: transcriptional regulator ATRX is...    103   1e-18    
ref|XP_009299691.1|  PREDICTED: transcriptional regulator ATRX is...    103   1e-18    
gb|ABB47753.2|  SNF2 domain-containing protein, putative, expressed     103   1e-18    
ref|XP_009299690.1|  PREDICTED: transcriptional regulator ATRX is...    103   1e-18    
ref|XP_010264860.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    103   1e-18    
ref|XP_010918889.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    103   1e-18    
ref|XP_008807947.1|  PREDICTED: transcriptional regulator ATRX is...    103   1e-18    
ref|XP_009299689.1|  PREDICTED: transcriptional regulator ATRX is...    103   1e-18    
ref|XP_010918888.1|  PREDICTED: protein CHROMATIN REMODELING 20 i...    103   2e-18    
gb|EFA80683.1|  SNF2-related domain-containing protein                  102   2e-18    
ref|XP_008807945.1|  PREDICTED: transcriptional regulator ATRX is...    102   2e-18    
ref|XP_004524223.1|  PREDICTED: transcriptional regulator ATRX-like     102   2e-18    
gb|AAF99756.1|AC003981_6  F22O13.8                                      102   2e-18    
ref|NP_001184937.1|  protein ATRX                                       102   2e-18    
ref|XP_011036350.1|  PREDICTED: protein CHROMATIN REMODELING 20-like    102   3e-18    
ref|XP_007030348.1|  Chromatin remodeling complex subunit isoform 3     102   3e-18    
ref|XP_006437466.1|  hypothetical protein CICLE_v10030509mg             102   3e-18    
ref|XP_006304461.1|  hypothetical protein CARUB_v10011116mg             102   3e-18    
ref|XP_006484618.1|  PREDICTED: transcriptional regulator ATRX-li...    102   3e-18    
ref|XP_007030347.1|  P-loop containing nucleoside triphosphate hy...    102   3e-18    
ref|XP_007030346.1|  Chromatin remodeling complex subunit isoform 1     102   3e-18    
ref|XP_002325781.1|  SNF2 domain-containing family protein              101   3e-18    
ref|XP_006417668.1|  hypothetical protein EUTSA_v10006555mg             102   3e-18    
ref|XP_008218352.1|  PREDICTED: transcriptional regulator ATRX          101   4e-18    
ref|XP_004302104.1|  PREDICTED: uncharacterized protein LOC101296301    101   5e-18    
ref|XP_009162344.1|  hypothetical protein T265_00335                    101   5e-18    
ref|XP_007208140.1|  hypothetical protein PRUPE_ppa000170mg             101   6e-18    
ref|XP_004997981.1|  helicase DNA-binding protein                       101   6e-18    
ref|XP_002889705.1|  ATRX/CHR20                                         100   7e-18    
ref|XP_010475667.1|  PREDICTED: protein CHROMATIN REMODELING 20-like    100   7e-18    
ref|XP_009148227.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    100   7e-18    
emb|CDX93550.1|  BnaA06g04980D                                          100   7e-18    
ref|XP_010489091.1|  PREDICTED: protein CHROMATIN REMODELING 20-l...    100   7e-18    
ref|XP_010458103.1|  PREDICTED: protein CHROMATIN REMODELING 20         100   7e-18    
emb|CDX95047.1|  BnaC05g06240D                                          100   9e-18    
ref|XP_010024935.1|  PREDICTED: transcriptional regulator ATRX          100   1e-17    
ref|XP_629344.1|  SNF2-related domain-containing protein                100   1e-17    
ref|XP_006854411.1|  hypothetical protein AMTR_s00039p00200130        99.4    2e-17    
emb|CBK23608.2|  unnamed protein product                              99.0    2e-17    
gb|EPY35327.1|  SNF2 DNA repair protein                               99.0    2e-17    
emb|CBI15777.3|  unnamed protein product                              97.8    3e-17    
emb|CAD35753.1|  X-linked nuclear protein                             98.6    3e-17    



>ref|XP_004240884.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Solanum 
lycopersicum]
 ref|XP_010322151.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Solanum 
lycopersicum]
 ref|XP_010322152.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Solanum 
lycopersicum]
 ref|XP_010322153.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Solanum 
lycopersicum]
 ref|XP_010322154.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Solanum 
lycopersicum]
 ref|XP_010322155.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Solanum 
lycopersicum]
Length=1287

 Score =  1804 bits (4673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1299 (73%), Positives = 1082/1299 (83%), Gaps = 34/1299 (3%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R IH N HP D +PFEAF  GSWQ VER+RI  GT   HVL +G++IEE I ++N+R+R
Sbjct  2     KRHIHYNAHPIDPHPFEAFWYGSWQAVERLRINMGTITTHVLVDGEVIEENIPVTNLRMR  61

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR AT SDCACFLRPGL++ V S P+Q E+S +      + + +P WID KIRSIERKPH
Sbjct  62    SRKATLSDCACFLRPGLEVCVLSIPYQGENSGD------EKDVKPVWIDGKIRSIERKPH  115

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
                C C+FH+SVYVTQGPPPI+KKTLSKEIK++ ++QIA+LQK+E KPCE+K YRWS S+
Sbjct  116   ELTCTCKFHVSVYVTQGPPPILKKTLSKEIKMLPIDQIAVLQKLEPKPCENKRYRWSSSE  175

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DC++LQ FKLF GKF SDL+W++ AS  K+  FDV+S+HN+IVYEI+ D+      NS  
Sbjct  176   DCNSLQTFKLFIGKFSSDLTWLMTASVLKEATFDVRSIHNQIVYEIVDDDLVRKETNSNQ  235

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDEL--RRSKRRFVQPER  3309
             HSY+V+FKLE  V T  +IQFN DIP+     D+ E+GPLV+YD +  RRSKRRFVQPER
Sbjct  236   HSYSVNFKLEGGVQTTTVIQFNRDIPDINSTSDLSESGPLVLYDLMGPRRSKRRFVQPER  295

Query  3308  YLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTLACYQQEl  3129
             Y GCDD + EFDVEMTRLVGG+  K E EELP+ALSIQADHAY+ G+I+  + + Y++EL
Sbjct  296   YYGCDDDMAEFDVEMTRLVGGRR-KVEYEELPLALSIQADHAYRTGEIEEIS-SSYKREL  353

Query  3128  rdnsllsrnrnssksDT--------------NRKRVSGDKAH-LAIVPLQLSAENNLFDQ  2994
                ++ S  + SS+S +              ++K V+ D+ H LAIVPL   +   L   
Sbjct  354   FGGNIRSHEKRSSESSSGWRNALKSDVNKLADKKSVTADRQHQLAIVPLHPPSGTGLTVH  413

Query  2993  KENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSS-LNLM--QGRRWGQVKVSKLK  2823
             ++ PL  +  E LSAEI EIVS+YI+ N SS    +K+S +N    + RRWGQVK+SKLK
Sbjct  414   EQVPLDVDVPEHLSAEIGEIVSRYIHFNSSSTSHDRKASKMNFTKPEARRWGQVKISKLK  473

Query  2822  FMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDET  2643
             FMGLD +GG +GS KK  +  T   ++DSIYDIRSF+KGS++ANVY+ELIRRCMANID T
Sbjct  474   FMGLDRRGGTLGSHKKYKRNTT---KKDSIYDIRSFKKGSVAANVYKELIRRCMANIDAT  530

Query  2642  LNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDT  2463
             LNKEQPPIIDQWKEFQ+TKS QRE  +  + N +EE+SE+DMLWKEMELALASCYLLDD+
Sbjct  531   LNKEQPPIIDQWKEFQSTKSSQRESGDHLAMNRDEEVSEIDMLWKEMELALASCYLLDDS  590

Query  2462  EDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSS  2283
             ED++ + A+ + +  +    VC HD+RLNEEIG++CRLCG VSTEIKDVPPPFMPS+  +
Sbjct  591   EDSHAQYASNVRIGAEIRGEVCRHDYRLNEEIGIICRLCGFVSTEIKDVPPPFMPSSNHN  650

Query  2282  SGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQR  2103
             S KEQR EE   + KQ DD  LD  +IPVSS  PSS    E N WALIPDL NKLR HQ+
Sbjct  651   SSKEQRTEEAT-DHKQDDDG-LDTLSIPVSSRAPSSSGGGEGNVWALIPDLGNKLRVHQK  708

Query  2102  RAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPL  1923
             RAFEFLWKNIAGSI+P ++ PESK+RGGCVISH+PGAGKTLLII+FLVSYLKLFPGSRPL
Sbjct  709   RAFEFLWKNIAGSIVPAEMQPESKERGGCVISHTPGAGKTLLIISFLVSYLKLFPGSRPL  768

Query  1922  VLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDC  1743
             VLAPKTTLYTWYKE++KWKIP+PVYQIHGGQT+KGEVLR+K+KLCPGLPRNQDVMHVLDC
Sbjct  769   VLAPKTTLYTWYKEVLKWKIPVPVYQIHGGQTFKGEVLREKVKLCPGLPRNQDVMHVLDC  828

Query  1742  LEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTK  1563
             LEKMQ WL+ PSVLLMGYTSFLTLTREDS YAHRKYM QVLRQCPG+LILDEGHNPRSTK
Sbjct  829   LEKMQMWLSQPSVLLMGYTSFLTLTREDSPYAHRKYMAQVLRQCPGLLILDEGHNPRSTK  888

Query  1562  SRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA  1383
             SRLRK LMKVNT LRILLSGTLFQNNFGEYFNTL LARP FVDEVLKELDPKYK + KGA
Sbjct  889   SRLRKGLMKVNTRLRILLSGTLFQNNFGEYFNTLTLARPTFVDEVLKELDPKYKNKNKGA  948

Query  1382  KTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQ  1203
              +RFSLENRARKMFIDKIS  IDS   ++RKEGLNILKKLT GFIDV++GG+SDNLPGLQ
Sbjct  949   -SRFSLENRARKMFIDKISTVIDSDIPKKRKEGLNILKKLTGGFIDVHDGGTSDNLPGLQ  1007

Query  1202  CYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkee  1023
             CYTLMMKSTTLQQEILVKLQ+QRPIYKGFPLELELLITLGAIHPWLIRTTACS QYFKEE
Sbjct  1008  CYTLMMKSTTLQQEILVKLQNQRPIYKGFPLELELLITLGAIHPWLIRTTACSSQYFKEE  1067

Query  1022  elealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  843
             ELEAL+KFKFDLKLGSKVKFVMSLIPRCLLR+EKVLIFCHNIAPINLFLEIFERFYGWRK
Sbjct  1068  ELEALQKFKFDLKLGSKVKFVMSLIPRCLLRREKVLIFCHNIAPINLFLEIFERFYGWRK  1127

Query  842   GIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  663
             GIEVLVLQGDIELF+RGR+MD FEE GGPSKVMLASITTCAEGISLTAASRVILLDSEWN
Sbjct  1128  GIEVLVLQGDIELFQRGRIMDLFEEPGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  1187

Query  662   PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  483
             PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH
Sbjct  1188  PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  1247

Query  482   WQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGRLQ  366
             WQAPKIEDELL EIVEEDRATLFH IMKNEKASNMG LQ
Sbjct  1248  WQAPKIEDELLREIVEEDRATLFHAIMKNEKASNMGSLQ  1286



>ref|XP_006353420.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006353421.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Solanum tuberosum]
Length=1286

 Score =  1798 bits (4658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 938/1298 (72%), Positives = 1069/1298 (82%), Gaps = 33/1298 (3%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R IH N HP D +PFEAF  GSWQ VER+RI  GT   HVL +G++IEE I ++N+R+R
Sbjct  2     KRHIHYNAHPIDPHPFEAFWYGSWQAVERLRINMGTITTHVLVDGEVIEENIPVTNLRMR  61

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR AT SDCACFLRPGL++ V S P+Q EDS +      + + +P WID KIRSIERKPH
Sbjct  62    SRKATLSDCACFLRPGLEVCVLSIPYQGEDSGD------EKDVKPVWIDGKIRSIERKPH  115

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
                C C+FH+SVYVTQGPPPI+KKTLSKEIK++ ++QIA+LQK+E KPCEDK+YRWS S+
Sbjct  116   ELTCTCEFHVSVYVTQGPPPILKKTLSKEIKMLPIDQIAVLQKLEPKPCEDKHYRWSSSE  175

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DC++LQ FKLF GKF SDL+W++ AS  K+  FDV+S+HN+IVYEI+ D+      N   
Sbjct  176   DCNSLQTFKLFIGKFSSDLTWLMTASVLKEATFDVRSIHNQIVYEIVDDDLVKKESNPNQ  235

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDEL--RRSKRRFVQPER  3309
             HS++V+FKLE+ V T  + QF+ DIP+     D+ EAGPLV+YD +  RRSKRRFVQPER
Sbjct  236   HSHSVNFKLEDGVQTTTVFQFSRDIPDVNSTSDLSEAGPLVLYDLMGPRRSKRRFVQPER  295

Query  3308  YLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTLACYQQE-  3132
             Y GCDD + EFDVEMTRLVGG+  K E EELP+ALSIQADHAY+ G+ID +    Y++E 
Sbjct  296   YYGCDDDMAEFDVEMTRLVGGRR-KVEYEELPLALSIQADHAYRTGEID-EIARSYKREL  353

Query  3131  ------------lrdnsllsrnrnssksDTNRKRVSGDKAH-LAIVPLQLSAENNLFDQK  2991
                            +   +  ++      ++K V+ D  H LAIVPL  S+  +L   +
Sbjct  354   FGGSIRPHEKSSESSSGWRNALKSDVNKLADKKSVTADSQHQLAIVPLHPSSGTDLTVHE  413

Query  2990  ENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSS-LNLM--QGRRWGQVKVSKLKF  2820
             + PL  +  E LSAEI EIVS+YIY N SS    +K+S +N    + RRWGQVK+SKLKF
Sbjct  414   QVPLDVDVPEHLSAEIGEIVSRYIYFNSSSTSHDRKASKMNFTKPEARRWGQVKISKLKF  473

Query  2819  MGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETL  2640
             MGLD      G+     K +   S++DSIYDIRSF+KGS++ANVY+ELIRRCMANID TL
Sbjct  474   MGLD---RRGGALGSHKKYKRNSSKKDSIYDIRSFKKGSVAANVYKELIRRCMANIDATL  530

Query  2639  NKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDTE  2460
             NKEQPPIIDQWKEFQ+TKS  RE  +  + N +EE+SE+DMLWKEMELALASCYLLDD+E
Sbjct  531   NKEQPPIIDQWKEFQSTKSDHRESGDHLAMNRDEEVSEIDMLWKEMELALASCYLLDDSE  590

Query  2459  DTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSS  2280
             D++++ A+ + +  +    VC HD+RLNEEIG++CRLCG VSTEIKDVPPPFMPS+  SS
Sbjct  591   DSHVQYASNVRIGAEIRGEVCRHDYRLNEEIGIICRLCGFVSTEIKDVPPPFMPSSNYSS  650

Query  2279  GKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRR  2100
              KEQR EE   + KQ DD  LD  +IPVSS  PSS    E N W LIPDL  KLR HQ+R
Sbjct  651   NKEQRTEEAT-DHKQDDDG-LDTLSIPVSSRAPSSSGGGEGNVWELIPDLGKKLRVHQKR  708

Query  2099  AFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLV  1920
             AFEFLWKNIAGSI+P ++ PESK+RGGCVISH+PGAGKTLLII+FLVSYLKLFPGSRPLV
Sbjct  709   AFEFLWKNIAGSIVPAEMQPESKERGGCVISHTPGAGKTLLIISFLVSYLKLFPGSRPLV  768

Query  1919  LAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCL  1740
             LAPKTTLYTWYKE++KWKIP+PVYQIHGGQT+KGEVLR+K+KLCPGLPRNQDVMHVLDCL
Sbjct  769   LAPKTTLYTWYKEVLKWKIPVPVYQIHGGQTFKGEVLREKVKLCPGLPRNQDVMHVLDCL  828

Query  1739  EKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKS  1560
             EKMQ WL+ PSVLLMGYTSFLTLTREDS YAHRKYM QVLR CPG+LILDEGHNPRSTKS
Sbjct  829   EKMQMWLSQPSVLLMGYTSFLTLTREDSPYAHRKYMAQVLRHCPGLLILDEGHNPRSTKS  888

Query  1559  RLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAK  1380
             RLRK LMKVNT LRILLSGTLFQNNFGEYFNTL LARP FVDEVLKELDPKYKK+ KGA 
Sbjct  889   RLRKGLMKVNTRLRILLSGTLFQNNFGEYFNTLTLARPTFVDEVLKELDPKYKKKNKGA-  947

Query  1379  TRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQC  1200
             +RFSLENRARKMFIDKIS  IDS   ++RKEGLNILKKLT GFIDV++GG+SDNLPGLQC
Sbjct  948   SRFSLENRARKMFIDKISTVIDSDIPKKRKEGLNILKKLTGGFIDVHDGGTSDNLPGLQC  1007

Query  1199  YTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeee  1020
             YTLMMKSTTLQQEILVKLQ+QRPIYKGFPLELELLITLGAIHPWLIRTTACS QYFKEEE
Sbjct  1008  YTLMMKSTTLQQEILVKLQNQRPIYKGFPLELELLITLGAIHPWLIRTTACSSQYFKEEE  1067

Query  1019  lealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKG  840
             LEAL+KFKFDLKLGSKVKFVMSLIPRCLLR+EKVLIFCHNIAPINLFLEIFERFYGWRKG
Sbjct  1068  LEALQKFKFDLKLGSKVKFVMSLIPRCLLRREKVLIFCHNIAPINLFLEIFERFYGWRKG  1127

Query  839   IEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNP  660
             IEVLVLQGDIELF+RGR+MD FEE GGPSKVMLASITTCAEGISLTAASRVILLDSEWNP
Sbjct  1128  IEVLVLQGDIELFQRGRIMDLFEEPGGPSKVMLASITTCAEGISLTAASRVILLDSEWNP  1187

Query  659   SKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHW  480
             SKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHW
Sbjct  1188  SKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHW  1247

Query  479   QAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGRLQ  366
             QAPKIEDELL EIVEEDRATLFH IMKNEKASNMG LQ
Sbjct  1248  QAPKIEDELLREIVEEDRATLFHAIMKNEKASNMGSLQ  1285



>ref|XP_009775827.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Nicotiana 
sylvestris]
Length=1285

 Score =  1793 bits (4644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 953/1299 (73%), Positives = 1077/1299 (83%), Gaps = 36/1299 (3%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +H N HP D +PFEAF  GSW  VER+R+  GT   HVL   ++IEE I ++++RIR
Sbjct  2     KRQLHYNAHPIDPHPFEAFWYGSWHAVERLRVSVGTITTHVLVNEEVIEENIPVTDLRIR  61

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR AT SDCACFLRPGLD+ V S P+Q+EDSD+      + + +P WIDAKIRSIERKPH
Sbjct  62    SRKATLSDCACFLRPGLDVCVLSIPYQAEDSDD------EKDVKPVWIDAKIRSIERKPH  115

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
                C CQF++SVYVTQGPPPIVKK LSKEI ++ ++QIAILQ++E KPCEDK+YRWS S+
Sbjct  116   ELTCTCQFYVSVYVTQGPPPIVKKALSKEINMLHIDQIAILQRLEPKPCEDKHYRWSSSE  175

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DC++LQ FKLF GKF SDL+W++ AS  K+  FDV+S+HN+IVYEI+ D+ D + PN   
Sbjct  176   DCNSLQNFKLFIGKFSSDLTWLVAASVLKEATFDVRSIHNQIVYEIVDDDLDKE-PNLNL  234

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDEL--RRSKRRFVQPER  3309
              SY+V+FKLEN VST  ++QF+ DIP      D  EAGPL++YD +  RRSKRRFVQPER
Sbjct  235   LSYSVNFKLENGVSTTTVVQFSRDIPVVNSTSDASEAGPLILYDPMGPRRSKRRFVQPER  294

Query  3308  YLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTLACYQ---  3138
             Y GCDD LT+FDVEMTRLVGG+  K E EELP+ALSIQADHAY+NG+I+ + +  Y+   
Sbjct  295   YYGCDDDLTDFDVEMTRLVGGRR-KVEYEELPLALSIQADHAYKNGEIE-ENIRSYERKL  352

Query  3137  -------QElrdnsllsrnrnssksDTNR----KRVSGDKAH-LAIVPLQLSAENNLFDQ  2994
                    QE + +   +  RN+ KSD N+    K V+ D  H LAIVPL     N+L   
Sbjct  353   FGGNIRPQEKKSSESSAGWRNALKSDINKLADEKSVTADSQHPLAIVPLP-PVGNDLIGD  411

Query  2993  KENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSS-LNLM--QGRRWGQVKVSKLK  2823
             +   L  E  ED+SAEI EIVS+YIY NGSS    + +S +N    + RRWGQVK+SKLK
Sbjct  412   EHVTLDVEVPEDVSAEIGEIVSRYIYFNGSSTSHNRNTSRMNFTKPEARRWGQVKISKLK  471

Query  2822  FMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDET  2643
             FMGLD      G      K +   S++DSIYDIRSF+KG+++ANVY+ELIRRCMANID T
Sbjct  472   FMGLD---RRHGGLGSHKKYKRNTSKKDSIYDIRSFKKGAVAANVYKELIRRCMANIDAT  528

Query  2642  LNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDT  2463
             LNKEQPPIIDQWKEFQ+TKS  RE  E  S N EEE+SE+DMLWKEMELALASCYLLDD+
Sbjct  529   LNKEQPPIIDQWKEFQSTKSGHRESAENVSVNKEEEISEIDMLWKEMELALASCYLLDDS  588

Query  2462  EDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSS  2283
             ED++++ A+++ +  +    VC HD+RLNEEIG++CRLCG VSTEIKDVPPPFMPS   S
Sbjct  589   EDSHVQYASDVRIGAEIRGEVCRHDYRLNEEIGIICRLCGFVSTEIKDVPPPFMPSANYS  648

Query  2282  SGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQR  2103
             S KEQR EE    ++  D+  LD  +IP SSN PSS  E E N WALIPDLRNKLR HQ+
Sbjct  649   SSKEQRTEEATYHKQ--DEDGLDSLSIPASSNAPSSSGEGEGNVWALIPDLRNKLRVHQK  706

Query  2102  RAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPL  1923
             RAFEFLWKNIAGS++P +++PESKKRGGCVISH+PGAGKTLLIIAFLVSYLKLFPGSRPL
Sbjct  707   RAFEFLWKNIAGSVVPAEMEPESKKRGGCVISHTPGAGKTLLIIAFLVSYLKLFPGSRPL  766

Query  1922  VLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDC  1743
             VLAPKTTLYTWYKE++KWKIP+PVYQIHGGQTYKGEVLR+KMKLCPGLPRNQDVMHVLDC
Sbjct  767   VLAPKTTLYTWYKEVLKWKIPVPVYQIHGGQTYKGEVLREKMKLCPGLPRNQDVMHVLDC  826

Query  1742  LEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTK  1563
             LEKMQ WL+ PSVLLMGYTSFLTLTREDS YAHRKYM QVL QCPG+LILDEGHNPRSTK
Sbjct  827   LEKMQMWLSQPSVLLMGYTSFLTLTREDSPYAHRKYMAQVLTQCPGLLILDEGHNPRSTK  886

Query  1562  SRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA  1383
             SRLRK LMKVNT LRILLSGTLFQNNFGEYFNTL LARP FVDEVLKELDPKYKK+ KGA
Sbjct  887   SRLRKGLMKVNTRLRILLSGTLFQNNFGEYFNTLTLARPIFVDEVLKELDPKYKKKNKGA  946

Query  1382  KTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQ  1203
              +RFSLENRARKMFIDKIS  IDS   ++RKEGLNILKKLT GFIDVY+GGSSD LPGLQ
Sbjct  947   -SRFSLENRARKMFIDKISSVIDSDIPKKRKEGLNILKKLTGGFIDVYDGGSSDRLPGLQ  1005

Query  1202  CYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkee  1023
             CYTLMMKSTTLQQEILVKLQ+QRPIYKGFPLELELLITLGAIHPWLIRTTACS QYFKEE
Sbjct  1006  CYTLMMKSTTLQQEILVKLQNQRPIYKGFPLELELLITLGAIHPWLIRTTACSSQYFKEE  1065

Query  1022  elealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  843
             ELEAL++FKFDLKLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK
Sbjct  1066  ELEALQQFKFDLKLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  1125

Query  842   GIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  663
             GIE LVLQGDIELF+RGR+MD+FEE GGPSKVMLASITTCAEGISLTAASRVILLDSEWN
Sbjct  1126  GIEALVLQGDIELFQRGRIMDQFEEPGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  1185

Query  662   PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  483
             PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH
Sbjct  1186  PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  1245

Query  482   WQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGRLQ  366
             WQAPKIEDELL EIVEEDRATLFH IMKNEKASNMG LQ
Sbjct  1246  WQAPKIEDELLREIVEEDRATLFHAIMKNEKASNMGSLQ  1284



>ref|XP_009594370.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009594371.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Nicotiana 
tomentosiformis]
Length=1286

 Score =  1789 bits (4634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 952/1299 (73%), Positives = 1076/1299 (83%), Gaps = 35/1299 (3%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +H N HP D +PFEAF  GSW  VER+RI  GT   +VL   ++IEE I ++++RIR
Sbjct  2     KRQLHYNAHPIDPHPFEAFWYGSWHAVERLRISVGTITTYVLVNEEVIEENIPVTDLRIR  61

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR AT SDCACFLRPGLD+   S P+Q+EDSD+      + + +P WIDAKIRSIERKPH
Sbjct  62    SRKATLSDCACFLRPGLDVCALSIPYQAEDSDD------EQDVKPVWIDAKIRSIERKPH  115

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
                C CQF++SVYVTQGPPPIVKK LSKEI ++ ++QIAILQ++E KPCEDK+YRWS S+
Sbjct  116   DLTCTCQFYVSVYVTQGPPPIVKKALSKEINMLHIDQIAILQRLEPKPCEDKHYRWSSSE  175

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DC++LQ FKLF GKF SDL+W++ AS  K+  FDV+S+HN+IVYEI+ D+ D   PN + 
Sbjct  176   DCNSLQNFKLFIGKFSSDLTWLVAASVLKEATFDVRSIHNQIVYEIVDDDLDKKEPNMDQ  235

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDEL--RRSKRRFVQPER  3309
              SY+V+FKLEN VST   +QF+ DI       D  EAGPL++YD +  RRSKRRFVQPER
Sbjct  236   LSYSVNFKLENGVSTTAAVQFSRDISVVNSTSDASEAGPLILYDPMGPRRSKRRFVQPER  295

Query  3308  YLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTLACYQ---  3138
             Y GCDD LT+FDVEMTRLVGG+  K E EELP+ALSIQADHAY+NG+I+ + +  Y+   
Sbjct  296   YNGCDDDLTDFDVEMTRLVGGRR-KVEYEELPLALSIQADHAYKNGEIE-ENIRSYERKF  353

Query  3137  -------QElrdnsllsrnrnssksDTN----RKRVSGD-KAHLAIVPLQLSAENNLFDQ  2994
                    QE + +   +  RN+ KSD N    +K V+ D +  LAIVPL      +L   
Sbjct  354   FGGNIRPQEKKPSESSAGWRNALKSDINTLADKKSVTADSQRQLAIVPLP-PVGTDLIGD  412

Query  2993  KENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSS-LNLM--QGRRWGQVKVSKLK  2823
             +  PL  E  ED+SAEI EIVS+YIY NGSS    + +S +N    + RRWGQVK+SKLK
Sbjct  413   EHVPLDVEVPEDVSAEIGEIVSRYIYFNGSSTSHNRNTSRMNFTKPEARRWGQVKISKLK  472

Query  2822  FMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDET  2643
             FMGLD      G      K +   S++DSIYDIRSF+KG+++ANVY+ELIRRCMANID T
Sbjct  473   FMGLD---RRRGGLGSHKKYKRNTSKKDSIYDIRSFKKGAVAANVYKELIRRCMANIDAT  529

Query  2642  LNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDT  2463
             LNKEQPPIIDQWKEFQ+TKS  RE  E  S N EEE+SE+D+LWKEMELALASCYLLDD+
Sbjct  530   LNKEQPPIIDQWKEFQSTKSGHRESTENVSANKEEEISEIDLLWKEMELALASCYLLDDS  589

Query  2462  EDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSS  2283
             ED++++ A+++ +  +    VC HD+RLNEEIG++CRLCG VSTEIKDVPPPFMPS   S
Sbjct  590   EDSHVQYASDVRIGAEIRGEVCRHDYRLNEEIGIICRLCGFVSTEIKDVPPPFMPSANYS  649

Query  2282  SGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQR  2103
             S KEQR EE   + KQ +D  LD  +IP SSN PSS  E EDN WALIPDLRNKLR HQ+
Sbjct  650   SSKEQRTEEAT-DYKQDEDG-LDSLSIPASSNAPSSSGEGEDNVWALIPDLRNKLRVHQK  707

Query  2102  RAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPL  1923
             RAFEFLWKNIAGS++P +++PE KKRGGCVISH+PGAGKTLLIIAFLVSYLKLFPGSRPL
Sbjct  708   RAFEFLWKNIAGSVVPAEMEPECKKRGGCVISHTPGAGKTLLIIAFLVSYLKLFPGSRPL  767

Query  1922  VLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDC  1743
             VLAPKTTLYTWYKE++KWKIP+PVYQIHGGQTYKGEVLR+KMKLCPGLPRNQDVMHVLDC
Sbjct  768   VLAPKTTLYTWYKEVLKWKIPVPVYQIHGGQTYKGEVLREKMKLCPGLPRNQDVMHVLDC  827

Query  1742  LEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTK  1563
             LEKMQ WL+ PSVLLMGYTSFLTLTREDS YAHRKYM QVL QCPG+LILDEGHNPRSTK
Sbjct  828   LEKMQMWLSQPSVLLMGYTSFLTLTREDSPYAHRKYMAQVLTQCPGLLILDEGHNPRSTK  887

Query  1562  SRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA  1383
             SRLRK LMKVNT LRILLSGTLFQNNFGEYFNTL LARP FVDEVLKELDPKYKK+ KGA
Sbjct  888   SRLRKGLMKVNTRLRILLSGTLFQNNFGEYFNTLTLARPIFVDEVLKELDPKYKKKNKGA  947

Query  1382  KTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQ  1203
              +RFSLENRARKMFIDKIS  IDS   ++RKEGLNILKKLT GFIDVY+GGSSD LPGLQ
Sbjct  948   -SRFSLENRARKMFIDKISSVIDSDIPKKRKEGLNILKKLTGGFIDVYDGGSSDKLPGLQ  1006

Query  1202  CYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkee  1023
             CYTLMMKSTTLQQEILVKLQ+QRPIYKGFPLELELLITLGAIHPWLIRTTACS QYFKEE
Sbjct  1007  CYTLMMKSTTLQQEILVKLQNQRPIYKGFPLELELLITLGAIHPWLIRTTACSSQYFKEE  1066

Query  1022  elealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  843
             ELEAL++FKFDLKLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK
Sbjct  1067  ELEALQQFKFDLKLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  1126

Query  842   GIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  663
             GIEVLVLQGDIELF+RGR+MD+FEE GGPSKVMLASITTCAEGISLTAASRVILLDSEWN
Sbjct  1127  GIEVLVLQGDIELFQRGRIMDQFEEPGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  1186

Query  662   PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  483
             PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH
Sbjct  1187  PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  1246

Query  482   WQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGRLQ  366
             WQAPKIEDELL EIVEEDRATLFH IMKNEKASNMG LQ
Sbjct  1247  WQAPKIEDELLREIVEEDRATLFHAIMKNEKASNMGSLQ  1285



>emb|CDP13967.1| unnamed protein product [Coffea canephora]
Length=1277

 Score =  1572 bits (4071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 839/1294 (65%), Positives = 993/1294 (77%), Gaps = 45/1294 (3%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ + ++ HP D YPFEA+  GSW  VER+RI++G   MH++D G++IEE I  SN+R
Sbjct  1     MKRKRLDESSHPLDTYPFEAYWWGSWHAVERLRIKDGAVTMHLVDNGEVIEEMIPTSNLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC+C LRPGLD+ V +    +EDS          E    W+DA+IRSIERK
Sbjct  61    MRSRKATINDCSCILRPGLDVCVLTASSDTEDSS---------EDSLVWVDARIRSIERK  111

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PHG  C C F++S Y+ +     ++K LSKE   VQ++QI ILQK++  P E+++YRW  
Sbjct  112   PHGAICACHFYVSFYIREDAALTLQKKLSKETTRVQIDQIMILQKLDSVPSENQHYRWRT  171

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDID-APN  3492
             S+DCS+L K+KLFTGKFCSDL+W++VAS  KQ  FDV+SV  R+VYE+L    D+D + +
Sbjct  172   SEDCSSLLKYKLFTGKFCSDLTWLVVASVVKQAIFDVRSVEGRMVYEVL----DVDCSTD  227

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
             S  +SY V+FKL+N + +PII+QF P I +R  + +++   PL +Y+  +LRRSKRRFVQ
Sbjct  228   SGSNSYCVNFKLDNGILSPIIVQFVPGIGKRTGD-EMHTDAPLCLYEPMDLRRSKRRFVQ  286

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYK-----SELEELPMALSIQADHAYQNGD-IDNK  3156
             P+RYLGCD  + EFDVE  R+ G KM K      E EE+P+ALSIQADH YQ  D  +N+
Sbjct  287   PDRYLGCD--VPEFDVETPRIGGRKMCKWDYEDEECEEMPLALSIQADHKYQKHDENENR  344

Query  3155  TLACYQQElrd-----nsllsrnrnssksDTNRKRVSGDKAHLAIVPLQLSAENNLFDQK  2991
                C ++  ++     ++  S    +S+S   R++   D++ LA+VPL +S+E     ++
Sbjct  345   DFFCKRRSDKNIRVCGSADKSTVSKNSESSPTREKKQSDQSQLALVPLSISSEGKSILRE  404

Query  2990  ENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRRWGQVKVSKLKFMGL  2811
              +    E+ ED S  I +++S+Y+Y NGS+A   KK +  L   R+ G   V  L     
Sbjct  405   LDASYDENPEDHSGNIADLISRYLYENGSTAKGRKKKASELNFNRKEGGFMVQHLP----  460

Query  2810  DVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKE  2631
                         K       S+ +SIY+++   K S SA   REL+ RCM NID T+N E
Sbjct  461   --------RKTYKRSAFCIRSEWESIYNLKPSGKKSFSAAACRELLTRCMENIDATINME  512

Query  2630  QPPIIDQWKEFQNTK-SCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDT  2454
             QPPIIDQW+EF++TK   Q+E  +K+  N+EEE+SE+DMLWKEMELALASCY LDD E++
Sbjct  513   QPPIIDQWEEFKSTKFQNQKETNDKAEKNHEEEISEIDMLWKEMELALASCYFLDDGEES  572

Query  2453  NLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGK  2274
             +    TE  ++T+KG   CHHD+RLNEEIG++CRLCG VSTEIKDV PPF  S      K
Sbjct  573   H-AFPTERKLSTEKGGTGCHHDYRLNEEIGVICRLCGFVSTEIKDVSPPFWSSASGFVHK  631

Query  2273  EQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAF  2094
             EQR EE  +E K      LD+F +P SS  PSSE EVED+ WALIPDLR+KLRAHQ+RAF
Sbjct  632   EQRAEEN-LEHKPNGAEGLDNFQVPASSKAPSSEGEVEDSVWALIPDLRSKLRAHQKRAF  690

Query  2093  EFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLA  1914
             EFLW NIAGS++P  ++ +SK+RGGCVISH+PGAGKTLLII FLVSYLKLFPGSRPLVLA
Sbjct  691   EFLWGNIAGSLVPALMEEKSKRRGGCVISHTPGAGKTLLIITFLVSYLKLFPGSRPLVLA  750

Query  1913  PKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEK  1734
             PKTTLYTWYKE+IKW IPIPVYQIHGGQTYKGEVLRQ+++   GLPRNQD MHVLDCLEK
Sbjct  751   PKTTLYTWYKEVIKWNIPIPVYQIHGGQTYKGEVLRQRLRSNAGLPRNQDFMHVLDCLEK  810

Query  1733  MQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRL  1554
             MQKWL+HPSVLLMGYTSFLTLTRE S YAHRKYM QVLRQCPGILILDEGHNPRSTKSRL
Sbjct  811   MQKWLSHPSVLLMGYTSFLTLTREGSNYAHRKYMAQVLRQCPGILILDEGHNPRSTKSRL  870

Query  1553  RKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTR  1374
             RKALMKVNT LR+LLSGTLFQNNFGEYFNTLCLARP FV EVLKELDPKYK+  KG K R
Sbjct  871   RKALMKVNTKLRVLLSGTLFQNNFGEYFNTLCLARPNFVKEVLKELDPKYKRNKKGQKNR  930

Query  1373  FSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYT  1194
             FS ENRARKMF DKISK IDS+   ER EGLNILK LT GFIDVYEGGSSDNLPGLQCYT
Sbjct  931   FSQENRARKMFTDKISKLIDSNIPDERLEGLNILKNLTGGFIDVYEGGSSDNLPGLQCYT  990

Query  1193  LMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeele  1014
             LMMKST+LQQ IL KLQ+QRP+YKGFPLELELLITLGAIHPWLIRTTACS QYF  EELE
Sbjct  991   LMMKSTSLQQGILDKLQNQRPVYKGFPLELELLITLGAIHPWLIRTTACSNQYFSAEELE  1050

Query  1013  alekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIE  834
              LE+ KFD+K GSKV+FVMSLIP+C+ R+EKVLIFCHNIAPINLFLE+F   + WRKG E
Sbjct  1051  DLERTKFDVKFGSKVRFVMSLIPKCVFRREKVLIFCHNIAPINLFLELFATIFHWRKGKE  1110

Query  833   VLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSK  654
             VLVLQGDIELFERGRVMDKFEE GGPSKVMLASIT CAEGISLTAASRVILLDSEWNPSK
Sbjct  1111  VLVLQGDIELFERGRVMDKFEEAGGPSKVMLASITACAEGISLTAASRVILLDSEWNPSK  1170

Query  653   SKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQA  474
             SKQAIARAFRPGQDKVVYVYQLLA GTLEEEKY RTTWKEWVSSMIFSE+LVEDPS WQA
Sbjct  1171  SKQAIARAFRPGQDKVVYVYQLLAAGTLEEEKYSRTTWKEWVSSMIFSEELVEDPSRWQA  1230

Query  473   PKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
              KIEDELL EIVEEDRATLFH IMK EKA ++ R
Sbjct  1231  QKIEDELLREIVEEDRATLFHRIMKIEKALSVIR  1264



>ref|XP_011093440.1| PREDICTED: LOW QUALITY PROTEIN: SNF2 domain-containing protein 
CLASSY 1-like [Sesamum indicum]
Length=1277

 Score =  1550 bits (4013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 837/1311 (64%), Positives = 997/1311 (76%), Gaps = 77/1311 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKRRS+HQ +HPFD +PFEAF  GSWQPVER++I NG     +++ G ++EE+I +S++R
Sbjct  1     MKRRSVHQIDHPFDPHPFEAFWGGSWQPVERLKIGNGAISTLIVENGVVVEEDIPMSHLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IRSR A S DC  FLRPG+D+ V +T   SE++ +      K    P WIDAK+RSIERK
Sbjct  61    IRSRKAMSFDCTSFLRPGVDVCVLTTSQNSENTHD------KRNAAPVWIDAKLRSIERK  114

Query  3848  PHGFGCVCQFHISVYVTQGPPPIV-KKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH   C C F++S Y+ QGP  I+  K LSKE  +++++QI +LQ++E KPC+ +YYRWS
Sbjct  115   PHDVACDCNFYVSFYLEQGPDLILANKKLSKETSMIKIDQIYVLQRLELKPCDSEYYRWS  174

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DCS++QKFKLFTGKFC+DL+W +V S  ++  FD++++ N IVYE+ +   D+   +
Sbjct  175   CSEDCSSVQKFKLFTGKFCADLTWFIVTSVLRKAAFDIRAMRNHIVYEVSEYNPDVAPAD  234

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
                H+Y V+FK+ENEVSTP I+QF PD  + GPEG   E G L  +D  ELRRSKRR VQ
Sbjct  235   PCNHTYTVNFKVENEVSTPFIVQFAPDALQEGPEG--REVGFLSSFDPMELRRSKRRNVQ  292

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYK----------SELEELPMALSIQADHAYQNGD  3168
             PERYLGCD+ L ++++E+TRL   K YK           E +E+P+ALS+QAD+ YQ   
Sbjct  293   PERYLGCDN-LPDYEIEVTRLGESKTYKLEYDEISSESDEYDEMPLALSVQADNQYQQYG  351

Query  3167  IDNKTLACYQQElrdnsllsrnrnssksDTNRKRV------SGDKA----HLAIVPLQLS  3018
                  +  Y++     +L S          +          + DK      LAIVP   S
Sbjct  352   GAEDWIRSYRKNNSRYNLESGVLKRKSHKKSSSSKPKKKSGAMDKGSQGNELAIVPANTS  411

Query  3017  AEN--NLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKS-SLNLMQ---GR  2856
              EN  + FD+K   ++  D  D S +I ++VSKY Y+N S +   KK+   + M+   G 
Sbjct  412   VENSSDFFDKKFRSVNIPD--DYSEDIGDMVSKYFYMNASPSSSKKKTFDFDFMEVESGS  469

Query  2855  RWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYREL  2676
             R  Q K ++ K+           SS   + KR C   R+SIYD+RSFRKGS+SA + REL
Sbjct  470   RQRQ-KGTRRKY--------HRTSSLSASLKRDCVYIRESIYDVRSFRKGSVSAQLCREL  520

Query  2675  IRRCMANIDETLNKE--QPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDMLWKE  2505
             IRRCM NID TL  E  QPP++DQWKEFQ+T S  +RE  EK + NNEEE+SE+D+LWKE
Sbjct  521   IRRCMNNIDATLKNEPIQPPVVDQWKEFQSTTSSNRREQDEKPTVNNEEEISEIDILWKE  580

Query  2504  MELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEI  2325
             MELALAS YL DD ED++ +   E+    +     C HDFRLNE++G VCRLCG V TEI
Sbjct  581   MELALASWYLFDDNEDSHAQPTVEVPKPREILENKCEHDFRLNEQVGTVCRLCGFVETEI  640

Query  2324  KDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWA  2145
             KD+ PPF  S  S   KEQR E+   E K+ +D +L                        
Sbjct  641   KDMLPPFTASAHSILNKEQRTEDEP-ELKKSEDGEL------------------------  675

Query  2144  LIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAF  1965
             +IPDL++KLR+HQ+RAFEFLW+NIAGS+IP++++ + K+RGGCVISHSPGAGKTLLIIAF
Sbjct  676   VIPDLKDKLRSHQKRAFEFLWRNIAGSLIPSRMEKKKKRRGGCVISHSPGAGKTLLIIAF  735

Query  1964  LVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCP  1785
             LVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWK+PIPVYQIHGGQTYKGEVL+Q+MKL P
Sbjct  736   LVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKVPIPVYQIHGGQTYKGEVLKQRMKLAP  795

Query  1784  GLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPG  1605
             GLPRNQDVMHVLDCLEKMQ+WL+HPS+LLMGYTSFLTLTREDS YAHRKYM Q+L+QCPG
Sbjct  796   GLPRNQDVMHVLDCLEKMQRWLSHPSILLMGYTSFLTLTREDSHYAHRKYMAQLLKQCPG  855

Query  1604  ILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVL  1425
             ILILDEGHNPRSTKSRLRKALMKVNT LR+LLSGTLFQNNFGEYFNTLCLARP FV+EVL
Sbjct  856   ILILDEGHNPRSTKSRLRKALMKVNTRLRVLLSGTLFQNNFGEYFNTLCLARPVFVNEVL  915

Query  1424  KELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFID  1245
             KELDPKY+KR K  +T+FSLENR RK+ IDKISKKIDS+K  ER + L  LKKLT+ FID
Sbjct  916   KELDPKYEKRNKERQTQFSLENRGRKLLIDKISKKIDSNKGEERAQALKTLKKLTSKFID  975

Query  1244  VYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWL  1065
             VYEGG+SD LPGLQCYTLMMKST+LQQEIL+KLQ+QRP+YKGFPLELELLITLGAIHPWL
Sbjct  976   VYEGGTSDKLPGLQCYTLMMKSTSLQQEILLKLQNQRPVYKGFPLELELLITLGAIHPWL  1035

Query  1064  IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPIN  885
             IRTTACS QYF  EELE LE+FKFD+K GSKV+FVM+LIPRCL+R EKVLIFCHNIAPIN
Sbjct  1036  IRTTACSSQYFTPEELEGLEQFKFDMKSGSKVRFVMNLIPRCLIRNEKVLIFCHNIAPIN  1095

Query  884   LFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISL  705
             LFL+IFERFYGWRKG EVLVLQGDIELFERGRVMDKFEE GGPSKVMLASIT CAEGISL
Sbjct  1096  LFLQIFERFYGWRKGREVLVLQGDIELFERGRVMDKFEEPGGPSKVMLASITACAEGISL  1155

Query  704   TAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVS  525
             TAASRVILLDSEWNPSKSKQAIARAFRPGQ+KVVYVYQLLATGTLEEEK+ RTTWKEWVS
Sbjct  1156  TAASRVILLDSEWNPSKSKQAIARAFRPGQNKVVYVYQLLATGTLEEEKHSRTTWKEWVS  1215

Query  524   SMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
              MIFS++ VEDPSHWQAPKIEDELL EIVEEDRA LFH IMKNEKASN+ R
Sbjct  1216  DMIFSDEHVEDPSHWQAPKIEDELLREIVEEDRAALFHRIMKNEKASNVIR  1266



>ref|XP_011093441.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093442.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093443.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Sesamum indicum]
Length=1276

 Score =  1540 bits (3987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 832/1311 (63%), Positives = 997/1311 (76%), Gaps = 78/1311 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKRRS+HQ  HPFD +PFEAF  GSWQPVER++I +G     +++ G + EE+I +S++R
Sbjct  1     MKRRSVHQINHPFDPHPFEAFWGGSWQPVERLKIGDGAISTLIVENGVVTEEDIPMSHLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IRSR A S DC  FLRPG+D+ V +T   SE++ +      +    P WIDAK+RSIERK
Sbjct  61    IRSRKAMSFDCTSFLRPGVDVCVLTTSQNSENTHD------ERNAAPVWIDAKLRSIERK  114

Query  3848  PHGFGCVCQFHISVYVTQGPPPIV-KKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH   C C F++S Y+ QGP  I+  K LSKE+ +++++QI++LQ++E KPC+ ++YRWS
Sbjct  115   PHDVACDCNFYVSFYLEQGPDLILANKKLSKEMSMIKIDQISVLQRLELKPCDSEHYRWS  174

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DCS++QKFKLFTGKFC+DL+W++V S  ++  FD++S+ N IVYE+ +    +   +
Sbjct  175   CSEDCSSVQKFKLFTGKFCADLTWLIVTSVLRKAAFDIRSIRNHIVYEVSEYNPHVAQAD  234

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
                H+Y V+FK+ENEVSTP I+QF  D  + GPEG   E G L  +D  ELRRSKRR VQ
Sbjct  235   PCNHTYTVNFKVENEVSTPFIVQFALDALQEGPEG--REVGFLSSFDPMELRRSKRRNVQ  292

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYKSELEE----------LPMALSIQADHAYQNGD  3168
             PERYLGCD+ L ++++E+TRL   K YK E +E          +P+ALS+QAD+ YQ   
Sbjct  293   PERYLGCDN-LPDYEIEVTRLGESKTYKLEYDEISSESDGYDEMPLALSVQADNQYQQYG  351

Query  3167  IDNKTLACYQQElrdnsllsrnrnssksDTNRKRV------SGDKA----HLAIVPLQLS  3018
                  +  Y++     +L S          +          + DK      LAIVP   S
Sbjct  352   GAEDWIRSYRKNNSGCNLESGVLKRKSHKKSSSSKHKKKSGAMDKGPQGNELAIVPANTS  411

Query  3017  AEN--NLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKS-SLNLMQ---GR  2856
             AEN  + FD+K   +   D  D S +I ++VSKY Y+N S +   KK+   + M+   G 
Sbjct  412   AENISDFFDKKFRNVKIPD--DYSEDIGDMVSKYFYMNASPSSSKKKTFDFDFMEVESGS  469

Query  2855  RWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYREL  2676
             R  Q K ++ K+           SS   + KR C   R+SIYD+RSFRKGS++A + REL
Sbjct  470   RRRQ-KGTRRKY--------HRTSSLSASLKRDCVYIRESIYDVRSFRKGSVTAQLCREL  520

Query  2675  IRRCMANIDETLNKE--QPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDMLWKE  2505
             IRRCM NID TL  E  QPP++DQWKEFQ+T S  +RE  EKS+ NNE+E+SE+DMLWKE
Sbjct  521   IRRCMNNIDATLKNEPIQPPVVDQWKEFQSTTSSNRREQDEKSTVNNEDEISEIDMLWKE  580

Query  2504  MELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEI  2325
             MELALAS YL DD ED++++   E+    +     C HDFRLNE++G +CRLCG V TEI
Sbjct  581   MELALASWYLFDDNEDSHVQPTAEVPKPREIVENKCEHDFRLNEQVGTICRLCGFVETEI  640

Query  2324  KDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWA  2145
             KD+ PPF  S  S   KEQR E+   E K+ +D +L+                       
Sbjct  641   KDMLPPFTASAHSIPNKEQRTEDEP-ELKKSEDGELE-----------------------  676

Query  2144  LIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAF  1965
               PDL++KLR+HQ+RAFEFLW+NIAGS+IP++++ + K+RGGCVISHSPGAGKTLLIIAF
Sbjct  677   --PDLKDKLRSHQKRAFEFLWRNIAGSLIPSRMEKKKKRRGGCVISHSPGAGKTLLIIAF  734

Query  1964  LVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCP  1785
             LVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWK+PIPVYQIHGGQTYKGEVL+Q+MKL P
Sbjct  735   LVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKVPIPVYQIHGGQTYKGEVLKQRMKLAP  794

Query  1784  GLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPG  1605
             GLPRNQDVMHVLDCLEKMQ+WL+HPS+LLMGYTSFLTLTREDS YAHRKYM Q+L+QCPG
Sbjct  795   GLPRNQDVMHVLDCLEKMQRWLSHPSILLMGYTSFLTLTREDSHYAHRKYMAQLLKQCPG  854

Query  1604  ILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVL  1425
             ILILDEGHNPRSTKSRLRKALMKVNT LR+LLSGTLFQNNFGEYFNTLCLARP FV+EVL
Sbjct  855   ILILDEGHNPRSTKSRLRKALMKVNTRLRVLLSGTLFQNNFGEYFNTLCLARPVFVNEVL  914

Query  1424  KELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFID  1245
             KELDPKY+KR K  +T+FSLENR RK+ IDKISKKIDS+K  ER + L  LKKLT+ FID
Sbjct  915   KELDPKYEKRNKERQTQFSLENRGRKLLIDKISKKIDSNKGEERAQALKTLKKLTSKFID  974

Query  1244  VYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWL  1065
             VYEGG+SD LPGLQCYTLMMKST+LQQEIL+KLQ+QRP+YKGFPLELELLITLGAIHPWL
Sbjct  975   VYEGGTSDKLPGLQCYTLMMKSTSLQQEILLKLQNQRPVYKGFPLELELLITLGAIHPWL  1034

Query  1064  IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPIN  885
             IRTTACS QYF  EELE LE+FKFD+K GSKV+FVM+LIPRCL+R EKVLIFCHNIAPIN
Sbjct  1035  IRTTACSSQYFTPEELEDLEQFKFDMKSGSKVRFVMNLIPRCLIRNEKVLIFCHNIAPIN  1094

Query  884   LFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISL  705
             LFL+IFERFYGWRKG EVLVLQGDIELFERGRVMDKFEE GGPSKVMLASIT CAEGISL
Sbjct  1095  LFLQIFERFYGWRKGREVLVLQGDIELFERGRVMDKFEEPGGPSKVMLASITACAEGISL  1154

Query  704   TAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVS  525
             TAASRVILLDSEWNPSKSKQAIARAFRPGQ+KVVYVYQLLATGTLEEEK+ RTTWKEWVS
Sbjct  1155  TAASRVILLDSEWNPSKSKQAIARAFRPGQNKVVYVYQLLATGTLEEEKHSRTTWKEWVS  1214

Query  524   SMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
              MIFS++ VEDPSHWQAPKIEDELL EIVEEDRA LFH IMKNEKASN+ R
Sbjct  1215  DMIFSDEHVEDPSHWQAPKIEDELLREIVEEDRAALFHRIMKNEKASNVIR  1265



>ref|XP_011093444.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Sesamum indicum]
Length=1130

 Score =  1387 bits (3591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 754/1159 (65%), Positives = 894/1159 (77%), Gaps = 71/1159 (6%)
 Frame = -3

Query  3755  IKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHK  3576
             + +++++QI++LQ++E KPC+ ++YRWS S+DCS++QKFKLFTGKFC+DL+W++V S  +
Sbjct  1     MSMIKIDQISVLQRLELKPCDSEHYRWSCSEDCSSVQKFKLFTGKFCADLTWLIVTSVLR  60

Query  3575  QVGFDVKSVHNRIVYEILKDENDIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPDIPERG  3396
             +  FD++S+ N IVYE+ +    +   +   H+Y V+FK+ENEVSTP I+QF  D  + G
Sbjct  61    KAAFDIRSIRNHIVYEVSEYNPHVAQADPCNHTYTVNFKVENEVSTPFIVQFALDALQEG  120

Query  3395  PEGDVYEAGPLVVYD--ELRRSKRRFVQPERYLGCDDYLTEFDVEMTRLVGGKMYKSELE  3222
             PEG   E G L  +D  ELRRSKRR VQPERYLGCD+ L ++++E+TRL   K YK E +
Sbjct  121   PEG--REVGFLSSFDPMELRRSKRRNVQPERYLGCDN-LPDYEIEVTRLGESKTYKLEYD  177

Query  3221  E----------LPMALSIQADHAYQNGDIDNKTLACYQQElrdnsllsrnrnssksDTNR  3072
             E          +P+ALS+QAD+ YQ        +  Y++     +L S          + 
Sbjct  178   EISSESDGYDEMPLALSVQADNQYQQYGGAEDWIRSYRKNNSGCNLESGVLKRKSHKKSS  237

Query  3071  KRV------SGDKA----HLAIVPLQLSAEN--NLFDQKENPLSFEDNEDLSAEIREIVS  2928
                      + DK      LAIVP   SAEN  + FD+K   +   D  D S +I ++VS
Sbjct  238   SSKHKKKSGAMDKGPQGNELAIVPANTSAENISDFFDKKFRNVKIPD--DYSEDIGDMVS  295

Query  2927  KYIYVNGSSAVEMKKS-SLNLMQ---GRRWGQVKVSKLKFMGLDVkgggigsskkkakKR  2760
             KY Y+N S +   KK+   + M+   G R  Q K ++ K+           SS   + KR
Sbjct  296   KYFYMNASPSSSKKKTFDFDFMEVESGSRRRQ-KGTRRKY--------HRTSSLSASLKR  346

Query  2759  TCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKE--QPPIIDQWKEFQNTK  2586
              C   R+SIYD+RSFRKGS++A + RELIRRCM NID TL  E  QPP++DQWKEFQ+T 
Sbjct  347   DCVYIRESIYDVRSFRKGSVTAQLCRELIRRCMNNIDATLKNEPIQPPVVDQWKEFQSTT  406

Query  2585  SC-QREPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKG  2409
             S  +RE  EKS+ NNE+E+SE+DMLWKEMELALAS YL DD ED++++   E+    +  
Sbjct  407   SSNRREQDEKSTVNNEDEISEIDMLWKEMELALASWYLFDDNEDSHVQPTAEVPKPREIV  466

Query  2408  TRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGD  2229
                C HDFRLNE++G +CRLCG V TEIKD+ PPF  S  S   KEQR E+   E K+ +
Sbjct  467   ENKCEHDFRLNEQVGTICRLCGFVETEIKDMLPPFTASAHSIPNKEQRTEDEP-ELKKSE  525

Query  2228  DADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ  2049
             D +L+                         PDL++KLR+HQ+RAFEFLW+NIAGS+IP++
Sbjct  526   DGELE-------------------------PDLKDKLRSHQKRAFEFLWRNIAGSLIPSR  560

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
             ++ + K+RGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW
Sbjct  561   MEKKKKRRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  620

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGY  1689
             K+PIPVYQIHGGQTYKGEVL+Q+MKL PGLPRNQDVMHVLDCLEKMQ+WL+HPS+LLMGY
Sbjct  621   KVPIPVYQIHGGQTYKGEVLKQRMKLAPGLPRNQDVMHVLDCLEKMQRWLSHPSILLMGY  680

Query  1688  TSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILL  1509
             TSFLTLTREDS YAHRKYM Q+L+QCPGILILDEGHNPRSTKSRLRKALMKVNT LR+LL
Sbjct  681   TSFLTLTREDSHYAHRKYMAQLLKQCPGILILDEGHNPRSTKSRLRKALMKVNTRLRVLL  740

Query  1508  SGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidki  1329
             SGTLFQNNFGEYFNTLCLARP FV+EVLKELDPKY+KR K  +T+FSLENR RK+ IDKI
Sbjct  741   SGTLFQNNFGEYFNTLCLARPVFVNEVLKELDPKYEKRNKERQTQFSLENRGRKLLIDKI  800

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVK  1149
             SKKIDS+K  ER + L  LKKLT+ FIDVYEGG+SD LPGLQCYTLMMKST+LQQEIL+K
Sbjct  801   SKKIDSNKGEERAQALKTLKKLTSKFIDVYEGGTSDKLPGLQCYTLMMKSTSLQQEILLK  860

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             LQ+QRP+YKGFPLELELLITLGAIHPWLIRTTACS QYF  EELE LE+FKFD+K GSKV
Sbjct  861   LQNQRPVYKGFPLELELLITLGAIHPWLIRTTACSSQYFTPEELEDLEQFKFDMKSGSKV  920

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             +FVM+LIPRCL+R EKVLIFCHNIAPINLFL+IFERFYGWRKG EVLVLQGDIELFERGR
Sbjct  921   RFVMNLIPRCLIRNEKVLIFCHNIAPINLFLQIFERFYGWRKGREVLVLQGDIELFERGR  980

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
             VMDKFEE GGPSKVMLASIT CAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ+K
Sbjct  981   VMDKFEEPGGPSKVMLASITACAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQNK  1040

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             VVYVYQLLATGTLEEEK+ RTTWKEWVS MIFS++ VEDPSHWQAPKIEDELL EIVEED
Sbjct  1041  VVYVYQLLATGTLEEEKHSRTTWKEWVSDMIFSDEHVEDPSHWQAPKIEDELLREIVEED  1100

Query  428   RATLFHMIMKNEKASNMGR  372
             RA LFH IMKNEKASN+ R
Sbjct  1101  RAALFHRIMKNEKASNVIR  1119



>gb|EYU20066.1| hypothetical protein MIMGU_mgv1a000446mg [Erythranthe guttata]
Length=1148

 Score =  1320 bits (3415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 717/1158 (62%), Positives = 861/1158 (74%), Gaps = 57/1158 (5%)
 Frame = -3

Query  3749  VVQLNQIAILQKIEQKPCEDK--YYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHK  3576
             +V++++I+ILQK+E KPCE+   YYRWS ++DCSTLQKFKLF G+FC+DLSW+ V+S  K
Sbjct  1     MVKIDRISILQKLEMKPCEEGQYYYRWSFTEDCSTLQKFKLFCGRFCNDLSWLAVSSILK  60

Query  3575  QVGFDVKSVHNRIVYEILK----DENDIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPDI  3408
             +  FD++++++ + YE+ +    +E     P S+Y ++ V+FK+EN+V TP+I++   + 
Sbjct  61    KTAFDIRTINSHLCYEVSEYNPTEEGQTADPPSDY-THTVNFKMENDVFTPVIVKLALNT  119

Query  3407  PERGPEGDVYEAGPLVVYD--ELRRSKRRFVQPERYLGCDDYLTEFDVEMTRLVGGKMYK  3234
                G      E G L   D  ELRRSKRR +QPERYL CD+ L ++++E+TRL   K YK
Sbjct  120   LPEGSSSAGLELGFLNSDDFMELRRSKRRNIQPERYLACDN-LPDYEIEVTRLGENKTYK  178

Query  3233  SEL-----------EELPMALSIQADHAYQNGDIDNKTLACYQQElrdnsllsrnrnssk  3087
             SE            EE  M+LS+QAD+ Y      ++T        +         +   
Sbjct  179   SEFDEVLSDSDASEEETHMSLSVQADNDYMQ--FGSRTSGSNSSNKKMKKSKKSGISGKG  236

Query  3086  sDTNRKRVSGDKAHLAIVPLQLSAE-NNLFDQKE--NPLSFEDNEDLSAEIREIVSKYIY  2916
             S  N          LA+V    S+E  ++F  K   N    E+++  S +I ++VSKY Y
Sbjct  237   SKEN---------GLAVVSKHTSSEKGSVFIDKSILNYKVVENDDQESGDIEQMVSKYFY  287

Query  2915  VNGSSAVEMKKSS-LNLMQGRRWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRD  2739
             +N   +   KK+S L+ M   R    + S+  +            S   + KR C   RD
Sbjct  288   MNNPPSSSKKKTSDLDFMDNGRKDDPRGSRRNY--------NRTGSHSGSSKRDCFYVRD  339

Query  2738  SIYDIRSFRKGSISANVYRELIRRCMANIDETLNKE--QPPIIDQWKEFQNTKSCQR---  2574
             S YD+RSFRKGS++A + RELIRRCM NI+ TL+ E  QPP++D WKE Q  K   R   
Sbjct  340   STYDVRSFRKGSVTAQLCRELIRRCMNNIEATLDNEPVQPPVVDHWKELQAKKDASRNES  399

Query  2573  ---EPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNL--KSATELHMATKKG  2409
                E     +   EEE+SE+DMLWKEMELAL S YL DD ED+    +   E   + K  
Sbjct  400   AAEEKPTTVNGGEEEEVSEIDMLWKEMELALVSLYLQDDNEDSARVQQPNVEAEKSNKNE  459

Query  2408  TRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGD  2229
                C HDF LNE++G VCRLCG V TEIKD+ PPF+ +T S+  K+QR EE   E+   +
Sbjct  460   ENKCAHDFILNEQVGTVCRLCGFVETEIKDILPPFVATTHSTGNKDQRTEEDS-EQNNAE  518

Query  2228  DADLDHFAIPVS-SNKPSSE-VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIP  2055
             D +   F I  + +  PS+   + E+N WALIP+L++KL  HQ++AFEFLW+NIAGS+ P
Sbjct  519   DQEFGRFHITSTPAPAPSTAFTQGENNVWALIPELKDKLLVHQKKAFEFLWRNIAGSLTP  578

Query  2054  TQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEII  1875
             ++++ + KKRGGCVISHSPGAGKTLLIIAFLVSYLKLFP SRPLVLAPKTTLYTWYKEII
Sbjct  579   SRMEDKKKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPNSRPLVLAPKTTLYTWYKEII  638

Query  1874  KWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLM  1695
             KWK+PIPVYQIHGGQTYKGEVL+Q+MKL PGLPRNQDVMHVLDCLEKMQ+WL+HPS+LLM
Sbjct  639   KWKVPIPVYQIHGGQTYKGEVLKQRMKLSPGLPRNQDVMHVLDCLEKMQRWLSHPSILLM  698

Query  1694  GYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRI  1515
             GYTSFLTLTREDS YAHRKYM ++L+ CPGILILDEGHNPRSTKSRLRK LMKVNT LR+
Sbjct  699   GYTSFLTLTREDSPYAHRKYMAKLLKNCPGILILDEGHNPRSTKSRLRKGLMKVNTRLRV  758

Query  1514  LLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFid  1335
             LLSGTLFQNNFGEYFNTLCLARP FV+EVLK+LDPKY+KR K  +T+FSLENR RK+ ID
Sbjct  759   LLSGTLFQNNFGEYFNTLCLARPVFVNEVLKKLDPKYEKRNKQRQTQFSLENRGRKLLID  818

Query  1334  kiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEIL  1155
             KISKKIDS+  +ER E L  L+KLT+ FIDVYEGG+SD LPGLQCYTLMMKST LQQ+IL
Sbjct  819   KISKKIDSNIGQERSEALKTLRKLTSKFIDVYEGGASDGLPGLQCYTLMMKSTNLQQDIL  878

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGS  975
              K+Q++R +YKGFPLELELLITLGAIHPWLI TT CSGQY   EEL  LE FKFDLK GS
Sbjct  879   SKMQNRRLVYKGFPLELELLITLGAIHPWLITTTLCSGQYLTPEELTDLENFKFDLKCGS  938

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             KV+FVM+LIPRCLLR EKVLIFCHNIAPINLF++IFERFYGW+KG EVLVLQGDIELFER
Sbjct  939   KVRFVMNLIPRCLLRNEKVLIFCHNIAPINLFIQIFERFYGWKKGREVLVLQGDIELFER  998

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
             GRVMD FEE GGPSKVMLASIT CAEGISLTAASRVILLDSEWNPSKSKQA+ARAFRPGQ
Sbjct  999   GRVMDMFEEPGGPSKVMLASITACAEGISLTAASRVILLDSEWNPSKSKQAVARAFRPGQ  1058

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVE  435
             +KVVYVYQLLA GTLEEEK+ RTTWKEWVS MIFS++ VEDPSHWQAPKIEDELL EIVE
Sbjct  1059  NKVVYVYQLLANGTLEEEKHSRTTWKEWVSDMIFSDEHVEDPSHWQAPKIEDELLREIVE  1118

Query  434   EDRATLFHMIMKNEKASN  381
             EDRA LFH IMKNEKASN
Sbjct  1119  EDRAALFHRIMKNEKASN  1136



>ref|XP_010658218.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Vitis vinifera]
 ref|XP_010658219.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Vitis vinifera]
Length=1263

 Score =  1311 bits (3392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 729/1295 (56%), Positives = 921/1295 (71%), Gaps = 58/1295 (4%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M++R++ QN+HPF  Y FEAF  GSWQ +E +RI++GT  +H+ +   +IEE+  I N+R
Sbjct  1     MRKRNLCQNQHPFHAYSFEAFYFGSWQAIELMRIEDGTVALHLAESEYVIEEKSPIPNLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IR R AT SDC CFLRPG +I+V  T  QSE SDEEN        EP WIDAKI SIER+
Sbjct  61    IRPRKATLSDCTCFLRPGTEITVLWTLQQSESSDEENR-------EPVWIDAKISSIERR  113

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF ++ Y+TQ P    K TLSK+I VV+L+QI+ILQK+ + PCED++YRW  
Sbjct  114   PHEPECSCQFFVNFYITQDPLGTEKGTLSKDISVVELDQISILQKLGKYPCEDEHYRWKF  173

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS LQ+ KLF GKF SDLSW++V S  KQ  FDV+SV NRIVY+I+  ++D  + N 
Sbjct  174   SEDCSLLQRTKLFLGKFSSDLSWLVVTSVLKQAVFDVRSVQNRIVYQIVGGDHDKVSLN-  232

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
                  AV+F+++N +STP+I  F P D  E  P     EAGPL   D  +LRRSKRR VQ
Sbjct  233   -----AVNFRVDNGISTPVIFPFVPADTIEADPLNGTNEAGPLPFCDIVDLRRSKRRNVQ  287

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQAD-HAYQNGDIDNKTLACY  3141
             P+R+     + +E D+   R    K+     EE+P+AL  + D H+        K +  Y
Sbjct  288   PDRFFSLGGF-SESDIGSVRAGIHKVDYWRKEEMPLALPDEGDVHSI----FSEKHIIDY  342

Query  3140  QQElrdnsllsrnrnssksDTNRKR--------VSGDKAHLAIVPLQLSAENNLFDQKEN  2985
             ++      + S          +R R         + D+   AIVP+ L  E       E+
Sbjct  343   EKGAHSLQIDSYEDFLVCKSKDRSREVKPILAAQNEDQHQFAIVPVPLIIEP--IAHGED  400

Query  2984  PLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKK-SSLNLMQGRRW-GQVKVSKLKFMGL  2811
              L  E   + S EI EI  KY   NG   ++ K  S L +    RW G+  + KL+    
Sbjct  401   HLHDETPWNESGEIGEISPKYYCTNGVPKLQRKNMSDLYMEVESRWEGKGPIRKLR----  456

Query  2810  DVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKE  2631
                         + +  T  ++ +S  ++R  +K   S   Y+E+I   M NI+ T+NKE
Sbjct  457   ------------RKRGFTIRTKTESYGEVRPHKKRPFSEPGYKEVIEAYMKNIESTINKE  504

Query  2630  QPPIIDQWKEFQ--NTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDTED  2457
             QP +IDQWKE Q  N  + +R+    SS  ++EE SE +MLW+EME ++AS YLL++ E 
Sbjct  505   QPLVIDQWKELQVRNDLNQRRDCNSPSSVGDQEESSETEMLWREMEFSIASSYLLEENEG  564

Query  2456  TNLKSATEL-HMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSS  2280
             +N++   E+   ++    +VC H++ L+EEIG++C+LCG VSTEIKDV PPF   T   +
Sbjct  565   SNVEVLKEVVQESSNISEQVCQHEYILDEEIGVLCQLCGFVSTEIKDVSPPFFQPTGWIT  624

Query  2279  GKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRR  2100
              +E R EE   + KQ ++   + F+IP SS+ P SE    DN WAL+PDLR KLR HQ++
Sbjct  625   NREWRDEEN-SKRKQAENDGFNLFSIPASSDTPLSEGN--DNVWALVPDLRKKLRLHQKK  681

Query  2099  AFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLV  1920
             AFEFLWKNIAGS++P  ++ E K+RGGCVISHSPGAGKT L+I+FLVSYLKLFPG RPLV
Sbjct  682   AFEFLWKNIAGSMVPALMEQEVKRRGGCVISHSPGAGKTFLVISFLVSYLKLFPGKRPLV  741

Query  1919  LAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDC  1743
             LAPKTTLYTWYKEIIKWK+P+PVYQIHG +TY+ E+ + K++  PG+PR NQDVMHVLDC
Sbjct  742   LAPKTTLYTWYKEIIKWKVPVPVYQIHGCRTYRYEIYKHKVETSPGIPRPNQDVMHVLDC  801

Query  1742  LEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTK  1563
             LEK+QKW AHPS+LLMGYTSFL+L REDS + HR+YM +VLRQ PGIL+LDEGHNPRST 
Sbjct  802   LEKIQKWHAHPSILLMGYTSFLSLMREDSKFIHRRYMGEVLRQSPGILVLDEGHNPRSTG  861

Query  1562  SRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA  1383
             SRLRKALMKV T+LRILLSGTLFQNNF EYFNTLCLARP+FV+EVL+ELDPK+K+     
Sbjct  862   SRLRKALMKVKTNLRILLSGTLFQNNFSEYFNTLCLARPKFVNEVLRELDPKFKRNKNRR  921

Query  1382  KTRFS-LENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGL  1206
             K R+S  E+RARK F D+I+K+I+S+   E+ EGLN+L+ LT+ FIDVYEGGSSDNLPGL
Sbjct  922   KRRYSSTESRARKFFTDEIAKRINSNVPEEQIEGLNMLRNLTSKFIDVYEGGSSDNLPGL  981

Query  1205  QCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfke  1026
             Q YTL+MKSTT+QQ+ L KLQ ++  YKG+PLELELL+TLG+IHPWLI T AC+ +YF  
Sbjct  982   QVYTLLMKSTTIQQQFLSKLQKKKDEYKGYPLELELLVTLGSIHPWLITTAACADKYFSR  1041

Query  1025  eelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWR  846
             EEL  L+K K D+K GSKVKFV+SL+ RC++RKEK+LIFCHNI+PINLF++IF++ Y W+
Sbjct  1042  EELLELKKHKDDVKKGSKVKFVLSLVNRCIIRKEKILIFCHNISPINLFVDIFDKLYKWK  1101

Query  845   KGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEW  666
             KG +VLVLQGD+ELFERGRVMD+FEE GG SKV+LASIT CAEGISLTAASRVILLD+EW
Sbjct  1102  KGEDVLVLQGDLELFERGRVMDQFEEPGGASKVLLASITACAEGISLTAASRVILLDTEW  1161

Query  665   NPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPS  486
             NPSK KQA+ARAFRPGQ++VVYVYQLL T TLEEEK  RT WKEWVSSMIFSE  VEDPS
Sbjct  1162  NPSKQKQAVARAFRPGQERVVYVYQLLETDTLEEEKNSRTNWKEWVSSMIFSEAFVEDPS  1221

Query  485   HWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASN  381
              WQA KIED+LL EIVEED A   HMIMKNEKASN
Sbjct  1222  CWQAEKIEDDLLREIVEEDWAKSIHMIMKNEKASN  1256



>ref|XP_010658217.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Vitis vinifera]
Length=1263

 Score =  1310 bits (3390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 728/1295 (56%), Positives = 922/1295 (71%), Gaps = 58/1295 (4%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M++R++ +N+HPF  +PFEAF  GSWQ +E +RI++GT  +H+ +   +IEE+  I N+R
Sbjct  1     MRKRNLCRNQHPFHAHPFEAFYFGSWQAIELMRIEDGTVALHLAESEYVIEEKSPIPNLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IR R AT SDC CFLRPG +I+V  T  QSE SDEEN        EP WIDAKI SIER+
Sbjct  61    IRPRKATLSDCTCFLRPGTEITVLWTLQQSESSDEENR-------EPVWIDAKISSIERR  113

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF ++ Y+TQ P    K TLSK+I VV+L+QI+ILQK+ + PCED++YRW  
Sbjct  114   PHEPECSCQFFVNFYITQDPLGTEKGTLSKDISVVELDQISILQKLGKYPCEDEHYRWKF  173

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS LQ+ KLF GKF SDLSW++V S  KQ  FDV+SV NRIVY+I+  ++D  + N 
Sbjct  174   SEDCSLLQRTKLFLGKFSSDLSWLVVTSVLKQAVFDVRSVQNRIVYQIVGGDHDKVSLN-  232

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
                  AV+F+++N +STP+I  F P D  E  P     EAGPL   D  +LRRSKRR VQ
Sbjct  233   -----AVNFRVDNGISTPVIFPFVPADTIEADPLNGTNEAGPLPFCDIVDLRRSKRRNVQ  287

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQAD-HAYQNGDIDNKTLACY  3141
             P+R+     + +E D+   R    K+     EE+P+AL  + D H+        K +  Y
Sbjct  288   PDRFFSLGGF-SESDIGSVRAGIHKVDYWRKEEMPLALPDEGDVHSI----FSEKHIIDY  342

Query  3140  QQElrdnsllsrnrnssksDTNRKR--------VSGDKAHLAIVPLQLSAENNLFDQKEN  2985
             ++      + S          +R R         + D+   AIVP+ L  E       E+
Sbjct  343   EKGAHSLQIDSYEDFLVCKSKDRSREVKPILAAQNEDQHQFAIVPVPLIIEP--IAHGED  400

Query  2984  PLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKK-SSLNLMQGRRW-GQVKVSKLKFMGL  2811
              L  E   + S EI EI  KY   NG   ++ K  S L +    RW G+  + KL+    
Sbjct  401   HLHDETPWNESGEIGEISPKYYCTNGVPKLQRKNMSDLYMEVESRWEGKGPIRKLR----  456

Query  2810  DVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKE  2631
                         + +  T  ++ +S  ++R  +K   S   Y+E+I   M NI+ T+NKE
Sbjct  457   ------------RKRGFTIRTKTESYGEVRPHKKRPFSEPGYKEVIEAYMKNIESTINKE  504

Query  2630  QPPIIDQWKEFQ--NTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDTED  2457
             QP +IDQWKE Q  N  + +R+    SS  ++EE SE +MLW+EME ++AS YLL++ E 
Sbjct  505   QPLVIDQWKELQVRNDLNQRRDCNSPSSVGDQEESSETEMLWREMEFSIASSYLLEENEG  564

Query  2456  TNLKSATEL-HMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSS  2280
             +N++   E+   ++    +VC H++ L+EEIG++C+LCG VSTEIKDV PPF   T   +
Sbjct  565   SNVEVLKEVVQESSNISEQVCQHEYILDEEIGVLCQLCGFVSTEIKDVSPPFFQPTGWIT  624

Query  2279  GKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRR  2100
              +E R EE   + KQ ++   + F+IP SS+ P SE    DN WAL+PDLR KLR HQ++
Sbjct  625   NREWRDEEN-SKRKQAENDGFNLFSIPASSDTPLSEGN--DNVWALVPDLRKKLRLHQKK  681

Query  2099  AFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLV  1920
             AFEFLWKNIAGS++P  ++ E K+RGGCVISHSPGAGKT L+I+FLVSYLKLFPG RPLV
Sbjct  682   AFEFLWKNIAGSMVPALMEQEVKRRGGCVISHSPGAGKTFLVISFLVSYLKLFPGKRPLV  741

Query  1919  LAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDC  1743
             LAPKTTLYTWYKEIIKWK+P+PVYQIHG +TY+ E+ + K++  PG+PR NQDVMHVLDC
Sbjct  742   LAPKTTLYTWYKEIIKWKVPVPVYQIHGCRTYRYEIYKHKVETSPGIPRPNQDVMHVLDC  801

Query  1742  LEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTK  1563
             LEK+QKW AHPS+LLMGYTSFL+L REDS + HR+YM +VLRQ PGIL+LDEGHNPRST 
Sbjct  802   LEKIQKWHAHPSILLMGYTSFLSLMREDSKFIHRRYMGEVLRQSPGILVLDEGHNPRSTG  861

Query  1562  SRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA  1383
             SRLRKALMKV T+LRILLSGTLFQNNF EYFNTLCLARP+FV+EVL+ELDPK+K+     
Sbjct  862   SRLRKALMKVKTNLRILLSGTLFQNNFSEYFNTLCLARPKFVNEVLRELDPKFKRNKNRR  921

Query  1382  KTRFS-LENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGL  1206
             K R+S  E+RARK F D+I+K+I+S+   E+ EGLN+L+ LT+ FIDVYEGGSSDNLPGL
Sbjct  922   KRRYSSTESRARKFFTDEIAKRINSNVPEEQIEGLNMLRNLTSKFIDVYEGGSSDNLPGL  981

Query  1205  QCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfke  1026
             Q YTL+MKSTT+QQ+ L KLQ ++  YKG+PLELELL+TLG+IHPWLI T AC+ +YF  
Sbjct  982   QVYTLLMKSTTIQQQFLSKLQKKKDEYKGYPLELELLVTLGSIHPWLITTAACADKYFSR  1041

Query  1025  eelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWR  846
             EEL  L+K K D+K GSKVKFV+SL+ RC++RKEK+LIFCHNI+PINLF++IF++ Y W+
Sbjct  1042  EELLELKKHKDDVKKGSKVKFVLSLVNRCIIRKEKILIFCHNISPINLFVDIFDKLYKWK  1101

Query  845   KGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEW  666
             KG +VLVLQGD+ELFERGRVMD+FEE GG SKV+LASIT CAEGISLTAASRVILLD+EW
Sbjct  1102  KGEDVLVLQGDLELFERGRVMDQFEEPGGASKVLLASITACAEGISLTAASRVILLDTEW  1161

Query  665   NPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPS  486
             NPSK KQA+ARAFRPGQ++VVYVYQLL T TLEEEK  RT WKEWVSSMIFSE  VEDPS
Sbjct  1162  NPSKQKQAVARAFRPGQERVVYVYQLLETDTLEEEKNSRTNWKEWVSSMIFSEAFVEDPS  1221

Query  485   HWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASN  381
              WQA KIED+LL EIVEED A   HMIMKNEKASN
Sbjct  1222  CWQAEKIEDDLLREIVEEDWAKSIHMIMKNEKASN  1256



>emb|CBI25419.3| unnamed protein product [Vitis vinifera]
Length=1635

 Score =  1308 bits (3385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 727/1294 (56%), Positives = 919/1294 (71%), Gaps = 56/1294 (4%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M  R++ +N+HPF  +PFEAF  GSWQ +E +RI++GT  +H+ +   +IEE+  I N+R
Sbjct  336   MHTRNLCRNQHPFHAHPFEAFYFGSWQAIELMRIEDGTVALHLAESEYVIEEKSPIPNLR  395

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IR R AT SDC CFLRPG +I+V  T  QSE SDEEN        EP WIDAKI SIER+
Sbjct  396   IRPRKATLSDCTCFLRPGTEITVLWTLQQSESSDEENR-------EPVWIDAKISSIERR  448

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF ++ Y+TQ P    K TLSK+I VV+L+QI+ILQK+ + PCED++YRW  
Sbjct  449   PHEPECSCQFFVNFYITQDPLGTEKGTLSKDISVVELDQISILQKLGKYPCEDEHYRWKF  508

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS LQ+ KLF GKF SDLSW++V S  KQ  FDV+SV NRIVY+I+  ++D  + N 
Sbjct  509   SEDCSLLQRTKLFLGKFSSDLSWLVVTSVLKQAVFDVRSVQNRIVYQIVGGDHDKVSLN-  567

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
                  AV+F+++N +STP+I  F P D  E  P     EAGPL   D  +LRRSKRR VQ
Sbjct  568   -----AVNFRVDNGISTPVIFPFVPADTIEADPLNGTNEAGPLPFCDIVDLRRSKRRNVQ  622

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTLACYQ  3138
             P+R+     + +E D+   R    K+     EE+P+AL  + D    +     K +  Y+
Sbjct  623   PDRFFSLGGF-SESDIGSVRAGIHKVDYWRKEEMPLALPDEGD---VHSIFSEKHIIDYE  678

Query  3137  QElrdnsllsrnrnssksDTNRKR--------VSGDKAHLAIVPLQLSAENNLFDQKENP  2982
             +      + S          +R R         + D+   AIVP+ L  E       E+ 
Sbjct  679   KGAHSLQIDSYEDFLVCKSKDRSREVKPILAAQNEDQHQFAIVPVPLIIEP--IAHGEDH  736

Query  2981  LSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKK-SSLNLMQGRRW-GQVKVSKLKFMGLD  2808
             L  E   + S EI EI  KY   NG   ++ K  S L +    RW G+  + KL+     
Sbjct  737   LHDETPWNESGEIGEISPKYYCTNGVPKLQRKNMSDLYMEVESRWEGKGPIRKLR-----  791

Query  2807  VkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQ  2628
                        + +  T  ++ +S  ++R  +K   S   Y+E+I   M NI+ T+NKEQ
Sbjct  792   -----------RKRGFTIRTKTESYGEVRPHKKRPFSEPGYKEVIEAYMKNIESTINKEQ  840

Query  2627  PPIIDQWKEFQ--NTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDT  2454
             P +IDQWKE Q  N  + +R+    SS  ++EE SE +MLW+EME ++AS YLL++ E +
Sbjct  841   PLVIDQWKELQVRNDLNQRRDCNSPSSVGDQEESSETEMLWREMEFSIASSYLLEENEGS  900

Query  2453  NLKSATEL-HMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSG  2277
             N++   E+   ++    +VC H++ L+EEIG++C+LCG VSTEIKDV PPF   T   + 
Sbjct  901   NVEVLKEVVQESSNISEQVCQHEYILDEEIGVLCQLCGFVSTEIKDVSPPFFQPTGWITN  960

Query  2276  KEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRA  2097
             +E R EE   + KQ ++   + F+IP SS+ P SE    DN WAL+PDLR KLR HQ++A
Sbjct  961   REWRDEEN-SKRKQAENDGFNLFSIPASSDTPLSEGN--DNVWALVPDLRKKLRLHQKKA  1017

Query  2096  FEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVL  1917
             FEFLWKNIAGS++P  ++ E K+RGGCVISHSPGAGKT L+I+FLVSYLKLFPG RPLVL
Sbjct  1018  FEFLWKNIAGSMVPALMEQEVKRRGGCVISHSPGAGKTFLVISFLVSYLKLFPGKRPLVL  1077

Query  1916  APKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCL  1740
             APKTTLYTWYKEIIKWK+P+PVYQIHG +TY+ E+ + K++  PG+PR NQDVMHVLDCL
Sbjct  1078  APKTTLYTWYKEIIKWKVPVPVYQIHGCRTYRYEIYKHKVETSPGIPRPNQDVMHVLDCL  1137

Query  1739  EKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKS  1560
             EK+QKW AHPS+LLMGYTSFL+L REDS + HR+YM +VLRQ PGIL+LDEGHNPRST S
Sbjct  1138  EKIQKWHAHPSILLMGYTSFLSLMREDSKFIHRRYMGEVLRQSPGILVLDEGHNPRSTGS  1197

Query  1559  RLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAK  1380
             RLRKALMKV T+LRILLSGTLFQNNF EYFNTLCLARP+FV+EVL+ELDPK+K+     K
Sbjct  1198  RLRKALMKVKTNLRILLSGTLFQNNFSEYFNTLCLARPKFVNEVLRELDPKFKRNKNRRK  1257

Query  1379  TRFS-LENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQ  1203
              R+S  E+RARK F D+I+K+I+S+   E+ EGLN+L+ LT+ FIDVYEGGSSDNLPGLQ
Sbjct  1258  RRYSSTESRARKFFTDEIAKRINSNVPEEQIEGLNMLRNLTSKFIDVYEGGSSDNLPGLQ  1317

Query  1202  CYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkee  1023
              YTL+MKSTT+QQ+ L KLQ ++  YKG+PLELELL+TLG+IHPWLI T AC+ +YF  E
Sbjct  1318  VYTLLMKSTTIQQQFLSKLQKKKDEYKGYPLELELLVTLGSIHPWLITTAACADKYFSRE  1377

Query  1022  elealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  843
             EL  L+K K D+K GSKVKFV+SL+ RC++RKEK+LIFCHNI+PINLF++IF++ Y W+K
Sbjct  1378  ELLELKKHKDDVKKGSKVKFVLSLVNRCIIRKEKILIFCHNISPINLFVDIFDKLYKWKK  1437

Query  842   GIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  663
             G +VLVLQGD+ELFERGRVMD+FEE GG SKV+LASIT CAEGISLTAASRVILLD+EWN
Sbjct  1438  GEDVLVLQGDLELFERGRVMDQFEEPGGASKVLLASITACAEGISLTAASRVILLDTEWN  1497

Query  662   PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  483
             PSK KQA+ARAFRPGQ++VVYVYQLL T TLEEEK  RT WKEWVSSMIFSE  VEDPS 
Sbjct  1498  PSKQKQAVARAFRPGQERVVYVYQLLETDTLEEEKNSRTNWKEWVSSMIFSEAFVEDPSC  1557

Query  482   WQAPKIEDELLGEIVEEDRATLFHMIMKNEKASN  381
             WQA KIED+LL EIVEED A   HMIMKNEKASN
Sbjct  1558  WQAEKIEDDLLREIVEEDWAKSIHMIMKNEKASN  1591



>emb|CAN75315.1| hypothetical protein VITISV_024158 [Vitis vinifera]
Length=1904

 Score =  1256 bits (3249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 720/1336 (54%), Positives = 906/1336 (68%), Gaps = 118/1336 (9%)
 Frame = -3

Query  4151  AFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACFLRPGL  3972
             AF  GSWQ +E +RI++GT  +H+ +   +IEE+  I N+RIR R AT SDC CFLRPG 
Sbjct  551   AFYFGSWQAIELMRIEDGTVALHLAESEYVIEEKSPIPNLRIRPRKATLSDCTCFLRPGT  610

Query  3971  DISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHISVYVTQG  3792
             +I+V  T  QSE SDEEN        EP WIDAKI SIER+PH   C CQF ++ Y+TQ 
Sbjct  611   EITVLWTLQQSESSDEENR-------EPVWIDAKISSIERRPHEPECSCQFFVNFYITQD  663

Query  3791  PPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTGKFCS  3612
             P    K TLSK+I VV+L+QI+ILQK+ + PCED++YRW  S+DCS LQ+ KLF GKF S
Sbjct  664   PLGTEKGTLSKDISVVELDQISILQKLGKYPCEDEHYRWKFSEDCSLLQRTKLFLGKFSS  723

Query  3611  DLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEYHSYAVSFKLENEVSTPI  3432
             DLSW++V S  KQ  FDV+SV NRIVY+I+  ++D  + N      AV+F+++N +STP+
Sbjct  724   DLSWLVVTSVLKQAVFDVRSVQNRIVYQIVGGDHDKVSLN------AVNFRVDNGISTPV  777

Query  3431  IIQFNP-DIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQPERYLGCDDYLTEFDVEMT  3261
             I  F P D  E  P     EAGPL   D  +LRRSKRR VQP+R+     + +E D+   
Sbjct  778   IFPFVPADTIEADPLNGTNEAGPLPFCDIVDLRRSKRRNVQPDRFFSLGGF-SESDIGSV  836

Query  3260  RLVGGKMYKSELEELPMALSIQAD-HAYQNGDIDNKTLACYQQElrdnsllsrnrnssks  3084
             R    K+     EE+P+AL  + D H+        K +  Y++      + S        
Sbjct  837   RAGIHKVDYWRKEEMPLALPDEGDVHSI----FSEKHIIDYEKGAHSLQIDSYEDFLVCK  892

Query  3083  DTNRKR--------VSGDKAHLAIVPLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVS  2928
               +R R         + D+   AIVP+ L  E       E+ L  E   + S EI EI  
Sbjct  893   SKDRSREVKPILAAQNEDQHQFAIVPVPLIIEP--IAHGEDHLHDETPWNESGEIGEISP  950

Query  2927  KYIYVNGSSAVEMKK-SSLNLMQGRRW-GQVKVSKLKFMGLDVkgggigsskkkakKRTC  2754
             KY   NG   ++ K  S L +    RW G+  + KL+                + +  T 
Sbjct  951   KYYCTNGVPKLQRKNMSDLYMEVESRWEGKGPIRKLR----------------RKRGFTI  994

Query  2753  PSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQ--NTKSC  2580
              ++ +S  ++R  +K   S   Y+E+I   M NI+ T+NKEQP +IDQWKE Q  N  + 
Sbjct  995   RTKTESYGEVRPHKKRPFSEPGYKEVIEAYMKNIESTINKEQPLVIDQWKELQVRNDLNQ  1054

Query  2579  QREPIeksstnneeelseLDMLWKEMELALASCYLLDDTE--------------------  2460
             +R+    SS  ++EE SE +MLW+EME ++AS YLL++ E                    
Sbjct  1055  RRDCNSPSSVGDQEESSETEMLWREMEFSIASSYLLEENEVRVMIEKIVGIEFLLAPLNR  1114

Query  2459  --------------------DTNLKSATEL-----HMATKKGTRVCHHDFRLNEEIGLVC  2355
                                 +  L S  E+       ++    +VC H++ L+EEIG++C
Sbjct  1115  IISFCVPWRQVFPSCLPWLVNIRLGSNVEVLKEVVQESSNISEQVCQHEYILDEEIGVLC  1174

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSS----------------SGKEQRPEEVVMEEKQGDDA  2223
             +LCG VSTEIKDV PPF+     S                + +E R EE   + KQ ++ 
Sbjct  1175  QLCGFVSTEIKDVSPPFVHIPADSAHNFMLQLYFQPTGWITNREWRDEEN-SKRKQAEND  1233

Query  2222  DLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID  2043
               + F+IP SS+ P SE    DN WAL+PDLR KLR HQ++AFEFLWKNIAGS++P  ++
Sbjct  1234  GFNLFSIPASSDTPLSEGN--DNVWALVPDLRKKLRLHQKKAFEFLWKNIAGSMVPALME  1291

Query  2042  PESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI  1863
              E K+RGGCVISHSPGAGKT L+I+FLVSYLKLFPG RPLVLAPKTTLYTWYKEIIKWK+
Sbjct  1292  QEVKRRGGCVISHSPGAGKTFLVISFLVSYLKLFPGKRPLVLAPKTTLYTWYKEIIKWKV  1351

Query  1862  PIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYT  1686
             P+PVYQIHG +TY+ E+ + K++  PG+PR NQDVMHVLDCLEK+QKW AHPS+LLMGYT
Sbjct  1352  PVPVYQIHGCRTYRYEIYKHKVETSPGIPRPNQDVMHVLDCLEKIQKWHAHPSILLMGYT  1411

Query  1685  SFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
             SFL+L REDS + HR+YM +VLRQ PGIL+LDEGHNPRST SRLRKALMKV T+LRILLS
Sbjct  1412  SFLSLMREDSKFIHRRYMGEVLRQSPGILVLDEGHNPRSTGSRLRKALMKVKTNLRILLS  1471

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFS-LENRARKMFidki  1329
             GTLFQNNF EYFNTLCLARP+FV+EVL+ELDPK+K+     K R+S  E+RARK F D+I
Sbjct  1472  GTLFQNNFSEYFNTLCLARPKFVNEVLRELDPKFKRNKNRRKRRYSSTESRARKFFTDEI  1531

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVK  1149
             +K+I+S+   E+ EGLN+L+ LT+ FIDVYEGGSSDNLPGLQ YTL+MKSTT+QQ+ L K
Sbjct  1532  AKRINSNVPEEQIEGLNMLRNLTSKFIDVYEGGSSDNLPGLQVYTLLMKSTTIQQQFLSK  1591

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             LQ ++  YKG+PLELELL+TLG+IHPWLI T AC+ +YF  EEL  L+K K D+K GSKV
Sbjct  1592  LQKKKDEYKGYPLELELLVTLGSIHPWLITTAACADKYFSREELLELKKHKDDVKKGSKV  1651

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             KFV+SL+ RC++RKEK+LIFCHNI+PINLF++IF++ Y W+KG +VLVLQGD+ELFERGR
Sbjct  1652  KFVLSLVNRCIIRKEKILIFCHNISPINLFVDIFDKLYKWKKGEDVLVLQGDLELFERGR  1711

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
             VMD+FEE GG SKV+LASIT CAEGISLTAASRVILLD+EWNPSK KQA+ARAFRPGQ++
Sbjct  1712  VMDQFEEPGGASKVLLASITACAEGISLTAASRVILLDTEWNPSKQKQAVARAFRPGQER  1771

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             VVYVYQLL T TLEEEK  RT WKEWVSSMIFSE  VEDPS WQA KIED+LL EIVEED
Sbjct  1772  VVYVYQLLETDTLEEEKNSRTNWKEWVSSMIFSEAFVEDPSCWQAEKIEDDLLREIVEED  1831

Query  428   RATLFHMIMKNEKASN  381
              A   HMIMKNEKASN
Sbjct  1832  WAKSIHMIMKNEKASN  1847



>gb|KDP44698.1| hypothetical protein JCGZ_01198 [Jatropha curcas]
Length=1254

 Score =  1235 bits (3195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 696/1306 (53%), Positives = 899/1306 (69%), Gaps = 85/1306 (7%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ +H+++HP + +PFEA   GSWQ V+RI I+NG+  +H  +   +IEE+  ISN+R
Sbjct  1     MKRKRLHESKHPLNPHPFEALHGGSWQSVDRIEIRNGSMTIHFANINHVIEEKGPISNIR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT+SDC C LRPG+D+ V S+   +             E    W DA+I SIERK
Sbjct  61    VKSRQATTSDCTCVLRPGIDVCVLSSTENA-------------ENSEVWSDARINSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF +  YV QGP    K TLSK+I+ V ++QI ILQ++++ PCE ++YRW  
Sbjct  108   PHESQCECQFFVKRYVNQGPLGSEKGTLSKDIEKVGIDQICILQRVDKIPCEGQFYRWDF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS +Q+ KLF GKFCSDL+W++VAS  KQ+ FDV+SV N+IVY+IL  ++      +
Sbjct  168   SEDCSCVQRTKLFIGKFCSDLAWLIVASVLKQLSFDVRSVQNKIVYQILDCDDGCSIKPN  227

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPD---IPERGPEGDVY-----EAGPLVVYDELRRSK  3333
               +S  V+FK++N + TP++ QF PD     E GP  DV+     E  P+   + LRRSK
Sbjct  228   RLNS--VNFKVDNNILTPVVHQFTPDNIDASEAGPASDVHKVDKDELSPVYNVNNLRRSK  285

Query  3332  RRFVQPERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKT  3153
             RR VQP+R+LGCD    E DV   R +  K  K + +E+ + LS+        G I N +
Sbjct  286   RRNVQPDRFLGCD-VRPEEDVGWVRTMPYKPDKWKEDEMSLPLSLLF------GPITNSS  338

Query  3152  LACYQQElrdnsllsrnrns---sksDTNRKRVSG-------DKAHLAIVPLQLSAENNL  3003
                 + E+   S       +   SK  T  ++V         ++  LAIVP+   ++   
Sbjct  339   TEQTEGEMGVLSSGLEPIENLPLSKFKTKPRKVKSVVVNQKENENELAIVPVPTESDLVA  398

Query  3002  FDQKENPLSFEDNEDLSA----EIREIVSKYIYVNGSSAVEMKKSSL--NLMQGRRW-GQ  2844
             F++  +      NE   A    E  +I   Y     S A+  K SS   +++   +W G+
Sbjct  399   FEEANS------NEKTPAYHSRETSDISFGYYGTKSSPAIRKKNSSEFDDIVFESKWKGR  452

Query  2843  VKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRC  2664
               +  ++                  + R   S+RD   +  ++++ ++SA  Y +LI+  
Sbjct  453   APIRNVQ----------------TGRHRPLHSKRDDHGEPLTYKRTTLSAGAYNKLIKSY  496

Query  2663  MANIDETL-NKEQPPIIDQWKEFQNTKSC--QREPIeksstnneeelseLDMLWKEMELA  2493
             M NID T+ + E+P I+DQW++F+  K+C  Q E +E  +T ++ E SE +MLW+EMEL+
Sbjct  497   MKNIDSTMMSNEEPHIVDQWEQFK-AKTCTGQSEKMEPPATEDDGETSETEMLWREMELS  555

Query  2492  LASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVP  2313
             LAS YLL++ ED+ ++ + E     +  T  C H F+++EEIG++C +CG VSTE+K V 
Sbjct  556   LASAYLLEENEDSQVRVSNE---TMQNSTENCRHAFKMDEEIGILCCICGFVSTEVKYVT  612

Query  2312  PPFMPSTCSSSGKEQRPEEVVMEE-KQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIP  2136
              PFM     ++  E RP  V   + K G++  L+ F   VSS +  S  E  DN WALIP
Sbjct  613   APFMEYVGWTA--ENRPWNVEDSDGKPGEEDGLNFFRNYVSSEE-MSLSEENDNVWALIP  669

Query  2135  DLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVS  1956
             +LR KL  HQ++AFEFLWKN+AGS+ P  ++  SKK GGCV+SH+PGAGKT LIIAFLVS
Sbjct  670   ELRKKLHLHQKKAFEFLWKNVAGSLTPANMEKSSKKIGGCVVSHTPGAGKTFLIIAFLVS  729

Query  1955  YLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLP  1776
             YLKLFPG RPLVLAPKTTLYTWYKE IKW+IPIPV+ IHG +TY+  V RQK     G P
Sbjct  730   YLKLFPGKRPLVLAPKTTLYTWYKEFIKWQIPIPVHLIHGRRTYR--VFRQKTVAIRGAP  787

Query  1775  R-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGIL  1599
             + + DVMHVLDCLEK+QKW A PSVL+MGYTSFLTL REDS +AHRKYM +VLR+ PG+L
Sbjct  788   KPSHDVMHVLDCLEKIQKWHAQPSVLVMGYTSFLTLMREDSKFAHRKYMAKVLRESPGLL  847

Query  1598  ILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKE  1419
             ILDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+F+ EVL+ 
Sbjct  848   ILDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFIREVLRA  907

Query  1418  LDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDV  1242
             LDPK+K++ K A K R  LE+RARK F+D I++KIDS    ER +GLN L+K+T+GFIDV
Sbjct  908   LDPKFKRKKKLAEKARHLLESRARKFFLDNIARKIDSDIAEERMQGLNELRKITSGFIDV  967

Query  1241  YEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLI  1062
             YEGG SDNLPGLQ YT++M ST +Q E+LVKL      Y G+PLELELLITL AIHPWL+
Sbjct  968   YEGGPSDNLPGLQIYTILMNSTDIQHEMLVKLHKIMATYNGYPLELELLITLAAIHPWLV  1027

Query  1061  RTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINL  882
             +T+ C  ++F  EEL  LEK K+D K GSKV FV++L+ R ++RKEKVLIFCHNIAPINL
Sbjct  1028  KTSNCVNKFFTWEELVELEKLKYDFKKGSKVMFVLNLVYR-IVRKEKVLIFCHNIAPINL  1086

Query  881   FLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLT  702
             F+E+FE  + W+KG E++VL GD+ELFERGRVMDKFEE GGPS+V+LASIT CAEGISLT
Sbjct  1087  FVELFENVFRWQKGREIMVLTGDLELFERGRVMDKFEEPGGPSRVLLASITACAEGISLT  1146

Query  701   AASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSS  522
             AASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY+RTTWKEWVSS
Sbjct  1147  AASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYRRTTWKEWVSS  1206

Query  521   MIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
             MIFSE  VEDPS WQA KIED++L E+VEEDR   FHMIMKNEKAS
Sbjct  1207  MIFSEAFVEDPSRWQAEKIEDDVLREMVEEDRVKSFHMIMKNEKAS  1252



>ref|XP_002520793.1| ATP-dependent helicase, putative [Ricinus communis]
 gb|EEF41502.1| ATP-dependent helicase, putative [Ricinus communis]
Length=1246

 Score =  1219 bits (3155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1293 (53%), Positives = 875/1293 (68%), Gaps = 65/1293 (5%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ + +++HPF+ YPFEA+ +GSWQ VE I I++G   +H  +   LIEE+   SN R
Sbjct  1     MKRKRLDESKHPFEAYPFEAWYSGSWQSVEFIEIRDGVMTLHFANNHHLIEEKGPPSNFR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT SDC CFLRPG+DI + STP                E    W DA+I SIERK
Sbjct  61    VKSRQATVSDCTCFLRPGIDICLLSTPENE-------------ENSEVWTDARINSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF I  +V QGP    K  LS+EI+VV +++I +LQK+++ P E ++YRW  
Sbjct  108   PHEPQCECQFFIKHHVNQGPLGSEKVKLSEEIEVVGIDRIRVLQKLDKIPSEGQFYRWDS  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCST+Q+ KLF GKFCSDL+W++VAS  +Q+ FDV+SV N+IVY+IL  ++D  +   
Sbjct  168   SEDCSTVQRTKLFIGKFCSDLTWLVVASVMRQIAFDVRSVQNKIVYQILGCDDDCSSIKP  227

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
               H  A+SFK+EN++ TP+++QF P   E  P  D+Y       Y    LRRSKRR VQP
Sbjct  228   NNHLNALSFKVENDILTPLVLQFAPT--EADPAPDMYGVDSDEAYSVKNLRRSKRRNVQP  285

Query  3314  ERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQN------GDIDNKT  3153
             ER+LGC D     DV   R +  K  K + +E+ + LS        +      G++   T
Sbjct  286   ERFLGC-DLPPGADVGWVRSMPYKPEKWKEDEMFLPLSFLFGQNASSSPEKIEGEMGVST  344

Query  3152  LACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIVPLQLSAENNLFDQKENPLSF  2973
                   E    S L +     K  T  +R    K  LAIVP+   +++  F++  +P   
Sbjct  345   PQIDSLEDLPLSKLKKRSRDVKWGTVNRR--EHKNELAIVPIPAESDSEPFEEMNSPEKD  402

Query  2972  EDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNL----MQGRRW-GQVKVSKLKFMGLD  2808
               N D    I +    Y    GS AV  KK+S  L    ++  RW G+   +     G  
Sbjct  403   PGN-DSRETINDFSFSYYRKKGSPAVR-KKNSYELDDMVVETTRWKGRPPKTNFHSGGY-  459

Query  2807  VkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETL-NKE  2631
                           +R+ P++R    +   ++K ++SA  Y +LI+  M NID TL +KE
Sbjct  460   --------------RRSIPTKRGDAGEPLKYKKTTLSAGAYNKLIKSYMKNIDSTLMSKE  505

Query  2630  QPPIIDQWKEFQNTK-SCQREPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDT  2454
             +P IIDQW++F+  + + Q +  E S T ++ E SE +MLW+EMEL+LAS YLLD+ E  
Sbjct  506   EPDIIDQWEQFKAKRHTVQSDKKELSPTEDDGEESETEMLWREMELSLASAYLLDEHE--  563

Query  2453  NLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGK  2274
              ++  TE     +K    C H+F+L+EEIG++C LCG VSTE+K V  PF+     ++  
Sbjct  564   -VRITTE---TMQKSNENCQHEFKLDEEIGILCHLCGFVSTEVKFVSAPFVEYVGWTA--  617

Query  2273  EQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAF  2094
             E RP         G+D  L+ F   V++   S   E  +N WALIPDLR KL  HQ++AF
Sbjct  618   ESRPCIDEDSRNPGEDEGLNLFGKYVAAENMSFS-EENNNVWALIPDLRMKLHLHQKKAF  676

Query  2093  EFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLA  1914
             EFLWKNIAGSIIP  ++  S+K GGCV+SH+PGAGKT LIIAFL SYLKLFPG RPLVLA
Sbjct  677   EFLWKNIAGSIIPANMEKASRKIGGCVVSHTPGAGKTFLIIAFLTSYLKLFPGKRPLVLA  736

Query  1913  PKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLE  1737
             PKTTLYTWYKE IKW+IP+PV+ IHG ++Y     RQK     G P+ +QDVMHVLDCLE
Sbjct  737   PKTTLYTWYKEFIKWQIPVPVHLIHGRRSYHN--FRQKTVAFRGGPKPSQDVMHVLDCLE  794

Query  1736  KMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSR  1557
             K+QKW A PSVL+MGYTSFLTL REDS + HRKYM +VLR+ PG+L+LDEGHNPRSTKSR
Sbjct  795   KIQKWHAQPSVLVMGYTSFLTLMREDSKFDHRKYMAKVLRESPGLLVLDEGHNPRSTKSR  854

Query  1556  LRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKG-AK  1380
             LRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+F+ EVLKELDPK+K++ KG  K
Sbjct  855   LRKVLMKVQTDLRILLSGTLFQNNFCEYFNTLCLARPKFIREVLKELDPKFKRKKKGEEK  914

Query  1379  TRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQC  1200
              R  LE+RARK F   I  +   S   ER +G+N+L+K+T+ FIDVYEGG +D LPGLQ 
Sbjct  915   ARHLLESRARKFF-LDIIARKIDSNTDERMQGINMLRKITSRFIDVYEGGPADGLPGLQI  973

Query  1199  YTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeee  1020
             YT++M ST +Q EILVKL      Y G+PLELELLITL +IHPWL++T+ C  ++F  +E
Sbjct  974   YTILMNSTDIQHEILVKLHKIMSTYHGYPLELELLITLASIHPWLVKTSNCVNKFFTWDE  1033

Query  1019  lealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKG  840
             L  +EK KFD K GSKV FV++L+ R +++KEKVLIFCHNIAPIN+F+E+FE  + W++G
Sbjct  1034  LVQIEKLKFDFKKGSKVMFVLNLVYR-IVKKEKVLIFCHNIAPINIFVELFENVFRWQRG  1092

Query  839   IEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNP  660
              E++VL GD+ELFERGRVMDKFEE G PS+V+LASIT CAEGISLTAASRVILLDSEWNP
Sbjct  1093  REIMVLTGDLELFERGRVMDKFEEPGSPSRVLLASITACAEGISLTAASRVILLDSEWNP  1152

Query  659   SKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHW  480
             SK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY RTTWKEWVSSMIFSE  VEDPS W
Sbjct  1153  SKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYSRTTWKEWVSSMIFSEAFVEDPSRW  1212

Query  479   QAPKIEDELLGEIVEEDRATLFHMIMKNEKASN  381
             QA KIED++L E+VEEDR   FHMIMKNEKAS 
Sbjct  1213  QAEKIEDDVLREMVEEDRVKSFHMIMKNEKAST  1245



>ref|XP_007008852.1| Chromatin remodeling complex subunit isoform 1 [Theobroma cacao]
 ref|XP_007008853.1| Chromatin remodeling complex subunit isoform 1 [Theobroma cacao]
 gb|EOY17662.1| Chromatin remodeling complex subunit isoform 1 [Theobroma cacao]
 gb|EOY17663.1| Chromatin remodeling complex subunit isoform 1 [Theobroma cacao]
Length=1261

 Score =  1204 bits (3115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 685/1294 (53%), Positives = 887/1294 (69%), Gaps = 54/1294 (4%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M++R ++Q++HPF+ YPFE    GSWQ VE IRI+NG   MH++D+  LIE++   S+ R
Sbjct  1     MRKRQLYQSKHPFNTYPFEVLFCGSWQAVELIRIKNGVMTMHLIDDQYLIEKQ-PFSDFR  59

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT SDC CFLRPG+D+ + S                +  PEP W+DAKI SIERK
Sbjct  60    VKSRQATLSDCTCFLRPGIDVCILSA--------SPLTGINEENPEPVWVDAKISSIERK  111

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF++++YV QGP    K  LSKE +VV ++QI++LQ++E+  C+D++Y W+ 
Sbjct  112   PHNSQCSCQFYVNLYVNQGPLGSEKVILSKETEVVGIDQISVLQRLEKHACDDQHYGWNF  171

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS L++ K+F GKF SD+SW+LV S  K++ FDV+SV N+IVY+IL  E+D    NS
Sbjct  172   SEDCSELRRTKIFLGKFLSDISWLLVTSVLKRIAFDVRSVQNKIVYQIL-GEDDSSPLNS  230

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
               + +AV+FK++N +S   +++ +P    E G     +E     VYD   LRRSKRR VQ
Sbjct  231   HNYLHAVNFKVDNGISVSDVVRLDPHQNNEAGAACSAHEIRQWPVYDAMNLRRSKRRNVQ  290

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKM--YKSELEELPMALSIQADHAYQNGDIDNKTLAC  3144
             PER+LGCD  L E D+   R    +   ++ E EE  +   +    +Y  G       A 
Sbjct  291   PERFLGCDSSL-ETDISWVRTAPLRTGNWREEEEEQELEEDMNLPLSYLFG-----MNAS  344

Query  3143  YQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIVPLQLSAENNLFDQKENPLSFEDN  2964
               +EL         ++ + S   +  V+G +      P +  A N    + +N L+    
Sbjct  345   TSKELTQCETSDVCKSKNISREFKSDVAGPRKSSVNYPRRSGATNP--RKHQNSLAIVP-  401

Query  2963  EDLSAEIREIVSKYIYVNG---SSAVEMKKSSLN---LMQGRRWGQVKVSKLKFMGLDVk  2802
               +S+E   + S + +      S A E++K SLN   + + R   + K+  L++M  +  
Sbjct  402   --VSSESDPLASGHCHAPKFPRSHAEEVEKVSLNYYSVKRSRTTHRKKIPALEYMDYEST  459

Query  2801  --gggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQ  2628
               G       +    R+  ++++   +  ++++ +ISA  Y +LI   M NID T  KE+
Sbjct  460   WKGRSFSKKGQNKSHRSVHTRKEDYDEPITYKRTTISAGAYNKLINSYMKNIDSTFTKEE  519

Query  2627  PPIIDQWKEFQNTKSCQ----REPIeksstnneeelseLDMLWKEMELALASCYLLDDTE  2460
             P IIDQW +F+   S +     EP E+ S  +E ++S+ ++LW+EMEL +AS Y  +D  
Sbjct  520   PHIIDQWNQFKEAASSEMSRKTEP-EQPSVEDEGDMSDTEILWREMELCMASAYFEEDEA  578

Query  2459  DTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSS  2280
               + +S        +K +  C HDF+L+EEIG++CR+CG V TEIK V  PF+      +
Sbjct  579   RVSAES-------LRKSSGNCQHDFKLDEEIGVLCRICGFVRTEIKYVSAPFLEHKSWIA  631

Query  2279  GKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRR  2100
               +   EE    +  GD+A L+ F    S + P SE    DN WALIP+L+ KL  HQ+R
Sbjct  632   DGKVCSEEEPEHKTDGDEA-LNLFCNYTSIDTPLSEEN--DNVWALIPELKKKLHFHQKR  688

Query  2099  AFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLV  1920
             AFEFLW+N+AGS+ P  ++  SKK GGCV+SHSPGAGKTLLIIAFL SYLKLFPG RPLV
Sbjct  689   AFEFLWQNVAGSLTPALMETASKKTGGCVVSHSPGAGKTLLIIAFLTSYLKLFPGKRPLV  748

Query  1919  LAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDC  1743
             LAPKTTLYTWYKE IKW+IPIPV+ IHG +TY+  V +++     G P+ +QDVMHVLDC
Sbjct  749   LAPKTTLYTWYKEFIKWEIPIPVHLIHGRRTYR--VFKKQSVRLHGAPKPSQDVMHVLDC  806

Query  1742  LEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTK  1563
             LEK+QKW A PSVL+MGYTSFLTL REDS + HRK+M +VLR+ PG+L+LDEGHNPRSTK
Sbjct  807   LEKIQKWHAQPSVLVMGYTSFLTLMREDSKFEHRKFMAKVLRESPGLLVLDEGHNPRSTK  866

Query  1562  SRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKR-VKG  1386
             SRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV EVL+ELDPK KK+  + 
Sbjct  867   SRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVYEVLRELDPKSKKKKSQF  926

Query  1385  AKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGL  1206
              K R  LENRARK FIDKI++KIDSS+  ER  GLN+L+ +T GFIDVYEGG+SD+LPGL
Sbjct  927   DKARNLLENRARKFFIDKIARKIDSSEGEERLHGLNMLRNITNGFIDVYEGGNSDSLPGL  986

Query  1205  QCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfke  1026
             Q YTLMM ST +Q EILVKL      Y G+PLELELLITL +IHP L+RT+ C  ++F  
Sbjct  987   QIYTLMMNSTDVQHEILVKLHKIMAGYSGYPLELELLITLASIHPSLVRTSNCVNKFFSP  1046

Query  1025  eelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWR  846
             EEL  LEK KFD K GSKV FV++L+ R +++KEKVLIFCHNIAPINLF+E+FE  + WR
Sbjct  1047  EELMTLEKIKFDFKKGSKVMFVLNLVYR-VIKKEKVLIFCHNIAPINLFIELFEIVFRWR  1105

Query  845   KGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEW  666
             KG E+LVL GD+ELFERGRVMDKFEE GG S+++LASIT CAEGISLTAASRVILLDSEW
Sbjct  1106  KGREILVLTGDLELFERGRVMDKFEEPGGASRILLASITACAEGISLTAASRVILLDSEW  1165

Query  665   NPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPS  486
             NPSK+KQAIARAFRPGQ KVV+VYQLLATGTLEE+KY+RTTWKEWVSSMIFSE  VEDPS
Sbjct  1166  NPSKTKQAIARAFRPGQQKVVFVYQLLATGTLEEDKYRRTTWKEWVSSMIFSEAFVEDPS  1225

Query  485   HWQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
              WQA KIED++L EIV ED+   FHMIMKNEKAS
Sbjct  1226  RWQAEKIEDDVLREIVAEDKVKSFHMIMKNEKAS  1259



>gb|KHG14659.1| DNA repair rhp54 [Gossypium arboreum]
Length=1268

 Score =  1200 bits (3105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1304 (52%), Positives = 877/1304 (67%), Gaps = 67/1304 (5%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M++R ++ +EHPFD YPFE F   SWQ VE IRI+NG   +H++D   LIE++   S++R
Sbjct  1     MRKRHLYHSEHPFDEYPFEVFVQDSWQAVELIRIKNGFMTLHLIDGQYLIEKK-PFSDLR  59

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT  DC CFLRPG+DI + S P ++E  DEE        PEP W+DAKI SIERK
Sbjct  60    VKSRKATLPDCTCFLRPGIDICILSRPQETESLDEET-------PEPVWVDAKISSIERK  112

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C CQF+I++Y  + P    K TLSKE +V+ +N I ILQK+E+  CED++YRW+ 
Sbjct  113   PHDSECSCQFYINLYDNRAPLGSEKGTLSKETEVIGINDICILQKLEKNACEDQHYRWNF  172

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCSTL++ K+F GKF SD+SW+LV S  KQ+ FDV+SV N+IVY+IL  ++D     +
Sbjct  173   SEDCSTLKRTKIFLGKFSSDISWLLVTSVLKQIAFDVRSVQNKIVYQILDQDDDTPLKYN  232

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQ  3318
              Y  +AV+ K EN +S   ++QF+P    E      V E     VYD   LRRSKRRFVQ
Sbjct  233   NYF-HAVNIKSENGISVSNVVQFDPLGNNETDAVYSVDETNQWPVYDAMNLRRSKRRFVQ  291

Query  3317  PERYLGCDD-YLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAY-QNGDIDNKTLAC  3144
             PER++GCD    T+    +T       ++ E EE    +++   H    N     +    
Sbjct  292   PERFVGCDHPGGTDTSWHLTAACRTSNWREEGEEQEADMNMPLSHLLCINASPTEELTLS  351

Query  3143  YQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAI-VPLQLSAENNLFDQKE---NPLS  2976
              +++    S        S   T RK   G+ +   +  P + S +N   D+      P+S
Sbjct  352   EKRDTMSKSKNVSKEVKSDVTTPRKPSVGNPSRSGVKYPRRPSVKNPRKDENTLAIVPVS  411

Query  2975  FEDNE-------------DLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRRWGQVKV  2835
              E  +             +LS EI ++   Y          MK+ + N        + K+
Sbjct  412   SETGDPAFGNCHMQRTPTNLSEEIEQLSLHY--------YNMKRYTAN-------KKKKI  456

Query  2834  SKLKFM--GLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCM  2661
               L+++  G   KG    +  +    R+  ++ +   ++++++K ++SA  Y +LI   M
Sbjct  457   PALEYLDYGTGWKGRPQPTKAQSKSYRSSQTRMEDFDELKTYKKTTLSAGAYNKLINSYM  516

Query  2660  ANIDETLNKEQPPIIDQWKEFQNTKSCQ---REPIeksstnneeelseLDMLWKEMELAL  2490
              NID T  K++  IID+W +F+   S +   +   E+     EEE+SE +MLW+EME+ +
Sbjct  517   KNIDSTSVKDESHIIDRWNQFKEATSTEMNRKTEPEEPPVEEEEEMSETEMLWREMEICM  576

Query  2489  ASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPP  2310
             AS Y  DD    + +S        +K    C H+F+L++E+G++CR+CG VSTEIK V  
Sbjct  577   ASSYFDDDEARVSAESL-------RKANENCQHEFKLDDEVGVLCRICGFVSTEIKHVSA  629

Query  2309  PFMP-STCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPD  2133
             PF+   T  + G     +E   E K   +  L+ F    +     SE    DN WALIP+
Sbjct  630   PFLEHKTWVADGNSCYRDET--ENKADGEEGLNLFCDYTTIQARLSEES--DNVWALIPE  685

Query  2132  LRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSY  1953
             LR KL  HQ+RAFEFLW NIAGS+IP  ++P SKK GGCV+SHSPG+GKT LIIAFL SY
Sbjct  686   LRKKLHFHQKRAFEFLWLNIAGSLIPALMEPSSKKTGGCVVSHSPGSGKTFLIIAFLASY  745

Query  1952  LKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR  1773
             LKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IHG ++Y+  V ++      G+PR
Sbjct  746   LKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIHGRRSYR--VFKKNAVKFHGVPR  803

Query  1772  -NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILI  1596
              +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL REDS + HRK+M +VLR+ PG+L+
Sbjct  804   PSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMREDSKFEHRKFMAKVLRESPGLLV  863

Query  1595  LDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKEL  1416
             LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV EVL+ L
Sbjct  864   LDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVFEVLRRL  923

Query  1415  DPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYE  1236
             DPKYK++ +  K R  LENRARK+F+DKI++KID+S   ER EGLN+L+K+T GFIDVYE
Sbjct  924   DPKYKRKKRFDKARNLLENRARKLFLDKIARKIDASVGEERMEGLNMLRKITNGFIDVYE  983

Query  1235  GGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRT  1056
             GG+ D LPGLQ YTLMM ST +Q EILVKL      Y G+PLELELLITL +IHP L+RT
Sbjct  984   GGNFDCLPGLQIYTLMMNSTDIQHEILVKLHKIMSTYTGYPLELELLITLASIHPSLVRT  1043

Query  1055  TACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFL  876
             + CS ++F  EEL  LEK KFD + GSKV FV++L+ R +++ EKVLIFCHNIAPI L  
Sbjct  1044  SNCSAKFFSTEELLELEKIKFDFRKGSKVMFVLNLVYR-IIKNEKVLIFCHNIAPIYLLA  1102

Query  875   EIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAA  696
             E+FER + WRKG E+LVL GD+ELFERGRVMDKFEE GG S+V+LASIT CAEGISLTAA
Sbjct  1103  EMFERIFRWRKGREILVLTGDLELFERGRVMDKFEEPGGASRVLLASITACAEGISLTAA  1162

Query  695   SRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMI  516
             SRVILLDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY+RTTWKEWVSSMI
Sbjct  1163  SRVILLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYRRTTWKEWVSSMI  1222

Query  515   FSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
             FSE  VEDPS WQA KIED++L EIV ED+   FHMIMKNEKAS
Sbjct  1223  FSEAFVEDPSQWQAEKIEDDVLREIVAEDKVKSFHMIMKNEKAS  1266



>ref|XP_007218889.1| hypothetical protein PRUPE_ppa000332mg [Prunus persica]
 gb|EMJ20088.1| hypothetical protein PRUPE_ppa000332mg [Prunus persica]
Length=1277

 Score =  1200 bits (3104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 684/1310 (52%), Positives = 894/1310 (68%), Gaps = 70/1310 (5%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGD-LIEEEISISNVR  4029
             ++R ++++ HPFD YPFEA   GSW PVE + I++GT  ++  D    +I+ +    N+R
Sbjct  3     RKRHLYRSTHPFDAYPFEALCCGSWHPVELLGIRSGTMTINFADNHSCVIQNKGPFPNIR  62

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A S DC CFLRPG+D+ V STP  +E+S+E+          P  +DA+I SI+R 
Sbjct  63    VRSRQANSYDCTCFLRPGVDVCVLSTPENTENSEEKIRA-------PVMVDARINSIKRV  115

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+F+++ YV QGP    + TL+K+ K V ++ I + Q +++  C +++YRW  
Sbjct  116   PHESHCSCRFYVNFYVNQGPLGSERATLNKDAKRVGIHDIFVFQTLDRDSCANEHYRWEF  175

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S DC TL + KL  GKF SD+SW+LV S  KQV FDV+SV  ++VY+I+  ++D     S
Sbjct  176   SADCPTLPRTKLLLGKFLSDISWLLVTSVLKQVSFDVRSVQRKVVYQIVGGDDDSTLSKS  235

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
             + + +AV+F++++ +  PI+++F   +P      D  E GP    D   LRRSKR+ V+P
Sbjct  236   DNYLHAVNFRVDDGLLVPIVVEF---VPADATGNDPTEGGPSSSSDLLGLRRSKRQNVRP  292

Query  3314  ERYLGCD-----------------DYLTEFD--VEMTRLVGGKMYKSELEELPMALSIQA  3192
             ER+LGCD                 D+  + D  + +++L G    +SE E       +  
Sbjct  293   ERFLGCDAPAEIEIGYIRSRPYKVDHSDDDDMHIPLSQLFGKHARRSE-EHTEAEQKVHY  351

Query  3191  DHAYQNGDI----DNKTLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIVPLQ  3024
                  + D+        LA   ++  +     ++R        RK+    +A LAIVPL 
Sbjct  352   KKLKSSEDLHASKSEDDLASESEDSLECKSKIKSRKVKSDVAKRKK---HQAQLAIVPL-  407

Query  3023  LSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGR-RW-  2850
                + + F    + L+    E  + E  E  +KY Y   S A   K S L+ M  + +W 
Sbjct  408   -PDKRDPFALGRSHLNANSPEKSTKEGEEFPAKYYYHYSSKAKRKKNSDLDDMDFQMKWD  466

Query  2849  GQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIR  2670
             G+V  S+              S     +  +  S+R+ +   R++ K S+SA  Y+ELI 
Sbjct  467   GKVSTSR-------------ASRVYNNRHNSIRSKREGLSG-RTYPKRSLSAGAYKELIN  512

Query  2669  RCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDMLWKEMELA  2493
               + ++D + NK++P I+DQWKEF+  K+  Q+   E     +EEE+SE +MLWKEMELA
Sbjct  513   TFLKDMDCS-NKQEPNIMDQWKEFKAGKNPEQQNETEMPEDEDEEEMSETEMLWKEMELA  571

Query  2492  LASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVP  2313
             LAS YLLD  E +  + +T    A K G   C H+FRLNEEIG+VC +CG VS EI DV 
Sbjct  572   LASAYLLDGDEGS--QGSTSGGTAQKSGAG-CRHEFRLNEEIGMVCLICGFVSIEIGDVS  628

Query  2312  PPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPD  2133
              PF+ +T  ++   +  EE   ++K+ +  + + F    S ++P    E  DN WALIP+
Sbjct  629   APFVQNTGWAADDRKINEEQT-DDKRAEYEEFNFFHTRTSPDEPEPLSEENDNVWALIPE  687

Query  2132  LRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSY  1953
             LR KL  HQ++AFEFLWKN+AGS+ P  ++ ++KK GGCVISHSPGAGKT LIIAFLVSY
Sbjct  688   LRRKLLFHQKKAFEFLWKNVAGSLEPALMEHKAKKIGGCVISHSPGAGKTFLIIAFLVSY  747

Query  1952  LKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR  1773
             LKLFPG RPLVLAPKTTLYTWYKE IKWKIPIPVY IHG +TY+  V ++K     G P+
Sbjct  748   LKLFPGKRPLVLAPKTTLYTWYKEFIKWKIPIPVYLIHGRRTYR--VFKKKTVTFTGGPK  805

Query  1772  -NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILI  1596
                DV+HVLDCLEK+QKW A PSVL+MGYTSFLTL REDS + HRK+M QVLR+ PGI++
Sbjct  806   PTDDVLHVLDCLEKIQKWHAQPSVLVMGYTSFLTLMREDSKFVHRKFMAQVLRESPGIVV  865

Query  1595  LDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKEL  1416
             LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV+EVL++L
Sbjct  866   LDEGHNPRSTKSRLRKGLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVNEVLRQL  925

Query  1415  DPKYKKRVKGA-KTRFSLENRARKMFidkiskkidssk-ererkEGLNILKKLTTGFIDV  1242
             DPKY+++ KG  K R  +E RARK+F+D+I+KKIDS++ E +R +GLN+L+ +T GFIDV
Sbjct  926   DPKYRRKKKGKEKARHLMEARARKLFLDQIAKKIDSNEGEDQRIQGLNMLRNITNGFIDV  985

Query  1241  YEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLI  1062
             YEGG+SD LPGLQ YTL+M +T +QQEIL KLQD    Y G+PLELELLITLG+IHPWLI
Sbjct  986   YEGGNSDTLPGLQIYTLLMNTTDIQQEILDKLQDIMSKYHGYPLELELLITLGSIHPWLI  1045

Query  1061  RTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINL  882
             +T AC+ ++F  E+LE LE++K DL  GSKVKFV+SLI R ++RKEKVLIFCHNIAP+ L
Sbjct  1046  KTAACADKFFTTEQLEDLEQYKHDLHKGSKVKFVLSLIYR-VVRKEKVLIFCHNIAPVRL  1104

Query  881   FLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLT  702
             FLE+FE  +GW++G EVLVL GD+ELFERG+VMDKFEE GG S+V+LASIT CAEGISLT
Sbjct  1105  FLELFEMVFGWQRGREVLVLTGDLELFERGKVMDKFEEAGGASRVLLASITACAEGISLT  1164

Query  701   AASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSS  522
             AASRVILLDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY RTTWKEWVSS
Sbjct  1165  AASRVILLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYGRTTWKEWVSS  1224

Query  521   MIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             MIFSE  VEDPS WQA KIED++L E+V ED++  FHMIMKNEKAS + R
Sbjct  1225  MIFSEAFVEDPSRWQAEKIEDDILREMVAEDKSKSFHMIMKNEKASTVVR  1274



>ref|XP_008233817.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Prunus 
mume]
Length=1277

 Score =  1198 bits (3099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 688/1307 (53%), Positives = 894/1307 (68%), Gaps = 64/1307 (5%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGD-LIEEEISISNVR  4029
             ++R ++++ HPFD YPFEA   GSW PVE + I++GT  +   D    +I+ +    N+R
Sbjct  3     RKRHLYRSTHPFDAYPFEALCCGSWHPVELLGIRSGTMTISFADNHSCVIQNKGPFPNIR  62

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A S DC CFLRPG+D+ V STP  +E+S+E+          P  +DA+I SI+R 
Sbjct  63    VRSRQANSYDCTCFLRPGVDVCVLSTPENTENSEEKIRA-------PVMVDARINSIKRV  115

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+F+++ YV QGP    + TL+K+ K V ++ I + Q +++  C +++YRW  
Sbjct  116   PHESHCSCRFYVNFYVNQGPLGSERATLNKDAKRVGIHDIFVFQTLDRDSCANEHYRWEF  175

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S DC TL + KL  GKF SD+SW+LV S  KQV FDV+SV  ++VY+I+  ++D     S
Sbjct  176   SADCPTLPRTKLLLGKFLSDISWLLVTSVLKQVSFDVRSVQRKVVYQIVGGDDDSTLSKS  235

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
             + + +AV+F++++ +  PI+++F   +P      D  E GP    D   LRRSKR+ V+P
Sbjct  236   DNYLHAVNFRVDDGLLVPIVVEF---VPADATGNDPTEGGPSSSSDLLGLRRSKRQNVRP  292

Query  3314  ERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSI--------QADHAYQNGDIDN  3159
             ER+LGCD    E ++   R    K+  S+ +E+ + LS           +H      +  
Sbjct  293   ERFLGCD-APAEIEIGYIRSRPYKVDHSDDDEMNIPLSQLFGKHARRSEEHTEAEQKVRY  351

Query  3158  KTLACYQ-----QElrdnsllsrnrnssksDTNRKRVSGD-------KAHLAIVPLQLSA  3015
             K L   +     +   D +  S +    KS T  ++V  D       +A LAIVPL    
Sbjct  352   KKLKSSEDLHASKSEDDLASESEDSLECKSKTKSRKVKSDVAKRKKHQAQLAIVPL--PD  409

Query  3014  ENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGR-RW-GQV  2841
             + + F      L+    E  + E  E  +KY Y   S A   K S L+ M  + +W G+V
Sbjct  410   KRDPFALGRGHLNANSPEKSTKEGEEFPAKYYYHYSSKAKRKKNSDLDDMDFQMKWDGKV  469

Query  2840  KVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCM  2661
               S+              S     +  +  S+R+ +   R++ K S+SA  Y+ELI   +
Sbjct  470   STSR-------------ASRVYNNRHNSIRSKREGLSG-RTYPKRSLSAGAYKELINTFL  515

Query  2660  ANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDMLWKEMELALAS  2484
              ++D + NK++P I+DQWKEF+  K+  Q+   E     +EEE+SE +MLWKEMELALAS
Sbjct  516   KDMDCS-NKQEPNIMDQWKEFKAGKNPEQQNETEMPEDEDEEEMSETEMLWKEMELALAS  574

Query  2483  CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPF  2304
              YLLD  E +  + +T    A K G   C H+FRLNEEIG+VC +CG VS EI DV  PF
Sbjct  575   AYLLDGDEGS--QGSTSGGTAQKSGAG-CRHEFRLNEEIGMVCLICGFVSIEIGDVSAPF  631

Query  2303  MPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRN  2124
             + +T  ++   +  EE   ++K+ +  + + F    S ++P    E  DN WALIP+LR 
Sbjct  632   VQNTGWAADDRKINEEQT-DDKRAEYEEFNFFHTRTSPDEPEPLSEENDNVWALIPELRR  690

Query  2123  KLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKL  1944
             KL  HQ++AFEFLWKN+AGS+ P  ++ ++KK GGCVISHSPGAGKT LIIAFLVSYLKL
Sbjct  691   KLLFHQKKAFEFLWKNVAGSLEPALMEHKAKKIGGCVISHSPGAGKTFLIIAFLVSYLKL  750

Query  1943  FPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQ  1767
             FPG RPLVLAPKTTLYTWYKE IKWKIPIPVY IHG +TY+  V ++K     G P+   
Sbjct  751   FPGKRPLVLAPKTTLYTWYKEFIKWKIPIPVYLIHGRRTYR--VFKKKTVTFTGGPKPTD  808

Query  1766  DVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDE  1587
             DV+HVLDCLEK+QKW A PSVL+MGYTSFLTL REDS + HRK+M QVLR+ PGI++LDE
Sbjct  809   DVLHVLDCLEKIQKWHAQPSVLVMGYTSFLTLMREDSKFVHRKFMAQVLRESPGIVVLDE  868

Query  1586  GHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPK  1407
             GHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV+EVL+ LDPK
Sbjct  869   GHNPRSTKSRLRKGLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVNEVLRALDPK  928

Query  1406  YKKRVKGA-KTRFSLENRARKMFidkiskkidssk-ererkEGLNILKKLTTGFIDVYEG  1233
             Y+++ KG  K R  +E RARK+F+D+I+KKIDS++ E +R +GLN+L+ +T GFIDVYEG
Sbjct  929   YRRKKKGKEKARHLMEARARKLFLDQIAKKIDSNEGEDQRIQGLNMLRNITNGFIDVYEG  988

Query  1232  GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTT  1053
             G+SD LPGLQ YTL+M +T +QQEIL KLQD    Y G+PLELELLITLG+IHPWLI+T 
Sbjct  989   GNSDTLPGLQIYTLLMNTTDIQQEILDKLQDIMSKYHGYPLELELLITLGSIHPWLIKTA  1048

Query  1052  ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLE  873
             AC+ ++F  E+LE LE++K DL  GSKVKFV+SLI R ++RKEKVLIFCHNIAP+ LFLE
Sbjct  1049  ACADKFFTTEQLEDLEQYKHDLHKGSKVKFVLSLIYR-VVRKEKVLIFCHNIAPVRLFLE  1107

Query  872   IFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAAS  693
             +FE  +GW++G EVLVL GD+ELFERG+VMDKFEE GG S+V+LASIT CAEGISLTAAS
Sbjct  1108  LFEMVFGWQRGREVLVLTGDLELFERGKVMDKFEEPGGASRVLLASITACAEGISLTAAS  1167

Query  692   RVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIF  513
             RVILLDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY RTTWKEWVSSMIF
Sbjct  1168  RVILLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYGRTTWKEWVSSMIF  1227

Query  512   SEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             SE  VEDPS WQA KIED++L E+V ED++  FHMIMKNEKAS + R
Sbjct  1228  SEAFVEDPSRWQAEKIEDDILREMVAEDKSKSFHMIMKNEKASTVVR  1274



>ref|XP_006595851.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Glycine max]
 ref|XP_006595852.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X2 [Glycine max]
 gb|KHN48592.1| DNA repair protein rhp54 [Glycine soja]
Length=1307

 Score =  1196 bits (3093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 687/1342 (51%), Positives = 890/1342 (66%), Gaps = 103/1342 (8%)
 Frame = -3

Query  4211  AMKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNV  4032
             A ++R + Q +HPF  +PFEA   GSWQ VE I+I+ GT  MH +D   ++ E+  +S++
Sbjct  2     AHRKRRLDQLKHPFSPHPFEAVAFGSWQAVEFIKIEGGTMSMHFVDNHHMVMEKGPLSDI  61

Query  4031  RIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIER  3852
             RIRSRNAT SDC+ FLRPG+D+ V S P QS+D+D        +  +P W DAKI S++R
Sbjct  62    RIRSRNATLSDCSRFLRPGIDVCVLSAPQQSDDADA-------INIDPVWADAKISSVQR  114

Query  3851  KPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             KPH   C CQF+++ YV QG      +TLS+EIKVV +NQI+ILQK+E  PCE+++YRW+
Sbjct  115   KPHDSECSCQFYVNFYVHQGSLGAELRTLSREIKVVGINQISILQKLESTPCENQHYRWA  174

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DCS +   KL  GK   DLSW++V +A K+V   V+S+ +++VY++L  +    + N
Sbjct  175   SSEDCSIISHTKLLLGKVLCDLSWLVVTTALKKVSICVRSLQDKLVYQVLGRDTVSTSLN  234

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPER-GPEGDVYE--AGPLVVYDELRRSKRRFV  3321
             +E H   V+FK +  +  PI+ Q      +R  PE + +E    P    + LRRSKRR V
Sbjct  235   NESHIDVVNFKTDKGMLVPIVSQVATLKTKRVDPEQESHEDKESPSYNVEGLRRSKRRNV  294

Query  3320  QPERYLGCDDYLTEFDVEMTRL-------------VGGKMYKSELEELPMALSIQADHAY  3180
             QPERYLGC+  +++ DV   R              +  +MY      +P+A   +     
Sbjct  295   QPERYLGCEK-VSQIDVGSFRNLPPVKIDTWKDNDIDHEMY------IPLAGLFRWQKKC  347

Query  3179  QNGDIDNKTLACYQQElrdnsllsrnrnssksDTNRKRVSGD-----KAHLAIVPLQLSA  3015
               GD DN      + +              K+ + + R  GD     + HLAI+PL    
Sbjct  348   LEGDTDNHQ----KVKKVSTCRELVVYKRKKTKSQKVRSGGDDQNEHQNHLAIIPLPAQH  403

Query  3014  E-------NNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLM---  2865
             +       ++L+D+       E +E        I SKY ++ G+++   KK+ + L+   
Sbjct  404   DPVEVIHCDDLYDKVTRSYGNESSE--------ISSKYHHLTGTTS---KKNDVKLLTFE  452

Query  2864  ----------------------------QGRRWGQVKVSKLKFMGLDVkgggigsskkka  2769
                                         + +R G   +  +  +G   +G       K  
Sbjct  453   SHYHAAKSDDGEKSDDLSWRYHYSYGAPKSQRKGLSDLDDMVNLGNKWEGISSSKVVKGK  512

Query  2768  kKRTCP-SQRDSIYDIR-SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQ  2595
             K RT     RD   + R +++  S++A  Y++LI   + NI+     E+P I DQWK+ +
Sbjct  513   KHRTTYFGSRDHGEEKRYNYKDRSLNAAAYKDLINSYLKNINTRPTNEEPAIADQWKQTE  572

Query  2594  NTKSC-QREPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMAT  2418
                S  Q+   E       EE SE+DMLW+E+E++LASCYL +DTED+N    TE     
Sbjct  573   TPSSIGQKTETEVLRKEEAEEESEMDMLWRELEVSLASCYLEEDTEDSNAAVFTETLENP  632

Query  2417  KKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEK  2238
               G   C HDFR+NEEIG+ C  CG VSTEIK + PPF+  +     ++Q PEE   + K
Sbjct  633   NAG---CPHDFRMNEEIGIYCYRCGFVSTEIKYITPPFIQHSVWHQEEKQIPEED-SKTK  688

Query  2237  QGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSII  2058
               +D D+D      S  KP S+    DN W LIP+L+ KL AHQ++AFEFLW+NIAGS+ 
Sbjct  689   ANEDDDIDLLPALDSPEKPVSQEN--DNVWVLIPELKAKLHAHQKKAFEFLWQNIAGSMD  746

Query  2057  PTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEI  1878
             P  ++  SK+RGGCV+SH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE 
Sbjct  747   PGLMEAASKRRGGCVVSHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEF  806

Query  1877  IKWKIPIPVYQIHGGQTYKGEVLRQKMKLC-PGLPR-NQDVMHVLDCLEKMQKWLAHPSV  1704
             IKW IPIPVY IHG +TY+  V +QK  +  PG+P+   DV HVLDCLEK+QKW +HPSV
Sbjct  807   IKWDIPIPVYLIHGRRTYR--VFKQKSSIVIPGVPKPTDDVKHVLDCLEKIQKWHSHPSV  864

Query  1703  LLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTS  1524
             L+MGYTSFLTL REDS +AHRKYM +VLR+ PG+++LDEGHNPRSTKSRLRK LMKV T 
Sbjct  865   LIMGYTSFLTLMREDSKFAHRKYMAKVLRESPGVMVLDEGHNPRSTKSRLRKVLMKVQTE  924

Query  1523  LRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAK-TRFSLENRARK  1347
             LRILLSGTLFQNNF EYFNTLCLARP+F+ EVLK LDPKYK++ K AK     LE+RARK
Sbjct  925   LRILLSGTLFQNNFCEYFNTLCLARPKFIHEVLKALDPKYKRKGKVAKKASHLLESRARK  984

Query  1346  MFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQ  1167
              F+D+I+KKIDSS  RER++GL +L+ +T GFIDVYEGGSSD LPGLQ YTL+M ST  Q
Sbjct  985   FFLDQIAKKIDSSNGRERRKGLKMLRNVTNGFIDVYEGGSSDGLPGLQIYTLLMNSTDTQ  1044

Query  1166  QEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl  987
              EIL +L  +     G+PLELELLITLG+IHPWL+++  C+ ++F + +L  LEK KFDL
Sbjct  1045  HEILHELHKKMAKVNGYPLELELLITLGSIHPWLVKSAVCAEKFFTQAQLMELEKCKFDL  1104

Query  986   kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIE  807
             ++GSKVKFV+SLI R +++KEKVLIFCHNIAP+ LF+E FE+++GW KG EVLVL G++E
Sbjct  1105  RIGSKVKFVLSLIYR-VVKKEKVLIFCHNIAPVKLFVEYFEKYFGWTKGREVLVLTGELE  1163

Query  806   LFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAF  627
             LFERGRVMDKFEE GG +K++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAF
Sbjct  1164  LFERGRVMDKFEEPGGVAKILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAF  1223

Query  626   RPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLG  447
             RPGQ KVVYVYQLL TG+LEE+KYKRTTWKEWVSSMIFSE  VEDPS WQA KIED++L 
Sbjct  1224  RPGQQKVVYVYQLLVTGSLEEDKYKRTTWKEWVSSMIFSEAFVEDPSQWQAEKIEDDILR  1283

Query  446   EIVEEDRATLFHMIMKNEKASN  381
             E+V EDR+  FHMIMKNEKAS 
Sbjct  1284  EMVAEDRSKSFHMIMKNEKAST  1305



>ref|XP_010087542.1| DNA repair protein rhp54 [Morus notabilis]
 gb|EXB29273.1| DNA repair protein rhp54 [Morus notabilis]
Length=1263

 Score =  1195 bits (3092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 694/1303 (53%), Positives = 886/1303 (68%), Gaps = 68/1303 (5%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             + +R ++Q+ H F  Y FEA    SW+  E + I+NGT  ++ +D   +I+E     N+R
Sbjct  2     VTKRHLYQSTHAFGGYSFEAISGSSWKRAESLLIRNGTMTLNFVDNPRVIQERGPSVNLR  61

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             I+SR AT SDC CFLRPG+DI V S P Q+E+S +      K   EP WID +I SIERK
Sbjct  62    IKSREATLSDCTCFLRPGIDICVLS-PSQNEESLD------KEIQEPDWIDGRISSIERK  114

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH  GC CQF+++ Y  QG    V++TLSKEI  + ++QI ILQK+   PCEDK+YRW  
Sbjct  115   PHESGCSCQFYVNFYTNQGSLGAVRETLSKEITAIGIDQIFILQKLGLNPCEDKHYRWES  174

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC + QK KL  GK  +DLSW+LV S+ K+V FDV+SV N++VY+IL+   +  + +S
Sbjct  175   SEDCPSRQKTKLLLGKILNDLSWLLVTSSLKRVSFDVRSVQNKLVYQILRGVEEDTSSSS  234

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPER-GPEGDVYEAGPLVVYDE--LRRSKRRFVQ  3318
               + +AV+F+++N V  PI+IQF PD      P+ D+ EAGP    D   LRRSKRR VQ
Sbjct  235   HSNLHAVNFRVDNGVLLPIVIQFLPDDSNMIVPKCDIDEAGPSPFSDSIGLRRSKRRNVQ  294

Query  3317  PERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSI--------QADHAYQNGDID  3162
             PER+LGCD   +E D+   R    ++ + E +E+ + LS            H  +   + 
Sbjct  295   PERFLGCDSG-SEIDIGYVRSRPYRVDRGEDDEMNLPLSCLFGVKAICDKPHTDKPHTVQ  353

Query  3161  NKTLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIVPLQLSAENNLFDQKENP  2982
              K     ++     +         K  ++ KR   D+  LAIVP         F ++ +P
Sbjct  354   GKKRGRPRKIDFCVNQRESEITERKEKSSGKRRKEDQCELAIVP---------FTEQTDP  404

Query  2981  LSFE-------DNEDLSAEIREIVSKYIYVNGSSAVEMKK--SSLNLMQGRRWGQVKVSK  2829
             LSFE       +  D   E+ EI  +  Y+N S+ V+ K    S +L     W      K
Sbjct  405   LSFEYYQFQARNPPDHEKELDEISPELFYINSSAKVKKKSSYDSEDLDIDTTWETRSFKK  464

Query  2828  LKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANID  2649
                             K  +KKR+   +  S    R ++K S+SA  Y ELI   + NID
Sbjct  465   ----------------KPVSKKRSHFVRFKSSSGERIYQKRSLSAGAYTELINEYLQNID  508

Query  2648  ETLNKEQPPIIDQWKEFQ-NTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLL  2472
              T  KE+PPI +QWKE +  T +      E      EEE+SE+DMLWKEMELALAS Y+L
Sbjct  509   CT-GKEEPPITEQWKENKKTTDNLYPSNTEVPLEEEEEEMSEIDMLWKEMELALASIYVL  567

Query  2471  DDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPST  2292
             D+ E +N  S+ +     K     C HD++++EE+G++C +CG V TEIKDV PPF+  T
Sbjct  568   DENEGSNGVSSAK----AKASNGGCLHDYKVDEELGVLCVICGFVLTEIKDVSPPFVQQT  623

Query  2291  CSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRA  2112
               +S  +   EE +     GD A LD    P S + P +E +  +N WALIP++R KL  
Sbjct  624   NWNSDDKNFNEEDLDHGPDGD-AKLDFKNNPDSPDDPLTEGQ--ENVWALIPEVRRKLHL  680

Query  2111  HQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGS  1932
             HQ++AFEFLW+NIAGS+ P  ++  SKK GGCVISHSPGAGKT LIIAFL SYLKLFPG+
Sbjct  681   HQKKAFEFLWQNIAGSLEPDLMEKSSKKTGGCVISHSPGAGKTFLIIAFLSSYLKLFPGT  740

Query  1931  RPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMH  1755
             RPLVLAPKTTLYTWYKE IKWKIP+PVY IHG +TY+  V R+K  + PG P    DV H
Sbjct  741   RPLVLAPKTTLYTWYKEFIKWKIPVPVYLIHGRRTYR--VFRKKSVVFPGAPMPTDDVRH  798

Query  1754  VLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNP  1575
             +LDCLEK+QKW +HPSVL+MGYTSFL L RE+S +AHRK+M +VLR+ PGIL+LDEGHNP
Sbjct  799   ILDCLEKIQKWHSHPSVLVMGYTSFLALMRENSKFAHRKFMAKVLRESPGILVLDEGHNP  858

Query  1574  RSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKR  1395
             RSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+F++EVLK LDPKYK++
Sbjct  859   RSTKSRLRKVLMKVETELRILLSGTLFQNNFCEYFNTLCLARPKFINEVLKALDPKYKRK  918

Query  1394  VKGAKTRFS--LENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSD  1221
              K    +    +E RARK F+D I++KIDS+  +ER +GLN+L+K+T GFIDVYE G SD
Sbjct  919   KKKLAEKARNLMEARARKFFLDTIARKIDSNVGKERMKGLNMLRKITNGFIDVYESGGSD  978

Query  1220  NLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSG  1041
             +LPGLQ YTL+M ST  Q +ILVKL      Y G+PLELELLITLG+IHPWL++T+ C+ 
Sbjct  979   SLPGLQIYTLLMNSTDKQHDILVKLHQIMSTYNGYPLELELLITLGSIHPWLVKTSLCAN  1038

Query  1040  QYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFER  861
             ++F +EEL  L+K+K+DLK GSKVKFV++L+ R +++ EK+LIFCHNIAP+ LF E+FE 
Sbjct  1039  KFFSDEELMELDKYKYDLKRGSKVKFVLNLVYR-VVKTEKILIFCHNIAPVRLFQELFEH  1097

Query  860   FYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVIL  681
              +GW++G EVL L GD+ELFERGRVMDKFEE GG ++V+LASIT CAEGISLTAASRVI+
Sbjct  1098  VFGWQRGREVLALTGDLELFERGRVMDKFEEPGGAARVLLASITACAEGISLTAASRVIM  1157

Query  680   LDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDL  501
             LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY+RTTWKEWVSSMIFSE  
Sbjct  1158  LDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYRRTTWKEWVSSMIFSEAF  1217

Query  500   VEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             VEDPS WQA KIED++L EIVEEDR   FHMIMKNEKAS + R
Sbjct  1218  VEDPSRWQAEKIEDDILREIVEEDRTKSFHMIMKNEKASTVIR  1260



>ref|XP_008454843.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Cucumis 
melo]
 ref|XP_008454845.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Cucumis 
melo]
 ref|XP_008454846.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Cucumis 
melo]
 ref|XP_008454847.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Cucumis 
melo]
Length=1263

 Score =  1186 bits (3067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 674/1300 (52%), Positives = 875/1300 (67%), Gaps = 68/1300 (5%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +++ +HPF+ YPFEA   GSWQ VE+IRI+NG   +H++++  ++ E    S+ R+R
Sbjct  5     KRRVYEFKHPFNDYPFEAMCCGSWQAVEKIRIRNGLITLHLVNDQFMVLERGPYSDFRVR  64

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR ATSSDC CFLRPG+D+ V S+ H  E+ D +        P+P WIDAKI SIER+PH
Sbjct  65    SRQATSSDCTCFLRPGVDVCVLSSSHNMENLDMQG-------PQPVWIDAKISSIERRPH  117

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
               GC CQF++ +Y    P    K +L KEI  + ++QI+ILQ++ +  CE +YYRW  S+
Sbjct  118   QAGCSCQFYVQLYADSKPLGSEKGSLCKEIVEMGIDQISILQRVRKNFCEGQYYRWDCSE  177

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             D S L K KL  GKF SDLSW++V SA K V FDV+S+ N+I+Y++L+      +  SE 
Sbjct  178   DSSLLPKTKLLLGKFLSDLSWLIVTSALKHVTFDVRSLDNKILYQVLESNQKSTSVTSEK  237

Query  3482  HSYAVSFKLENEVSTPIIIQFN-PDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQPE  3312
               + V+F+ ++ +  PII Q +  D  E  P    ++       D  +LRRSKRR VQP+
Sbjct  238   ILHTVNFRDDDGMLIPIIHQLDTSDNIEIPPAEHAFDNRLHSFTDPVDLRRSKRRNVQPD  297

Query  3311  RYLGCDDY-LTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTLACYQQ  3135
             R+LGCD    +E D   TR+        +   LP+A       +     I+N++      
Sbjct  298   RFLGCDSLDESEIDYSGTRIYKNDQLNDDEMTLPLACLFGTPVSSSKLKIENES----NH  353

Query  3134  ElrdnsllsrnrnssksDTNRKRVSG------DKAHLAIVPLQLSAENNLFDQKENPLSF  2973
                  S+            + +  SG      DK  LAIVPL L  +    D   N  + 
Sbjct  354   HSNKVSVHDDLSVFKNRIKSLEMKSGMSDEVEDKNQLAIVPL-LDEQPIASDPYPNVANS  412

Query  2972  EDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRRWGQVKVSKLKFMGLDVkggg  2793
               N   + +I E+ + Y Y+N  S                    K+ K KF         
Sbjct  413   CGN--YTKQITEMSATYYYINNKS--------------------KIRKRKFSDFQDVDFE  450

Query  2792  igsskkkakKRTCPSQRDSIYDI----------RSFRKGSISANVYRELIRRCMANIDET  2643
                   +AK  +   +R S + I          R ++K S+SA  Y++LI   + NID T
Sbjct  451   NDIDSCRAKASSSKGRRPSYHSISYKEDGHPKERQWQKRSLSAGAYKDLINSFLKNIDST  510

Query  2642  LNKEQPPIIDQWKEFQNTKSCQREPIekss--tnneeelseLDMLWKEMELALASCYLLD  2469
             + KE+P IIDQWKEF+N KSC  + IE        EEE SE++MLW+EME++LAS YL+D
Sbjct  511   IKKEEPQIIDQWKEFKN-KSCLDKKIEMEMPSNEKEEESSEIEMLWREMEISLASSYLID  569

Query  2468  DTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTC  2289
               +  +  ++ E     +K ++ C H+F+LNEEIG++C +CG VSTEIKDV  PFM    
Sbjct  570   ANQGFSNGTSVE---PEQKPSKWCKHEFKLNEEIGMLCHICGFVSTEIKDVSAPFMQHM-  625

Query  2288  SSSGKEQRPEEVVMEEKQGDDADLDHFA-IPVSSNKPSSEVEVEDNAWALIPDLRNKLRA  2112
             S S +E+R EE   E    ++ +++ F+ +P S +  S E    DN WALIP+ RNKL  
Sbjct  626   SWSTEERRIEEKDTEHNSDEEEEMNIFSGLPSSDDTLSEE---NDNVWALIPEFRNKLHI  682

Query  2111  HQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGS  1932
             HQ++AFEFLWKNIAGS++P  +D  ++K GGCVISH+PGAGKT LII+FLVSYLKLFPG 
Sbjct  683   HQKKAFEFLWKNIAGSMVPALMDQATRKIGGCVISHTPGAGKTFLIISFLVSYLKLFPGK  742

Query  1931  RPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHV  1752
             RPLVLAPKTTLYTWYKE IKW++P+P++ IHG +TY+      K     G     DVMH+
Sbjct  743   RPLVLAPKTTLYTWYKEFIKWEVPVPIHLIHGRRTYRVFRANSKPVTFAGPRPTDDVMHI  802

Query  1751  LDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPR  1572
             LDCLEK++KW AHPSVL+MGYTSFLTL RED+ +AHRKYM +VLRQ PGILILDEGHNPR
Sbjct  803   LDCLEKIKKWHAHPSVLVMGYTSFLTLMREDAKFAHRKYMAKVLRQSPGILILDEGHNPR  862

Query  1571  STKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRV  1392
             STKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV+EVLK+LDPK+K++ 
Sbjct  863   STKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVNEVLKKLDPKFKRKK  922

Query  1391  KGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLP  1212
             K A      E RARK F+DKI++KID+  E +R++GLN+L+ +T GFIDVYEGGS D LP
Sbjct  923   KKAP--HLQEARARKFFLDKIARKIDAGDEEDRRDGLNMLRNMTGGFIDVYEGGSKDGLP  980

Query  1211  GLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYf  1032
             GLQ YTL+M +T +QQEIL KL      + G+PLELELLITLG+IHPWL++T  C+ ++F
Sbjct  981   GLQIYTLLMNTTDIQQEILNKLHKIMAQFPGYPLELELLITLGSIHPWLVKTAVCANKFF  1040

Query  1031  keeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYG  852
              + E+  L+++KFDL+ GSKV FV++L+ R +++KEK+LIFCHNIAP+ LF+E+FE  + 
Sbjct  1041  TDREMMELDRYKFDLRKGSKVMFVLNLVYR-VVKKEKILIFCHNIAPVRLFVELFENVFR  1099

Query  851   WRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDS  672
             W++G E+L L GD+ELFERG+VMDKFE+  GPSKV+LASIT CAEGISLTAASRVILLDS
Sbjct  1100  WKRGREILALTGDLELFERGKVMDKFEDPVGPSKVLLASITACAEGISLTAASRVILLDS  1159

Query  671   EWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVED  492
             EWNPSK+KQAIARAFRPGQ KVVYVYQLL TGTLEE+KYKRTTWKEWVSSMIFSE  VED
Sbjct  1160  EWNPSKTKQAIARAFRPGQLKVVYVYQLLVTGTLEEDKYKRTTWKEWVSSMIFSEAFVED  1219

Query  491   PSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             PS WQA KIED++L E+VEEDR   FHMIMKNEKAS + R
Sbjct  1220  PSKWQAEKIEDDVLREMVEEDRVKSFHMIMKNEKASTVIR  1259



>ref|XP_006435819.1| hypothetical protein CICLE_v10033966mg [Citrus clementina]
 ref|XP_006486250.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006486251.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486252.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X3 [Citrus sinensis]
 ref|XP_006486253.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X4 [Citrus sinensis]
 ref|XP_006486254.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X5 [Citrus sinensis]
 gb|ESR49059.1| hypothetical protein CICLE_v10033966mg [Citrus clementina]
Length=1299

 Score =  1186 bits (3067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/1334 (51%), Positives = 888/1334 (67%), Gaps = 99/1334 (7%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             +RR ++Q++HPFD +PFEAF + SW+ +E IRI++GT  MH+ D     EE    SN+RI
Sbjct  3     RRRHLYQSKHPFDDHPFEAFFDDSWRTLELIRIEDGTMTMHLKDNQCYTEERRPFSNLRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR ATSSDC CFLRPG+D+ V S    +E SDEEN        EP W+DAKI SIERKP
Sbjct  63    RSRKATSSDCTCFLRPGIDVCVLSASQDAESSDEENE-------EPVWVDAKISSIERKP  115

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             H   C CQ ++  Y+  GP    +  LSKE K+V ++QI ILQK+ +  CED+YYRW+ S
Sbjct  116   HEGQCSCQLYVKFYINPGPLGSERGALSKETKLVGIDQITILQKLGRDACEDQYYRWNFS  175

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSE  3486
             +DCS+LQK KL  GKF SDLS++LVAS  KQ  FD++SV  +IVY++L  ++D  +P+S 
Sbjct  176   EDCSSLQKTKLLLGKFSSDLSFLLVASVLKQTAFDIRSVQKKIVYQVLGSDDDNSSPDSI  235

Query  3485  YHSYAVSFKLENEVSTPIIIQF-NPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
              H  A++FK+E+ VST  + QF  PD  E    G   E G L +YD   LRRSKRR VQP
Sbjct  236   NHLNAINFKVEDGVSTSHLFQFIPPDTKEVSTAGGTEEVGLLPIYDVMNLRRSKRRNVQP  295

Query  3314  ERYLGCDDYLTEFDVEMTRLVGGKMYK------------------SELEELPMALSIQAD  3189
             +R++GCD    E D+   R+   K  K                  S L + P+  S+  +
Sbjct  296   DRFIGCD-IPPESDIGWVRMFPIKSDKWEEEEEEEAQEQELYLPLSHLLDGPLGSSLSEE  354

Query  3188  HAYQNGDIDNKTLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIVPLQLSAEN  3009
             +A              + E+R+           + +++  +     + LAIVP+    + 
Sbjct  355   NA--------------EVEIRNPIKRKSRSRLREMESSLTKEMDHASELAIVPVPTEGDP  400

Query  3008  NLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRR--------  2853
               F    +PL  +    LS +I E+  K+ Y+ GS +V  + S+ + ++GR         
Sbjct  401   LAF--YPDPLPSKTPSYLSRKINEVSPKF-YLKGSHSVR-RCSTSHSVRGRNTSHSVQRR  456

Query  2852  ------------WGQVKVSKLKFMGLDVkggg------------igsskkkakKRTCPSQ  2745
                         W + KVS  K  G +V                     K  K R    +
Sbjct  457   TTSEFEDKELDDWWEEKVSNKKVQGENVLEVEDMGLERRSWGRPSNKKVKSNKYRPVSLK  516

Query  2744  RDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREP  2568
                  +  + +K ++SA  +  LI   M NID T+  E+P ++DQW EF+  KS  Q   
Sbjct  517   SQEFSEKGTHKKSTLSAVAFNRLINSYMKNIDSTITDEEPNVVDQWNEFKAAKSSEQTME  576

Query  2567  IeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHD  2388
             I++SS+ NE E+SE + LWKEMELA+A  Y+L+D E +N   ++E     +  + VC H+
Sbjct  577   IDESSSENESEVSENEPLWKEMELAMAEAYILEDNEGSNAGLSSE---DPQISSIVCQHE  633

Query  2387  FRLNEEIGLVCRLCGVVSTEIKDVPPPFM-PSTCSSSGKEQRPEEVVMEEKQGDDADLDH  2211
             F L+EEIG++C +CG V TEIK V P F+ P +  +S K    E+     + G D++   
Sbjct  634   FTLDEEIGILCPICGFVKTEIKYVTPAFLEPKSWITSNKVDNEEDT----EHGLDSNE--  687

Query  2210  FAIPVSSNKPSSEV---EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP  2040
               + +  N  SS++      DN WALIP+L+ KL  HQ++AFEFLW+NIAGS++P  +D 
Sbjct  688   -GLNLCCNLASSDILSPNENDNVWALIPELKMKLHLHQKKAFEFLWRNIAGSLVPASMDA  746

Query  2039  ESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIP  1860
             ESK  GGCVISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTW+KE IKWKIP
Sbjct  747   ESKNTGGCVISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWHKEFIKWKIP  806

Query  1859  IPVYQIHGGQTYKGEVLRQKM--KLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYT  1686
             +PV+ IHG +TY+  V RQK       G+    DVMHVLDCLEK+QKW A PS+L+MGYT
Sbjct  807   LPVHLIHGRRTYR--VFRQKRISSFKGGVRPTLDVMHVLDCLEKIQKWHAQPSILVMGYT  864

Query  1685  SFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
             SFLTL RED+ +AHRKYM +VLR+ PGI++LDEGHNPRSTKSRLRKALMKV T  R+LLS
Sbjct  865   SFLTLIREDAKFAHRKYMAKVLRESPGIVVLDEGHNPRSTKSRLRKALMKVETDQRVLLS  924

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GTLFQNNF EYFNTLCLARP+F+ EVL+ELD  +K++    K    LE+RARK F+D I+
Sbjct  925   GTLFQNNFCEYFNTLCLARPKFIHEVLRELDQNFKRKKMRMKNPRQLESRARKFFVDTIA  984

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKL  1146
             +KI+S    ER +GLN+L+ +T+GFIDVYEGG+SDNLPGLQ YTL+M ST +Q E+L KL
Sbjct  985   RKINSDDGEERIQGLNMLRNITSGFIDVYEGGASDNLPGLQIYTLLMNSTEVQVEVLEKL  1044

Query  1145  QDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVK  966
             Q     Y G+PLELELLITL AIHPWL++T+ C  ++F  + L  LEK K++++ GSKV 
Sbjct  1045  QKIMSTYNGYPLELELLITLAAIHPWLVKTSNCVNKFFDLKALARLEKHKYEIRKGSKVM  1104

Query  965   FVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRV  786
             FV++L+ R ++++EKVL+FCHNIAPI LF E+FE+ + W++G E+L+L GDIELFERGR+
Sbjct  1105  FVLNLVHR-VIKQEKVLMFCHNIAPIMLFAELFEKIFRWQRGREILILTGDIELFERGRI  1163

Query  785   MDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKV  606
             MDKFEE  GPS++++ASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ K+
Sbjct  1164  MDKFEEPSGPSRILIASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKM  1223

Query  605   VYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
             VYVYQLLA+GTLEE+KY+RTTWKEWVS MIFSE+LVEDPS WQA K+ED++L EIV  DR
Sbjct  1224  VYVYQLLASGTLEEDKYRRTTWKEWVSRMIFSEELVEDPSRWQAEKMEDDVLREIVAADR  1283

Query  425   ATLFHMIMKNEKAS  384
                FHMIMKNEKAS
Sbjct  1284  MKSFHMIMKNEKAS  1297



>gb|KGN50700.1| hypothetical protein Csa_5G217680 [Cucumis sativus]
Length=1264

 Score =  1180 bits (3052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/1301 (51%), Positives = 872/1301 (67%), Gaps = 69/1301 (5%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +++ +HPF+ YPFEA   GSWQ VE+IRI+NG   +H++++  ++ E    S+ R+R
Sbjct  5     KRRVYEFKHPFNDYPFEAMCCGSWQAVEKIRIRNGLITLHLVNDQFMVLERGPYSDFRVR  64

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR ATSSDC CFLRPG+D+ V S  +  E+ D          P+P WIDAKI SI+R+PH
Sbjct  65    SRQATSSDCTCFLRPGVDVCVLSFSNNMENLDM-------QSPQPVWIDAKISSIKRRPH  117

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
               GC CQF++ +Y    P    K +L KEI  + ++QI+ILQ++ +  CE ++YRW  S+
Sbjct  118   QAGCSCQFYVQLYADSKPLGSEKGSLCKEIVEMGIDQISILQRVRKNICEGQFYRWDCSE  177

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             D S L K KL  GKF SDLSW++V SA K V FDV S+ N+I+Y++L+      +  S+ 
Sbjct  178   DSSLLPKTKLLLGKFLSDLSWLIVTSALKHVTFDVISLDNKILYQVLEINQKSTSVTSDK  237

Query  3482  HSYAVSFKLENEVSTPIIIQFN-PDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQPE  3312
               + V+F+ ++    PII Q +  D  E  P  D ++     + D  +LRRSKRR VQP 
Sbjct  238   ILHTVNFRDDDGRLIPIIHQLDTSDNIEILPGEDAFDNQLRSITDPVDLRRSKRRNVQPV  297

Query  3311  RYLGCDDY-LTEFDVEMTRLVGGKMYKSELEE-LPMALSIQADHAYQNGDIDNKTLACYQ  3138
             R+LGCD    +E D   TR+        + E  LP+A             I+N++     
Sbjct  298   RFLGCDSIDESEIDYSGTRIYKNDQLNDDDEMILPLAYLFGTPVGSSKQKIENES----N  353

Query  3137  QElrdnsllsrnrnssksDTNRKRVSG------DKAHLAIVPLQLSAENNLFDQKENPLS  2976
              +    S+            + +  SG      DK  LAIVP+ L  +    D   N  +
Sbjct  354   HDSNKLSVHDDLSVFKSRIKSLEMKSGMSDELEDKNQLAIVPI-LDEQPIASDPYPNVAN  412

Query  2975  FEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRRWGQVKVSKLKFMGLDVkgg  2796
                N   + +I E+ S Y Y+N  S                    K+ K KF        
Sbjct  413   SCGN--YTKQITEMSSTYYYINNKS--------------------KIRKRKFSDFQDVDF  450

Query  2795  gigsskkkakKRTCPSQRDSIYDI----------RSFRKGSISANVYRELIRRCMANIDE  2646
                    + K  +   +R S + I          R ++K S+SA  Y++LI   + NID 
Sbjct  451   ENDIDSCRGKASSSKGRRPSYHSISYKENGHPKERPWQKRSLSAGAYKDLINSFLKNIDS  510

Query  2645  TLNKEQPPIIDQWKEFQNTKSCQREPIekss--tnneeelseLDMLWKEMELALASCYLL  2472
             T+ K++P IIDQWKEF+N KSC  + IE        EEE SE++MLW+EME++LAS YL+
Sbjct  511   TIKKDEPQIIDQWKEFKN-KSCLDKKIEMEMPSNEKEEESSEIEMLWREMEISLASSYLI  569

Query  2471  DDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPST  2292
             D  +  +  ++ E     +K ++ C H+F+LNEEIG++C +CG VSTEIKDV  PFM   
Sbjct  570   DANQGFSNGTSME---PEQKPSKWCKHEFKLNEEIGMLCHICGFVSTEIKDVSAPFMQHM  626

Query  2291  CSSSGKEQRPEEVVMEEKQGDDADLDHFA-IPVSSNKPSSEVEVEDNAWALIPDLRNKLR  2115
               S+ +E+R EE   E    ++ +++ F+ +P S +  S E    DN WALIP+ RNKL 
Sbjct  627   GWST-EERRTEEKDPEHNSDEEEEMNIFSGLPSSDDTLSEE---NDNVWALIPEFRNKLH  682

Query  2114  AHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPG  1935
              HQ++AFEFLWKN+AGS++P  +D  ++K GGCVISH+PGAGKT LII+FLVSYLKLFPG
Sbjct  683   LHQKKAFEFLWKNVAGSMVPALMDQATRKIGGCVISHTPGAGKTFLIISFLVSYLKLFPG  742

Query  1934  SRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMH  1755
              RPLVLAPKTTLYTWYKE IKW++P+P++ IHG +TY+      K     G     DVMH
Sbjct  743   KRPLVLAPKTTLYTWYKEFIKWEVPVPIHLIHGRRTYRVFRANSKPVTFAGPRPTDDVMH  802

Query  1754  VLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNP  1575
             +LDCLEK++KW AHPSVL+MGYTSFLTL RED+ +AHRKYM +VLRQ PGILILDEGHNP
Sbjct  803   ILDCLEKIKKWHAHPSVLVMGYTSFLTLMREDAKFAHRKYMAKVLRQSPGILILDEGHNP  862

Query  1574  RSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKR  1395
             RSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV+EVLK+LDPK++++
Sbjct  863   RSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVNEVLKKLDPKFQRK  922

Query  1394  VKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNL  1215
              K  K     E RARK F+DKI++KID+  E +R++GLN+L+ +T GFIDVYEGGS D L
Sbjct  923   KK--KAPHLQEARARKFFLDKIARKIDAGDEEDRRDGLNMLRNMTGGFIDVYEGGSKDGL  980

Query  1214  PGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQY  1035
             PGLQ YTL+M +T +QQEIL KL      + G+PLELELLITLG+IHPWL++T  C+ ++
Sbjct  981   PGLQIYTLLMNTTDIQQEILNKLHKIMAQFPGYPLELELLITLGSIHPWLVKTAVCANKF  1040

Query  1034  fkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFY  855
             F + E+  L+K+KFDL+ GSKV FV++L+ R +++KEK+LIFCHNIAP+ LF+E+FE  +
Sbjct  1041  FTDREMMELDKYKFDLRKGSKVMFVLNLVYR-VVKKEKILIFCHNIAPVRLFVELFENVF  1099

Query  854   GWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLD  675
              W++G E+L L GD+ELFERG+VMDKFE+  GPSKV+LASIT CAEGISLTAASRVILLD
Sbjct  1100  RWKRGREILALTGDLELFERGKVMDKFEDPVGPSKVLLASITACAEGISLTAASRVILLD  1159

Query  674   SEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE  495
             SEWNPSK+KQAIARAFRPGQ KVVYVYQLL TGTLEE+KYKRTTWKEWVSSMIFSE  VE
Sbjct  1160  SEWNPSKTKQAIARAFRPGQLKVVYVYQLLVTGTLEEDKYKRTTWKEWVSSMIFSEAFVE  1219

Query  494   DPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             DPS WQA KIEDE+L E+VEEDR   FHMIMKNEKAS + R
Sbjct  1220  DPSKWQAEKIEDEVLREMVEEDRVKSFHMIMKNEKASTVIR  1260



>ref|XP_004146461.1| PREDICTED: uncharacterized protein LOC101215377 [Cucumis sativus]
Length=1252

 Score =  1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/1301 (51%), Positives = 868/1301 (67%), Gaps = 81/1301 (6%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +++ +HPF+ YPFEA   GSWQ VE+IRI+NG   +H++++  ++ E    S+ R+R
Sbjct  5     KRRVYEFKHPFNDYPFEAMCCGSWQAVEKIRIRNGLITLHLVNDQFMVLERGPYSDFRVR  64

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR ATSSDC CFLRPG+D+ V S  +  E+ D          P+P WIDAKI SI+R+PH
Sbjct  65    SRQATSSDCTCFLRPGVDVCVLSFSNNMENLDM-------QSPQPVWIDAKISSIKRRPH  117

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
               GC CQF++ +Y    P    K +L KEI  + ++QI+ILQ++ +  CE ++YRW  S+
Sbjct  118   QAGCSCQFYVQLYADSKPLGSEKGSLCKEIVEMGIDQISILQRVRKNICEGQFYRWDCSE  177

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             D S L K KL  GKF SDLSW++V SA K V FDV S+ N+I+Y++L+      +  S+ 
Sbjct  178   DSSLLPKTKLLLGKFLSDLSWLIVTSALKHVTFDVISLDNKILYQVLEINQKSTSVTSDK  237

Query  3482  HSYAVSFKLENEVSTPIIIQFN-PDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQPE  3312
               + V+F+ ++    PII Q +  D  E  P  D ++     + D  +LRRSKRR VQP 
Sbjct  238   ILHTVNFRDDDGRLIPIIHQLDTSDNIEILPGEDAFDNQLRSITDPVDLRRSKRRNVQPV  297

Query  3311  RYLGCDDY-LTEFDVEMTRLVGGKMYKSELEE-LPMALSIQADHAYQNGDIDNKTLACYQ  3138
             R+LGCD    +E D   TR+        + E  LP+A             I+N++     
Sbjct  298   RFLGCDSIDESEIDYSGTRIYKNDQLNDDDEMILPLAYLFGTPVGSSKQKIENES----N  353

Query  3137  QElrdnsllsrnrnssksDTNRKRVSG------DKAHLAIVPLQLSAENNLFDQKENPLS  2976
              +    S+            + +  SG      DK  LAIVP+ L  +    D   N  +
Sbjct  354   HDSNKLSVHDDLSVFKSRIKSLEMKSGMSDELEDKNQLAIVPI-LDEQPIASDPYPNVAN  412

Query  2975  FEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRRWGQVKVSKLKFMGLDVkgg  2796
                N   + +I E+ S Y Y+N  S                    K+ K KF        
Sbjct  413   SCGN--YTKQITEMSSTYYYINNKS--------------------KIRKRKFSDFQDVDF  450

Query  2795  gigsskkkakKRTCPSQRDSIYDI----------RSFRKGSISANVYRELIRRCMANIDE  2646
                    + K  +   +R S + I          R ++K S+SA  Y++LI   + NID 
Sbjct  451   ENDIDSCRGKASSSKGRRPSYHSISYKENGHPKERPWQKRSLSAGAYKDLINSFLKNIDS  510

Query  2645  TLNKEQPPIIDQWKEFQNTKSCQREPIekss--tnneeelseLDMLWKEMELALASCYLL  2472
             T+ K++P IIDQWKEF+N KSC  + IE        EEE SE++MLW+EME++LAS YL+
Sbjct  511   TIKKDEPQIIDQWKEFKN-KSCLDKKIEMEMPSNEKEEESSEIEMLWREMEISLASSYLI  569

Query  2471  DDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPST  2292
             D               A +K ++ C H+F+LNEEIG++C +CG VSTEIKDV  PFM   
Sbjct  570   D---------------ANQKPSKWCKHEFKLNEEIGMLCHICGFVSTEIKDVSAPFMQHM  614

Query  2291  CSSSGKEQRPEEVVMEEKQGDDADLDHFA-IPVSSNKPSSEVEVEDNAWALIPDLRNKLR  2115
               S+ +E+R EE   E    ++ +++ F+ +P S +  S E    DN WALIP+ RNKL 
Sbjct  615   GWST-EERRTEEKDPEHNSDEEEEMNIFSGLPSSDDTLSEE---NDNVWALIPEFRNKLH  670

Query  2114  AHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPG  1935
              HQ++AFEFLWKN+AGS++P  +D  ++K GGCVISH+PGAGKT LII+FLVSYLKLFPG
Sbjct  671   LHQKKAFEFLWKNVAGSMVPALMDQATRKIGGCVISHTPGAGKTFLIISFLVSYLKLFPG  730

Query  1934  SRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMH  1755
              RPLVLAPKTTLYTWYKE IKW++P+P++ IHG +TY+      K     G     DVMH
Sbjct  731   KRPLVLAPKTTLYTWYKEFIKWEVPVPIHLIHGRRTYRVFRANSKPVTFAGPRPTDDVMH  790

Query  1754  VLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNP  1575
             +LDCLEK++KW AHPSVL+MGYTSFLTL RED+ +AHRKYM +VLRQ PGILILDEGHNP
Sbjct  791   ILDCLEKIKKWHAHPSVLVMGYTSFLTLMREDAKFAHRKYMAKVLRQSPGILILDEGHNP  850

Query  1574  RSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKR  1395
             RSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV+EVLK+LDPK++++
Sbjct  851   RSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVNEVLKKLDPKFQRK  910

Query  1394  VKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNL  1215
              K  K     E RARK F+DKI++KID+  E +R++GLN+L+ +T GFIDVYEGGS D L
Sbjct  911   KK--KAPHLQEARARKFFLDKIARKIDAGDEEDRRDGLNMLRNMTGGFIDVYEGGSKDGL  968

Query  1214  PGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQY  1035
             PGLQ YTL+M +T +QQEIL KL      + G+PLELELLITLG+IHPWL++T  C+ ++
Sbjct  969   PGLQIYTLLMNTTDIQQEILNKLHKIMAQFPGYPLELELLITLGSIHPWLVKTAVCANKF  1028

Query  1034  fkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFY  855
             F + E+  L+K+KFDL+ GSKV FV++L+ R +++KEK+LIFCHNIAP+ LF+E+FE  +
Sbjct  1029  FTDREMMELDKYKFDLRKGSKVMFVLNLVYR-VVKKEKILIFCHNIAPVRLFVELFENVF  1087

Query  854   GWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLD  675
              W++G E+L L GD+ELFERG+VMDKFE+  GPSKV+LASIT CAEGISLTAASRVILLD
Sbjct  1088  RWKRGREILALTGDLELFERGKVMDKFEDPVGPSKVLLASITACAEGISLTAASRVILLD  1147

Query  674   SEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE  495
             SEWNPSK+KQAIARAFRPGQ KVVYVYQLL TGTLEE+KYKRTTWKEWVSSMIFSE  VE
Sbjct  1148  SEWNPSKTKQAIARAFRPGQLKVVYVYQLLVTGTLEEDKYKRTTWKEWVSSMIFSEAFVE  1207

Query  494   DPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             DPS WQA KIEDE+L E+VEEDR   FHMIMKNEKAS + R
Sbjct  1208  DPSKWQAEKIEDEVLREMVEEDRVKSFHMIMKNEKASTVIR  1248



>ref|XP_004171552.1| PREDICTED: uncharacterized LOC101215377 [Cucumis sativus]
Length=1252

 Score =  1178 bits (3047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/1301 (51%), Positives = 867/1301 (67%), Gaps = 81/1301 (6%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +++ +HPF+ YPFEA   GSWQ VE+IRI+NG   +H++++  ++ E    S+ R+R
Sbjct  5     KRRVYEFKHPFNDYPFEAMCCGSWQAVEKIRIRNGLITLHLVNDQFMVLERGPYSDFRVR  64

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR ATSSDC CFLRPG+D+ V S  +  E+ D          P+P WIDAKI SI+R+PH
Sbjct  65    SRQATSSDCTCFLRPGVDVCVLSFSNNMENLDM-------QSPQPVWIDAKISSIKRRPH  117

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
               GC CQF++ +Y    P    K +L KEI  + ++QI+ILQ++ +  CE ++YRW  S+
Sbjct  118   QAGCSCQFYVQLYADSKPLGSEKGSLCKEIVEMGIDQISILQRVRKNICEGQFYRWDCSE  177

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             D S L K KL  GKF SDLSW++V SA K V FDV S+ N+I+Y++L+      +  S+ 
Sbjct  178   DSSLLPKTKLLLGKFLSDLSWLIVTSALKHVTFDVISLDNKILYQVLEINQKSTSVTSDK  237

Query  3482  HSYAVSFKLENEVSTPIIIQFN-PDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQPE  3312
               + V+F+ ++    PII Q +  D  E  P  D ++     + D  +LRRSKRR VQP 
Sbjct  238   ILHTVNFRDDDGRLIPIIHQLDTSDNIEILPGEDAFDNQLRSITDPVDLRRSKRRNVQPV  297

Query  3311  RYLGCDDY-LTEFDVEMTRLVGGKMYKSELEE-LPMALSIQADHAYQNGDIDNKTLACYQ  3138
             R+LGCD    +E D   TR+        + E  LP+A             I+N++     
Sbjct  298   RFLGCDSIDESEIDYSGTRIYKNDQLNDDDEMILPLAYLFGTPVGSSKQKIENES----N  353

Query  3137  QElrdnsllsrnrnssksDTNRKRVSG------DKAHLAIVPLQLSAENNLFDQKENPLS  2976
              +    S+            + +  SG      DK  LAIVP+ L  +    D   N  +
Sbjct  354   HDSNKLSVHDDLSVFKSRIKSLEMKSGMSDELEDKNQLAIVPI-LDEQPIASDPYPNVAN  412

Query  2975  FEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRRWGQVKVSKLKFMGLDVkgg  2796
                N   + +I E+ S Y Y+N  S                    K+ K KF        
Sbjct  413   SCGN--YTKQITEMSSTYYYINNKS--------------------KIRKRKFSDFQDVDF  450

Query  2795  gigsskkkakKRTCPSQRDSIYDI----------RSFRKGSISANVYRELIRRCMANIDE  2646
                    + K  +   +R S + I          R ++K S+SA  Y++LI   + NID 
Sbjct  451   ENDIDSCRGKASSSKGRRPSYHSISYKENGHPKERPWQKRSLSAGAYKDLINSFLKNIDS  510

Query  2645  TLNKEQPPIIDQWKEFQNTKSCQREPIekss--tnneeelseLDMLWKEMELALASCYLL  2472
             T+ K++P IIDQWKEF+N KSC  + IE        EEE SE++MLW+EME++LAS YL+
Sbjct  511   TIKKDEPQIIDQWKEFKN-KSCLDKKIEMEMPSNEKEEESSEIEMLWREMEISLASSYLI  569

Query  2471  DDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPST  2292
             D               A +K ++ C H+F+LNEEIG++C +CG VSTEIKDV  PFM   
Sbjct  570   D---------------ANQKPSKWCKHEFKLNEEIGMLCHICGFVSTEIKDVSAPFMQHM  614

Query  2291  CSSSGKEQRPEEVVMEEKQGDDADLDHFA-IPVSSNKPSSEVEVEDNAWALIPDLRNKLR  2115
               S+ +E+R EE   E    ++ +++ F+ +P S +  S E    DN WALIP+ RNKL 
Sbjct  615   GWST-EERRTEEKDPEHNSDEEEEMNIFSGLPSSDDTLSEE---NDNVWALIPEFRNKLH  670

Query  2114  AHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPG  1935
              HQ++AFEFLWKN+AGS++P  +D  ++K GGCVISH+PGAGKT LII+FLVSYLKLFPG
Sbjct  671   LHQKKAFEFLWKNVAGSMVPALMDQATRKIGGCVISHTPGAGKTFLIISFLVSYLKLFPG  730

Query  1934  SRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMH  1755
              RPLVLAPKTTLYTWYKE IKW++P+P++ IHG +TY+      K     G     DVMH
Sbjct  731   KRPLVLAPKTTLYTWYKEFIKWEVPVPIHLIHGRRTYRVFRANSKPVTFAGPRPTDDVMH  790

Query  1754  VLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNP  1575
             +LDCLEK++KW AHPSVL+MGYTSFLTL RED+ +AHRKYM +VLRQ PGILILDEGHNP
Sbjct  791   ILDCLEKIKKWHAHPSVLVMGYTSFLTLMREDAKFAHRKYMAKVLRQSPGILILDEGHNP  850

Query  1574  RSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKR  1395
             RSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+FV+EVLK+LDPK+++ 
Sbjct  851   RSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLARPKFVNEVLKKLDPKFQR-  909

Query  1394  VKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNL  1215
              K  K     E RARK F+DKI++KID+  E +R++GLN+L+ +T GFIDVYEGGS D L
Sbjct  910   -KKRKAPHLQEARARKFFLDKIARKIDAGDEEDRRDGLNMLRNMTGGFIDVYEGGSKDGL  968

Query  1214  PGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQY  1035
             PGLQ YTL+M +T +QQEIL KL      + G+PLELELLITLG+IHPWL++T  C+ ++
Sbjct  969   PGLQIYTLLMNTTDIQQEILNKLHKIMAQFPGYPLELELLITLGSIHPWLVKTAVCANKF  1028

Query  1034  fkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFY  855
             F + E+  L+K+KFDL+ GSKV FV++L+ R +++KEK+LIFCHNIAP+ LF+E+FE  +
Sbjct  1029  FTDREMMELDKYKFDLRKGSKVMFVLNLVYR-VVKKEKILIFCHNIAPVRLFVELFENVF  1087

Query  854   GWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLD  675
              W++G E+L L GD+ELFERG+VMDKFE+  GPSKV+LASIT CAEGISLTAASRVILLD
Sbjct  1088  RWKRGREILALTGDLELFERGKVMDKFEDPVGPSKVLLASITACAEGISLTAASRVILLD  1147

Query  674   SEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE  495
             SEWNPSK+KQAIARAFRPGQ KVVYVYQLL TGTLEE+KYKRTTWKEWVSSMIFSE  VE
Sbjct  1148  SEWNPSKTKQAIARAFRPGQLKVVYVYQLLVTGTLEEDKYKRTTWKEWVSSMIFSEAFVE  1207

Query  494   DPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             DPS WQA KIEDE+L E+VEEDR   FHMIMKNEKAS + R
Sbjct  1208  DPSKWQAEKIEDEVLREMVEEDRVKSFHMIMKNEKASTVIR  1248



>ref|XP_002312184.2| hypothetical protein POPTR_0008s07350g [Populus trichocarpa]
 gb|EEE89551.2| hypothetical protein POPTR_0008s07350g [Populus trichocarpa]
Length=1234

 Score =  1173 bits (3034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/1305 (51%), Positives = 863/1305 (66%), Gaps = 103/1305 (8%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ +HQ++HPF+ +PFEA   GSWQ VE I+I++G   +H +D    IEE+   SNVR
Sbjct  1     MKRKRLHQSKHPFNAHPFEALCCGSWQSVELIQIRDGAMTVHFVDGHHRIEEKGPFSNVR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR ATSSDC CFLRPG+D+ V S+  +++++        +   EP W+DAKI SI+RK
Sbjct  61    VKSRKATSSDCTCFLRPGIDVCVLSSSERAKNTG-------EGNSEPVWVDAKISSIKRK  113

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED-------  3690
             PH   C CQF +++YV QGP    +  LSKE + V +N+I++LQK++  PCE        
Sbjct  114   PHVSHCSCQFFVNLYVNQGPLGSERARLSKETEAVGINEISVLQKLDNDPCEADNNQQEA  173

Query  3689  KYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN  3510
             ++YRW   +DCS +Q+ KLF G+F +DL+W+LVAS  KQV F+V+SV N+IVY+IL  EN
Sbjct  174   QFYRWEFCEDCSLVQRSKLFLGRFSADLTWLLVASVLKQVEFNVRSVQNKIVYQILGGEN  233

Query  3509  DIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPD--IPERGPEGDV--YEAGPLVVYDELR  3342
             +  +  S  H   V+FK+++ +STP ++Q  P     E G   D    E  P      LR
Sbjct  234   EHCSLKSNNHINCVTFKVKDSISTPFVVQLVPTDACSEAGHISDTNGTEQSPCYDVMSLR  293

Query  3341  RSKRRFVQPERYLGCDDYLTEFDVEMTRLV-------GGKMYKSELEELPMALSIQADHA  3183
             RSKRR VQPER+L CD    E ++   R +         +  + E   LP+A  +   HA
Sbjct  294   RSKRRNVQPERFLACD-APAETEIGWVRSLPYTPLKWKAEEEEEEEMHLPLAY-LFGTHA  351

Query  3182  YQNGDIDNKTLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIVPLQLSAENNL  3003
                G  + K      +E++                NR+     +  LAIVP+        
Sbjct  352   ---GMANRKKHGTQIREVKSGV------------ANRRE---HQDQLAIVPVHTEDVLAT  393

Query  3002  FDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKS-SLNLMQGRRWGQVKVSKL  2826
             F+Q ++P+  +  E  S    E    Y     S A   K     +LM G  WG       
Sbjct  394   FEQFDSPV--KTPEPYSQAFIEFPISYYRKKSSPAAHRKNDRDEDLMFGNGWGG------  445

Query  2825  KFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDE  2646
             KF    V+             R+   ++D      ++++ ++SA  Y +LI   M NID 
Sbjct  446   KFSTKKVQRARY---------RSTHLKQDGSCAPMTYKRTALSAGAYNKLISSYMKNIDA  496

Query  2645  TL-NKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDMLWKEMELALASCYLL  2472
             T+ +KE P IIDQW+EF+   S  Q+E +E SS  ++ E SE +MLW+EMEL LAS Y+L
Sbjct  497   TIKSKEVPRIIDQWEEFKAKHSSDQKEKMEPSSVKDDGESSETEMLWREMELCLASAYIL  556

Query  2471  DDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPST  2292
             +D E                    C H+F+L+EEIG++C++CG V TEIK V  PFM  T
Sbjct  557   EDNEKN------------------CQHEFKLDEEIGILCQICGFVKTEIKYVSAPFMEHT  598

Query  2291  C-SSSGKEQRPEEVVM--EEKQGDDADLDHFA---IPVSSNKPSSEVEVEDNAWALIPDL  2130
               ++  K Q  E++ +  +E +G     +H +   +PVS        EV DN W LIP+L
Sbjct  599   GWTAESKPQNEEDLELKPDEDEGSSLFGNHTSGEDVPVS--------EVNDNVWDLIPEL  650

Query  2129  RNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYL  1950
             R KL  HQ++AFEFLWKN AGS++P  ++  SKK GGCV+SH+PGAGKT LIIAFLVSYL
Sbjct  651   RPKLHMHQKKAFEFLWKNTAGSLVPAHMEKTSKKIGGCVVSHTPGAGKTFLIIAFLVSYL  710

Query  1949  KLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGL-PR  1773
             KLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IHG  T      +Q      G  PR
Sbjct  711   KLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIHG--TRSSRAFKQTPAALRGSGPR  768

Query  1772  -NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILI  1596
              +QDV+H+LDCLEKMQKW A PSVL+MGYTSFLTL REDS Y HRKYM +VLR+ PG+LI
Sbjct  769   PSQDVVHILDCLEKMQKWHAQPSVLVMGYTSFLTLMREDSKYNHRKYMAKVLRESPGMLI  828

Query  1595  LDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKEL  1416
             LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTL LARP F+ EVLK L
Sbjct  829   LDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLSLARPMFIKEVLKAL  888

Query  1415  DPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVY  1239
             DPK+K++ KGA K R  LE+RARK FID I+ KI+S +  E+ +GLN+L+ +T GFIDVY
Sbjct  889   DPKFKRKKKGAQKARHLLESRARKFFIDNIASKINSDEAEEKMQGLNMLRNMTNGFIDVY  948

Query  1238  EGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIR  1059
             EG +SD LPG+Q YT++M  T +Q +ILVKL        G+PLE+ELLITL +IHP L+ 
Sbjct  949   EGTASDTLPGIQIYTILMNPTDIQHQILVKLHKIMEKCPGYPLEVELLITLASIHPSLVN  1008

Query  1058  TTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLF  879
             ++ C  +++  EEL  LEK +FD K GSKV FV++L+ R +++ EKVLIFCHNIAPI LF
Sbjct  1009  SSVCVKKFYNLEELMELEKLRFDCKKGSKVMFVLNLVYR-VVKNEKVLIFCHNIAPIKLF  1067

Query  878   LEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTA  699
             LE+FE  + W++G E+LVL G++ELFERGRVMDKFEE+GGPS+V+LASIT CAEGISLTA
Sbjct  1068  LELFENIFRWQQGKEILVLTGELELFERGRVMDKFEELGGPSRVLLASITACAEGISLTA  1127

Query  698   ASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSM  519
             ASRVILLDSEWNPSK+KQAIARAFRPGQ K+VYVYQLLATGT+EE+KY+RT WKEWVS M
Sbjct  1128  ASRVILLDSEWNPSKTKQAIARAFRPGQQKMVYVYQLLATGTVEEDKYRRTAWKEWVSRM  1187

Query  518   IFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
             IFSE+ VEDPS WQA KIED++L EIVEEDR   FHMIMKNEKAS
Sbjct  1188  IFSEEFVEDPSRWQAEKIEDDVLREIVEEDRVKSFHMIMKNEKAS  1232



>gb|KHN38546.1| Helicase ARIP4 [Glycine soja]
Length=1310

 Score =  1164 bits (3010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 679/1345 (50%), Positives = 885/1345 (66%), Gaps = 108/1345 (8%)
 Frame = -3

Query  4211  AMKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNV  4032
             A ++R + Q +HPF  +PFEA   GSWQ VE I+I+ GT  MH  D   ++ E+  +S++
Sbjct  2     AHRKRRLDQLKHPFSPHPFEAVAFGSWQAVEFIKIEAGTMSMHFADNHHVVMEKGPLSDI  61

Query  4031  RIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIER  3852
             RIRSR AT  DC+ FLRPG+D+ V S P QS+D+D        +  +P W DAKI S++R
Sbjct  62    RIRSRKATLPDCSRFLRPGIDVCVLSAPQQSDDADAG------INLDPVWTDAKISSVQR  115

Query  3851  KPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             KPH   C CQF+++ YV QG      +TL+KEIKVV +NQI+ILQK+E  PCE+++YRW+
Sbjct  116   KPHDSECSCQFYVNFYVHQGSLGAELRTLNKEIKVVGINQISILQKLESTPCENQHYRWA  175

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASA-HKQVGFDVKSVHNRIVYEILKDENDIDAP  3495
              S+DCS +   KL  GK   DLSW++V +A  K+V F V+S+ +++VY++L+ +  +   
Sbjct  176   SSEDCSIISHTKLLLGKVLCDLSWLVVTTALKKKVSFCVRSLEDKLVYQVLERDTTVSTS  235

Query  3494  -NSEYHSYAVSFKLENEVSTPIIIQFNPDIPER-GPEGDVYE--AGPLVVYDELRRSKRR  3327
              N+E H   V+FK E      I+ Q      +R  PE + +E    P    + LRRSKRR
Sbjct  236   LNNESHIDVVNFKTEKGTLFSIVSQVATLKTKRVEPEQESHEDKESPSYNVEGLRRSKRR  295

Query  3326  FVQPERYLGCDDYLTEFDVEMTRL---VGGKMYKSELEE----LPMALSIQADHAYQNGD  3168
              VQPERYLGC+  +++ DV   R    V    +K +  +    +P+A        +  GD
Sbjct  296   NVQPERYLGCEK-VSQIDVGSFRNLPPVKINTWKDDDVDHEMNIPLAGLFSLQKKFLEGD  354

Query  3167  IDN----------KTLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIV-----  3033
              DN          + L  YQ++   +  +    +      N         HLAI+     
Sbjct  355   TDNHQKVKKASSCRELVVYQRKKTKSQKVKSGGDDQNEHQN---------HLAIIALPAQ  405

Query  3032  --PLQLSAENNLFDQ------------------------KENP---LSFEDNE-----DL  2955
               P+++   ++L D+                        K+N    L+FE +      D 
Sbjct  406   HDPVEVIHCDDLNDKVTRSYGHESSEVSSKYRHLIGTTSKKNDIKLLTFESHNHAAKSDD  465

Query  2954  SAEIREIVSKYIYVNGS-SAVEMKKSSLNLMQ--GRRWGQVKVSKLKFMGLDVkgggigs  2784
             + +I ++ S+Y Y  G+  +  M  S L+ M   G +W  +  SK  F G          
Sbjct  466   ADKIDDLSSRYHYSYGTPKSQRMGLSDLDDMVDLGNKWEGISSSK-GFQG----------  514

Query  2783  skkkakKRTCPSQRDSIYDIR-SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQW  2607
                K ++ T    RD     R +++  S++A  Y++LI   + N++     E+  I DQW
Sbjct  515   ---KKQRTTYLRSRDHGEQKRYNYKDRSLNAAAYKDLINSYLKNMNTRPTNEESAIADQW  571

Query  2606  KEFQNTKSC-QREPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATEL  2430
             K+ +   +  Q+   +     + EE SE+DMLW+E+E++LASCYL ++TED++    TE 
Sbjct  572   KQSETPSNIGQKTETQMLDEEDAEEESEMDMLWRELEVSLASCYLEEETEDSHAAVFTET  631

Query  2429  HMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVV  2250
                   G   C HDFR+NEEIG+ C  CG VSTEIK + PPF+  +     ++Q PEE  
Sbjct  632   LENPNPG---CPHDFRMNEEIGIYCYRCGFVSTEIKYITPPFIQHSVRHQEEKQSPEE--  686

Query  2249  MEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIA  2070
              + K   D D D   +P   +      +  +N WALIP+L+ KL AHQ++AFEFLW+NIA
Sbjct  687   -DSKTKPDEDDDIDLLPALDSPEKLVSQENENVWALIPELKAKLHAHQKKAFEFLWQNIA  745

Query  2069  GSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTW  1890
             GS+ P  ++  SK+RGGCVISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTW
Sbjct  746   GSMDPELMETASKRRGGCVISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTW  805

Query  1889  YKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLC-PGLPR-NQDVMHVLDCLEKMQKWLA  1716
             YKE IKW IPIPVY IHG +TY+  V +QK  +  PG+P+   DV HVLDCLEK+QKW +
Sbjct  806   YKEFIKWDIPIPVYLIHGRRTYR--VFKQKSSIVIPGVPKPTDDVKHVLDCLEKIQKWHS  863

Query  1715  HPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMK  1536
             HPSVL+MGYTSFLTL REDS +AHRKYM +VLR+ PGI++LDEGHNPRSTKSRLRK LMK
Sbjct  864   HPSVLIMGYTSFLTLMREDSKFAHRKYMAKVLRESPGIMVLDEGHNPRSTKSRLRKVLMK  923

Query  1535  VNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAK-TRFSLEN  1359
             V T LRILLSGTLFQNNF EYFNTLCLARP+F+ EVLK LD KYK++ K AK     LE+
Sbjct  924   VQTELRILLSGTLFQNNFCEYFNTLCLARPKFIHEVLKALDSKYKRKGKVAKKASHLLES  983

Query  1358  RARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKS  1179
             RARK F+D+I+KKIDS+  RER++GL +L+ +T GFIDVYEG SSD LPGLQ YTL+M S
Sbjct  984   RARKFFLDQIAKKIDSNNGRERRQGLKMLRNVTNGFIDVYEGRSSDGLPGLQIYTLLMNS  1043

Query  1178  TTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekf  999
             T  Q EIL +L  +     G+PLELELLITLG+IHPWL+++  C+ ++F   +L  LEK 
Sbjct  1044  TDTQHEILHELHKKMARVNGYPLELELLITLGSIHPWLVKSAVCAEKFFTPAQLMELEKC  1103

Query  998   kfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQ  819
             KFDL++GSKVKFV+SLI R +++KEKVLIFCHNIAP+ LF+E FE+++GW KG EVLVL 
Sbjct  1104  KFDLRIGSKVKFVLSLIYR-VVKKEKVLIFCHNIAPVKLFVEYFEKYFGWTKGREVLVLS  1162

Query  818   GDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAI  639
             G++ELFERGRVMDKFEE GG +K++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAI
Sbjct  1163  GELELFERGRVMDKFEEPGGVAKILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAI  1222

Query  638   ARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIED  459
             ARAFRPGQ KVVYVYQLL TG+LEE+KYKRTTWKEWVSSMIFSE  VEDPS WQA KIED
Sbjct  1223  ARAFRPGQQKVVYVYQLLVTGSLEEDKYKRTTWKEWVSSMIFSEAFVEDPSQWQAEKIED  1282

Query  458   ELLGEIVEEDRATLFHMIMKNEKAS  384
              +L E+V EDR+  FHMIMKNEK S
Sbjct  1283  YILREMVAEDRSKSFHMIMKNEKTS  1307



>ref|XP_008369294.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Malus 
domestica]
 ref|XP_008369295.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Malus 
domestica]
Length=1285

 Score =  1156 bits (2991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/1323 (51%), Positives = 891/1323 (67%), Gaps = 90/1323 (7%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGD-LIEEEISISNVR  4029
             ++R +++ +HPFD  PFEA   GSWQPVE + I+ G   M   +    +I ++   +N+R
Sbjct  5     RKRHLYRAKHPFDANPFEALCCGSWQPVEVLSIRRGKMTMSFGNNHPCIIRDKGPFANLR  64

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR+A   DC CFLRPG+DI V STP  ++DS+E +        +P  +DA+I SIER 
Sbjct  65    VRSRHANMYDCTCFLRPGVDICVLSTPEHTDDSEEGSR-------DPVMVDARISSIERV  117

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C CQF+++ YV QGP    + TL+KE K+V +++I + Q I++   E++ YRW 
Sbjct  118   PHESDRCSCQFYVNFYVNQGPLGTERATLNKEAKLVGIDEIFVFQMIDRDAYENQPYRWE  177

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S DC TL + KL  G F SD+SW+LVAS  K+V FD++SV N+IVY+IL+ +ND    N
Sbjct  178   CSADCPTLPRTKLLLGTFLSDVSWLLVASVMKRVIFDIRSVKNKIVYQILEGDNDRTLLN  237

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPERG---PEGDVYEAGPLVVYDELRRSKRRFV  3321
             S+ + +AV+FK++N +  P++++F PD        PE D     P      LRRSKRR +
Sbjct  238   SDNYLHAVNFKVDNGLLVPMVVEFVPDDATEADPTPEMDESVPSPSTELVGLRRSKRRII  297

Query  3320  QPERYLGCDDYLTEFDVEMTRLVGGKM-YKSELEELPMALS----IQADHAYQNGDIDNK  3156
             QPER+L CD   +E ++   R    K+ Y SE +EL + LS      A H+ +N + + K
Sbjct  298   QPERFLACD-APSEIEIGYVRSRPYKVDYSSEDDELYIPLSQLFAKHASHSEENTEAEQK  356

Query  3155  -------------------TLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIV  3033
                                 LAC + +  D+        S K  +   ++   +  LA+V
Sbjct  357   FRPKKLKSSKDDNYWKTEEELAC-KSDDDDDVEYKIKTKSKKVKSGVGKLKRHRDELALV  415

Query  3032  PLQLSAENNLFDQKENPLSFEDN--------EDLSAEIREIVSKYIYVNGSSAVEMKKSS  2877
                        + + +PL+            E  + E  E  +KY Y +         S 
Sbjct  416   -----------EYRRDPLTLGHGHRNVNTTPEKGANESDEFPAKYYYHHNRKTKRKNNSD  464

Query  2876  LNLMQGR-RW-GQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGS  2703
             L+ M  + +W G+V  S+              S     +  +  S+RD   + R++ + S
Sbjct  465   LDDMDFQMKWDGKVSTSR-------------ASRVLYRRHHSIRSKRDP--NGRTYPRRS  509

Query  2702  ISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC--QREPIeksstnneeels  2529
             ++   Y+ELI   + ++D T NK    I+DQW EF+  K+   ++E     + + EEE+S
Sbjct  510   LNTGAYKELINSFLKDMDCT-NKPDANIMDQWNEFKAAKNSDQRKETEMPENDDEEEEMS  568

Query  2528  eLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             E +MLWKEMELALAS YL    +D    +A   + +  K    C H+F+LNEEIG++C +
Sbjct  569   ETEMLWKEMELALASAYL----QDNEGSNAAAANASPPKSDSACRHEFKLNEEIGIICSI  624

Query  2348  CGVVSTEIKDVPPPFMP-STCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
             CG VSTEI+DV PPF+  ++  +  ++   EE   + K+ +  + + F    + + P + 
Sbjct  625   CGFVSTEIRDVSPPFVQNASVDTYDRKSNVEEP--DNKRAEYEEFNFFHTRTTPDDPETL  682

Query  2171  VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGA  1992
              E  DN WALIP+LR KL  HQ++AFEFLWKN+AGS+ P+ ++ ++KK GGCVISH+PGA
Sbjct  683   SEENDNVWALIPELRKKLLFHQKKAFEFLWKNVAGSLEPSLMERKAKKTGGCVISHTPGA  742

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEV  1812
             GKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IPIPVY IHG +TY+  V
Sbjct  743   GKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWQIPIPVYLIHGRRTYR--V  800

Query  1811  LRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
              ++K     G P+   DVMHVLDCLEK+QKW A PSVL+MGYTSFLTL REDS + HRK+
Sbjct  801   FKKKTVNFTGGPKPTDDVMHVLDCLEKIQKWHAQPSVLVMGYTSFLTLMREDSKFVHRKF  860

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
             M QVLR+ PG+++LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCL
Sbjct  861   MAQVLRESPGLVVLDEGHNPRSTKSRLRKGLMKVETDLRILLSGTLFQNNFCEYFNTLCL  920

Query  1454  ARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererk-EGL  1281
             ARP+FV+EVL+ LDPKY++  KG  K R  +E RARK+F+DKI+KKIDS++E +++ +GL
Sbjct  921   ARPKFVNEVLRALDPKYRRIKKGKEKARHLMEARARKLFLDKIAKKIDSNEEEDQRIQGL  980

Query  1280  NILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
             N L+ +T GFIDVYEGG+SD LPGLQ YTL+M +T +Q+++L +LQ+    YKG+PLELE
Sbjct  981   NQLRHITNGFIDVYEGGNSDTLPGLQIYTLLMNTTDIQRDMLDRLQNIMANYKGYPLELE  1040

Query  1100  LLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEK  921
             LLITLG+IHPWLI T  C+G++F+ EEL  LE++K+DL  GSKVKFV++L+ + ++R EK
Sbjct  1041  LLITLGSIHPWLITTACCAGKFFRPEELMELEQYKYDLHKGSKVKFVLNLVYQ-VVRNEK  1099

Query  920   VLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVML  741
             VLIFCHNIAP+ LFLE+FER +GW++G EVLVL GD+ELF+RG+VMDKFEE GG S+V+L
Sbjct  1100  VLIFCHNIAPVRLFLELFERVFGWQRGREVLVLTGDLELFDRGKVMDKFEEPGGASRVLL  1159

Query  740   ASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEE  561
             ASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+
Sbjct  1160  ASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEED  1219

Query  560   KYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASN  381
             KY RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+V ED++  FHMIMKNEKAS 
Sbjct  1220  KYGRTTWKEWVSSMIFSEAFVEDPSRWQAEKIEDDVLREMVAEDKSKSFHMIMKNEKAST  1279

Query  380   MGR  372
             + R
Sbjct  1280  VVR  1282



>ref|XP_009369221.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009369222.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Pyrus 
x bretschneideri]
 ref|XP_009369223.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Pyrus 
x bretschneideri]
Length=1285

 Score =  1147 bits (2967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/1320 (51%), Positives = 885/1320 (67%), Gaps = 84/1320 (6%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGD-LIEEEISISNVR  4029
             ++R +++ +HPFD  PFEA   GSWQPVE + I+ G   M   +    +I ++   +N+R
Sbjct  5     RKRHLYRAKHPFDANPFEALCCGSWQPVEVLSIRRGKMTMSFGNNHPCIIRDKGPFANLR  64

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR+A   DC CFLRPG+DI V STP  ++DS E +        +P  +DA+I SIER 
Sbjct  65    VRSRHANMYDCTCFLRPGVDICVLSTPEDTDDSKEGSR-------DPVMVDARISSIERV  117

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C CQF+++ YV QGP    + TL+KE K+V +++I + Q I++   E++ YRW 
Sbjct  118   PHESDRCSCQFYVNFYVNQGPLGTERATLNKEAKLVGIDEIFVFQMIDRDAYENQPYRWE  177

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S DC TL + KL  G F SD+SW+LVAS  K+V FD++SV  +IVY+IL+ +ND    N
Sbjct  178   CSADCPTLPRTKLLLGTFLSDVSWLLVASVMKRVIFDIRSVKTKIVYQILEGDNDRTLLN  237

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPERG---PEGDVYEAGPLVVYDELRRSKRRFV  3321
             S+ + +AV+FK++N +  P++++F PD        PE D     P      LRRSKRR +
Sbjct  238   SDNYLHAVNFKVDNGLLVPMVVEFVPDDATEADPTPEMDESVPSPSTELVGLRRSKRRII  297

Query  3320  QPERYLGCDDYLTEFDVEMTRLVGGKM-YKSELEELPMALS----IQADHAYQNGDIDNK  3156
             QPER+L CD   +E ++   R    K+ Y SE +EL + LS      A H+ ++ + + K
Sbjct  298   QPERFLACD-APSEIEIGYVRSRPYKVDYSSEDDELYIPLSQLFAKHASHSEEHTEAEQK  356

Query  3155  -------------------TLACYQQElrdnsllsrnrnssksDTNRKRVSGDKAHLAIV  3033
                                 LAC + +  D+        S K  +   +    +  LA+V
Sbjct  357   FRPKKLKSSKDDNYWKTEEELAC-KSDDDDDVEYKIKTKSKKVKSGAGKQKRHRDELALV  415

Query  3032  -----PLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNL  2868
                  PL L   +   +           E  + E  E  +KY Y +         S L+ 
Sbjct  416   EYRRDPLTLGHGHRHVNSTP--------EKGTNESDEFPAKYYYHHNRKTKRKNNSDLDD  467

Query  2867  MQGR-RW-GQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISA  2694
             M  + +W G+V  S+              S     +  +  S+RD   + R++ + S++ 
Sbjct  468   MDFQMKWDGKVSTSR-------------ASRVLYRRHHSIRSKRDP--NGRTYPRRSLNT  512

Query  2693  NVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC--QREPIeksstnneeelseLD  2520
               Y+ELI   + ++D T NK    I+DQW EF+  K+   ++E     + + EEE+SE +
Sbjct  513   GAYKELINSFLKDMDCT-NKPDANIMDQWNEFKAAKNSDQRKETEMPENDDEEEEMSETE  571

Query  2519  MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             MLWKEMELALAS YL    +D    +A   + +  K    C H+F+LNEEIG++C +CG 
Sbjct  572   MLWKEMELALASAYL----QDNEGSNAAAANASPPKSDSACRHEFKLNEEIGIICSICGF  627

Query  2339  VSTEIKDVPPPFMP-STCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
             VSTEI+DV PPF+  ++  +  ++   EE   + K+ +  + + F    + + P +  E 
Sbjct  628   VSTEIRDVSPPFVQNASVDTYDRKSNVEEP--DNKRAEYEEFNFFHTRTTPDDPETLSEE  685

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
              DN WALIP+LR KL  HQ++AFEFLWKN+AGS+ P+ ++ ++KK GGCVISH+PGAGKT
Sbjct  686   SDNVWALIPELRKKLLFHQKKAFEFLWKNVAGSLEPSLMERKAKKTGGCVISHTPGAGKT  745

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQ  1803
              LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IPIPVY IHG +TY+  V ++
Sbjct  746   FLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWQIPIPVYLIHGRRTYR--VFKK  803

Query  1802  KMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQ  1626
             K     G P+   DVMHVLDCLEK+QKW A PSVL+MGYTSFLTL REDS + HRK+M Q
Sbjct  804   KTINFTGGPKPTDDVMHVLDCLEKIQKWHAQPSVLVMGYTSFLTLMREDSKFVHRKFMAQ  863

Query  1625  VLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARP  1446
             VLR+ PG+++LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP
Sbjct  864   VLRESPGLVVLDEGHNPRSTKSRLRKGLMKVETDLRILLSGTLFQNNFCEYFNTLCLARP  923

Query  1445  RFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererk-EGLNIL  1272
             +FV+EVL+ LD KY++  KG  K R  +E RARK+F+DKI+KKIDS++E +++ +GLN L
Sbjct  924   KFVNEVLRALDSKYRRIKKGKEKARHLMEARARKLFLDKIAKKIDSNEEEDQRIQGLNQL  983

Query  1271  KKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLI  1092
             + +T GFIDVYEGG+SD LPGLQ YTL+M +T +Q+++L +LQ+    YKG+PLELELLI
Sbjct  984   RHITNGFIDVYEGGNSDTLPGLQIYTLLMNTTDIQRDMLDRLQNIMANYKGYPLELELLI  1043

Query  1091  TLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLI  912
             TLG+IHPWLI T  C+G +F+ EEL  LE++K+DL  GSKVKFV++L+ + ++R EKVLI
Sbjct  1044  TLGSIHPWLITTACCAGTFFRPEELMELEQYKYDLHKGSKVKFVLNLVYQ-VVRNEKVLI  1102

Query  911   FCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASI  732
             FCHNIAP+ LFLE+FER +GW++G EVLVL GD+ELF+RG+VMDKFEE GG S+V+LASI
Sbjct  1103  FCHNIAPVRLFLELFERVFGWQRGREVLVLTGDLELFDRGKVMDKFEEPGGASRVLLASI  1162

Query  731   TTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYK  552
             T CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ KVVYVYQLLATGTLEE+KY 
Sbjct  1163  TACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLATGTLEEDKYG  1222

Query  551   RTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+V ED++  FHMIMKNEKAS + R
Sbjct  1223  RTTWKEWVSSMIFSEAFVEDPSRWQAEKIEDDVLREMVAEDKSKSFHMIMKNEKASTVVR  1282



>gb|KEH28290.1| chromatin remodeling complex subunit [Medicago truncatula]
Length=1305

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/1328 (50%), Positives = 869/1328 (65%), Gaps = 82/1328 (6%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             ++R ++ +++PF+  PFEA   GSW PVE I++++G+  +H  D   ++ ++ ++S++RI
Sbjct  3     RKRRLNDSKNPFNSDPFEAVIFGSWHPVEFIKVKSGSMSIHFTDNHHMVMDKGTLSDIRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR AT SDC+CFLRPG+D+ V S P ++ DS         +  EP W DA+I SI+RKP
Sbjct  63    RSRKATVSDCSCFLRPGIDVCVLSPPKRANDSVG-------LNLEPVWADARISSIQRKP  115

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             HG  C CQF ++ YV QG   +  +TL K++KV  LNQIAILQKIE  P E++ +RWS S
Sbjct  116   HGSECSCQFFVNFYVEQGSLGLEMRTLCKDVKVFGLNQIAILQKIEHSPGENQPHRWSSS  175

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILK-DENDIDAPNS  3489
             +D S+L   KL  GKF  DLSW++V S  K V F  +SV N++VY+IL  D ++  + N+
Sbjct  176   EDSSSLPHTKLLLGKFLIDLSWLVVTSVVKNVSFCARSVENKMVYQILGGDSSNSSSSNT  235

Query  3488  EYHSYAVSFKLENEVSTPIIIQF---NPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQ  3318
             E H   + F+ ++ +  PI+ Q    N    +   E    EA      D LRRSKRR VQ
Sbjct  236   ESHIDVIGFRTDDGMLVPIVSQVAITNTKRADHAHESRADEASSSYNVDGLRRSKRRHVQ  295

Query  3317  PERYLGCD----DYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNKTL  3150
             PERY+GC+    D  T  ++   R+   K    E+  LP++   +   +      D    
Sbjct  296   PERYVGCEVKELDVGTFRNMPPVRIETSKAVVDEMS-LPLSFLFRLPQSSPEKGADK---  351

Query  3149  ACYQQElrdnsllsrnrnssksDTNRKRVSGD------KAHLAIVPLQLSAENNLFDQKE  2988
              C +    +        N        K+  GD      K  LAI+PL         DQ  
Sbjct  352   -CQKANKPNACRELLVYNRRAKTQEGKKTCGDVDQKVHKNSLAIIPLP--------DQDA  402

Query  2987  NPLSFED---NEDLS----AEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRR--------  2853
             +P++ E    N +++     + R+I S+Y ++  +    MK  +L  + G+         
Sbjct  403   DPIAVEHYDPNGNVARSHEHQSRDITSQYSHLVNNPK-PMKNINLLDVPGKSDDAEKNDH  461

Query  2852  -------WGQVKVSKLKFMGLD---------VkgggigsskkkakKRTCPSQRDSIYDIR  2721
                    +G  K+ +     LD                +   + K R+   + +      
Sbjct  462   VSSRCQFFGSTKLQRKSIGDLDDIDLGNRWEGIKRKSKTGFHEGKYRSTHLRNNGEGRSH  521

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksstnn  2544
             +++  +++A  Y+ LI   + NI+     E+PPI DQWK+   T    Q    + S   +
Sbjct  522   NYKDRTLNAAAYKSLIHSYLQNINTIPVIEEPPITDQWKKCNTTNGVGQNVETKISHGED  581

Query  2543  eeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIG  2364
             + E +E+DMLWKE+E++LAS Y  DD+E +N   A  L    K    VC HD RL+EEIG
Sbjct  582   DVEKAEIDMLWKELEVSLASSYF-DDSEVSN---AIVLAEPEKNLEEVCEHDNRLDEEIG  637

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNK  2184
             + C +CG V+T I+DV P F+ ++     ++Q       EE   DD D D    P  +++
Sbjct  638   IYCCICGFVTTHIRDVNPIFVENSVWRQEEKQIDGGEDKEEATKDDEDDDFHFFPTDTSR  697

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISH  2004
                  E   + W+LIP+LR KL  HQ++AFEFLW+NIAGS  P  I+ ESKKRGGCVISH
Sbjct  698   DEPISEENQSVWSLIPELREKLHVHQKKAFEFLWRNIAGSTNPGLIEAESKKRGGCVISH  757

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IPIPVY IHG +TY
Sbjct  758   TPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPIPVYLIHGRRTY  817

Query  1823  KGEVLRQK-MKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
             +  V +Q  +   PG+P+   DV HVLDCLEK+QKW +HPSVL+MGYTSFLTL REDS +
Sbjct  818   R--VFKQNTVATLPGVPKPTDDVKHVLDCLEKIQKWHSHPSVLIMGYTSFLTLMREDSKF  875

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
             AHRK+M QVLR+ PG+L+LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYF
Sbjct  876   AHRKFMAQVLRESPGLLVLDEGHNPRSTKSRLRKCLMKVQTELRILLSGTLFQNNFCEYF  935

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGA------KTRFSLENRARKMFidkiskkidss  1308
             NTLCLARP+F  EVLK LDPKYK++ KG       K ++ +E+RARK F+D I++KIDS+
Sbjct  936   NTLCLARPKFPHEVLKALDPKYKRKKKGVDQKGAEKAQYLIESRARKFFLDTIARKIDSN  995

Query  1307  kererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
                ER +GLN+L+ +T GFIDVYE GSSD LPGLQ YTL+M +T +Q EIL KL      
Sbjct  996   VGEERIQGLNMLRNVTNGFIDVYEAGSSDGLPGLQIYTLLMNTTDIQHEILQKLHSDMFK  1055

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
               G+PLELELLITLG+IHPWL++T  CS ++  +E+L  L+K+KFDLK+GSKV+FV+SLI
Sbjct  1056  CSGYPLELELLITLGSIHPWLVKTAVCSQKFLTKEQLSDLDKYKFDLKIGSKVRFVLSLI  1115

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
              R +++ EKVLIFCHNIAP+ LF E FE+++GW+KG EVLVL G++ELFERG++MDKFEE
Sbjct  1116  YR-VVKNEKVLIFCHNIAPVRLFQEYFEKYFGWQKGREVLVLTGELELFERGKIMDKFEE  1174

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
              GG SK++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ K+VYVYQL
Sbjct  1175  PGGVSKILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKMVYVYQL  1234

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHM  408
             L TG+LEE+KY+RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+VEED++  FHM
Sbjct  1235  LVTGSLEEDKYRRTTWKEWVSSMIFSEAFVEDPSRWQAEKIEDDILREMVEEDKSKSFHM  1294

Query  407   IMKNEKAS  384
             IMKNEKAS
Sbjct  1295  IMKNEKAS  1302



>gb|AES99655.2| chromatin remodeling complex subunit [Medicago truncatula]
Length=1342

 Score =  1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/1330 (50%), Positives = 869/1330 (65%), Gaps = 86/1330 (6%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             ++R ++ +++PF+  PFEA   GSW PVE I++++G+  +H  D   ++ ++ ++S++RI
Sbjct  40    RKRRLNDSKNPFNSDPFEAVIFGSWHPVEFIKVKSGSMSIHFTDNHHMVMDKGTLSDIRI  99

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR AT SDC+CFLRPG+D+ V S P ++ DS         +  EP W DA+I SI+RKP
Sbjct  100   RSRKATVSDCSCFLRPGIDVCVLSPPKRANDSVG-------LNLEPVWADARISSIQRKP  152

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             HG  C CQF ++ YV QG   +  +TL K++KV  LNQIAILQKIE  P E++ +RWS S
Sbjct  153   HGSECSCQFFVNFYVEQGSLGLEMRTLCKDVKVFGLNQIAILQKIEHSPGENQPHRWSSS  212

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILK-DENDIDAPNS  3489
             +D S+L   KL  GKF  DLSW++V S  K V F  +SV N++VY+IL  D ++  + N+
Sbjct  213   EDSSSLPHTKLLLGKFLIDLSWLVVTSVVKNVSFCARSVENKMVYQILGGDSSNSSSSNT  272

Query  3488  EYHSYAVSFKLENEVSTPIIIQF---NPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQ  3318
             E H   + F+ ++ +  PI+ Q    N    +   E    EA      D LRRSKRR VQ
Sbjct  273   ESHIDVIGFRTDDGMLVPIVSQVAITNTKRADHAHESRADEASSSYNVDGLRRSKRRHVQ  332

Query  3317  PERYLGCDDYLTEFDVEM------TRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNK  3156
             PERY+GC+  + E DV         R+   K    E+  LP++   +   +      D  
Sbjct  333   PERYVGCE--VKELDVGTFRNMPPVRIETSKAVVDEMS-LPLSFLFRLPQSSPEKGADK-  388

Query  3155  TLACYQQElrdnsllsrnrnssksDTNRKRVSGD------KAHLAIVPLQLSAENNLFDQ  2994
                C +    +        N        K+  GD      K  LAI+PL         DQ
Sbjct  389   ---CQKANKPNACRELLVYNRRAKTQEGKKTCGDVDQKVHKNSLAIIPLP--------DQ  437

Query  2993  KENPLSFED---NEDLS----AEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRR------  2853
               +P++ E    N +++     + R+I S+Y ++  +    MK  +L  + G+       
Sbjct  438   DADPIAVEHYDPNGNVARSHEHQSRDITSQYSHLVNNPK-PMKNINLLDVPGKSDDAEKN  496

Query  2852  ---------WGQVKVSKLKFMGLD---------VkgggigsskkkakKRTCPSQRDSIYD  2727
                      +G  K+ +     LD                +   + K R+   + +    
Sbjct  497   DHVSSRCQFFGSTKLQRKSIGDLDDIDLGNRWEGIKRKSKTGFHEGKYRSTHLRNNGEGR  556

Query  2726  IRSFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksst  2550
               +++  +++A  Y+ LI   + NI+     E+PPI DQWK+   T    Q    + S  
Sbjct  557   SHNYKDRTLNAAAYKSLIHSYLQNINTIPVIEEPPITDQWKKCNTTNGVGQNVETKISHG  616

Query  2549  nneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
              ++ E +E+DMLWKE+E++LAS Y  DD+E +N   A  L    K    VC HD RL+EE
Sbjct  617   EDDVEKAEIDMLWKELEVSLASSYF-DDSEVSN---AIVLAEPEKNLEEVCEHDNRLDEE  672

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS  2190
             IG+ C +CG V+T I+DV P F+ ++     ++Q       EE   DD D D    P  +
Sbjct  673   IGIYCCICGFVTTHIRDVNPIFVENSVWRQEEKQIDGGEDKEEATKDDEDDDFHFFPTDT  732

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
             ++     E   + W+LIP+LR KL  HQ++AFEFLW+NIAGS  P  I+ ESKKRGGCVI
Sbjct  733   SRDEPISEENQSVWSLIPELREKLHVHQKKAFEFLWRNIAGSTNPGLIEAESKKRGGCVI  792

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IPIPVY IHG +
Sbjct  793   SHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPIPVYLIHGRR  852

Query  1829  TYKGEVLRQK-MKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
             TY+  V +Q  +   PG+P+   DV HVLDCLEK+QKW +HPSVL+MGYTSFLTL REDS
Sbjct  853   TYR--VFKQNTVATLPGVPKPTDDVKHVLDCLEKIQKWHSHPSVLIMGYTSFLTLMREDS  910

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              +AHRK+M QVLR+ PG+L+LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF E
Sbjct  911   KFAHRKFMAQVLRESPGLLVLDEGHNPRSTKSRLRKCLMKVQTELRILLSGTLFQNNFCE  970

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGA------KTRFSLENRARKMFidkiskkid  1314
             YFNTLCLARP+F  EVLK LDPKYK++ KG       K ++ +E+RARK F+D I++KID
Sbjct  971   YFNTLCLARPKFPHEVLKALDPKYKRKKKGVDQKGAEKAQYLIESRARKFFLDTIARKID  1030

Query  1313  sskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQR  1134
             S+   ER +GLN+L+ +T GFIDVYE GSSD LPGLQ YTL+M +T +Q EIL KL    
Sbjct  1031  SNVGEERIQGLNMLRNVTNGFIDVYEAGSSDGLPGLQIYTLLMNTTDIQHEILQKLHSDM  1090

Query  1133  PIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMS  954
                 G+PLELELLITLG+IHPWL++T  CS ++  +E+L  L+K+KFDLK+GSKV+FV+S
Sbjct  1091  FKCSGYPLELELLITLGSIHPWLVKTAVCSQKFLTKEQLSDLDKYKFDLKIGSKVRFVLS  1150

Query  953   LIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKF  774
             LI R +++ EKVLIFCHNIAP+ LF E FE+++GW+KG EVLVL G++ELFERG++MDKF
Sbjct  1151  LIYR-VVKNEKVLIFCHNIAPVRLFQEYFEKYFGWQKGREVLVLTGELELFERGKIMDKF  1209

Query  773   EEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
             EE GG SK++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ K+VYVY
Sbjct  1210  EEPGGVSKILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKMVYVY  1269

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLF  414
             QLL TG+LEE+KY+RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+VEED++  F
Sbjct  1270  QLLVTGSLEEDKYRRTTWKEWVSSMIFSEAFVEDPSRWQAEKIEDDILREMVEEDKSKSF  1329

Query  413   HMIMKNEKAS  384
             HMIMKNEKAS
Sbjct  1330  HMIMKNEKAS  1339



>ref|XP_003616697.1| DNA repair and recombination protein RAD54-like protein [Medicago 
truncatula]
Length=1380

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/1328 (50%), Positives = 867/1328 (65%), Gaps = 86/1328 (6%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             ++R ++ +++PF+  PFEA   GSW PVE I++++G+  +H  D   ++ ++ ++S++RI
Sbjct  40    RKRRLNDSKNPFNSDPFEAVIFGSWHPVEFIKVKSGSMSIHFTDNHHMVMDKGTLSDIRI  99

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR AT SDC+CFLRPG+D+ V S P ++ DS         +  EP W DA+I SI+RKP
Sbjct  100   RSRKATVSDCSCFLRPGIDVCVLSPPKRANDSVG-------LNLEPVWADARISSIQRKP  152

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             HG  C CQF ++ YV QG   +  +TL K++KV  LNQIAILQKIE  P E++ +RWS S
Sbjct  153   HGSECSCQFFVNFYVEQGSLGLEMRTLCKDVKVFGLNQIAILQKIEHSPGENQPHRWSSS  212

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILK-DENDIDAPNS  3489
             +D S+L   KL  GKF  DLSW++V S  K V F  +SV N++VY+IL  D ++  + N+
Sbjct  213   EDSSSLPHTKLLLGKFLIDLSWLVVTSVVKNVSFCARSVENKMVYQILGGDSSNSSSSNT  272

Query  3488  EYHSYAVSFKLENEVSTPIIIQF---NPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQ  3318
             E H   + F+ ++ +  PI+ Q    N    +   E    EA      D LRRSKRR VQ
Sbjct  273   ESHIDVIGFRTDDGMLVPIVSQVAITNTKRADHAHESRADEASSSYNVDGLRRSKRRHVQ  332

Query  3317  PERYLGCDDYLTEFDVEM------TRLVGGKMYKSELEELPMALSIQADHAYQNGDIDNK  3156
             PERY+GC+  + E DV         R+   K    E+  LP++   +   +      D  
Sbjct  333   PERYVGCE--VKELDVGTFRNMPPVRIETSKAVVDEMS-LPLSFLFRLPQSSPEKGADK-  388

Query  3155  TLACYQQElrdnsllsrnrnssksDTNRKRVSGD------KAHLAIVPLQLSAENNLFDQ  2994
                C +    +        N        K+  GD      K  LAI+PL         DQ
Sbjct  389   ---CQKANKPNACRELLVYNRRAKTQEGKKTCGDVDQKVHKNSLAIIPLP--------DQ  437

Query  2993  KENPLSFED---NEDLS----AEIREIVSKYIYVNGSSAVEMKKSSLNLMQGRR------  2853
               +P++ E    N +++     + R+I S+Y ++  +    MK  +L  + G+       
Sbjct  438   DADPIAVEHYDPNGNVARSHEHQSRDITSQYSHLVNNPK-PMKNINLLDVPGKSDDAEKN  496

Query  2852  ---------WGQVKVSKLKFMGLD---------VkgggigsskkkakKRTCPSQRDSIYD  2727
                      +G  K+ +     LD                +   + K R+   + +    
Sbjct  497   DHVSSRCQFFGSTKLQRKSIGDLDDIDLGNRWEGIKRKSKTGFHEGKYRSTHLRNNGEGR  556

Query  2726  IRSFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksst  2550
               +++  +++A  Y+ LI   + NI+     E+PPI DQWK+   T    Q    + S  
Sbjct  557   SHNYKDRTLNAAAYKSLIHSYLQNINTIPVIEEPPITDQWKKCNTTNGVGQNVETKISHG  616

Query  2549  nneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
              ++ E +E+DMLWKE+E++LAS Y  DD+E +N   A  L    K    VC HD RL+EE
Sbjct  617   EDDVEKAEIDMLWKELEVSLASSYF-DDSEVSN---AIVLAEPEKNLEEVCEHDNRLDEE  672

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS  2190
             IG+ C +CG V+T I+DV P F+ ++     ++Q       EE   DD D D    P  +
Sbjct  673   IGIYCCICGFVTTHIRDVNPIFVENSVWRQEEKQIDGGEDKEEATKDDEDDDFHFFPTDT  732

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
             ++     E   + W+LIP+LR KL  HQ++AFEFLW+NIAGS  P  I+ ESKKRGGCVI
Sbjct  733   SRDEPISEENQSVWSLIPELREKLHVHQKKAFEFLWRNIAGSTNPGLIEAESKKRGGCVI  792

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IPIPVY IHG +
Sbjct  793   SHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPIPVYLIHGRR  852

Query  1829  TYKGEVLRQK-MKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
             TY+  V +Q  +   PG+P+   DV HVLDCLEK+QKW +HPSVL+MGYTSFLTL REDS
Sbjct  853   TYR--VFKQNTVATLPGVPKPTDDVKHVLDCLEKIQKWHSHPSVLIMGYTSFLTLMREDS  910

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              +AHRK+M QVLR+ PG+L+LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF E
Sbjct  911   KFAHRKFMAQVLRESPGLLVLDEGHNPRSTKSRLRKCLMKVQTELRILLSGTLFQNNFCE  970

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGA------KTRFSLENRARKMFidkiskkid  1314
             YFNTLCLARP+F  EVLK LDPKYK++ KG       K ++ +E+RARK F+D I++KID
Sbjct  971   YFNTLCLARPKFPHEVLKALDPKYKRKKKGVDQKGAEKAQYLIESRARKFFLDTIARKID  1030

Query  1313  sskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQR  1134
             S+   ER +GLN+L+ +T GFIDVYE GSSD LPGLQ YTL+M +T +Q EIL KL    
Sbjct  1031  SNVGEERIQGLNMLRNVTNGFIDVYEAGSSDGLPGLQIYTLLMNTTDIQHEILQKLHSDM  1090

Query  1133  PIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMS  954
                 G+PLELELLITLG+IHPWL++T  CS ++  +E+L  L+K+KFDLK+GSKV+FV+S
Sbjct  1091  FKCSGYPLELELLITLGSIHPWLVKTAVCSQKFLTKEQLSDLDKYKFDLKIGSKVRFVLS  1150

Query  953   LIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKF  774
             LI R +++ EKVLIFCHNIAP+ LF E FE+++GW+KG EVLVL G++ELFERG++MDKF
Sbjct  1151  LIYR-VVKNEKVLIFCHNIAPVRLFQEYFEKYFGWQKGREVLVLTGELELFERGKIMDKF  1209

Query  773   EEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
             EE GG SK++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ K+VYVY
Sbjct  1210  EEPGGVSKILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKMVYVY  1269

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLF  414
             QLL TG+LEE+KY+RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+VEED++  F
Sbjct  1270  QLLVTGSLEEDKYRRTTWKEWVSSMIFSEAFVEDPSRWQAEKIEDDILREMVEEDKSKSF  1329

Query  413   HMIMKNEK  390
             HMIMKNEK
Sbjct  1330  HMIMKNEK  1337



>gb|EPS74404.1| hypothetical protein M569_00351, partial [Genlisea aurea]
Length=655

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/638 (79%), Positives = 563/638 (88%), Gaps = 2/638 (0%)
 Frame = -3

Query  2279  GKEQRPEEVVMEEKQGDDADLDH--FAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQ  2106
              K+Q+ E    EE + ++AD     FAIP+    PS+  E +   WALIPDL++KLR HQ
Sbjct  9     AKDQKSEGDSPEENKFEEADEGQQGFAIPLPPVTPSALGEGKKTVWALIPDLKDKLRLHQ  68

Query  2105  RRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRP  1926
             +RAFEFLW+NIAGS+ P++++   K RGGCV+SHSPGAGKTLLIIAFLVSYLKLFPGSRP
Sbjct  69    KRAFEFLWRNIAGSMTPSRMERNQKLRGGCVVSHSPGAGKTLLIIAFLVSYLKLFPGSRP  128

Query  1925  LVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLD  1746
             LVLAPKTTLYTWYKEIIKWK+P+PVYQIHGGQT+KGEVLRQ+MKL  GLP+NQDV+HVLD
Sbjct  129   LVLAPKTTLYTWYKEIIKWKVPVPVYQIHGGQTFKGEVLRQRMKLPSGLPKNQDVLHVLD  188

Query  1745  CLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRST  1566
             CLEK+Q+WL+HPS+LLMGYTSFLTLTREDS YAHR YM Q+L+QCPGILILDEGHNPRST
Sbjct  189   CLEKIQRWLSHPSILLMGYTSFLTLTREDSHYAHRTYMAQLLKQCPGILILDEGHNPRST  248

Query  1565  KSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKG  1386
             KSRLRKALMKV+T LR+LLSGTLFQNNFGEYFNTL LARP FV EVLKELDPKY+ R + 
Sbjct  249   KSRLRKALMKVDTRLRVLLSGTLFQNNFGEYFNTLLLARPSFVHEVLKELDPKYETRNEE  308

Query  1385  AKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGL  1206
               T+FSLENR RK+ IDKIS KIDS K  ER + L  LKKLT  FI+VYEGG+++ LPGL
Sbjct  309   RSTQFSLENRGRKLLIDKISVKIDSKKAGERAQALMTLKKLTNKFINVYEGGNAEELPGL  368

Query  1205  QCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfke  1026
             QCYTLMMKST+LQQ+IL+KLQ+QRP+YKGFPLELELLITLGAIHPWLI+TT CSG YF  
Sbjct  369   QCYTLMMKSTSLQQDILIKLQNQRPVYKGFPLELELLITLGAIHPWLIKTTQCSGVYFSA  428

Query  1025  eelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWR  846
             EEL+ LE++KFD+K+GSKV+FVM+LIPRCL+R EKVLIFCHNIAPINLFL+IFERFYGWR
Sbjct  429   EELDDLEQYKFDMKVGSKVRFVMNLIPRCLVRNEKVLIFCHNIAPINLFLQIFERFYGWR  488

Query  845   KGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEW  666
             KG EVLVLQGDIELFERGRVMDKFEE  GPSKVMLASIT  AEGISLTAASRVILLDSEW
Sbjct  489   KGREVLVLQGDIELFERGRVMDKFEEATGPSKVMLASITASAEGISLTAASRVILLDSEW  548

Query  665   NPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPS  486
             NPSKSKQAIARAFRPGQ+KVVYVYQLLA GTLEEEK+ RTTWKEWVS MIFS++ VEDPS
Sbjct  549   NPSKSKQAIARAFRPGQNKVVYVYQLLANGTLEEEKHSRTTWKEWVSDMIFSDEFVEDPS  608

Query  485   HWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMGR  372
             HWQAPKIEDELL EIVEEDRA LFH IMKNEKASN+ R
Sbjct  609   HWQAPKIEDELLREIVEEDRAALFHRIMKNEKASNVIR  646



>ref|XP_010692922.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692923.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692924.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Beta 
vulgaris subsp. vulgaris]
Length=1312

 Score =   970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/793 (63%), Positives = 610/793 (77%), Gaps = 12/793 (2%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC---QREPIeksst  2550
             S +K ++  +VY++LI   M NI  T+  + P   D WK  Q   +    +       + 
Sbjct  522   SRKKKTLDISVYKDLISTYMKNIQLTIENKLPISTDAWKNLQGASAMYEKKAAADAAPAP  581

Query  2549  nneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
               EEE SE +ML++E+EL LAS Y  +DT+  +     E      K    C H + +++E
Sbjct  582   EEEEEESETEMLFRELELCLASAYYEEDTKAADSDEPVEKFF---KNDGSCQHVYTIDDE  638

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPST--CSSSGKEQRPEEVVMEEKQGDDADLDHFAIPV  2196
             IG++CRLCG V TEI+DV PPFM  +   +   +  + E+   E K  D+A  D    P 
Sbjct  639   IGILCRLCGYVITEIRDVSPPFMRQSGYTAKHDRSDKIEKDDTEHKLLDEACADLVYNPA  698

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGC  2016
             S +   SE    DN W LIP+++ KL  HQ++AFEFLW+N+AGS+IP++++P SKK GGC
Sbjct  699   SYDTLVSESN--DNVWGLIPNIKKKLHDHQKKAFEFLWRNLAGSLIPSEMEPSSKKVGGC  756

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             VISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKEIIKW+ P+PVYQIHG
Sbjct  757   VISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEIIKWEFPVPVYQIHG  816

Query  1835  GQTYKGEVLRQKMKLCPG-LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
              +TY+  +  QK+  C   +  N D+MHVLDCLEK+QKW AHPSVLLMGYTSFL+L RED
Sbjct  817   RRTYRDRIYMQKVGTCSSTVVPNGDIMHVLDCLEKIQKWHAHPSVLLMGYTSFLSLMRED  876

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S YAHR+YM Q+LR+ PGILILDEGHNPRSTKSRLRKALM+V+T  RILLSGTLFQNNFG
Sbjct  877   SKYAHRRYMGQILRESPGILILDEGHNPRSTKSRLRKALMRVDTEFRILLSGTLFQNNFG  936

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsske  1302
             EYFNTLCLARPRFV+EVL+ LDPKYKK++KG  KTR S+ENRARK+F+D I+KKI+S++ 
Sbjct  937   EYFNTLCLARPRFVNEVLRVLDPKYKKKIKGQNKTRTSIENRARKVFMDIIAKKINSNET  996

Query  1301  rerkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
              ER +GLN+LK +T  FIDVYEGGSS+NLPGLQ YTLMMK T LQ EILV+L     + +
Sbjct  997   EERDDGLNMLKNMTNKFIDVYEGGSSENLPGLQSYTLMMKPTPLQHEILVRLHKHMNVAR  1056

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
             GFPLELEL+ITLG+IHPWLI++  C+ ++   EEL++L++F+ D   GSKVKFV+ L+ R
Sbjct  1057  GFPLELELMITLGSIHPWLIKSAVCANKFLSLEELQSLDEFRLDPTKGSKVKFVLGLVQR  1116

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
              ++R+EKVLIFCHNIAPINLFLE+FER YGWRKG EVLVLQGD+ELFERGRVMDKFEE G
Sbjct  1117  SIIRREKVLIFCHNIAPINLFLELFERIYGWRKGHEVLVLQGDLELFERGRVMDKFEERG  1176

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
             GPSKV+LASI  CAEGI+LTAASRV+LLDSEWNPSK KQAIARAFRPGQ+K+VYVYQLL 
Sbjct  1177  GPSKVLLASINACAEGITLTAASRVVLLDSEWNPSKQKQAIARAFRPGQEKIVYVYQLLV  1236

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIM  402
              GTLEE+K+ RTTWKEWVS MIFSE+ V+DPS WQA KIED LL EIVEED A  FHMIM
Sbjct  1237  NGTLEEDKHGRTTWKEWVSCMIFSEEHVDDPSKWQAEKIEDALLREIVEEDHAKSFHMIM  1296

Query  401   KNEKASNMGRLQV  363
             KNEKAS    L+V
Sbjct  1297  KNEKASYENPLKV  1309


 Score =   247 bits (631),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 188/307 (61%), Gaps = 14/307 (5%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M+RRS+H++ HPFD + FE F  G W+ V+R+RI  GT     LD G L EE+  +S +R
Sbjct  1     MRRRSLHRSLHPFDDHAFEVFYQGLWKTVDRLRISCGTITFSFLDLGYLFEEKSFLSTLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +R R AT +DC C LRPG D+SVFS    S++S E++           W DA+I SIER 
Sbjct  61    LRPRRATMTDCTCVLRPGADVSVFSASDNSDESSEDSPS--------GWFDARITSIERT  112

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+F+I  Y         ++ LSKE++ + +++I+I Q +EQKP E+ +YRW L
Sbjct  113   PHESECNCKFYIKFYYINDDTGTDRRKLSKEVETIGISEISIFQVLEQKPSENTHYRWHL  172

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             ++DC++L + KLF  KF SD++W+LVAS  KQ  FDV+S+  ++VY+IL  + +    +S
Sbjct  173   AEDCTSLSRTKLFLSKFASDVTWLLVASVQKQTVFDVRSIEKKLVYQIL--DTNFSPYSS  230

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGP--EGDVYEAGPLVVYD--ELRRSKRRFV  3321
                   V+F+++ E +   +  F P   +  P  +    E  PL  Y+  ELRRSKRR V
Sbjct  231   SVQLSGVNFRIDGETTISTVFPFVPVAKDEAPPVQEVTEEEDPLERYELTELRRSKRRNV  290

Query  3320  QPERYLG  3300
             QPERYLG
Sbjct  291   QPERYLG  297



>ref|XP_004307689.1| PREDICTED: uncharacterized protein LOC101291094 [Fragaria vesca 
subsp. vesca]
Length=1287

 Score =   930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/787 (64%), Positives = 611/787 (78%), Gaps = 21/787 (3%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksstnn  2544
             ++ K S++A  Y+ELI + + ++D + NK++P I+DQWK F+  K+  Q++  E      
Sbjct  510   AYSKRSLNAGAYKELINKFLKDMDCS-NKQEPNIMDQWKNFKEKKNFDQKDETEMPEDEQ  568

Query  2543  eeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIG  2364
             EEE+SE D LWKE +L LASCYLL D E++N  ++      +  G   C H+F L+EEIG
Sbjct  569   EEEMSEEDRLWKEFDLVLASCYLLGD-EESNGATSGNFRQNSGPG---CQHEFTLDEEIG  624

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFA---IPVS  2193
             L C +CG V TEI+ V PPF+ + C  +  +++P+E   + K+ +    + F    IPV 
Sbjct  625   LKCIICGFVKTEIRHVTPPFVRNPCGFTD-DKKPDEEDPDPKRAEYEQFNFFHKRDIPVD  683

Query  2192  SNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCV  2013
                P    E  +N WALIP+LR KL  HQ++AFEFLWKNIAGS+ P  ++ +SKK GGCV
Sbjct  684   EPVP----EENENVWALIPELRKKLLFHQKKAFEFLWKNIAGSMEPALMEKKSKKNGGCV  739

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW IPIPVY IHG 
Sbjct  740   ISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWNIPIPVYLIHGR  799

Query  1832  QTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
             +TY+  V R         P+   DVMHVLDCLEK+QKW A PSVL+MGYTSFLTL REDS
Sbjct  800   RTYR--VFRNNSASYTRGPKPTDDVMHVLDCLEKIQKWHAQPSVLVMGYTSFLTLMREDS  857

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              + HR++M QVLR+ PGIL+LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF E
Sbjct  858   KFVHRRFMAQVLRESPGILVLDEGHNPRSTKSRLRKGLMKVETDLRILLSGTLFQNNFCE  917

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGAK--TRFSLENRARKMFidkiskkidssk-  1305
             YFNTLCLARP+FV+EVLK LDPKY+++ K  K   R  +E RARK+F+DKI+KKIDS++ 
Sbjct  918   YFNTLCLARPKFVNEVLKALDPKYRRKKKALKDKARHLMEARARKLFLDKIAKKIDSNEG  977

Query  1304  ererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIY  1125
             E +R EGLN L+K+T  FIDVYEGG+SD LPGLQ YTL+M +T +QQ IL +LQ     Y
Sbjct  978   EDQRIEGLNKLRKITNRFIDVYEGGNSDTLPGLQIYTLLMNTTDIQQVILDRLQQIMATY  1037

Query  1124  KGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIP  945
             KG+PLELELLITLG+IHPWLI+T AC+ ++F  EEL ALE++K+DL  GSKVKFV++L+ 
Sbjct  1038  KGYPLELELLITLGSIHPWLIKTAACADKFFSPEELLALEQYKYDLHKGSKVKFVLNLVY  1097

Query  944   RCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEV  765
             R + RKEKVLIFCHNIAP+ LFLE+FER + W +G EVLVL GD+ELFERG+VMDKFEE 
Sbjct  1098  R-VTRKEKVLIFCHNIAPVKLFLELFERVFQWERGREVLVLTGDLELFERGKVMDKFEEP  1156

Query  764   GGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLL  585
             GG S+V+LASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ KVVYVYQLL
Sbjct  1157  GGASRVLLASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLL  1216

Query  584   ATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMI  405
             ATGTLEE+KY+RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+V ED++  FHMI
Sbjct  1217  ATGTLEEDKYRRTTWKEWVSSMIFSEAFVEDPSRWQAEKIEDDILREMVGEDKSKAFHMI  1276

Query  404   MKNEKAS  384
             MKNEKAS
Sbjct  1277  MKNEKAS  1283


 Score =   259 bits (662),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 191/306 (62%), Gaps = 10/306 (3%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             +R +++ +HPFD +PFEA   GSW+ VE IR+ NGT  M  +D   +I+++   +N+R+R
Sbjct  4     KRHLYRAKHPFDAHPFEALCCGSWKGVELIRLSNGTMNMKFVDHPCVIQDKGPFANLRVR  63

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR AT  DC C LRP +DI V S    +E SDE+         +   +DA+I SIER PH
Sbjct  64    SRRATLYDCICLLRPSVDICVLSNSDHTESSDEKRR-------DAICVDARISSIERGPH  116

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
                C C+FH++ YV QGP    + TL KE +V+ ++Q+ ILQ++++  C ++YYRW  S 
Sbjct  117   DSQCSCRFHVNFYVNQGPLGSERATLKKETEVIGIDQVFILQRLDRNSCRNQYYRWDRSV  176

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             D S+L   KL  GKF SDLSW+LV S+ KQ+ FDV+SV N+IVY+I    +D    +S  
Sbjct  177   DSSSLPNTKLLLGKFLSDLSWLLVTSSLKQIVFDVRSVQNKIVYQIFSGNDDTTPSDSGN  236

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERG-PEGDVYEAGPLVVYD--ELRRSKRRFVQPE  3312
                AV+F +EN +  PII+Q  PD    G P  D++E  P    D  ELRRSKRR  QP+
Sbjct  237   SFKAVNFGVENGIPVPIILQLVPDDSTGGDPACDMHEDRPSPTSDFPELRRSKRRKTQPD  296

Query  3311  RYLGCD  3294
             R+L CD
Sbjct  297   RFLACD  302



>ref|XP_007141730.1| hypothetical protein PHAVU_008G220500g [Phaseolus vulgaris]
 gb|ESW13724.1| hypothetical protein PHAVU_008G220500g [Phaseolus vulgaris]
Length=1310

 Score =   929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/787 (63%), Positives = 608/787 (77%), Gaps = 16/787 (2%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSC-QREPIeksstnn  2544
             +++  +++A  Y++LI   + NI+    +E+P I DQWKE   T +  Q+         +
Sbjct  536   NYKDRTLNAAAYKDLINSYLKNINTKPTQEEPSITDQWKENNTTSTIGQKTGTGTLDEED  595

Query  2543  eeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIG  2364
              EE+SE+DMLW+E+E++LASCYL    ED+N    T+     +K    C HDFR+NEEIG
Sbjct  596   AEEVSEMDMLWRELEVSLASCYL---EEDSNAAFITD---TVEKPNEGCPHDFRMNEEIG  649

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNK  2184
             + C  CG+VSTEIK + PPF+  +     ++   EE        DD DL+ F    S   
Sbjct  650   IYCYRCGLVSTEIKYITPPFIQHSAWHQEEKHSAEEDSRIRVDEDD-DLNLFPALDSPEG  708

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISH  2004
             P S+    DN WALIP+LR KL AHQ++AFEFLW+NIAGS+ P  ++ +SK+ GGCV+SH
Sbjct  709   PVSQEN--DNVWALIPELRIKLHAHQKKAFEFLWQNIAGSMEPRLMEAKSKRMGGCVVSH  766

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW IPIPVY IHG +TY
Sbjct  767   TPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWDIPIPVYLIHGRRTY  826

Query  1823  KGEVLRQKMKLC-PGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
             +  V +QK  +  PG+P+   DV HVLDCLEK+QKW + PSVL+MGYTSFLTL REDS +
Sbjct  827   R--VFKQKSPVVLPGVPKPTDDVKHVLDCLEKIQKWHSQPSVLIMGYTSFLTLMREDSKF  884

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
             AHRKYM +VLR+ PGI++LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYF
Sbjct  885   AHRKYMAKVLRESPGIMVLDEGHNPRSTKSRLRKVLMKVQTKLRILLSGTLFQNNFCEYF  944

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAK-TRFSLENRARKMFidkiskkidsskerer  1293
             NTLCLARP+F+ EVLK LDPKY+++ K AK     LE+RARK F+DKI+KKIDS K RER
Sbjct  945   NTLCLARPKFIHEVLKALDPKYRRKGKVAKKASHLLESRARKFFLDKIAKKIDSGKGRER  1004

Query  1292  kEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
             ++GL +L+ +T GFIDVYEGGS+D LPGLQ YTL+M ST  Q EIL KL  +     G+P
Sbjct  1005  QQGLKMLRNVTNGFIDVYEGGSADGLPGLQIYTLLMNSTDTQHEILHKLHKKMSQCNGYP  1064

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
             LELELLITLG+IHPWL++T  C+ ++F  E+L  LEK KFDLK+GSKV+FV+SLI R ++
Sbjct  1065  LELELLITLGSIHPWLVKTAVCAQKFFSSEQLMELEKCKFDLKIGSKVRFVLSLIYR-VV  1123

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
             RKEKVLIFCHNIAP+ LF+E FE+++GW +G EVLVL G++ELFERGRVMDKFEE GG +
Sbjct  1124  RKEKVLIFCHNIAPVKLFVEYFEKYFGWLRGKEVLVLTGELELFERGRVMDKFEEPGGVA  1183

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             K++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLL TG+
Sbjct  1184  KILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLVTGS  1243

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNE  393
             LEE+KY+RTTWKEWVSSMIFSE  VEDPS WQA KIED++L E+V EDR+  FHMIMKNE
Sbjct  1244  LEEDKYRRTTWKEWVSSMIFSEAFVEDPSQWQAEKIEDDILREMVAEDRSKSFHMIMKNE  1303

Query  392   KASNMGR  372
             KAS+  +
Sbjct  1304  KASSTNK  1310


 Score =   265 bits (678),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 141/315 (45%), Positives = 198/315 (63%), Gaps = 10/315 (3%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             ++R + Q +HPF+ +PFEA   G WQ VE I+I+ G   MH +D   +  E+  +S++RI
Sbjct  4     RKRRLDQTKHPFNSHPFEAVAYGKWQAVEFIKIEAGILSMHFVDNHYMTMEKGPLSDIRI  63

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
              SR AT SDC+ FLRPG+DI V S P QS DSD           +P W DAKI SI+RKP
Sbjct  64    SSRKATLSDCSRFLRPGIDICVLSAPQQSTDSDAIVI-------DPVWTDAKISSIQRKP  116

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             H   C CQF+++ YV QG      +TLSKEIKVV + QI+ILQK+E  PCED++YRW+ S
Sbjct  117   HDSECSCQFYVNFYVHQGSLGAELRTLSKEIKVVGIKQISILQKLENTPCEDQHYRWASS  176

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSE  3486
             +DCS +   KL  GK   DLSW++VASA K++ F  + +  ++VY+IL  +    + N +
Sbjct  177   EDCSIISHTKLLLGKVLCDLSWLVVASALKKISFCFRCLEEKLVYQILGRDTVSTSLNKD  236

Query  3485  YHSYAVSFKLENEVSTPIIIQFNPDIPER-GPEGDVYEAGPLVVY--DELRRSKRRFVQP  3315
             +H   V+F+ E+ +  P + Q    + ++ G   + +E    + Y  + LRRSKRR VQP
Sbjct  237   FHIDVVNFRTESGMLVPFVSQVATPVTKKIGHVQESHEDKVSLSYSVEGLRRSKRRNVQP  296

Query  3314  ERYLGCDDYLTEFDV  3270
             ERYLGCD+  +E DV
Sbjct  297   ERYLGCDNDASEIDV  311



>ref|XP_006576108.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like [Glycine 
max]
Length=1311

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 515/880 (59%), Positives = 640/880 (73%), Gaps = 36/880 (4%)
 Frame = -3

Query  2981  LSFEDNE-----DLSAEIREIVSKYIYVNGS-SAVEMKKSSLNLMQ--GRRWGQVKVSKL  2826
             L+FE +      D + +I ++ S+Y Y  G+  +  M  S L+ M   G +W  +  SK 
Sbjct  453   LTFESHNHAAKSDDADKIDDLSSRYHYSYGTPKSQRMGLSDLDDMVDLGNKWEGISSSK-  511

Query  2825  KFMGLDVkgggigsskkkakKRTCPSQRDSIYDIR-SFRKGSISANVYRELIRRCMANID  2649
              F G             K ++ T    RD     R +++  S++A  Y++LI   + N++
Sbjct  512   GFQG-------------KKQRTTYLRSRDHGEQKRYNYKDRSLNAAAYKDLINSYLKNMN  558

Query  2648  ETLNKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDMLWKEMELALASCYLL  2472
                  E+  I DQWK+ +   +  Q+   +     + EE SE+DMLW+E+E++LASCYL 
Sbjct  559   TRPTNEESAIADQWKQSETPSNIGQKTETQMLDEEDAEEESEMDMLWRELEVSLASCYLE  618

Query  2471  DDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPST  2292
             ++TED++    TE       G   C HDFR+NEEIG+ C  CG VSTEIK + PPF+  +
Sbjct  619   EETEDSHAAVFTETLENPNPG---CPHDFRMNEEIGIYCYRCGFVSTEIKYITPPFIQHS  675

Query  2291  CSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRA  2112
                  ++Q PEE   + K   D D D   +P   +      +  +N WALIP+L+ KL A
Sbjct  676   VRHQEEKQSPEE---DSKTKPDEDDDIDLLPALDSPEKLVSQENENVWALIPELKAKLHA  732

Query  2111  HQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGS  1932
             HQ++AFEFLW+NIAGS+ P  ++  SK+RGGCVISH+PGAGKT LIIAFLVSYLKLFPG 
Sbjct  733   HQKKAFEFLWQNIAGSMDPELMETASKRRGGCVISHTPGAGKTFLIIAFLVSYLKLFPGK  792

Query  1931  RPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLC-PGLPR-NQDVM  1758
             RPLVLAPKTTLYTWYKE IKW IPIPVY IHG +TY+  V +QK  +  PG+P+   DV 
Sbjct  793   RPLVLAPKTTLYTWYKEFIKWDIPIPVYLIHGRRTYR--VFKQKSSIVIPGVPKPTDDVK  850

Query  1757  HVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHN  1578
             HVLDCLEK+QKW +HPSVL+MGYTSFLTL REDS +AHRKYM +VLR+ PGI++LDEGHN
Sbjct  851   HVLDCLEKIQKWHSHPSVLIMGYTSFLTLMREDSKFAHRKYMAKVLRESPGIMVLDEGHN  910

Query  1577  PRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKK  1398
             PRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLARP+F+ EVLK LD KYK+
Sbjct  911   PRSTKSRLRKVLMKVQTELRILLSGTLFQNNFCEYFNTLCLARPKFIHEVLKALDSKYKR  970

Query  1397  RVKGAK-TRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSD  1221
             + K AK     LE+RARK F+D+I+KKIDS+  RER++GL +L+ +T GFIDVYEG SSD
Sbjct  971   KGKVAKKASHLLESRARKFFLDQIAKKIDSNNGRERRQGLKMLRNVTNGFIDVYEGRSSD  1030

Query  1220  NLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSG  1041
              LPGLQ YTL+M ST  Q EIL +L  +     G+PLELELLITLG+IHPWL+++  C+ 
Sbjct  1031  GLPGLQIYTLLMNSTDTQHEILHELHKKMARVNGYPLELELLITLGSIHPWLVKSAVCAE  1090

Query  1040  QYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFER  861
             ++F   +L  LEK KFDL++GSKVKFV+SLI R +++KEKVLIFCHNIAP+ LF+E FE+
Sbjct  1091  KFFTPAQLMELEKCKFDLRIGSKVKFVLSLIYR-VVKKEKVLIFCHNIAPVKLFVEYFEK  1149

Query  860   FYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVIL  681
             ++GW KG EVLVL G++ELFERGRVMDKFEE GG +K++LASIT CAEGISLTAASRVI+
Sbjct  1150  YFGWTKGREVLVLSGELELFERGRVMDKFEEPGGVAKILLASITACAEGISLTAASRVIM  1209

Query  680   LDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDL  501
             LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLL TG+LEE+KYKRTTWKEWVSSMIFSE  
Sbjct  1210  LDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLVTGSLEEDKYKRTTWKEWVSSMIFSEAF  1269

Query  500   VEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASN  381
             VEDPS WQA KIED +L E+V EDR+  FHMIMKNEK S 
Sbjct  1270  VEDPSQWQAEKIEDYILREMVAEDRSKSFHMIMKNEKTST  1309


 Score =   259 bits (662),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 142/319 (45%), Positives = 203/319 (64%), Gaps = 12/319 (4%)
 Frame = -3

Query  4211  AMKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNV  4032
             A ++R + Q +HPF  +PFEA   GSWQ VE I+I+ GT  MH  D   ++ E+  +S++
Sbjct  29    AHRKRRLDQLKHPFSPHPFEAVAFGSWQAVEFIKIEAGTMSMHFADNHHVVMEKGPLSDI  88

Query  4031  RIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIER  3852
             RIRSR AT  DC+ FLRPG+D+ V S P QS+D+D        +  +P W DAKI S++R
Sbjct  89    RIRSRKATLPDCSRFLRPGIDVCVLSAPQQSDDADAG------INLDPVWTDAKISSVQR  142

Query  3851  KPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             KPH   C CQF+++ YV QG      +TL+KEIKVV +NQI+ILQK+E  PCE+++YRW+
Sbjct  143   KPHDSECSCQFYVNFYVHQGSLGAELRTLNKEIKVVGINQISILQKLESTPCENQHYRWA  202

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASA-HKQVGFDVKSVHNRIVYEILKDENDIDAP  3495
              S+DCS +   KL  GK   DLSW++V +A  K+V F V+S+ +++VY++L+ +  +   
Sbjct  203   SSEDCSIISHTKLLLGKVLCDLSWLVVTTALKKKVSFCVRSLEDKLVYQVLERDTTVSTS  262

Query  3494  -NSEYHSYAVSFKLENEVSTPIIIQFNPDIPER-GPEGDVYE--AGPLVVYDELRRSKRR  3327
              N+E H   V+FK E      I+ Q      +R  PE + +E    P    + LRRSKRR
Sbjct  263   LNNESHIDVVNFKTEKGTLFSIVSQVATLKTKRVEPEQESHEDKESPSYNVEGLRRSKRR  322

Query  3326  FVQPERYLGCDDYLTEFDV  3270
              VQPERYLGC+  +++ DV
Sbjct  323   NVQPERYLGCEK-VSQIDV  340



>gb|KCW50427.1| hypothetical protein EUGRSUZ_J00168 [Eucalyptus grandis]
Length=1206

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/796 (62%), Positives = 607/796 (76%), Gaps = 21/796 (3%)
 Frame = -3

Query  2750  SQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSCQR  2574
             ++R+ + + R + + ++SA +Y++LI+  M +ID T+ N E+P ++DQW    +     R
Sbjct  423   TKRECLTEERIYGQRTLSAGMYKDLIKSYMKSIDSTVTNNEEPLLVDQWNRLASRNHVDR  482

Query  2573  E-PIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC  2397
                +E  S   E E  EL+MLW+EMEL++ S YL ++ E +  +   E     ++    C
Sbjct  483   RFEVEMPSPVEEVEDPELEMLWREMELSMTSSYLFEENEGSKAELCNEY---VERTINRC  539

Query  2396  HHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPS----TCSSSGKEQRPEEVVMEEKQGD  2229
             HH+  L+EEIG++C+LCG V +EI+D+ P F+PS    T   +  EQ PE       Q +
Sbjct  540   HHENILDEEIGILCKLCGTVISEIRDISPAFLPSATWTTDHKTNNEQNPEH-----DQAE  594

Query  2228  DADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ  2049
             D  LD F    +S+   +E    +N W LIP+LR KL  HQ++AFEFLW+N+ GS++P Q
Sbjct  595   DEGLDIFCKNDASDPKVAEEN--ENVWTLIPELRKKLHIHQKKAFEFLWQNVTGSLLPAQ  652

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
             ++   KK GGCVISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTW+KE +KW
Sbjct  653   METSGKKTGGCVISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWHKEFVKW  712

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMG  1692
             +IPIPVY IHG ++Y+  V RQK     G+P+  QDVMHVLDCLEK+QKW AHPSVL+MG
Sbjct  713   EIPIPVYLIHGRRSYR--VFRQKSISFAGMPKPGQDVMHVLDCLEKIQKWHAHPSVLVMG  770

Query  1691  YTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRIL  1512
             YTSFLTL REDS +AHRK+M +VLR+ PGILILDEGHNPRSTKSRLRK LMKV T LRIL
Sbjct  771   YTSFLTLMREDSKFAHRKHMAKVLRESPGILILDEGHNPRSTKSRLRKVLMKVQTDLRIL  830

Query  1511  LSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidk  1332
             LSGTLFQNNF EYFNTLCLARP+F+ EVL+ LDPK++K+ K  K R  LE+RARK FID 
Sbjct  831   LSGTLFQNNFCEYFNTLCLARPKFIHEVLRVLDPKFRKKTK-KKARNLLESRARKFFIDN  889

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILV  1152
             I  KI+SS   ER +GLN+L+ +T+GFID YE G+SD LPGLQ YTL+M  T +QQ +L+
Sbjct  890   IGNKINSSNNEERIQGLNMLRNMTSGFIDNYEAGNSDTLPGLQSYTLLMNPTDIQQHVLL  949

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSK  972
             KL      Y G+PLELELLITLG+IHPWL++T  C+ ++F  EEL  L+K KFD+K GSK
Sbjct  950   KLHRIMSKYHGYPLELELLITLGSIHPWLVKTACCASKFFNREELNQLDKHKFDIKKGSK  1009

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
             VKFV+SL+ R + +KEKVLIFCHNIAPINLFLE+FE  +GWRKG EV+VL GD+ELFERG
Sbjct  1010  VKFVLSLVYR-VFQKEKVLIFCHNIAPINLFLELFENIFGWRKGKEVMVLTGDLELFERG  1068

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
             RVMD+FEE G PS+++LASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ 
Sbjct  1069  RVMDQFEEPGHPSRILLASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQ  1128

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEE  432
             K+VYVYQLLA  TLEE+KY+RTTWKEWVSSMIFSE  VEDPS WQ  K+EDE+L E+VEE
Sbjct  1129  KMVYVYQLLAANTLEEDKYRRTTWKEWVSSMIFSEAFVEDPSCWQRNKLEDEILREMVEE  1188

Query  431   DRATLFHMIMKNEKAS  384
             D++   HMIMKNEKAS
Sbjct  1189  DKSKSIHMIMKNEKAS  1204


 Score =   176 bits (447),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 159/270 (59%), Gaps = 42/270 (16%)
 Frame = -3

Query  4082  VLDEGDLIEEEISISNVRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEK  3903
              +D+   IEE    +NVRI+SR AT SDC CFLRPG+DI V S                 
Sbjct  5     TVDDQYTIEESGPFTNVRIKSRQATLSDCTCFLRPGVDICVLS-----------------  47

Query  3902  MEPEPAWIDAKIRSIERKPHGFGCVCQ-FHISVYVTQGPPPIVKKTLSKEIKVVQLNQIA  3726
                 P+           K   FG + + F++ +Y ++ P    K  LS+EI +V ++ I+
Sbjct  48    ----PS----------EKSDCFGELQEPFYVKLYTSKCPLGSEKGVLSQEIILVGIDDIS  93

Query  3725  ILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVH  3546
             ILQ+++ K  E + YRW+ ++DCS LQ+ KL  G+F +D+SW+LV SA KQ+ F+++S+H
Sbjct  94    ILQRLDSKHFESQLYRWTYAEDCSLLQRSKLLLGRFLADISWLLVTSALKQIIFNIRSLH  153

Query  3545  NRIVYEILKDENDIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDV----Y  3378
             N+IVYEI   +  + + +++ +   ++FK+ENEV  PII+Q    IP +  E  V    +
Sbjct  154   NKIVYEICGRDGRV-SFDTDNNLRTLNFKVENEVMLPIIVQ---HIPTKTSEAVVAFEEH  209

Query  3377  EAGPLVVYD--ELRRSKRRFVQPERYLGCD  3294
             E+  +   D  +LRRSKRR VQPER+LGCD
Sbjct  210   ESALVPFSDVMDLRRSKRRNVQPERFLGCD  239



>ref|XP_010031162.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Eucalyptus grandis]
Length=1261

 Score =   920 bits (2377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/796 (62%), Positives = 607/796 (76%), Gaps = 21/796 (3%)
 Frame = -3

Query  2750  SQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSCQR  2574
             ++R+ + + R + + ++SA +Y++LI+  M +ID T+ N E+P ++DQW    +     R
Sbjct  478   TKRECLTEERIYGQRTLSAGMYKDLIKSYMKSIDSTVTNNEEPLLVDQWNRLASRNHVDR  537

Query  2573  E-PIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC  2397
                +E  S   E E  EL+MLW+EMEL++ S YL ++ E +  +   E     ++    C
Sbjct  538   RFEVEMPSPVEEVEDPELEMLWREMELSMTSSYLFEENEGSKAELCNEY---VERTINRC  594

Query  2396  HHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPS----TCSSSGKEQRPEEVVMEEKQGD  2229
             HH+  L+EEIG++C+LCG V +EI+D+ P F+PS    T   +  EQ PE       Q +
Sbjct  595   HHENILDEEIGILCKLCGTVISEIRDISPAFLPSATWTTDHKTNNEQNPEH-----DQAE  649

Query  2228  DADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ  2049
             D  LD F    +S+   +E    +N W LIP+LR KL  HQ++AFEFLW+N+ GS++P Q
Sbjct  650   DEGLDIFCKNDASDPKVAEEN--ENVWTLIPELRKKLHIHQKKAFEFLWQNVTGSLLPAQ  707

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
             ++   KK GGCVISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTW+KE +KW
Sbjct  708   METSGKKTGGCVISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWHKEFVKW  767

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMG  1692
             +IPIPVY IHG ++Y+  V RQK     G+P+  QDVMHVLDCLEK+QKW AHPSVL+MG
Sbjct  768   EIPIPVYLIHGRRSYR--VFRQKSISFAGMPKPGQDVMHVLDCLEKIQKWHAHPSVLVMG  825

Query  1691  YTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRIL  1512
             YTSFLTL REDS +AHRK+M +VLR+ PGILILDEGHNPRSTKSRLRK LMKV T LRIL
Sbjct  826   YTSFLTLMREDSKFAHRKHMAKVLRESPGILILDEGHNPRSTKSRLRKVLMKVQTDLRIL  885

Query  1511  LSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidk  1332
             LSGTLFQNNF EYFNTLCLARP+F+ EVL+ LDPK++K+ K  K R  LE+RARK FID 
Sbjct  886   LSGTLFQNNFCEYFNTLCLARPKFIHEVLRVLDPKFRKKTK-KKARNLLESRARKFFIDN  944

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILV  1152
             I  KI+SS   ER +GLN+L+ +T+GFID YE G+SD LPGLQ YTL+M  T +QQ +L+
Sbjct  945   IGNKINSSNNEERIQGLNMLRNMTSGFIDNYEAGNSDTLPGLQSYTLLMNPTDIQQHVLL  1004

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSK  972
             KL      Y G+PLELELLITLG+IHPWL++T  C+ ++F  EEL  L+K KFD+K GSK
Sbjct  1005  KLHRIMSKYHGYPLELELLITLGSIHPWLVKTACCASKFFNREELNQLDKHKFDIKKGSK  1064

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
             VKFV+SL+ R + +KEKVLIFCHNIAPINLFLE+FE  +GWRKG EV+VL GD+ELFERG
Sbjct  1065  VKFVLSLVYR-VFQKEKVLIFCHNIAPINLFLELFENIFGWRKGKEVMVLTGDLELFERG  1123

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
             RVMD+FEE G PS+++LASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ 
Sbjct  1124  RVMDQFEEPGHPSRILLASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQ  1183

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEE  432
             K+VYVYQLLA  TLEE+KY+RTTWKEWVSSMIFSE  VEDPS WQ  K+EDE+L E+VEE
Sbjct  1184  KMVYVYQLLAANTLEEDKYRRTTWKEWVSSMIFSEAFVEDPSCWQRNKLEDEILREMVEE  1243

Query  431   DRATLFHMIMKNEKAS  384
             D++   HMIMKNEKAS
Sbjct  1244  DKSKSIHMIMKNEKAS  1259


 Score =   247 bits (631),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 135/299 (45%), Positives = 191/299 (64%), Gaps = 18/299 (6%)
 Frame = -3

Query  4172  FDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCA  3993
             F +  FEA   GSWQPVE IRI +G      +D+   IEE    +NVRI+SR AT SDC 
Sbjct  8     FLMSAFEALCVGSWQPVESIRISHGRMTTCTVDDQYTIEESGPFTNVRIKSRQATLSDCT  67

Query  3992  CFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHI  3813
             CFLRPG+DI V S   +S+   E          EP W+DA+I SIERKPH   C CQF++
Sbjct  68    CFLRPGVDICVLSPSEKSDCFGELQ--------EPGWVDARISSIERKPHESRCCCQFYV  119

Query  3812  SVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKL  3633
              +Y ++ P    K  LS+EI +V ++ I+ILQ+++ K  E + YRW+ ++DCS LQ+ KL
Sbjct  120   KLYTSKCPLGSEKGVLSQEIILVGIDDISILQRLDSKHFESQLYRWTYAEDCSLLQRSKL  179

Query  3632  FTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEYHSYAVSFKLE  3453
               G+F +D+SW+LV SA KQ+ F+++S+HN+IVYEI   +  + + +++ +   ++FK+E
Sbjct  180   LLGRFLADISWLLVTSALKQIIFNIRSLHNKIVYEICGRDGRV-SFDTDNNLRTLNFKVE  238

Query  3452  NEVSTPIIIQFNPDIPERGPEGDV----YEAGPLVVYD--ELRRSKRRFVQPERYLGCD  3294
             NEV  PII+Q    IP +  E  V    +E+  +   D  +LRRSKRR VQPER+LGCD
Sbjct  239   NEVMLPIIVQ---HIPTKTSEAVVAFEEHESALVPFSDVMDLRRSKRRNVQPERFLGCD  294



>ref|XP_010031159.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010031160.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010031161.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Eucalyptus grandis]
Length=1267

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/796 (62%), Positives = 607/796 (76%), Gaps = 21/796 (3%)
 Frame = -3

Query  2750  SQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSCQR  2574
             ++R+ + + R + + ++SA +Y++LI+  M +ID T+ N E+P ++DQW    +     R
Sbjct  484   TKRECLTEERIYGQRTLSAGMYKDLIKSYMKSIDSTVTNNEEPLLVDQWNRLASRNHVDR  543

Query  2573  E-PIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC  2397
                +E  S   E E  EL+MLW+EMEL++ S YL ++ E +  +   E     ++    C
Sbjct  544   RFEVEMPSPVEEVEDPELEMLWREMELSMTSSYLFEENEGSKAELCNEY---VERTINRC  600

Query  2396  HHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPS----TCSSSGKEQRPEEVVMEEKQGD  2229
             HH+  L+EEIG++C+LCG V +EI+D+ P F+PS    T   +  EQ PE       Q +
Sbjct  601   HHENILDEEIGILCKLCGTVISEIRDISPAFLPSATWTTDHKTNNEQNPEH-----DQAE  655

Query  2228  DADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ  2049
             D  LD F    +S+   +E    +N W LIP+LR KL  HQ++AFEFLW+N+ GS++P Q
Sbjct  656   DEGLDIFCKNDASDPKVAEEN--ENVWTLIPELRKKLHIHQKKAFEFLWQNVTGSLLPAQ  713

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
             ++   KK GGCVISH+PGAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTW+KE +KW
Sbjct  714   METSGKKTGGCVISHTPGAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWHKEFVKW  773

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMG  1692
             +IPIPVY IHG ++Y+  V RQK     G+P+  QDVMHVLDCLEK+QKW AHPSVL+MG
Sbjct  774   EIPIPVYLIHGRRSYR--VFRQKSISFAGMPKPGQDVMHVLDCLEKIQKWHAHPSVLVMG  831

Query  1691  YTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRIL  1512
             YTSFLTL REDS +AHRK+M +VLR+ PGILILDEGHNPRSTKSRLRK LMKV T LRIL
Sbjct  832   YTSFLTLMREDSKFAHRKHMAKVLRESPGILILDEGHNPRSTKSRLRKVLMKVQTDLRIL  891

Query  1511  LSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidk  1332
             LSGTLFQNNF EYFNTLCLARP+F+ EVL+ LDPK++K+ K  K R  LE+RARK FID 
Sbjct  892   LSGTLFQNNFCEYFNTLCLARPKFIHEVLRVLDPKFRKKTK-KKARNLLESRARKFFIDN  950

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILV  1152
             I  KI+SS   ER +GLN+L+ +T+GFID YE G+SD LPGLQ YTL+M  T +QQ +L+
Sbjct  951   IGNKINSSNNEERIQGLNMLRNMTSGFIDNYEAGNSDTLPGLQSYTLLMNPTDIQQHVLL  1010

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSK  972
             KL      Y G+PLELELLITLG+IHPWL++T  C+ ++F  EEL  L+K KFD+K GSK
Sbjct  1011  KLHRIMSKYHGYPLELELLITLGSIHPWLVKTACCASKFFNREELNQLDKHKFDIKKGSK  1070

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
             VKFV+SL+ R + +KEKVLIFCHNIAPINLFLE+FE  +GWRKG EV+VL GD+ELFERG
Sbjct  1071  VKFVLSLVYR-VFQKEKVLIFCHNIAPINLFLELFENIFGWRKGKEVMVLTGDLELFERG  1129

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
             RVMD+FEE G PS+++LASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ 
Sbjct  1130  RVMDQFEEPGHPSRILLASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQ  1189

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEE  432
             K+VYVYQLLA  TLEE+KY+RTTWKEWVSSMIFSE  VEDPS WQ  K+EDE+L E+VEE
Sbjct  1190  KMVYVYQLLAANTLEEDKYRRTTWKEWVSSMIFSEAFVEDPSCWQRNKLEDEILREMVEE  1249

Query  431   DRATLFHMIMKNEKAS  384
             D++   HMIMKNEKAS
Sbjct  1250  DKSKSIHMIMKNEKAS  1265


 Score =   266 bits (681),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 202/310 (65%), Gaps = 18/310 (6%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             +RR ++ ++HPF+ YPFEA   GSWQPVE IRI +G      +D+   IEE    +NVRI
Sbjct  3     RRRDLYLSKHPFNAYPFEALCVGSWQPVESIRISHGRMTTCTVDDQYTIEESGPFTNVRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             +SR AT SDC CFLRPG+DI V S   +S+   E          EP W+DA+I SIERKP
Sbjct  63    KSRQATLSDCTCFLRPGVDICVLSPSEKSDCFGELQ--------EPGWVDARISSIERKP  114

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             H   C CQF++ +Y ++ P    K  LS+EI +V ++ I+ILQ+++ K  E + YRW+ +
Sbjct  115   HESRCCCQFYVKLYTSKCPLGSEKGVLSQEIILVGIDDISILQRLDSKHFESQLYRWTYA  174

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSE  3486
             +DCS LQ+ KL  G+F +D+SW+LV SA KQ+ F+++S+HN+IVYEI   +  + + +++
Sbjct  175   EDCSLLQRSKLLLGRFLADISWLLVTSALKQIIFNIRSLHNKIVYEICGRDGRV-SFDTD  233

Query  3485  YHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDV----YEAGPLVVYD--ELRRSKRRF  3324
              +   ++FK+ENEV  PII+Q    IP +  E  V    +E+  +   D  +LRRSKRR 
Sbjct  234   NNLRTLNFKVENEVMLPIIVQ---HIPTKTSEAVVAFEEHESALVPFSDVMDLRRSKRRN  290

Query  3323  VQPERYLGCD  3294
             VQPER+LGCD
Sbjct  291   VQPERFLGCD  300



>ref|XP_010535836.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010535838.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010535839.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X2 [Tarenaya hassleriana]
Length=1129

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/803 (61%), Positives = 604/803 (75%), Gaps = 20/803 (2%)
 Frame = -3

Query  2762  RTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNT  2589
             R+   + D I   +   K ++SA  Y +LI   M NID T+  +  P  +++QW+E +  
Sbjct  335   RSIVLKTDDIDGPKIHTKKTLSAGAYNKLIDSYMKNIDSTIAAKDEPTNVVEQWEELKKV  394

Query  2588  KSCQR---EPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMAT  2418
             K+  +   E  E SS  ++ E SE +MLW+EMEL LAS Y+LDD E      A   + A 
Sbjct  395   KASSKQNGENDETSSEEDDGETSENEMLWREMELCLASSYILDDNE------ARVDNEAI  448

Query  2417  KKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEK  2238
             +K    C HD+RL+EEIGL+CRLCG + TEIK V  PF      ++ K+Q  E+ +    
Sbjct  449   QKSNGGCEHDYRLDEEIGLLCRLCGHIKTEIKHVSAPFAEHKKWTTEKKQIDEDDIRTTN  508

Query  2237  QGDDADLDHFAIPVSSNKPSSEV---EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAG  2067
              G D + +   +  + +  SSE+   E  DN W+LIP+L+ KL  HQ+RAFEFLW+N+AG
Sbjct  509   VGQDRNTEDLNMS-ADHASSSELPLGEENDNVWSLIPELKRKLHLHQKRAFEFLWRNLAG  567

Query  2066  SIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWY  1887
             +++P ++DP S   GGCVISHSPGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWY
Sbjct  568   AMVPAEMDPSSDNIGGCVISHSPGAGKTFLIIAFLASYLKLFPGKRPLVLAPKTTLYTWY  627

Query  1886  KEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHP  1710
             KE IKW+IP+PV+ IHG +TY   VL+Q      G P+ +QDVMHVLDCL+K+QKW ++P
Sbjct  628   KEFIKWEIPVPVHLIHGRRTYC--VLKQNPIPIKGFPKPSQDVMHVLDCLDKIQKWHSNP  685

Query  1709  SVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVN  1530
             SVL+MGY+SF TL REDS  AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+
Sbjct  686   SVLVMGYSSFQTLMREDSKLAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVD  745

Query  1529  TSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRAR  1350
             T LRILLSGTLFQNNF EYFNTLCLARP+FV E+L ELD K+K      K    LENRAR
Sbjct  746   TDLRILLSGTLFQNNFCEYFNTLCLARPKFVHEILMELDQKFKTNQGVNKAPHLLENRAR  805

Query  1349  KMFidkiskkidsskererkEGLNILKKLTTGFIDVYEG-GSSDNLPGLQCYTLMMKSTT  1173
             K F+D I+KKIDSS   ER +GLN+L+ +T GFIDVYEG GS D LPGLQ YTL+M ST 
Sbjct  806   KFFLDIIAKKIDSSVGEERHQGLNMLRNMTNGFIDVYEGNGSGDVLPGLQIYTLLMNSTD  865

Query  1172  LQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkf  993
             +Q  +L+KLQ+    + G+PLELELLITL AIHPWLI+T+ C  ++F  +EL  +E+ K+
Sbjct  866   VQHRVLMKLQNIMSTFHGYPLELELLITLAAIHPWLIKTSTCVSKFFNPQELADIERLKY  925

Query  992   dlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGD  813
             D K GSKV FV++L+ R ++++EK+LIFCHNIAPINLFLE+FE  + WR+G E+L L GD
Sbjct  926   DAKKGSKVMFVLNLVFR-VVKREKILIFCHNIAPINLFLELFENVFRWRRGREILTLTGD  984

Query  812   IELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIAR  633
             +ELFERGRV+DKFEE GG ++V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIAR
Sbjct  985   LELFERGRVIDKFEEPGGTARVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIAR  1044

Query  632   AFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDEL  453
             AFRPGQ KVVYVYQLLA GTLEE+KY+RTTW EWVSSMIFSE+ VEDPS WQA KIED++
Sbjct  1045  AFRPGQQKVVYVYQLLARGTLEEDKYRRTTWNEWVSSMIFSEEFVEDPSLWQAEKIEDDV  1104

Query  452   LGEIVEEDRATLFHMIMKNEKAS  384
             L EIVEEDR   FHMIMKNEKAS
Sbjct  1105  LREIVEEDRVKSFHMIMKNEKAS  1127


 Score =   102 bits (254),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 83/133 (62%), Gaps = 8/133 (6%)
 Frame = -3

Query  3680  RWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDID  3501
             RW  S+DC  L K +L  GKF  DLSW+LVAS  K++ F ++++  ++VY+I+ D N+  
Sbjct  24    RWHFSEDCPLLVKTRLTLGKFLPDLSWLLVASVMKRISFHIRTIREKLVYQIITD-NEYG  82

Query  3500  APNSEYHSYAVSFKLENEVSTPIIIQFNP-DIPERGPEGD-VYEAGPLVVYD---ELRRS  3336
               +S  H  AV+F ++N VS   +++FNP D  E   E   V +   L  YD   ELRRS
Sbjct  83    EGSSSMH--AVNFTVQNGVSLSKVVEFNPADTVEEETESPIVKQETDLYPYDGVIELRRS  140

Query  3335  KRRFVQPERYLGC  3297
             KRR V+P+R+LGC
Sbjct  141   KRRNVRPDRFLGC  153



>ref|XP_011003589.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011003664.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011003731.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011003800.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Populus euphratica]
 ref|XP_011003878.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X1 [Populus euphratica]
Length=1328

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/901 (57%), Positives = 639/901 (71%), Gaps = 51/901 (6%)
 Frame = -3

Query  3047  HLAIVPLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLN-  2871
              LAIVP+        F+Q ++P+  +  E  S    E    Y Y   SS    +K+ L+ 
Sbjct  464   QLAIVPVHTEDVLVTFEQFDSPV--KTPEHYSQAFIEFPISY-YRKTSSPAAHRKNDLDE  520

Query  2870  -LMQGRRWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISA  2694
              LM G  WG       KF    V+             R+   ++D+     ++++ ++SA
Sbjct  521   DLMFGNGWGG------KFSTKKVQRARY---------RSTHLKQDNSCAPMTYKRTALSA  565

Query  2693  NVYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLD  2520
               Y +LI   M  ID T+ +KE P IIDQW+EF+   S  Q+E +E SS  ++ E SE +
Sbjct  566   GAYNKLISSYMKKIDATIKSKEVPRIIDQWEEFKAKHSSDQKEKMEPSSVKDDGESSETE  625

Query  2519  MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             MLW+EMEL LAS Y+L+D E           ++T+   + C H+F+L+EEIG++C++CG 
Sbjct  626   MLWREMELCLASAYILEDNEAL---------LSTQTTQKNCQHEFKLDEEIGILCQICGF  676

Query  2339  VSTEIKDVPPPFMPS---TCSSSGKEQRPEEVVMEEKQGDDADLDHFA---IPVSSNKPS  2178
             V TEIK V  PFM     T  S  + +   EV  +E +G     +H +   +PVS     
Sbjct  677   VKTEIKYVSAPFMEHKGWTAESKPQNEEDSEVKTDEDEGSSLFGNHTSGEDVPVS-----  731

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSP  1998
                EV DN W LIP+LR KL  HQ++AFEFLWKN AGS++P  ++  SKK GGCV+SH+P
Sbjct  732   ---EVNDNVWDLIPELRPKLHMHQKKAFEFLWKNTAGSLVPAHMEKTSKKIGGCVVSHTP  788

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             GAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ I+G  T   
Sbjct  789   GAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLING--TRSS  846

Query  1817  EVLRQKMKLCPGL-PR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              V +Q   +  G  PR +QDV+H+LDCLEKMQKW AHPSVL+MGY SFLTL REDS Y H
Sbjct  847   RVFKQTPAVLRGSGPRPSQDVVHILDCLEKMQKWHAHPSVLVMGYPSFLTLMREDSKYNH  906

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
             RKYM +VLR+ PG+LILDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNT
Sbjct  907   RKYMAKVLRESPGMLILDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNT  966

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererkE  1287
             L LARP F+ EVLK LDPK+K++ KGA K R  LE+RARK FID I+ KI+S +  E+ +
Sbjct  967   LSLARPMFIKEVLKALDPKFKRKKKGAQKARHLLESRARKFFIDNIASKINSDEAEEKMQ  1026

Query  1286  GLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
             GLN+L+ +T GFIDVYEG +SD LPGLQ YT++M  T +Q +ILVKL        G+PLE
Sbjct  1027  GLNMLRNMTNGFIDVYEGTASDTLPGLQIYTILMNPTDIQHQILVKLHKIMEKCPGYPLE  1086

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
             +ELLITL +IHP L+ ++ C  + +  EEL  LEK +FD K GSKV FV++L+ R +++ 
Sbjct  1087  VELLITLASIHPSLVNSSVCVKKIYNLEELMELEKLRFDCKKGSKVMFVLNLVYR-VVKN  1145

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVLIFCHNIAPI LF+E+FE  + W++G E+LVL G++ELFERGRVMDKFEE+GGPS+V
Sbjct  1146  EKVLIFCHNIAPIKLFIELFENIFRWQQGKEILVLTGELELFERGRVMDKFEELGGPSRV  1205

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ K+VYVYQLLATGT+E
Sbjct  1206  LLASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQKMVYVYQLLATGTVE  1265

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKA  387
             E+KY+RT WKEWVS MIFSE+ VEDPS WQA KIED++L EIVEEDR   FHMIMKNEKA
Sbjct  1266  EDKYRRTAWKEWVSRMIFSEEFVEDPSRWQAEKIEDDVLREIVEEDRVKSFHMIMKNEKA  1325

Query  386   S  384
             S
Sbjct  1326  S  1326


 Score =   275 bits (703),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 199/315 (63%), Gaps = 18/315 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ +HQ++H F+ +PFEA   GSWQ VE I+I++G   +H +D    I+E+   SN+R
Sbjct  1     MKRKRLHQSKHSFNAHPFEALCCGSWQNVELIQIRDGAMTLHFVDNHHRIDEKGPFSNIR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT SDC CFLRPG+D+ V S+   ++++        +   EP W+DAKI SI+RK
Sbjct  61    VKSRKATLSDCTCFLRPGIDVCVLSSSEHAKNTG-------EGNSEPVWVDAKISSIKRK  113

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED-------  3690
             PH   C CQF +++YV QGP    +  LSKE   V +N+I++LQK++  PCE        
Sbjct  114   PHVSHCSCQFFVNLYVNQGPLGSERARLSKETVAVGINEISVLQKLDNDPCEAGNNQQEA  173

Query  3689  KYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN  3510
             ++YRW   +DCS +Q+ KLF G+F +DL+W+LVAS  KQV FDV+SV N+IVY+I   EN
Sbjct  174   QFYRWEFCEDCSLVQRSKLFLGRFSADLTWLLVASVLKQVEFDVRSVQNKIVYQISGGEN  233

Query  3509  DIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPD--IPERGPEGDV--YEAGPLVVYDELR  3342
             +  +  S  H   V+FK+++ +STP ++Q  P     E G   D    E  P      LR
Sbjct  234   EHCSLKSNNHINCVTFKVKDSISTPFVVQLVPTDACSEVGHIRDTNGTEQSPCYDVMSLR  293

Query  3341  RSKRRFVQPERYLGC  3297
             RSKR+ +QPER+L C
Sbjct  294   RSKRQNIQPERFLAC  308



>ref|XP_011003947.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Populus euphratica]
Length=1276

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/902 (57%), Positives = 639/902 (71%), Gaps = 51/902 (6%)
 Frame = -3

Query  3047  HLAIVPLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLN-  2871
              LAIVP+        F+Q ++P+  +  E  S    E    Y Y   SS    +K+ L+ 
Sbjct  412   QLAIVPVHTEDVLVTFEQFDSPV--KTPEHYSQAFIEFPISY-YRKTSSPAAHRKNDLDE  468

Query  2870  -LMQGRRWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISA  2694
              LM G  WG       KF    V+             R+   ++D+     ++++ ++SA
Sbjct  469   DLMFGNGWGG------KFSTKKVQRARY---------RSTHLKQDNSCAPMTYKRTALSA  513

Query  2693  NVYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLD  2520
               Y +LI   M  ID T+ +KE P IIDQW+EF+   S  Q+E +E SS  ++ E SE +
Sbjct  514   GAYNKLISSYMKKIDATIKSKEVPRIIDQWEEFKAKHSSDQKEKMEPSSVKDDGESSETE  573

Query  2519  MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             MLW+EMEL LAS Y+L+D E           ++T+   + C H+F+L+EEIG++C++CG 
Sbjct  574   MLWREMELCLASAYILEDNEAL---------LSTQTTQKNCQHEFKLDEEIGILCQICGF  624

Query  2339  VSTEIKDVPPPFMPS---TCSSSGKEQRPEEVVMEEKQGDDADLDHFA---IPVSSNKPS  2178
             V TEIK V  PFM     T  S  + +   EV  +E +G     +H +   +PVS     
Sbjct  625   VKTEIKYVSAPFMEHKGWTAESKPQNEEDSEVKTDEDEGSSLFGNHTSGEDVPVS-----  679

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSP  1998
                EV DN W LIP+LR KL  HQ++AFEFLWKN AGS++P  ++  SKK GGCV+SH+P
Sbjct  680   ---EVNDNVWDLIPELRPKLHMHQKKAFEFLWKNTAGSLVPAHMEKTSKKIGGCVVSHTP  736

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             GAGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ I+G  T   
Sbjct  737   GAGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLING--TRSS  794

Query  1817  EVLRQKMKLCPGL-PR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              V +Q   +  G  PR +QDV+H+LDCLEKMQKW AHPSVL+MGY SFLTL REDS Y H
Sbjct  795   RVFKQTPAVLRGSGPRPSQDVVHILDCLEKMQKWHAHPSVLVMGYPSFLTLMREDSKYNH  854

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
             RKYM +VLR+ PG+LILDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNT
Sbjct  855   RKYMAKVLRESPGMLILDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNT  914

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererkE  1287
             L LARP F+ EVLK LDPK+K++ KGA K R  LE+RARK FID I+ KI+S +  E+ +
Sbjct  915   LSLARPMFIKEVLKALDPKFKRKKKGAQKARHLLESRARKFFIDNIASKINSDEAEEKMQ  974

Query  1286  GLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
             GLN+L+ +T GFIDVYEG +SD LPGLQ YT++M  T +Q +ILVKL        G+PLE
Sbjct  975   GLNMLRNMTNGFIDVYEGTASDTLPGLQIYTILMNPTDIQHQILVKLHKIMEKCPGYPLE  1034

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
             +ELLITL +IHP L+ ++ C  + +  EEL  LEK +FD K GSKV FV++L+ R +++ 
Sbjct  1035  VELLITLASIHPSLVNSSVCVKKIYNLEELMELEKLRFDCKKGSKVMFVLNLVYR-VVKN  1093

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVLIFCHNIAPI LF+E+FE  + W++G E+LVL G++ELFERGRVMDKFEE+GGPS+V
Sbjct  1094  EKVLIFCHNIAPIKLFIELFENIFRWQQGKEILVLTGELELFERGRVMDKFEELGGPSRV  1153

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LASIT CAEGISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ K+VYVYQLLATGT+E
Sbjct  1154  LLASITACAEGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQKMVYVYQLLATGTVE  1213

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKA  387
             E+KY+RT WKEWVS MIFSE+ VEDPS WQA KIED++L EIVEEDR   FHMIMKNEKA
Sbjct  1214  EDKYRRTAWKEWVSRMIFSEEFVEDPSRWQAEKIEDDVLREIVEEDRVKSFHMIMKNEKA  1273

Query  386   SN  381
             S 
Sbjct  1274  ST  1275


 Score =   226 bits (575),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 170/311 (55%), Gaps = 62/311 (20%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ +HQ++H F+ +PFEA   GSWQ VE I+I++G   +H +D    I+E+   SN+R
Sbjct  1     MKRKRLHQSKHSFNAHPFEALCCGSWQNVELIQIRDGAMTLHFVDNHHRIDEKGPFSNIR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT SDC CFLRPG+D+ V S+               +   EP W+DAKI SI+RK
Sbjct  61    VKSRKATLSDCTCFLRPGIDVCVLSSSEH-------AKNTGEGNSEPVWVDAKISSIKRK  113

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPC-------ED  3690
             PH   C CQF +++YV QGP    +  LSKE   V +N+I++LQK++  PC       E 
Sbjct  114   PHVSHCSCQFFVNLYVNQGPLGSERARLSKETVAVGINEISVLQKLDNDPCEAGNNQQEA  173

Query  3689  KYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN  3510
             ++YRW   +DCS +Q+ KLF G+F +DL+W+LVAS  KQV FDV  V +      ++D N
Sbjct  174   QFYRWEFCEDCSLVQRSKLFLGRFSADLTWLLVASVLKQVEFDVSEVGH------IRDTN  227

Query  3509  DIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKR  3330
                                                E+ P  DV           LRRSKR
Sbjct  228   GT---------------------------------EQSPCYDVM---------SLRRSKR  245

Query  3329  RFVQPERYLGC  3297
             + +QPER+L C
Sbjct  246   QNIQPERFLAC  256



>ref|XP_010535825.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535826.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535827.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535828.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535829.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535830.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535832.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535833.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535834.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535835.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Tarenaya hassleriana]
Length=1279

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/803 (61%), Positives = 604/803 (75%), Gaps = 20/803 (2%)
 Frame = -3

Query  2762  RTCPSQRDSIYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNT  2589
             R+   + D I   +   K ++SA  Y +LI   M NID T+  +  P  +++QW+E +  
Sbjct  485   RSIVLKTDDIDGPKIHTKKTLSAGAYNKLIDSYMKNIDSTIAAKDEPTNVVEQWEELKKV  544

Query  2588  KSCQR---EPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMAT  2418
             K+  +   E  E SS  ++ E SE +MLW+EMEL LAS Y+LDD E      A   + A 
Sbjct  545   KASSKQNGENDETSSEEDDGETSENEMLWREMELCLASSYILDDNE------ARVDNEAI  598

Query  2417  KKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEK  2238
             +K    C HD+RL+EEIGL+CRLCG + TEIK V  PF      ++ K+Q  E+ +    
Sbjct  599   QKSNGGCEHDYRLDEEIGLLCRLCGHIKTEIKHVSAPFAEHKKWTTEKKQIDEDDIRTTN  658

Query  2237  QGDDADLDHFAIPVSSNKPSSEV---EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAG  2067
              G D + +   +  + +  SSE+   E  DN W+LIP+L+ KL  HQ+RAFEFLW+N+AG
Sbjct  659   VGQDRNTEDLNMS-ADHASSSELPLGEENDNVWSLIPELKRKLHLHQKRAFEFLWRNLAG  717

Query  2066  SIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWY  1887
             +++P ++DP S   GGCVISHSPGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWY
Sbjct  718   AMVPAEMDPSSDNIGGCVISHSPGAGKTFLIIAFLASYLKLFPGKRPLVLAPKTTLYTWY  777

Query  1886  KEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHP  1710
             KE IKW+IP+PV+ IHG +TY   VL+Q      G P+ +QDVMHVLDCL+K+QKW ++P
Sbjct  778   KEFIKWEIPVPVHLIHGRRTYC--VLKQNPIPIKGFPKPSQDVMHVLDCLDKIQKWHSNP  835

Query  1709  SVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVN  1530
             SVL+MGY+SF TL REDS  AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+
Sbjct  836   SVLVMGYSSFQTLMREDSKLAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVD  895

Query  1529  TSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRAR  1350
             T LRILLSGTLFQNNF EYFNTLCLARP+FV E+L ELD K+K      K    LENRAR
Sbjct  896   TDLRILLSGTLFQNNFCEYFNTLCLARPKFVHEILMELDQKFKTNQGVNKAPHLLENRAR  955

Query  1349  KMFidkiskkidsskererkEGLNILKKLTTGFIDVYEG-GSSDNLPGLQCYTLMMKSTT  1173
             K F+D I+KKIDSS   ER +GLN+L+ +T GFIDVYEG GS D LPGLQ YTL+M ST 
Sbjct  956   KFFLDIIAKKIDSSVGEERHQGLNMLRNMTNGFIDVYEGNGSGDVLPGLQIYTLLMNSTD  1015

Query  1172  LQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkf  993
             +Q  +L+KLQ+    + G+PLELELLITL AIHPWLI+T+ C  ++F  +EL  +E+ K+
Sbjct  1016  VQHRVLMKLQNIMSTFHGYPLELELLITLAAIHPWLIKTSTCVSKFFNPQELADIERLKY  1075

Query  992   dlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGD  813
             D K GSKV FV++L+ R ++++EK+LIFCHNIAPINLFLE+FE  + WR+G E+L L GD
Sbjct  1076  DAKKGSKVMFVLNLVFR-VVKREKILIFCHNIAPINLFLELFENVFRWRRGREILTLTGD  1134

Query  812   IELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIAR  633
             +ELFERGRV+DKFEE GG ++V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIAR
Sbjct  1135  LELFERGRVIDKFEEPGGTARVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIAR  1194

Query  632   AFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDEL  453
             AFRPGQ KVVYVYQLLA GTLEE+KY+RTTW EWVSSMIFSE+ VEDPS WQA KIED++
Sbjct  1195  AFRPGQQKVVYVYQLLARGTLEEDKYRRTTWNEWVSSMIFSEEFVEDPSLWQAEKIEDDV  1254

Query  452   LGEIVEEDRATLFHMIMKNEKAS  384
             L EIVEEDR   FHMIMKNEKAS
Sbjct  1255  LREIVEEDRVKSFHMIMKNEKAS  1277


 Score =   241 bits (616),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/309 (41%), Positives = 192/309 (62%), Gaps = 11/309 (4%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R ++Q++HPFD   FEAF +G+W+ V+ ++I++G   MH  D G +I+ + +   +R
Sbjct  1     MKKRLLYQSKHPFDPCSFEAFCSGTWKGVDHLKIEDGMMAMHFSDNGYMIDGKRAFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A   DC CFLRPG+D+ V    +        + E  + + EP W+DAKI SIER 
Sbjct  61    LRSRRANLVDCTCFLRPGIDVCVL---YPVRRIGISDKETLEHDLEPVWVDAKIVSIERN  117

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+F+I++Y+ QG     K  ++++  +V LN I+ILQK  ++  ED+ YRW  
Sbjct  118   PHESECSCKFYINIYIDQGCIGSEKVRMNRDPVIVGLNHISILQKFFKQQSEDRPYRWHF  177

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC  L K +L  GKF  DLSW+LVAS  K++ F ++++  ++VY+I+ D N+    +S
Sbjct  178   SEDCPLLVKTRLTLGKFLPDLSWLLVASVMKRISFHIRTIREKLVYQIITD-NEYGEGSS  236

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP--DIPERGPEGDVYEAGPLVVYD---ELRRSKRRF  3324
               H  AV+F ++N VS   +++FNP   + E      V +   L  YD   ELRRSKRR 
Sbjct  237   SMH--AVNFTVQNGVSLSKVVEFNPADTVEEETESPIVKQETDLYPYDGVIELRRSKRRN  294

Query  3323  VQPERYLGC  3297
             V+P+R+LGC
Sbjct  295   VRPDRFLGC  303



>ref|XP_006281920.1| hypothetical protein CARUB_v10028127mg [Capsella rubella]
 gb|EOA14818.1| hypothetical protein CARUB_v10028127mg [Capsella rubella]
Length=1261

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/791 (62%), Positives = 597/791 (75%), Gaps = 21/791 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             ++K ++SA  Y +LI   M+ ID T+    E   +++QW   +N  S   E  ++ S N+
Sbjct  482   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKNEATNVVEQWVGLKNAASSSMEAGKRLSEND  541

Query  2543  e--eelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
             +  EE SE +MLW+EMEL LAS Y+LDD E   ++   E   A  K    C HD+ LNEE
Sbjct  542   DDDEETSENEMLWREMELCLASSYILDDNE---VRVDNE---AFHKAISDCEHDYELNEE  595

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPV-  2196
             IG+ CRLCG V TE+K V  PF      ++  +Q  E+ +   K   D    H + IPV 
Sbjct  596   IGMCCRLCGHVGTEMKHVSAPFAHHKKWTTETKQINEDDINTTKVNQDGAESHNYTIPVA  655

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGC  2016
             SS+ PS+E    DN W+LIP L+ KL  HQ++AFEFLW+N+AGS++P  +DP S+K GGC
Sbjct  656   SSDMPSAEES--DNVWSLIPQLKRKLHLHQKKAFEFLWRNLAGSVVPAMMDPSSEKIGGC  713

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             VISH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG
Sbjct  714   VISHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHG  773

Query  1835  GQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
              +TY   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL RED
Sbjct  774   RRTYC--VAKENTIQFKGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMRED  831

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF 
Sbjct  832   SKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFC  891

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             EYFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+    
Sbjct  892   EYFNTLCLARPKFVHEVLIELDKKFQTNQTVQKAPHLLENRARKFFLDIIAKKIDTKVGD  951

Query  1298  erkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
             ER +GLN+L+ +T+GFID YEG   GS D LPGLQ YTL+M ST +Q + L KLQ+    
Sbjct  952   ERLQGLNMLRNITSGFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDIQHKTLTKLQNIMST  1011

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
             Y G+PLELELLITL AIHPWL++TT C  ++F  +EL  +EK K D K GSKV FV++L+
Sbjct  1012  YHGYPLELELLITLAAIHPWLVKTTTCCTKFFNPQELSEIEKLKHDAKKGSKVMFVLNLV  1071

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
              R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFEE
Sbjct  1072  FR-VVKREKILIFCHNIAPIRLFLELFENVFRWQRGRELLTLTGDLELFERGRVIDKFEE  1130

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
              GGPS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQL
Sbjct  1131  PGGPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQL  1190

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHM  408
             L+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEED+   FHM
Sbjct  1191  LSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSQWQAEKIEDDVLREIVEEDKVKSFHM  1250

Query  407   IMKNEKASNMG  375
             IMKNEKAS  G
Sbjct  1251  IMKNEKASTGG  1261


 Score =   211 bits (536),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 177/301 (59%), Gaps = 14/301 (5%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+      HPF+  PFE F +G+W+ VE +RI+NGT  M +L+ G ++++      +R
Sbjct  1     MKRKHYFDFNHPFNPCPFEVFCSGTWKAVEYLRIENGTMTMRLLENGQVLDDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC  FLR GLD+ V           +++   ++   EP W+DA+I SIERK
Sbjct  61    LRSRKATLVDCTSFLRHGLDVCVL---------YQKDVTLDEETTEPVWVDARILSIERK  111

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C FH+SVY+ QG     K  +++    + LNQI+ILQK  ++   D+YYRW  
Sbjct  112   PHESECLCIFHVSVYIDQGCIGSEKHRMNRASVPMGLNQISILQKFCKEQNLDRYYRWRN  171

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L K +L  GKF  DL+W+LV S  K + F +++ H ++VY+I+ DE   D   S
Sbjct  172   SEDCTSLVKTRLNLGKFLPDLTWLLVTSVLKNIVFQIRTFHEKMVYQIVADE---DCECS  228

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPER  3309
                  A++  +E+ V    I+ FNP   +   + DV +     V  ELRRSKRR  +P+R
Sbjct  229   SSSLSAMNITVEDGVFMSKIVLFNP-AEDTHQDTDVKQEIEEEVM-ELRRSKRRSGRPDR  286

Query  3308  Y  3306
             +
Sbjct  287   F  287



>ref|XP_009108311.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Brassica 
rapa]
 ref|XP_009108312.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Brassica 
rapa]
 ref|XP_009108313.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Brassica 
rapa]
 ref|XP_009108314.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Brassica 
rapa]
Length=1271

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/787 (61%), Positives = 594/787 (75%), Gaps = 18/787 (2%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQN--TKSCQREPIeksst  2550
             F++ ++SA  Y ELI   M+NID T+   KE   +++QW+  +N  + + + E       
Sbjct  494   FKRRTLSAGAYNELIESYMSNIDSTIAAKKETNSVVEQWEALKNPTSTTVEDEDGSSEDD  553

Query  2549  nneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
             ++E E SE +MLW+EMEL +AS Y+LDD E   L+   E   A +K T  C HD+ LNEE
Sbjct  554   DSEGETSENEMLWREMELCMASSYILDDNE---LRVDNE---AFQKATSGCEHDYELNEE  607

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS  2190
             IG+ C+LCG V +EI+DV  PF      ++  +   EE +    + D  +   F +PV++
Sbjct  608   IGMCCKLCGHVGSEIRDVSAPFARQKKWTTEAKHINEEDIDTNVKQDGDERRSFTMPVAT  667

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
              +  S  E E N W+LIP LR KL  HQ++AFEFLW+N+AGS++P+ +DP S K GGCV+
Sbjct  668   LEVPSPEESE-NVWSLIPQLRRKLHMHQKKAFEFLWRNLAGSVVPSMMDPSSDKIGGCVV  726

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IHG +
Sbjct  727   SHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIHGRR  786

Query  1829  TYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
             TY   V ++      G+P+ +QDV HV+DCL+K+QKW A PSVL+MGYTSFLTL REDS 
Sbjct  787   TYC--VAKENKIQFKGIPKPSQDVSHVIDCLDKIQKWHAQPSVLVMGYTSFLTLMREDSK  844

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
             +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LR+LLSGTLFQNNF EY
Sbjct  845   FAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRVLLSGTLFQNNFCEY  904

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             FNTLCLARP+F+ EVL ELD K+       K    +ENRARK F+D I+KKID+    ER
Sbjct  905   FNTLCLARPKFIHEVLMELDEKFNTNQTVQKAPHLIENRARKFFLDIIAKKIDTKVGDER  964

Query  1292  kEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
              +GLN+L+ +T+GFID YEG   GS D LPGLQ YTL+M ST LQ + L KLQ     Y 
Sbjct  965   LQGLNMLRNMTSGFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDLQHKTLTKLQTVMSTYH  1024

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
             G+PLELELLITL AIHPWL++T+ C  ++F  EEL  +EK K D K GSKV FV++L+ R
Sbjct  1025  GYPLELELLITLAAIHPWLVKTSTCCAKFFNPEELFEIEKLKHDAKKGSKVMFVLNLVFR  1084

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
              ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELF+RGRV+DKFEE G
Sbjct  1085  -VVKREKILIFCHNIAPIRLFLELFENVFRWKRGREILTLTGDLELFDRGRVIDKFEEHG  1143

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
             GPS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLL+
Sbjct  1144  GPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLS  1203

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIM  402
              GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEED+   FHMIM
Sbjct  1204  RGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSQWQAEKIEDDVLREIVEEDKVKSFHMIM  1263

Query  401   KNEKASN  381
             KNEKAS 
Sbjct  1264  KNEKAST  1270


 Score =   204 bits (519),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 174/306 (57%), Gaps = 18/306 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+  +Q  H FD  PFE F +G+W+ VE +R+++G+  M + + G ++++      +R
Sbjct  1     MKRKRYYQLNHTFDPCPFEVFCSGTWKAVEYLRVESGSMTMRLFENGHVLDDVKPFQKLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT+ DC  FLR G+D+ V     +    D         + EP W+DAKI SIERK
Sbjct  61    LRSRKATTIDCTTFLRHGVDVCVLYQKDEVTPED---------DLEPVWVDAKIVSIERK  111

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C+FH+S+Y+ QG     K  +++   V+ L+QI+ILQK  ++   D++YRW  
Sbjct  112   PHEPECLCEFHVSIYIDQGCISSEKHRMNRASVVMGLDQISILQKFPKEQSVDRFYRWRY  171

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+D ++L K +L  GKF  DLSW+LV S  K   F +K++ N++VY I+ DE    +   
Sbjct  172   SEDSASLVKTRLTLGKFMPDLSWLLVTSVLKNTVFHIKTIQNKMVYLIMTDEESSSSSCL  231

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD-----ELRRSKRRF  3324
                  A++  +E+ V    ++ FNPD  +     D          +     ELRRSKRR 
Sbjct  232   S----AMNITVEDGVYLSKVVTFNPDEDDTTLALDYVHVEEEESEEEEEVMELRRSKRRN  287

Query  3323  VQPERY  3306
             ++P+RY
Sbjct  288   MRPDRY  293



>ref|XP_006414244.1| hypothetical protein EUTSA_v10024231mg [Eutrema salsugineum]
 gb|ESQ55697.1| hypothetical protein EUTSA_v10024231mg [Eutrema salsugineum]
Length=1279

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/795 (61%), Positives = 599/795 (75%), Gaps = 25/795 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             + K ++SA  Y +LI   M+NID T+    E   +++QW+E +N  S   E  +  S ++
Sbjct  496   YTKRTLSAGAYNKLIDSYMSNIDSTIAAKNEATSVVEQWEELKNFTSTSMEAEDMCSEDD  555

Query  2543  ee-----elseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
             ++     E SE +MLW+EMEL LAS Y+LDD+E   ++   E   A +K T  C HDF L
Sbjct  556   DDDDDDGETSENEMLWREMELCLASSYILDDSE---VRVDNE---AFQKATGDCKHDFEL  609

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             NEEIG+ CRLCG V TEIK    PF      ++  +Q  E+ +  + + D+ +  +F + 
Sbjct  610   NEEIGMCCRLCGHVGTEIKHFSAPFAQHKKWTTETKQINEDDIDTKVKQDEVESRNFTMT  669

Query  2198  V---SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK  2028
             V   SS  PS+E    DN W+LIP L+ KL  HQR+AFEFLW+N+AGS++P  +DP S+K
Sbjct  670   VVAASSETPSAEES--DNVWSLIPQLKRKLHMHQRKAFEFLWRNLAGSVVPAMMDPSSEK  727

Query  2027  RGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVY  1848
              GGCV+SH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+
Sbjct  728   IGGCVVSHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVH  787

Query  1847  QIHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTL  1671
              IHG +TY   V+++      G+P+ +QDV HV+DCL+K+QKW A PSVL+MGYTSFLTL
Sbjct  788   LIHGRRTYC--VVKENTIQFKGVPKPSQDVRHVIDCLDKIQKWHAQPSVLVMGYTSFLTL  845

Query  1670  TREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQ  1491
              REDS +AHRK+M +VLR+ PG++ILDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQ
Sbjct  846   MREDSKFAHRKHMAKVLRESPGLVILDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQ  905

Query  1490  NNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkids  1311
             NNF EYFNTLCLARP+FV EVL ELD K+       K    LENRARK+F+D I++KID+
Sbjct  906   NNFCEYFNTLCLARPKFVHEVLMELDQKFNTNQAVQKAPHLLENRARKLFLDIIARKIDT  965

Query  1310  skererkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQD  1140
                 ER +GLN+LK +T+ FID YEG   GS D LPGLQ YTL+M ST LQ + L KLQ+
Sbjct  966   KVGDERLQGLNMLKNMTSSFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDLQHKTLTKLQN  1025

Query  1139  QRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFV  960
                 Y G+PLELELLITL AIHPWL++T+ C  ++F  EEL  +EK K D K GSKV FV
Sbjct  1026  IMSTYHGYPLELELLITLAAIHPWLVKTSTCCAKFFNPEELFEIEKLKHDAKKGSKVMFV  1085

Query  959   MSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMD  780
             ++L+ R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+D
Sbjct  1086  LNLVFR-VVKREKILIFCHNIAPIRLFIELFENVFRWKRGRELLTLTGDLELFERGRVID  1144

Query  779   KFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVY  600
             KFEE GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVY
Sbjct  1145  KFEEPGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVY  1204

Query  599   VYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRAT  420
             VYQLL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEEDR  
Sbjct  1205  VYQLLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVEEDRVK  1264

Query  419   LFHMIMKNEKASNMG  375
              FHMIMKNEKAS  G
Sbjct  1265  SFHMIMKNEKASTGG  1279


 Score =   209 bits (531),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 184/317 (58%), Gaps = 18/317 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+  ++  H FD  PFE F +G+W+ VE +RI+NG   M +L+ G ++E+      +R
Sbjct  1     MKRKHYYELNHSFDPCPFEVFCSGTWKAVEYLRIENGVMAMQLLENGHVLEDVRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR ATS DC  FLR G+D+ V         S   + E  + + EP W+DAKI SIERK
Sbjct  61    LRSRKATSIDCNSFLRHGVDVCVL-----YHKSVSLDEETPEHDMEPVWVDAKIVSIERK  115

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C F++S+Y+ QG     K  +++   +V LNQI++LQK  ++   D++YRW  
Sbjct  116   PHESECLCNFYVSIYIDQGCIGSEKHRINRASVLVGLNQISVLQKFFKEQSMDRFYRWRF  175

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L + +L  GKF  DL+W+ V S  K + F ++++  ++VY+I+    D D+  S
Sbjct  176   SEDCASLVETRLTHGKFLPDLTWLFVTSVLKSIVFHIRTIQEKMVYQIV---TDQDSQGS  232

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEG-----DVYEAGPLVVYDELRRSKRRF  3324
                  A++  +E+ V    ++ FNPD    G +G     DV +     V  ELRRSKRR 
Sbjct  233   SSSLSAMNITVEDGVYISKVVLFNPD----GDDGTHQDPDVQQESEEEVM-ELRRSKRRH  287

Query  3323  VQPERYLGCDDYLTEFD  3273
             V+P+R+   +  L   D
Sbjct  288   VRPDRFAFSESQLDSKD  304



>gb|KFK33843.1| hypothetical protein AALP_AA5G067200 [Arabis alpina]
Length=1251

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/792 (61%), Positives = 594/792 (75%), Gaps = 18/792 (2%)
 Frame = -3

Query  2729  DIRSFRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeks  2556
             D + ++K ++SA  Y +LI   M+NID T+    E   ++ QW+E +N  S   E  E+ 
Sbjct  465   DPQIYKKRTLSAGAYNKLIDSYMSNIDSTIAAKNEGTSVVAQWEELKNFTSASMEAGERE  524

Query  2555  stnneeelse--LDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFR  2382
             S ++++E      +MLW+EMEL LAS Y+LDD E      A     AT  G R C HD+ 
Sbjct  525   SEDDDDEGDTSENEMLWREMELCLASSYILDDNEVRVDNEA--FQKAT--GERDCEHDYE  580

Query  2381  LNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAI  2202
             LNEEIG+ CRLCG V TEIK V  PF      ++  +   E+ +  +   D  +  +F +
Sbjct  581   LNEEIGMCCRLCGHVGTEIKHVSAPFAKQKKWTTETKHINEDDIDTKVNQDGDENRNFTM  640

Query  2201  PVSS-NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR  2025
             PV+S   PS+E    DN W+LIP LR KL  HQR+AFEFLW+N+AGS++P  +D  S+KR
Sbjct  641   PVASLEMPSAEES--DNVWSLIPQLRWKLHLHQRKAFEFLWRNLAGSVVPAMMDLSSEKR  698

Query  2024  GGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQ  1845
             GGCV+SH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ 
Sbjct  699   GGCVVSHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHL  758

Query  1844  IHGGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT  1668
             IHG +TY   V +       G+P+ +QDV HV+DCL+K+QKW A PSVL+MGYTSFLTL 
Sbjct  759   IHGRRTYC--VSKDNTIQFKGVPKPSQDVRHVIDCLDKIQKWHAQPSVLVMGYTSFLTLM  816

Query  1667  REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQN  1488
             REDS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQN
Sbjct  817   REDSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQN  876

Query  1487  NFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidss  1308
             NF EYFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+ 
Sbjct  877   NFCEYFNTLCLARPKFVHEVLMELDKKFEANQAVQKAPHLLENRARKFFLDIIAKKIDTK  936

Query  1307  kererkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQ  1137
                ER +GLN+L+ +T+ FID YEG   GS D LPGLQ YTL+M ST +Q + L KLQ+ 
Sbjct  937   VGDERLQGLNMLRNMTSSFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDVQHKTLTKLQNI  996

Query  1136  RPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVM  957
                Y G+PLELELLITL AIHPWL++T+ C  ++F  EEL  +EK K D K GSKV FV+
Sbjct  997   MSTYHGYPLELELLITLAAIHPWLVKTSTCCAKFFNPEELFEIEKLKHDAKKGSKVMFVL  1056

Query  956   SLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDK  777
             +L+ R +++KEK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DK
Sbjct  1057  NLVFR-VVKKEKILIFCHNIAPIRLFLELFENVFRWKRGRELLTLTGDLELFERGRVIDK  1115

Query  776   FEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYV  597
             FEE GGPS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVV+V
Sbjct  1116  FEEPGGPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVFV  1175

Query  596   YQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATL  417
             YQLL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEEDR   
Sbjct  1176  YQLLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSMWQAEKIEDDVLREIVEEDRVKS  1235

Query  416   FHMIMKNEKASN  381
             FHMIMKNEKAS 
Sbjct  1236  FHMIMKNEKAST  1247


 Score =   210 bits (534),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 176/306 (58%), Gaps = 27/306 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+  +Q  HPFD  PFE F +G+W+ VE + I+ GT  + +L++G ++++      +R
Sbjct  1     MKRKHYYQLNHPFDPCPFEVFSSGTWKAVEYLEIEKGTMRIRLLEDGLVLDDVKPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC+ FLRPG+D  V    +               + EP W+DAKI SIERK
Sbjct  61    LRSRKATLIDCSTFLRPGIDCCVLYQTN---------------DQEPVWVDAKIVSIERK  105

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C F++SVY+ QG   + K  +++   ++ L+QI ILQK  ++   D++YRW  
Sbjct  106   PHESECLCNFYVSVYIDQGCIGLEKHRINRASVLLGLHQICILQKFYKEQSLDRFYRWRF  165

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS+L K +L  GKF  D +W+LV S  K + F ++++  ++VY+I+ +E    + N 
Sbjct  166   SEDCSSLVKTRLTLGKFLPDFTWLLVTSVLKSIAFQIRAIQEKMVYQIVTEEGSTSSLN-  224

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDV-YEAGPLVVYDELRRSKRRFVQPE  3312
                  A++  +E+ V    ++ FNP       + D+  E        ELRRSKRR V+P+
Sbjct  225   -----AMNITVEDGVFISKVVLFNP-----AEDQDLDAEEESEEEVMELRRSKRRNVRPD  274

Query  3311  RYLGCD  3294
             R+   D
Sbjct  275   RFAFSD  280



>ref|XP_002877253.1| hypothetical protein ARALYDRAFT_484766 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53512.1| hypothetical protein ARALYDRAFT_484766 [Arabidopsis lyrata subsp. 
lyrata]
Length=1254

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/791 (61%), Positives = 593/791 (75%), Gaps = 21/791 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTK--SCQREPIeksst  2550
             ++K ++SA  Y +LI   M+ ID T+    E   +++QW+  +NT   S + E       
Sbjct  475   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKDEATNVVEQWEGLKNTATFSMEAEERLSDED  534

Query  2549  nneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
               + E SE +MLW+EMEL LAS Y+LDD E   ++   E   A  K T  C HD+ LNEE
Sbjct  535   EGDGETSENEMLWREMELCLASSYILDDNE---VRVDNE---AFHKATGDCEHDYELNEE  588

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPV-  2196
             IG+ CRLC  V +EIK V  PF      ++  +Q  E+ +   K   D   +H F IPV 
Sbjct  589   IGMCCRLCSHVGSEIKYVSAPFAQHKKWTTETKQINEDDINTTKVNQDGVENHTFTIPVA  648

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGC  2016
             SS+ PS+E    DN W+LIP L+ KL  HQ++AFEFLWKN+AGS+IP  +DP S+K GGC
Sbjct  649   SSDMPSAEES--DNVWSLIPQLKRKLHLHQKKAFEFLWKNLAGSVIPAMMDPSSEKIGGC  706

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             V+SH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG
Sbjct  707   VVSHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHG  766

Query  1835  GQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
              +TY   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSF TL RED
Sbjct  767   RRTYC--VSKENTIQFKGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFQTLMRED  824

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF 
Sbjct  825   SKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFC  884

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             EYFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+    
Sbjct  885   EYFNTLCLARPKFVHEVLVELDQKFQTNQAVEKAPHLLENRARKFFLDIIAKKIDTKVGD  944

Query  1298  erkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
             ER +GLN+L+ +T+GFID YEG   GS D LPGLQ YTL+M ST +Q + L KLQ+    
Sbjct  945   ERLQGLNMLRNMTSGFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDVQHKSLTKLQNIMST  1004

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
             Y G+PLELELLITL AIHPWL++TT C  ++F  EEL  +EK K D K GSKV FV++L+
Sbjct  1005  YHGYPLELELLITLAAIHPWLVKTTTCCTKFFNPEELFEIEKLKHDAKKGSKVMFVLNLV  1064

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
              R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFEE
Sbjct  1065  FR-VVKREKILIFCHNIAPIRLFLELFENVFRWQRGRELLTLTGDLELFERGRVIDKFEE  1123

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
              GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQL
Sbjct  1124  PGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQL  1183

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHM  408
             L+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEED+   FHM
Sbjct  1184  LSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSQWQAEKIEDDVLREIVEEDKVKSFHM  1243

Query  407   IMKNEKASNMG  375
             IMKNEKAS  G
Sbjct  1244  IMKNEKASTGG  1254


 Score =   223 bits (568),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/301 (41%), Positives = 175/301 (58%), Gaps = 18/301 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+   +  HPF+  PFE F  G+W+ VE +RI+NGT  M +L+ G ++ +      +R
Sbjct  1     MKRKHYFEFNHPFNPCPFEVFCWGTWKAVEYLRIENGTMTMRLLENGQVLADIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC  FLRPG+D+ V     +               PEP W+DA+I SIERK
Sbjct  61    LRSRKATLIDCTSFLRPGIDVCVLYQKDEET-------------PEPVWVDARILSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C FH+ VY+ QG   + K  ++K   +V LN+IAILQK  ++   D+YYRW  
Sbjct  108   PHESECLCTFHVIVYIDQGCIGLEKHRMNKVPVLVGLNEIAILQKFCKEQSLDRYYRWRY  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS+L K +L  GKF  DL+W+LV S  K + F +++VH ++VY+I+ D+   D   S
Sbjct  168   SEDCSSLVKTRLNLGKFLPDLTWLLVTSVLKNIVFQIRTVHEKMVYQIVTDQ---DCEGS  224

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPER  3309
                  A++  +E+ V    ++ FNP   +   E DV +        ELRRSKRR  +PER
Sbjct  225   SSSLSAMNITVEDGVFMSKVVLFNP-AEDTYQESDV-KEEIEEEVMELRRSKRRSGRPER  282

Query  3308  Y  3306
             Y
Sbjct  283   Y  283



>ref|XP_010496657.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
Length=1041

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/790 (61%), Positives = 587/790 (74%), Gaps = 22/790 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             F+K ++SA  Y +LI   M+ ID T+    E   +++Q    +N  S   E      +++
Sbjct  265   FKKRTLSAGAYNKLIDSYMSRIDSTIAAKNEATNVVEQLMGLKNAASSSME---AEKSSS  321

Query  2543  eeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIG  2364
             E++ +E +MLW+EMEL LAS Y+LDD E   ++   E   A  K    C HD+ LNEEIG
Sbjct  322   EDDDAENEMLWREMELCLASSYILDDNE---VRVDNE---AFHKALGDCEHDYELNEEIG  375

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPVSSN  2187
             + CRLCG V TE+K V  PF      ++  +Q  E+ +   K   D    H + IPV+S+
Sbjct  376   MCCRLCGHVGTEMKHVSAPFAHHKKWTTETKQVNEDDINTTKVNQDGAESHNYTIPVASS  435

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVIS  2007
                S  E  DN W+LIP L  KL  HQ++AFEFLW+N+AGS++P  +DP S+K GGCVIS
Sbjct  436   DMPSAKE-SDNVWSLIPQLERKLHLHQKKAFEFLWRNLAGSVVPAMMDPSSEKIGGCVIS  494

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQT  1827
             H+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG +T
Sbjct  495   HTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHGRRT  554

Query  1826  YKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
             Y   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL REDS +
Sbjct  555   YC--VAKENTIQIEGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMREDSKF  612

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
             AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF EYF
Sbjct  613   AHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFCEYF  672

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+    ER 
Sbjct  673   NTLCLARPKFVHEVLVELDQKFQTNQTEQKAPHLLENRARKFFLDIIAKKIDTKVGDERL  732

Query  1289  EGLNILKKLTTGFIDVYEGGSS-----DNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIY  1125
             +GLN+L+ +T+GFID YEG  S     D LPGLQ YTL+M ST +Q   L KLQ+    Y
Sbjct  733   QGLNMLRNMTSGFIDNYEGNGSGSGSGDVLPGLQIYTLLMNSTDIQHRTLTKLQNIMSTY  792

Query  1124  KGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIP  945
              G+PLELELLITL AIHPWL++TTAC  ++   +EL  +EK K D K GSKV FV++L+ 
Sbjct  793   HGYPLELELLITLAAIHPWLVKTTACCTKFLNPQELSEIEKLKHDAKKGSKVMFVLNLVF  852

Query  944   RCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEV  765
             R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFEE 
Sbjct  853   R-VVKREKILIFCHNIAPIRLFLELFENIFRWKRGRELLTLTGDLELFERGRVIDKFEEP  911

Query  764   GGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLL  585
             GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLL
Sbjct  912   GGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLL  971

Query  584   ATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMI  405
             + GTLEE+KY+RTTWKEWVSSMIFSE+ V DPS WQA KIED++L EIVEED+   FHMI
Sbjct  972   SRGTLEEDKYRRTTWKEWVSSMIFSEEFVADPSQWQAEKIEDDVLREIVEEDKVKSFHMI  1031

Query  404   MKNEKASNMG  375
             MKNEKAS  G
Sbjct  1032  MKNEKASTGG  1041



>ref|XP_010496660.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
Length=763

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/724 (64%), Positives = 555/724 (77%), Gaps = 19/724 (3%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             +MLW+EMEL LAS Y+LDD E   ++   E   A  K    C HD+ LNEEIG+ CRLCG
Sbjct  51    EMLWREMELCLASSYILDDNE---VRVDNE---AFHKALGGCEHDYELNEEIGMCCRLCG  104

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPV-SSNKPSSEV  2169
              V TE+K V  PF      ++  +Q  E+ +   K   D    H + IPV SS+ PS+E 
Sbjct  105   HVGTEMKHVSAPFAHHKKWTTETKQVNEDDINTTKVNQDGAESHNYTIPVASSDMPSAEE  164

Query  2168  EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAG  1989
                DN W+LIP L  KL  HQ++AFEFLW+N+AGS++P  +DP S+K GGCVISH+PGAG
Sbjct  165   S--DNVWSLIPQLERKLHLHQKKAFEFLWRNLAGSVVPAMMDPSSEKIGGCVISHTPGAG  222

Query  1988  KTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVL  1809
             KT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG +TY   V 
Sbjct  223   KTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHGRRTYC--VA  280

Query  1808  RQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYM  1632
             ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL REDS +AHRKYM
Sbjct  281   KENTIQIEGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMREDSKFAHRKYM  340

Query  1631  NQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLA  1452
              +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF EYFNTLCLA
Sbjct  341   AKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFCEYFNTLCLA  400

Query  1451  RPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNIL  1272
             RP+FV EVL ELD K++      K    +ENRARK F+D I+KKID+    ER +GLN+L
Sbjct  401   RPKFVQEVLVELDQKFQTNQTEQKAPHLIENRARKFFLDIIAKKIDTKVGDERLQGLNML  460

Query  1271  KKLTTGFIDVYEGGSS-----DNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
             + +T+GFID YEG  S     D LPGLQ YTL+M ST +Q   L KLQ+    Y G+PLE
Sbjct  461   RNMTSGFIDNYEGSGSGSGSGDVLPGLQIYTLLMNSTDVQHRTLTKLQNIMSTYHGYPLE  520

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
             LELLITL AIHPWL++TTAC  ++   +EL  +E+ K D K GSKV FV++L+ R ++++
Sbjct  521   LELLITLAAIHPWLVKTTACCTKFLNPQELSEIEELKHDAKKGSKVMFVLNLVFR-VVKR  579

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFEE GG S+V
Sbjct  580   EKILIFCHNIAPIRLFLELFENIFRWKRGRELLTLTGDLELFERGRVIDKFEEPGGQSRV  639

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQLL+ GTLE
Sbjct  640   LLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQLLSRGTLE  699

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKA  387
             E+KY+RTTWKEWVSSMIFSE+ V DPS WQA KIED++L EIVEED+   FHMIMKNEKA
Sbjct  700   EDKYRRTTWKEWVSSMIFSEEFVADPSQWQAEKIEDDVLREIVEEDKVKSFHMIMKNEKA  759

Query  386   SNMG  375
             S  G
Sbjct  760   STGG  763



>ref|XP_010454346.1| PREDICTED: SNF2 domain-containing protein CLASSY 2 isoform X1 
[Camelina sativa]
Length=1257

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/790 (61%), Positives = 589/790 (75%), Gaps = 18/790 (2%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTK---SCQREPIek  2559
             R F+K ++SA  Y +LI   M NI+ T+  +  P  +++QW+E + T       R+  + 
Sbjct  476   RVFKKVTLSAGAYNKLINTYMNNIEVTIAAKDEPTSVVEQWEELKKTNFVSKLHRDTEQT  535

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
              + ++  E SE +MLW+EMEL LAS Y+LDD E   ++   E     + G   C H++RL
Sbjct  536   RNEDDGGETSENEMLWREMELCLASSYILDDNE---VRVDNEAFEKARSG---CEHEYRL  589

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIGL CRLCG + TEIK V  PF      +   +Q  E  +  +   ++A+   F + 
Sbjct  590   DEEIGLCCRLCGHLGTEIKHVSAPFAEHKKWTIETKQIEEHDLKTKWSHEEAERKDFTMS  649

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
               S++     E  DN WALIP L+ KL  HQ+RAFEFLW+NIAGS+ PT +DP S K GG
Sbjct  650   SDSSELLV-AEESDNVWALIPQLKRKLHMHQQRAFEFLWRNIAGSVEPTLMDPTSDKIGG  708

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISH+PGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  709   CVISHTPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  768

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G QTY        ++   G+P+ +QD MHVLDCLEKMQKW AHPSVLLMGYTSFLTL RE
Sbjct  769   GRQTYSTFKHNTTVQF-NGVPKPSQDAMHVLDCLEKMQKWHAHPSVLLMGYTSFLTLMRE  827

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS ++HRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T  RILLSGTLFQNNF
Sbjct  828   DSKFSHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDFRILLSGTLFQNNF  887

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+F+ EVL ELD KYK R    K    LENRARK+FID I+KKID+S  
Sbjct  888   CEYFNTLCLARPKFIYEVLMELDQKYKTRQYVNKAPHLLENRARKLFIDIIAKKIDASVG  947

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+LK +T  FID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD   
Sbjct  948   DERLQGLNMLKNMTNSFIDNYEGSGSGSGDALPGLQIYTLLMNSTDVQHKILTKLQDVIK  1007

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              + G+PLE+EL  TL AIHPWLI+T+ C  ++F ++EL  +EK K D K GSKV FV++L
Sbjct  1008  THYGYPLEVELQTTLAAIHPWLIKTSNCCTKFFNQQELVEIEKHKHDAKKGSKVMFVLNL  1067

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1068  VYR-VVKREKILIFCHNIAPIRLFIELFENVFRWQRGREILTLTGDLELFERGRVIDKFE  1126

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E+G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1127  ELGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1186

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR   FH
Sbjct  1187  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRVKSFH  1246

Query  410   MIMKNEKASN  381
             MIMKNEKAS 
Sbjct  1247  MIMKNEKAST  1256


 Score =   219 bits (559),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 183/313 (58%), Gaps = 29/313 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPF+  PFE F +G+W+ VE IRI++G   + +L+ G ++E+      +R
Sbjct  1     MKKRRFYGLKHPFNPCPFEFFCSGTWKAVEHIRIEDGKMAIRLLENGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +R+R AT +DC CFLRP +D+ V    H+              + EP W+DA+I SI+RK
Sbjct  61    VRARKATLTDCICFLRPDIDVCVLYPLHED-------------DLEPVWVDARIVSIDRK  107

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C C+F++ +Y+ QG     K+ ++K+  ++ LNQI+ILQK  ++   D++YRW 
Sbjct  108   PHDQSECSCKFNVRIYIDQGCIASDKQRINKDSVLIGLNQISILQKFYKEQSSDQFYRWK  167

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DC++L + +L  GKF  DLSW+ V S  K + F +++V  ++VY+I+ DE       
Sbjct  168   FSEDCTSLTRTRLSLGKFLPDLSWLAVTSTMKSIVFHIRTVQTKMVYQIITDE------G  221

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSK  3333
             S     +++   E+ VS   ++QFNP DI      PE   E D Y         ELRRSK
Sbjct  222   SSSSISSMNITFEDGVSLSKVVQFNPADIVDDSQDPEIKQETDCYPE--EEEVVELRRSK  279

Query  3332  RRFVQPERYLGCD  3294
             RR V+P+ Y GCD
Sbjct  280   RRKVRPDIYTGCD  292



>ref|XP_010454347.1| PREDICTED: SNF2 domain-containing protein CLASSY 2 isoform X2 
[Camelina sativa]
Length=1257

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/790 (61%), Positives = 590/790 (75%), Gaps = 18/790 (2%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTK---SCQREPIek  2559
             R F+K ++SA  Y +LI   M NI+ T+  +  P  +++QW+E + T       R+  + 
Sbjct  476   RVFKKVTLSAGAYNKLINTYMNNIEVTIAAKDEPTSVVEQWEELKKTNFVSKLHRDTEQT  535

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
              + ++  E SE +MLW+EMEL LAS Y+LDD E   ++   E     + G   C H++RL
Sbjct  536   RNEDDGGETSENEMLWREMELCLASSYILDDNE---VRVDNEAFEKARSG---CEHEYRL  589

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIGL CRLCG + TEIK V  PF      +   +Q  E  +  +   ++A+   F + 
Sbjct  590   DEEIGLCCRLCGHLGTEIKHVSAPFAEHKKWTIETKQIEEHDLKTKWSHEEAERKDFTMS  649

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
               S++     E  DN WALIP L+ KL  HQ+RAFEFLW+NIAGS+ PT +DP S K GG
Sbjct  650   SDSSELLV-AEESDNVWALIPQLKRKLHMHQQRAFEFLWRNIAGSVEPTLMDPTSDKIGG  708

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISH+PGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  709   CVISHTPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  768

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G QTY        ++   G+P+ +QD MHVLDCLEKMQKW AHPSVLLMGYTSFLTL RE
Sbjct  769   GRQTYSTFKHNTTVQF-NGVPKPSQDAMHVLDCLEKMQKWHAHPSVLLMGYTSFLTLMRE  827

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS ++HRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T  RILLSGTLFQNNF
Sbjct  828   DSKFSHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDFRILLSGTLFQNNF  887

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+F+ EVL ELD KYK R    K    LENRARK+FID I+KKID+S  
Sbjct  888   CEYFNTLCLARPKFIYEVLMELDQKYKTRQYVNKAPHLLENRARKLFIDIIAKKIDASVG  947

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+LK +T  FID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD   
Sbjct  948   DERLQGLNMLKNMTNSFIDNYEGSGSGSGDALPGLQIYTLLMNSTDVQHKILTKLQDVIK  1007

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              + G+PLE+EL  TL AIHPWLI+T+ C  ++F ++EL  +EKFK D K GSKV FV++L
Sbjct  1008  SHYGYPLEVELQTTLAAIHPWLIKTSNCCTKFFNQQELVEIEKFKHDAKKGSKVMFVLNL  1067

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1068  VYR-VVKREKILIFCHNIAPIRLFIELFENVFRWQRGREILTLTGDLELFERGRVIDKFE  1126

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E+G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1127  ELGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1186

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR   FH
Sbjct  1187  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRVKSFH  1246

Query  410   MIMKNEKASN  381
             MIMKNEKAS 
Sbjct  1247  MIMKNEKAST  1256


 Score =   219 bits (559),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 183/313 (58%), Gaps = 29/313 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPF+  PFE F +G+W+ VE IRI++G   + +L+ G ++E+      +R
Sbjct  1     MKKRRFYGLKHPFNPCPFEFFCSGTWKAVEHIRIEDGKMAIRLLENGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +R+R AT +DC CFLRP +D+ V    H+              + EP W+DA+I SI+RK
Sbjct  61    VRARKATLTDCICFLRPDIDVCVLYPLHED-------------DLEPVWVDARIVSIDRK  107

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C C+F++ +Y+ QG     K+ ++K+  ++ LNQI+ILQK  ++   D++YRW 
Sbjct  108   PHDQSECSCKFNVRIYIDQGCIASDKQRINKDSVLIGLNQISILQKFYKEQSSDQFYRWK  167

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DC++L + +L  GKF  DLSW+ V S  K + F +++V  ++VY+I+ DE       
Sbjct  168   FSEDCTSLTRTRLSLGKFLPDLSWLAVTSTMKSIVFHIRTVQTKMVYQIITDE------G  221

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSK  3333
             S     +++   E+ VS   ++QFNP DI      PE   E D Y         ELRRSK
Sbjct  222   SSSSISSMNITFEDGVSLSKVVQFNPADIVDDSQDPEIKQETDCYPE--EEEVVELRRSK  279

Query  3332  RRFVQPERYLGCD  3294
             RR V+P+ Y GCD
Sbjct  280   RRKVRPDIYTGCD  292



>ref|NP_189853.1| chromatin remodeling 38 [Arabidopsis thaliana]
 sp|Q9M297.1|CLSY1_ARATH RecName: Full=SNF2 domain-containing protein CLASSY 1; AltName: 
Full=Protein CHROMATIN REMODELING 38 [Arabidopsis thaliana]
 emb|CAB86450.1| putative protein [Arabidopsis thaliana]
 gb|AEE77745.1| chromatin remodeling 38 [Arabidopsis thaliana]
Length=1256

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/791 (61%), Positives = 594/791 (75%), Gaps = 21/791 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQN--TKSCQREPIeksst  2550
             ++K ++SA  Y +LI   M+ ID T+  +     +++QW+  +N  + S + E       
Sbjct  477   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKDKATNVVEQWQGLKNPASFSIEAEERLSEEE  536

Query  2549  nneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEE  2370
              ++ E SE ++LW+EMEL LAS Y+LDD E   ++   E   A  K T  C HD+ LNEE
Sbjct  537   EDDGETSENEILWREMELCLASSYILDDHE---VRVDNE---AFHKATCDCEHDYELNEE  590

Query  2369  IGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPV-  2196
             IG+ CRLCG V TEIK V  PF      ++  +Q  E+ +       D    H F IPV 
Sbjct  591   IGMCCRLCGHVGTEIKHVSAPFARHKKWTTETKQINEDDINTTIVNQDGVESHTFTIPVA  650

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGC  2016
             SS+ PS+E    DN W+LIP L+ KL  HQ++AFEFLWKN+AGS++P  +DP S K GGC
Sbjct  651   SSDMPSAEES--DNVWSLIPQLKRKLHLHQKKAFEFLWKNLAGSVVPAMMDPSSDKIGGC  708

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             V+SH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG
Sbjct  709   VVSHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHG  768

Query  1835  GQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
              +TY   + ++K     G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL RED
Sbjct  769   RRTYC--MSKEKTIQFEGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMRED  826

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF 
Sbjct  827   SKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFC  886

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             EYFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+    
Sbjct  887   EYFNTLCLARPKFVHEVLVELDKKFQTNQAEQKAPHLLENRARKFFLDIIAKKIDTKVGD  946

Query  1298  erkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
             ER +GLN+L+ +T+GFID YEG   GS D LPGLQ YTL+M ST +Q + L KLQ+    
Sbjct  947   ERLQGLNMLRNMTSGFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDVQHKSLTKLQNIMST  1006

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
             Y G+PLELELLITL AIHPWL++TT C  ++F  +EL  +EK K D K GSKV FV++L+
Sbjct  1007  YHGYPLELELLITLAAIHPWLVKTTTCCAKFFNPQELLEIEKLKHDAKKGSKVMFVLNLV  1066

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
              R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFEE
Sbjct  1067  FR-VVKREKILIFCHNIAPIRLFLELFENVFRWKRGRELLTLTGDLELFERGRVIDKFEE  1125

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
              GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQL
Sbjct  1126  PGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQL  1185

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHM  408
             L+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEED+   FHM
Sbjct  1186  LSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSQWQAEKIEDDVLREIVEEDKVKSFHM  1245

Query  407   IMKNEKASNMG  375
             IMKNEKAS  G
Sbjct  1246  IMKNEKASTGG  1256


 Score =   226 bits (577),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 123/301 (41%), Positives = 177/301 (59%), Gaps = 18/301 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+   +  HPF+  PFE F  G+W+ VE +RI+NGT  M +L+ G ++++      +R
Sbjct  1     MKRKHYFEFNHPFNPCPFEVFCWGTWKAVEYLRIENGTMTMRLLENGQVLDDIKPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IRSR AT  DC  FLRPG+D+ V     +               PEP W+DA++ SIERK
Sbjct  61    IRSRKATLIDCTSFLRPGIDVCVLYQRDEET-------------PEPVWVDARVLSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C FH+SVY+ QG   + K  ++K   +V LN+IAILQK  ++   D+YYRW  
Sbjct  108   PHESECLCTFHVSVYIDQGCIGLEKHRMNKVPVLVGLNEIAILQKFCKEQSLDRYYRWRY  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS+L K +L  GKF  DL+W+LV S  K + F +++VH ++VY+I+ DE   D   S
Sbjct  168   SEDCSSLVKTRLNLGKFLPDLTWLLVTSVLKNIVFQIRTVHEKMVYQIVTDE---DCEGS  224

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPER  3309
                  A++  +E+ V    ++ FNP   +   + DV +        ELRRSKRR  +PER
Sbjct  225   SSSLSAMNITVEDGVVMSKVVLFNP-AEDTCQDSDV-KEEIEEEVMELRRSKRRSGRPER  282

Query  3308  Y  3306
             Y
Sbjct  283   Y  283



>ref|XP_010420881.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X2 [Camelina sativa]
Length=1258

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/790 (61%), Positives = 593/790 (75%), Gaps = 18/790 (2%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTKSCQR---EPIek  2559
             R F+K ++SA  Y +LI   M NI+ T+  +  P  +++QW+E + T    +   +  + 
Sbjct  477   RVFKKVTLSAGAYNKLIDTYMNNIEVTIAAKDEPTSVVEQWEELKKTNFVSKLYGDMEQT  536

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
             S+ ++E E SE  MLW+EMEL LAS Y+LDD+E      A E+  +       C H++RL
Sbjct  537   SNEDDEGETSENKMLWREMELCLASSYILDDSEARVDNKAFEMARSG------CEHEYRL  590

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIGL CRLCG V TEIK V  PF      +   +Q  E  +  +    +A+ + F + 
Sbjct  591   DEEIGLCCRLCGHVGTEIKHVSAPFAEHKKWTIETKQIEEHDLKTKLGHKEAEREDFTMS  650

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
             + S++  +  E  DN WALIP L+ KL  HQ+RAFEFLW+NIAGS+ P  +DP S K GG
Sbjct  651   IDSSELLA-AEESDNVWALIPQLKRKLHMHQQRAFEFLWRNIAGSVEPALMDPTSDKIGG  709

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISH+PGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  710   CVISHTPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  769

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G QTY        ++   G+P+ ++DVMHVLDCLEK+QKW AHPSVL+MGYTSFLTL RE
Sbjct  770   GRQTYSTFKHNSTVQF-NGVPKPSKDVMHVLDCLEKIQKWHAHPSVLVMGYTSFLTLMRE  828

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T LRILLSGTLFQNNF
Sbjct  829   DSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDLRILLSGTLFQNNF  888

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+F+ EVL ELD KYK R    K    LENRARK+FID I+KKID+S  
Sbjct  889   CEYFNTLCLARPKFIHEVLMELDQKYKTRQYVNKAPHLLENRARKLFIDIIAKKIDASVG  948

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+LK +T  FID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD   
Sbjct  949   DERLQGLNMLKNMTNSFIDNYEGSGSGSGDALPGLQIYTLLMNSTDVQHKILTKLQDVIK  1008

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              + G+PLE+EL  TL AIHPWLI+T+ C  ++F ++EL  +EK K D K GSKV FV++L
Sbjct  1009  SHYGYPLEVELQTTLAAIHPWLIKTSNCCTKFFNQQELVEIEKHKHDAKKGSKVMFVLNL  1068

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1069  VYR-VVKREKILIFCHNIAPIRLFIELFENVFRWQRGREILTLTGDLELFERGRVIDKFE  1127

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E+G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1128  ELGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1187

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR   FH
Sbjct  1188  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRVKSFH  1247

Query  410   MIMKNEKASN  381
             MIMKNEKAS 
Sbjct  1248  MIMKNEKAST  1257


 Score =   232 bits (592),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 187/313 (60%), Gaps = 29/313 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPFD  PFE F +G+W+ VE IRI++G   + +L+ G ++E+      +R
Sbjct  1     MKKRRFYGLKHPFDPCPFEFFCSGTWKAVEHIRIEDGKMAIRLLENGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC CFLRP +D+ V    H+              + EP W+DA+I SIERK
Sbjct  61    LRSRKATLTDCICFLRPDIDVCVLYPLHED-------------DLEPVWVDARIVSIERK  107

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C C+ ++ +Y+ QG     K+ ++K+  V+ LNQI+ILQK  ++   D+YYRW 
Sbjct  108   PHDQSKCSCKINVRIYIDQGCIASDKQRINKDSVVIGLNQISILQKFYKEQITDQYYRWK  167

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DC++L + +L  GKF  DLSW+ V S  K + F +++V  ++VY+I+ DE      +
Sbjct  168   FSEDCTSLTRTRLSLGKFLPDLSWLAVTSFTKSIVFHIRTVQTKMVYQIITDE----GCS  223

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSK  3333
             S   S  ++F  E+ VS   ++QFNP DI      PE   E D Y     VV  E+RRSK
Sbjct  224   SSMSSMNITF--EDGVSLSKVVQFNPADIVDDSQDPEIKQETDCYPEEDEVV--EMRRSK  279

Query  3332  RRFVQPERYLGCD  3294
             RR V+P+RY GCD
Sbjct  280   RRKVRPDRYTGCD  292



>ref|XP_010420880.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Camelina sativa]
Length=1258

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/790 (62%), Positives = 594/790 (75%), Gaps = 18/790 (2%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTKSCQR---EPIek  2559
             R F+K ++SA  Y +LI   M NI+ T+  +  P  +++QW+E + T    +   +  + 
Sbjct  477   RVFKKVTLSAGAYNKLIDTYMNNIEVTIAAKDEPTSVVEQWEELKKTNFVSKLYGDMEQT  536

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
             S+ ++E E SE  MLW+EMEL LAS Y+LDD+E      A E+  +       C H++RL
Sbjct  537   SNEDDEGETSENKMLWREMELCLASSYILDDSEARVDNKAFEMARSG------CEHEYRL  590

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIGL CRLCG V TEIK V  PF      +   +Q  E  +  +    +A+ + F + 
Sbjct  591   DEEIGLCCRLCGHVGTEIKHVSAPFAEHKKWTIETKQIEEHDLKTKLGHKEAEREDFTMS  650

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
             + S++  +  E  DN WALIP L+ KL  HQ+RAFEFLW+NIAGS+ P  +DP S K GG
Sbjct  651   IDSSELLA-AEESDNVWALIPQLKRKLHMHQQRAFEFLWRNIAGSVEPALMDPTSDKIGG  709

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISH+PGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  710   CVISHTPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  769

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G QTY        ++   G+P+ ++DVMHVLDCLEK+QKW AHPSVL+MGYTSFLTL RE
Sbjct  770   GRQTYSTFKHNSTVQF-NGVPKPSKDVMHVLDCLEKIQKWHAHPSVLVMGYTSFLTLMRE  828

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T LRILLSGTLFQNNF
Sbjct  829   DSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDLRILLSGTLFQNNF  888

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+F+ EVL ELD KYK R    K    LENRARK+FID I+KKID+S  
Sbjct  889   CEYFNTLCLARPKFIHEVLMELDQKYKTRQYVNKAPHLLENRARKLFIDIIAKKIDASVG  948

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+LK +T  FID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD   
Sbjct  949   DERLQGLNMLKNMTNSFIDNYEGSGSGSGDALPGLQIYTLLMNSTDVQHKILTKLQDVIK  1008

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              + G+PLE+EL  TL AIHPWLI+T+ C  ++F ++EL  +EKFK D K GSKV FV++L
Sbjct  1009  SHYGYPLEVELQTTLAAIHPWLIKTSNCCTKFFNQQELVEIEKFKHDAKKGSKVMFVLNL  1068

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1069  VYR-VVKREKILIFCHNIAPIRLFIELFENVFRWQRGREILTLTGDLELFERGRVIDKFE  1127

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E+G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1128  ELGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1187

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR   FH
Sbjct  1188  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRVKSFH  1247

Query  410   MIMKNEKASN  381
             MIMKNEKAS 
Sbjct  1248  MIMKNEKAST  1257


 Score =   232 bits (592),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/313 (41%), Positives = 187/313 (60%), Gaps = 29/313 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPFD  PFE F +G+W+ VE IRI++G   + +L+ G ++E+      +R
Sbjct  1     MKKRRFYGLKHPFDPCPFEFFCSGTWKAVEHIRIEDGKMAIRLLENGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC CFLRP +D+ V    H+              + EP W+DA+I SIERK
Sbjct  61    LRSRKATLTDCICFLRPDIDVCVLYPLHED-------------DLEPVWVDARIVSIERK  107

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C C+ ++ +Y+ QG     K+ ++K+  V+ LNQI+ILQK  ++   D+YYRW 
Sbjct  108   PHDQSKCSCKINVRIYIDQGCIASDKQRINKDSVVIGLNQISILQKFYKEQITDQYYRWK  167

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DC++L + +L  GKF  DLSW+ V S  K + F +++V  ++VY+I+ DE      +
Sbjct  168   FSEDCTSLTRTRLSLGKFLPDLSWLAVTSFTKSIVFHIRTVQTKMVYQIITDE----GCS  223

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSK  3333
             S   S  ++F  E+ VS   ++QFNP DI      PE   E D Y     VV  E+RRSK
Sbjct  224   SSMSSMNITF--EDGVSLSKVVQFNPADIVDDSQDPEIKQETDCYPEEDEVV--EMRRSK  279

Query  3332  RRFVQPERYLGCD  3294
             RR V+P+RY GCD
Sbjct  280   RRKVRPDRYTGCD  292



>ref|XP_002873997.1| hypothetical protein ARALYDRAFT_351139 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50256.1| hypothetical protein ARALYDRAFT_351139 [Arabidopsis lyrata subsp. 
lyrata]
Length=1260

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/791 (61%), Positives = 587/791 (74%), Gaps = 20/791 (3%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTK---SCQREPIek  2559
             R ++K ++SA  Y +LI   M NI+ T++ +  P  ++DQW+E + T       R+  + 
Sbjct  479   RVYKKVTLSAGAYNKLIDSYMNNIESTISAKDEPTNVLDQWEELKKTNFAFKVHRDMEQN  538

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
              S + E E SE +MLW+EMEL LAS Y+LDD E      A   + A +K    C HD++L
Sbjct  539   LSEDGEGETSENEMLWREMELCLASSYILDDNE------ARVDNEALEKARSGCEHDYKL  592

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIG+ CRLCG V TEIKDV  PF      +   +Q  E+ +  +    + + + F + 
Sbjct  593   DEEIGMCCRLCGHVGTEIKDVSAPFAEHKKWTMETKQLEEDDIKTKLSHKEGETEDFTMS  652

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
               S+K  +  E E N WALIP L+ KL  HQRRAFEFLW+N+AGS+ P+ +DP S   GG
Sbjct  653   SDSSKILAAEESE-NVWALIPQLKRKLHMHQRRAFEFLWRNLAGSVEPSLMDPTSDNIGG  711

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISHSPGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  712   CVISHSPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  771

Query  1838  GGQTYKGEVLRQKMKL-CPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR  1665
             G +TY     +Q   +   G+P+ +QDVMHVLDCLEK+QKW AHPSVL+MGYTSFLTL R
Sbjct  772   GRRTYC--TFKQNSTIQFNGVPKPSQDVMHVLDCLEKIQKWHAHPSVLVMGYTSFLTLMR  829

Query  1664  EDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNN  1485
             EDS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T LRILLSGTLFQNN
Sbjct  830   EDSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDLRILLSGTLFQNN  889

Query  1484  FGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssk  1305
             F EYFNTLCLARP+F+ EVL ELD K+K      K    LENRARK FID I+KKID+  
Sbjct  890   FCEYFNTLCLARPKFIHEVLMELDQKFKTNQSVNKAPHLLENRARKFFIDIIAKKIDAGV  949

Query  1304  ererkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQR  1134
               ER +G+N+LK +T  FID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD  
Sbjct  950   GDERLQGINMLKNMTNSFIDNYEGSGSGSGDALPGLQIYTLVMNSTDIQHKILTKLQDVI  1009

Query  1133  PIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMS  954
               Y G+PLE+EL ITL AIHPWL+ ++ C  ++F  +EL  +EK K D K GSKV FV++
Sbjct  1010  KTYFGYPLEVELQITLAAIHPWLVTSSNCCKKFFNPQELLEIEKLKHDAKKGSKVMFVLN  1069

Query  953   LIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKF  774
             L+ R ++++EK+LIFCHNIAPI +F E+FE  + W++G E+L L GD+ELFERGRV+DKF
Sbjct  1070  LVYR-VVKREKILIFCHNIAPIRMFTELFENVFRWQRGREILTLTGDLELFERGRVIDKF  1128

Query  773   EEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
             EE G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVY
Sbjct  1129  EEPGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVY  1188

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLF  414
             QLL+ GTLEE+KY+RTTWKEWVSSMIFSE+ V DPS WQA KIED++L EIV ED+   F
Sbjct  1189  QLLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVADPSLWQAEKIEDDVLREIVGEDKVKSF  1248

Query  413   HMIMKNEKASN  381
             HMIMKNEKAS 
Sbjct  1249  HMIMKNEKAST  1259


 Score =   236 bits (601),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 187/319 (59%), Gaps = 28/319 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPFD  PFE F +G+W+PVE +RI++G   + +L  G ++E+      +R
Sbjct  1     MKKRGFYNLKHPFDPCPFEFFCSGTWKPVEYMRIEDGMMTIRLLQNGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A  SDC CFLRP +D+ V    H+              + EP W+DA+I SIERK
Sbjct  61    LRSRKAALSDCICFLRPDIDVCVLYRLHED-------------DLEPVWVDARIVSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+  + +Y+ QG     K+ ++K+  ++ LNQI+ILQK  ++   D++YRW  
Sbjct  108   PHDSECSCKISVRIYIDQGCIGSEKQRINKDAVLIGLNQISILQKFYKEQSTDQFYRWKF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L K +L  GKF  DLSW+ V S  K + F +++V  R+VY+I+ DE      +S
Sbjct  168   SEDCTSLMKTRLSLGKFLPDLSWLTVTSILKSIVFHIRTVQTRMVYQIVADEGSSSTLSS  227

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSKR  3330
                   ++  +E+ VS   ++QFNP DI      PE   E D ++    VV  ELRRSKR
Sbjct  228   ------MNITVEDGVSLSKVVQFNPADILDDSQDPEIKQETDYFQEADEVV--ELRRSKR  279

Query  3329  RFVQPERYLGCDDYLTEFD  3273
             R V+P+R+ GCD  L   D
Sbjct  280   RNVRPDRFTGCDYQLDTND  298



>ref|XP_010483428.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
 ref|XP_010483429.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
 ref|XP_010483430.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
 ref|XP_010483431.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
 ref|XP_010483432.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
 ref|XP_010483434.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
 ref|XP_010483435.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 [Camelina 
sativa]
Length=1259

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/792 (61%), Positives = 590/792 (74%), Gaps = 22/792 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             ++K ++SA  Y +LI   M+ ID T+    E   +++Q    +N  S   E  + SS ++
Sbjct  479   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKNEATNVVEQLMGLKNAASSSMEAEKSSSEDD  538

Query  2543  eeelseLD-MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEI  2367
             +EE +  + MLW+EMEL LAS Y+LDD E   ++   E   A  K    C HD+ LNEEI
Sbjct  539   DEEETSENEMLWREMELCLASSYILDDNE---VRVDNE---AFHKALGGCEHDYELNEEI  592

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPV-S  2193
             G+ CRLCG V TE+K V  PF      ++  +Q  E+ +   K   D    H + IPV S
Sbjct  593   GMCCRLCGHVGTEMKHVSAPFAHHKKWTTETKQVNEDDINTTKVNQDGAESHNYTIPVAS  652

Query  2192  SNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCV  2013
             S+ PS+E    DN W+LIP L  KL  HQ++AFEFLW+N+AGS++P  +DP S+K GGCV
Sbjct  653   SDMPSAEES--DNVWSLIPQLERKLHLHQKKAFEFLWRNLAGSVVPAMMDPSSEKIGGCV  710

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG 
Sbjct  711   ISHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHGR  770

Query  1832  QTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
             +TY   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL REDS
Sbjct  771   RTYC--VAKENTIQIEGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMREDS  828

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF E
Sbjct  829   KFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFCE  888

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskere  1296
             YFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+    E
Sbjct  889   YFNTLCLARPKFVHEVLVELDQKFQTNQTEQKAPHLLENRARKFFLDIIAKKIDTKVGDE  948

Query  1295  rkEGLNILKKLTTGFIDVYEGGSS-----DNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
             R +GLN+L+ +T+GFID YEG  S     D LPGLQ YTL+M ST +Q   L KLQ+   
Sbjct  949   RLQGLNMLRNMTSGFIDNYEGNGSGSGSGDVLPGLQIYTLLMNSTDIQHRTLTKLQNIMS  1008

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              Y G+PLELELLITL AIHPWL++TTAC  ++   +EL  +EK K D K GSKV FV++L
Sbjct  1009  TYHGYPLELELLITLAAIHPWLVKTTACCTKFLNPQELSEIEKLKHDAKKGSKVMFVLNL  1068

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1069  VFR-VVKREKILIFCHNIAPIRLFLELFENIFRWKRGRELLTLTGDLELFERGRVIDKFE  1127

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1128  EPGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1187

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ V DPS WQA KIED++L EIVEED+   FH
Sbjct  1188  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVADPSQWQAEKIEDDVLREIVEEDKVKSFH  1247

Query  410   MIMKNEKASNMG  375
             MIMKNEKAS  G
Sbjct  1248  MIMKNEKASTGG  1259


 Score =   211 bits (538),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 116/301 (39%), Positives = 178/301 (59%), Gaps = 17/301 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+      HPF+  PFE F +G+W+ VE +RI+NG   M +L+ G ++++      +R
Sbjct  1     MKRKHYFDFNHPFNQCPFEVFCSGTWKAVEYLRIENGAMTMPLLENGQVLDDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC  FLRPGLD+ V           +++   ++   EP W+DA+I SIERK
Sbjct  61    LRSRKATLVDCTSFLRPGLDVCVL---------YQKDVTVDEETTEPVWVDARILSIERK  111

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C FH+SVY+ QG     K  +++   ++ LNQI+ILQK+ ++   D+YYRW  
Sbjct  112   PHESECLCIFHVSVYIDQGCIGSEKHRMNRASVLMGLNQISILQKLCKEQSLDRYYRWRN  171

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L K +L  GKF  D+SW+LV S  K + F +++ H ++VY+I+ DE       S
Sbjct  172   SEDCTSLVKTRLNLGKFLPDVSWLLVTSVLKNIVFQIRTFHEKMVYQIVADE------CS  225

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPER  3309
                  A++  +E+ V    ++ FNP   +   + DV +     V  ELRRSKRR  +P+R
Sbjct  226   SSSLSAMNITVEDGVFMSKVVLFNP-AEDTHQDTDVKQEIEEEVM-ELRRSKRRSGRPDR  283

Query  3308  Y  3306
             +
Sbjct  284   F  284



>ref|XP_010443568.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443569.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443570.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443571.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443572.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443573.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443575.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443576.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
 ref|XP_010443577.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
Length=1259

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/792 (60%), Positives = 591/792 (75%), Gaps = 22/792 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             ++K ++SA  Y +LI   M+ ID T+    E   +++Q    +N  S   E  + SS ++
Sbjct  479   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKNEATNVVEQLMGLKNAASSSMEAEKSSSEDD  538

Query  2543  eeelseLD-MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEI  2367
             +EE +  + MLW+EMEL LAS Y+LDD E   ++   E   A  K    C HD+ LNEEI
Sbjct  539   DEEETSENEMLWREMELCLASSYILDDNE---VRVDNE---AFHKALGGCEHDYELNEEI  592

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPVSS  2190
             G+ CRLCG V TE+K V  PF      ++  +Q  E+ +   K   D    H + +PV+S
Sbjct  593   GMCCRLCGHVGTEMKHVSAPFAHHKKWTTETKQVNEDDINTTKVNQDGAESHNYTVPVAS  652

Query  2189  -NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCV  2013
              + PS+E    DN W+LIP L+ KL  HQ++AFEFLW+N+AGS++P  +DP S+K GGCV
Sbjct  653   LDMPSAEES--DNVWSLIPQLKRKLHLHQKKAFEFLWRNLAGSVVPAMMDPSSEKIGGCV  710

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG 
Sbjct  711   ISHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHGR  770

Query  1832  QTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
             +TY   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL REDS
Sbjct  771   RTYC--VAKENTIQIEGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMREDS  828

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF E
Sbjct  829   KFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFCE  888

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskere  1296
             YFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+    E
Sbjct  889   YFNTLCLARPKFVHEVLVELDQKFQTNQTEQKAPHLLENRARKFFLDIIAKKIDTKVGDE  948

Query  1295  rkEGLNILKKLTTGFIDVYEGGSS-----DNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
             R +GLN+L+ +T+GFID YEG  S     D LPGLQ YTL+M ST +Q   L KLQ+   
Sbjct  949   RLQGLNMLRNMTSGFIDNYEGNGSGSGSGDVLPGLQIYTLLMNSTDIQHRTLTKLQNIMS  1008

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              Y G+PLELELLITL AIHPWL++TTAC  ++   +EL  +EK K D K GSKV FV++L
Sbjct  1009  TYHGYPLELELLITLAAIHPWLVKTTACCTKFLNPQELSEIEKLKHDAKKGSKVMFVLNL  1068

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1069  VFR-VVKREKILIFCHNIAPIRLFLELFENIFRWKRGRELLTLTGDLELFERGRVIDKFE  1127

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1128  EPGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1187

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ V DPS WQA KIED++L EIVEED+   FH
Sbjct  1188  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVADPSQWQAEKIEDDVLREIVEEDKVKSFH  1247

Query  410   MIMKNEKASNMG  375
             MIMKNEKAS  G
Sbjct  1248  MIMKNEKASTGG  1259


 Score =   208 bits (529),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 114/301 (38%), Positives = 177/301 (59%), Gaps = 17/301 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+     +HP +  PFE F +G+W+ VE +RI+NG   M +L+ G ++++      +R
Sbjct  1     MKRKHYFDFDHPLNPCPFEVFCSGTWKAVEYLRIENGAMTMRLLENGQVLDDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC  FLRPGLD+ V           +++   ++   EP W+DA+I SIERK
Sbjct  61    LRSRKATLVDCTSFLRPGLDVCVL---------YQKDVTVDEETTEPVWVDARILSIERK  111

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C FH+SVY+ QG     K  +++   ++ LNQI+ILQK+ ++   ++YYRW  
Sbjct  112   PHESECFCIFHVSVYIDQGCIGSEKHRMNRASVLMGLNQISILQKLCKEQSLNRYYRWRN  171

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L K +L  GKF  D+SW+LV S  K + F +++ H ++VY+I+ DE       S
Sbjct  172   SEDCTSLVKTRLNLGKFLPDVSWLLVTSVLKNIVFQIRTFHEKMVYQIVADE------CS  225

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPER  3309
                  A++  +E+ V    ++ FNP   +   + DV +     V  ELRRSKRR  +P+R
Sbjct  226   SSSLSAMNITVEDGVFMSKVVLFNP-AEDTHQDTDVKQEIEEEVM-ELRRSKRRSGRPDR  283

Query  3308  Y  3306
             +
Sbjct  284   F  284



>ref|XP_010493147.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like [Camelina 
sativa]
 ref|XP_010493148.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like [Camelina 
sativa]
Length=1253

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/790 (61%), Positives = 586/790 (74%), Gaps = 18/790 (2%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTK---SCQREPIek  2559
             R F+K ++SA  Y +LI   M NI+ T+  +  P  +++QW+E + T       R+  + 
Sbjct  472   RVFKKVTLSAGAYNKLIDTYMNNIEVTIAAKDEPTSVVEQWEELKKTNFVSKLHRDMEQT  531

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
             S+ ++E E SE +MLW+EMEL LAS Y+LDD E      A   + A +K    C H++RL
Sbjct  532   SNEDDEGETSENEMLWREMELCLASSYILDDNE------ARVGNEAFEKARIGCEHEYRL  585

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIG+ CRLCG V TEIK V  PF      +   +Q  E  +  +    +A+   F + 
Sbjct  586   DEEIGMCCRLCGHVGTEIKHVSAPFAEHKKWTIETKQIEEHDLKTKLGHKEAERKDFTMS  645

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
              S +      E  DN WALIP L+ KL  HQ+RAFEFLW+NIAG + P  +DP S K GG
Sbjct  646   -SDSLGLLAAEESDNVWALIPQLKRKLHMHQQRAFEFLWRNIAGYVEPALMDPTSDKIGG  704

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISH+PGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  705   CVISHTPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  764

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G +TY        ++   G+P+ ++DVMHVLDCLEK+QKW AHPSVL+MGYTSFLTL RE
Sbjct  765   GRRTYSTFKHNSTVQF-NGVPKPSKDVMHVLDCLEKIQKWHAHPSVLVMGYTSFLTLMRE  823

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF
Sbjct  824   DSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKGLMKVGTDLRILLSGTLFQNNF  883

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+F+ EVL ELD KYK R    K    LENRARK+FID I+KKID+S  
Sbjct  884   CEYFNTLCLARPKFIHEVLMELDQKYKTRQGVKKAPHLLENRARKLFIDIIAKKIDASVG  943

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+LK +T  FID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD   
Sbjct  944   DERLQGLNMLKNMTNSFIDNYEGSGCGSGDALPGLQIYTLLMNSTDVQHKILAKLQDVID  1003

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              Y G+PLE+EL  TL AIHPWL+ T+ C  ++F  +EL  +EK K D K GSKV FV++L
Sbjct  1004  SYYGYPLEVELQTTLAAIHPWLVTTSNCCTKFFNPQELVEIEKVKHDAKKGSKVMFVLNL  1063

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1064  VYR-VVKREKILIFCHNIAPIRLFIELFENVFRWQRGREILTLTGDLELFERGRVIDKFE  1122

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E+G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1123  ELGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1182

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR   FH
Sbjct  1183  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRVKSFH  1242

Query  410   MIMKNEKASN  381
             MIMKNEKAS 
Sbjct  1243  MIMKNEKAST  1252


 Score =   218 bits (556),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 121/313 (39%), Positives = 179/313 (57%), Gaps = 29/313 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPFD  PFE F +G+W  VE IRI++G   + +L+ G ++E+      +R
Sbjct  1     MKKRRFYGLKHPFDPCPFEFFCSGTWNAVEYIRIEDGKMAIRLLENGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC C LRP +D+ V    H+              + EP W+DA+I SIERK
Sbjct  61    LRSRKATLTDCICLLRPDIDVCVLYPLHED-------------DFEPVWVDARIVSIERK  107

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C C+ +I +Y+ QG     K+ ++K+  ++ LNQI+ILQK  ++   D++YRW 
Sbjct  108   PHDQSKCSCKINIRIYIDQGCIASDKQRINKDSVLISLNQISILQKFYKEQSTDQFYRWK  167

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DC++L + +L  GKF  DLSW+ V S  K + F +++V  +IVY+I+ DE       
Sbjct  168   FSEDCTSLTRTRLSLGKFLPDLSWLAVTSITKSIVFHIRTVQTKIVYQIITDE------G  221

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSK  3333
             S      ++  +E+ V    ++QFNP DI      PE   E D           ELRRSK
Sbjct  222   SSSSMSLMNITVEDGVPLSKVVQFNPADIVNDSQDPETKQETDC--DPEEEEVVELRRSK  279

Query  3332  RRFVQPERYLGCD  3294
             RR V+P+RY GCD
Sbjct  280   RRKVRPDRYTGCD  292



>ref|XP_006400609.1| hypothetical protein EUTSA_v10012460mg [Eutrema salsugineum]
 gb|ESQ42062.1| hypothetical protein EUTSA_v10012460mg [Eutrema salsugineum]
Length=1280

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/799 (61%), Positives = 588/799 (74%), Gaps = 31/799 (4%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQR--------  2574
             R ++K ++SA  Y +LI   M NID T+    E   ++DQW+E + T    +        
Sbjct  492   RVYKKVTLSAGAYNKLIDTYMNNIDSTIAAKDESTNVVDQWEELKKTNFAAKPHGEMEET  551

Query  2573  -EPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC  2397
                 +    ++E E SE  +LW+EMEL+LAS Y+LDD E      A   + A +K    C
Sbjct  552   SSEDDDDDDDDEGETSENQVLWREMELSLASTYILDDNE------ARVDNEAFQKAKGGC  605

Query  2396  HHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADL  2217
              HD+ LNEEIGL CRLCG V TEI+ V  PF      ++   Q  EE  ++ K   + + 
Sbjct  606   VHDYLLNEEIGLCCRLCGHVGTEIRYVSAPFAEHKKWTTETRQ-IEEDDLKTKMSHNKEA  664

Query  2216  DHFAIPVSSNKPSSEV---EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI  2046
             +     +SS+  SSE+   E  DN WALIP L+ KL  HQ+RAFEFLW+N+AGS+ P  +
Sbjct  665   ESQDFTMSSD--SSEILAAEESDNVWALIPQLKRKLHTHQQRAFEFLWRNLAGSVEPPLM  722

Query  2045  DPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWK  1866
             DP S   GGCVISHSPGAGKT L+IAFL SYLKLFPG RPL+LAPKTTLYTWYKE IKW+
Sbjct  723   DPTSDNVGGCVISHSPGAGKTFLMIAFLTSYLKLFPGKRPLILAPKTTLYTWYKEFIKWE  782

Query  1865  IPIPVYQIHGGQTYKGEVLRQKMKL-CPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMG  1692
             IP PV+ IHG +TY   V +Q   +   G+P+ +QDVMHVLDCLEK+QKW AHPSVL+MG
Sbjct  783   IPFPVHLIHGRRTYC--VFKQNSTVQFKGVPKPSQDVMHVLDCLEKIQKWHAHPSVLVMG  840

Query  1691  YTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRIL  1512
             YTSFLTL REDS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T LR+L
Sbjct  841   YTSFLTLMREDSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDLRVL  900

Query  1511  LSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidk  1332
             LSGTLFQNNF EYFNTLCLARP+FV EVL ELD K+K      K    LENRARK F+D 
Sbjct  901   LSGTLFQNNFCEYFNTLCLARPKFVHEVLMELDQKFKANQGVNKAPHRLENRARKFFLDN  960

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQE  1161
             I+KKID+    ER +GLN+LK +T  FID YEG   G+SD LPGLQ YTL+M ST +Q  
Sbjct  961   IAKKIDAGVGEERLQGLNMLKNMTNSFIDNYEGSGSGTSDALPGLQIYTLLMNSTDIQHN  1020

Query  1160  ILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkL  981
             IL KLQ+    Y GFPLELELL+TL AIHPWL++T+ C  ++F  +EL  +EK K D K 
Sbjct  1021  ILTKLQNVMETYHGFPLELELLVTLAAIHPWLVKTSTCCAKFFNPQELVEIEKLKHDAKK  1080

Query  980   GSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELF  801
             GSKV FV++++ R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELF
Sbjct  1081  GSKVMFVLNMVFR-VVKREKILIFCHNIAPIRLFIELFENVFRWQRGKEILTLTGDLELF  1139

Query  800   ERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRP  621
             ERGRV+DKFE+ G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRP
Sbjct  1140  ERGRVIDKFEDPGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRP  1199

Query  620   GQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEI  441
             GQ K+VYVYQLL+ GTLEE+KYKRTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EI
Sbjct  1200  GQQKIVYVYQLLSRGTLEEDKYKRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREI  1259

Query  440   VEEDRATLFHMIMKNEKAS  384
             V EDR   FHMIMKNEKAS
Sbjct  1260  VGEDRVKSFHMIMKNEKAS  1278


 Score =   233 bits (593),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 187/315 (59%), Gaps = 29/315 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK++  +  +HPFD  PFE F +G+W+ VE +RI++G   + +++   ++E+      +R
Sbjct  1     MKKKRFYDLKHPFDPCPFEIFSSGTWKAVEYLRIEDGKMTIRLVENVYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT SDC CFLRPG+D+ V    ++              +PEP W+DA+I SIERK
Sbjct  61    LRSRKATLSDCTCFLRPGIDVCVLYPLYED-------------DPEPVWVDARIASIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+ ++ +Y+ QG     ++ ++++  ++ LNQI+ILQ+  ++   D++YRW  
Sbjct  108   PHDSECSCKIYVRIYIDQGCIGSERQRINRDSVLIGLNQISILQRFFKEQSSDQFYRWKF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             ++DC++L K +L  GKF  DLSW++V S  K + F +++V N++VY+I+ D    D   S
Sbjct  168   AEDCTSLMKTRLSLGKFLPDLSWLVVTSVMKNIVFHIRTVQNKMVYQIVTD----DEEGS  223

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP----------DIPERGPEGDVYEAGPLVVYDELRR  3339
                  A++ K+E+ VS   ++ FNP           + E   E D Y+    VV  ELRR
Sbjct  224   SSSLTAMNIKVEDGVSLSKVVHFNPADIIIVEDSSQVLELKQETDFYQEEDEVV--ELRR  281

Query  3338  SKRRFVQPERYLGCD  3294
             SKRR V P+RY GCD
Sbjct  282   SKRRNVIPDRYYGCD  296



>gb|ABA18099.1| SNF2 domain-containing protein [Olimarabidopsis pumila]
Length=1256

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/792 (60%), Positives = 589/792 (74%), Gaps = 21/792 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETLNKEQPPI--IDQWKEFQNTKSCQREPIeksstnn  2544
             ++K ++SA  Y +LI   M+ ID T+  ++     ++QW+  +N  S   +  E+ S   
Sbjct  475   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKEKATDAVEQWEGLKNGASSSMKAEERLSEEE  534

Query  2543  eeelseLD---MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNE  2373
             +++  E     MLW+EMEL LAS Y+LDD E      A   H AT      C HD+ LNE
Sbjct  535   DDDEEETSEIEMLWREMELCLASSYILDDNEVRVDNEA--FHKATGYD---CEHDYELNE  589

Query  2372  EIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPV  2196
             EIG+ CR CG V TEIK+V  PF      ++  +   E+ +   K   +    H F  PV
Sbjct  590   EIGMCCRSCGHVGTEIKNVSAPFAQHKKWTTETKHVNEDDINTTKVNQEGVESHSFTKPV  649

Query  2195  -SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
              SS+ PS+E    DN W+LIP L+ KL  HQ++AFEFLW+N+AGS++P  +D  S+K GG
Sbjct  650   ASSDMPSAEES--DNVWSLIPQLKIKLHLHQKKAFEFLWRNLAGSMVPAMMDASSEKIGG  707

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +H
Sbjct  708   CVISHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLH  767

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G +TY   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL RE
Sbjct  768   GRRTYC--VAKENTIQFKGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMRE  825

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS +AHRKYM +VL++ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF
Sbjct  826   DSKFAHRKYMAKVLKESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNF  885

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+FV EVL ELD K++      K    LENRARK F+D I+KKID+   
Sbjct  886   CEYFNTLCLARPKFVHEVLMELDQKFETNQAAQKAPHLLENRARKFFLDIIAKKIDTKVG  945

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+L+ +T+GFID YEG   GS D LPGLQ YTL+M ST +Q + L KLQ+   
Sbjct  946   DERLQGLNMLRNMTSGFIDNYEGSGSGSGDVLPGLQIYTLLMNSTDIQHKSLTKLQNIMS  1005

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              Y G+PLELELLITL AIHPWL++TT C  ++F  +EL  +EK K D K GSKV FV++L
Sbjct  1006  TYHGYPLELELLITLAAIHPWLVKTTTCCTKFFNPQELFEIEKLKHDAKKGSKVMFVLNL  1065

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1066  VFR-VVKREKILIFCHNIAPIRLFLELFENVFRWKRGRELLTLTGDLELFERGRVIDKFE  1124

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1125  EPGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1184

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIVEED+   FH
Sbjct  1185  LLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSQWQAEKIEDDVLREIVEEDKVKSFH  1244

Query  410   MIMKNEKASNMG  375
             MIMKNEKAS  G
Sbjct  1245  MIMKNEKASTGG  1256


 Score =   218 bits (555),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 175/302 (58%), Gaps = 21/302 (7%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR++  +  HPF+  PFE F  G+W+ VE +RI+NGT  M +L+ G ++++      +R
Sbjct  1     MKRKNYFEFNHPFNPCPFEVFCLGTWKAVEYLRIENGTMTMRLLENGQVLDDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC  FLRP LD+ V     +                EP W+DA+I SIERK
Sbjct  61    LRSRKATLIDCTSFLRPSLDVCVLYQKDEEIT-------------EPVWVDARILSIERK  107

Query  3848  PHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             PH    C+C+FH+SVY+ QG     K  ++K   VV LNQI+ILQK  ++   D YYRW 
Sbjct  108   PHDESECLCKFHVSVYIDQGCIGSEKHRMNKATVVVGLNQISILQKFCKEQSLDNYYRWR  167

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S++C++L K +L  GKF  DL+W+LV S  K + F +++VH +IVY+I+ DE       
Sbjct  168   YSENCTSLVKTRLNLGKFLPDLTWLLVTSVLKNIVFQIRTVHEKIVYQIVTDE------G  221

Query  3491  SEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPE  3312
              E    A++  +E+ V    ++ FNP   +   + DV E     V  ELRRSKRR  QP+
Sbjct  222   CEGSLSAMNIMVEDGVFMSKVVLFNP-AEDTYQDTDVKEEIEEEVIMELRRSKRRSAQPD  280

Query  3311  RY  3306
             R+
Sbjct  281   RF  282



>ref|NP_197542.1| chromatin remodeling 42 [Arabidopsis thaliana]
 sp|F4K493.1|CLSY2_ARATH RecName: Full=SNF2 domain-containing protein CLASSY 2; AltName: 
Full=Protein CHROMATIN REMODELING 42 [Arabidopsis thaliana]
 gb|AED92841.1| chromatin remodeling 42 [Arabidopsis thaliana]
Length=1261

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/790 (60%), Positives = 581/790 (74%), Gaps = 18/790 (2%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTK---SCQREPIek  2559
             R ++K ++SA  Y +LI   M NI+ T+  +  P  ++DQW+E + T        +  + 
Sbjct  480   RVYKKVTLSAGAYNKLIDTYMNNIESTIAAKDEPTSVVDQWEELKKTNFAFKLHGDMEKN  539

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
              S + E E SE +MLW+EMEL LAS Y+LDD E   ++   E     + G   C HD+RL
Sbjct  540   LSEDGEGETSENEMLWREMELCLASSYILDDNE---VRVDNEAFEKARSG---CEHDYRL  593

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
              EEIG+ CRLCG V +EIKDV  PF      +   +   E+ +  +    +A    F++ 
Sbjct  594   EEEIGMCCRLCGHVGSEIKDVSAPFAEHKKWTIETKHIEEDDIKTKLSHKEAQTKDFSM-  652

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
             +S +      E  DN WALIP L+ KL  HQRRAFEFLW+N+AGS+ P+ +DP S   GG
Sbjct  653   ISDSSEMLAAEESDNVWALIPKLKRKLHVHQRRAFEFLWRNVAGSVEPSLMDPTSGNIGG  712

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISHSPGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  713   CVISHSPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  772

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
             G +TY     + K     G+P+ ++DVMHVLDCLEK+QKW AHPSVL+MGYTSF TL RE
Sbjct  773   GRRTY-CTFKQNKTVQFNGVPKPSRDVMHVLDCLEKIQKWHAHPSVLVMGYTSFTTLMRE  831

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T LRILLSGTLFQNNF
Sbjct  832   DSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDLRILLSGTLFQNNF  891

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              EYFNTLCLARP+F+ EVL ELD K+K      K    LENRARK+F+D I+KKID+S  
Sbjct  892   CEYFNTLCLARPKFIHEVLMELDQKFKTNHGVNKAPHLLENRARKLFLDIIAKKIDASVG  951

Query  1301  rerkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
              ER +GLN+LK +T GFID YEG   GS D LPGLQ YTL+M ST +Q +IL KLQD   
Sbjct  952   DERLQGLNMLKNMTNGFIDNYEGSGSGSGDALPGLQIYTLVMNSTDIQHKILTKLQDVIK  1011

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              Y G+PLE+EL ITL AIHPWL+ ++ C  ++F  +EL  + K K D K GSKV FV++L
Sbjct  1012  TYFGYPLEVELQITLAAIHPWLVTSSNCCTKFFNPQELSEIGKLKHDAKKGSKVMFVLNL  1071

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             I R ++++EK+LIFCHNIAPI +F E+FE  + W++G E+L L GD+ELFERGRV+DKFE
Sbjct  1072  IFR-VVKREKILIFCHNIAPIRMFTELFENIFRWQRGREILTLTGDLELFERGRVIDKFE  1130

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             E G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQ
Sbjct  1131  EPGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQ  1190

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFH  411
             LL+ GTLEE+KY+RTTWKEWVS MIFSE+ V DPS WQA KIED++L EIV ED+   FH
Sbjct  1191  LLSRGTLEEDKYRRTTWKEWVSCMIFSEEFVADPSLWQAEKIEDDILREIVGEDKVKSFH  1250

Query  410   MIMKNEKASN  381
             MIMKNEKAS 
Sbjct  1251  MIMKNEKAST  1260


 Score =   229 bits (585),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 186/312 (60%), Gaps = 27/312 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MK+R  +  +HPFD  PFE F +G+W+PVE +RI++G   + +L+ G ++E+      +R
Sbjct  1     MKKRGFYNLKHPFDPCPFEFFCSGTWKPVEYMRIEDGMMTIRLLENGYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A  SDC CFLRP +D+ V    H+              + EP W+DA+I SIERK
Sbjct  61    LRSRKAALSDCICFLRPDIDVCVLYRIHED-------------DLEPVWVDARIVSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+ ++ +Y+ QG     K+ ++++  V+ LNQI+ILQK  ++   D++YRW  
Sbjct  108   PHESECSCKINVRIYIDQGCIGSEKQRINRDSVVIGLNQISILQKFYKEQSTDQFYRWRF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L K +L  GKF  DLSW+ V S  K + F +++V  ++VY+I+ DE    +  S
Sbjct  168   SEDCTSLMKTRLSLGKFLPDLSWLTVTSTLKSIVFQIRTVQTKMVYQIVTDEEGSSSTLS  227

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSKR  3330
                  +++  LE+ VS   +++FNP DI       E   E D Y+    VV  ELRRSKR
Sbjct  228   -----SMNITLEDGVSLSKVVKFNPADILDDSQDLEIKQETDYYQEEDEVV--ELRRSKR  280

Query  3329  RFVQPERYLGCD  3294
             R V+P+ Y GCD
Sbjct  281   RNVRPDIYTGCD  292



>ref|XP_010496658.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Camelina 
sativa]
Length=1314

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/791 (60%), Positives = 588/791 (74%), Gaps = 20/791 (3%)
 Frame = -3

Query  2717  FRKGSISANVYRELIRRCMANIDETL--NKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             ++K ++SA  Y +LI   M+ ID T+    E   +++Q    +N  S   E  + SS ++
Sbjct  534   YKKRTLSAGAYNKLIDSYMSRIDSTIAAKNEATNVVEQLMGLKNAASSSMEAEKSSSEDD  593

Query  2543  eeelseLD-MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEI  2367
             +EE +  + MLW+EMEL LAS Y+LDD E   ++   E   A  K    C HD+ LNEEI
Sbjct  594   DEEETSENEMLWREMELCLASSYILDDNE---VRVDNE---AFHKALGGCEHDYELNEEI  647

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH-FAIPVSS  2190
             G+ CRLCG V TE+K V  PF      ++  +Q  E+ +   K   D    H + IPV+S
Sbjct  648   GMCCRLCGHVGTEMKHVSAPFAHHKKWTTETKQVNEDDINTTKVNQDGAESHNYTIPVAS  707

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
             +   S  E  DN W+LIP L  KL  HQ++AFEFLW+N+AGS++P  +DP S+K GGCVI
Sbjct  708   SDMPSAKE-SDNVWSLIPQLERKLHLHQKKAFEFLWRNLAGSVVPAMMDPSSEKIGGCVI  766

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PGAGKT LIIAFL SYLK+FPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ +HG +
Sbjct  767   SHTPGAGKTFLIIAFLASYLKIFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLLHGRR  826

Query  1829  TYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
             TY   V ++      G+P+ +QDVMHVLDCL+K+QKW A PSVL+MGYTSFLTL REDS 
Sbjct  827   TYC--VAKENTIQIEGIPKPSQDVMHVLDCLDKIQKWHAQPSVLVMGYTSFLTLMREDSK  884

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
             +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV+T LRILLSGTLFQNNF EY
Sbjct  885   FAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVDTDLRILLSGTLFQNNFCEY  944

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             FNTLCLARP+FV EVL ELD K++      K    +ENRARK F+D I+KKID+    ER
Sbjct  945   FNTLCLARPKFVQEVLVELDQKFQTNQTEQKAPHLIENRARKFFLDIIAKKIDTKVGDER  1004

Query  1292  kEGLNILKKLTTGFIDVYEGGSS-----DNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
              +GLN+L+ +T+GFID YEG  S     D LPGLQ YTL+M ST +Q   L KLQ+    
Sbjct  1005  LQGLNMLRNMTSGFIDNYEGSGSGSGSGDVLPGLQIYTLLMNSTDVQHRTLTKLQNIMST  1064

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
             Y G+PLELELLITL AIHPWL++TTAC  ++   +EL  +E+ K D K GSKV FV++L+
Sbjct  1065  YHGYPLELELLITLAAIHPWLVKTTACCTKFLNPQELSEIEELKHDAKKGSKVMFVLNLV  1124

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
              R ++++EK+LIFCHNIAPI LFLE+FE  + W++G E+L L GD+ELFERGRV+DKFEE
Sbjct  1125  FR-VVKREKILIFCHNIAPIRLFLELFENIFRWKRGRELLTLTGDLELFERGRVIDKFEE  1183

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
              GG S+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVYQL
Sbjct  1184  PGGQSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVYQL  1243

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHM  408
             L+ GTLEE+KY+RTTWKEWVSSMIFSE+ V DPS WQA KIED++L EIVEED+   FHM
Sbjct  1244  LSRGTLEEDKYRRTTWKEWVSSMIFSEEFVADPSQWQAEKIEDDVLREIVEEDKVKSFHM  1303

Query  407   IMKNEKASNMG  375
             IMKNEKAS  G
Sbjct  1304  IMKNEKASTGG  1314


 Score =   212 bits (539),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 116/301 (39%), Positives = 178/301 (59%), Gaps = 17/301 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+      HPF+  PFE F +G+W+ VE +RI+NG   M +L+ G ++++      +R
Sbjct  56    MKRKHYFDFNHPFNQCPFEVFCSGTWKAVEYLRIENGAMTMRLLENGQVLDDIRPFQRLR  115

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT  DC  FLRPGLD+ V           +++   ++   EP W+DA+I SIERK
Sbjct  116   LRSRKATLVDCTSFLRPGLDVCVL---------YQKDVTVDEETTEPVWVDARILSIERK  166

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C+C FH+SVY+ QG     K  +++   ++ LNQI+ILQK+ ++   D+YYRW  
Sbjct  167   PHESECLCIFHVSVYIDQGCIGSEKHRMNRASVLMGLNQISILQKLCKEQSLDRYYRWRN  226

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L K +L  GKF  D+SW+LV S  K + F +++ H ++VY+I+ DE       S
Sbjct  227   SEDCTSLVKTRLNLGKFLPDVSWLLVTSVLKNIVFQIRTFHEKMVYQIVADE------CS  280

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRRSKRRFVQPER  3309
                  A++  +E+ V    ++ FNP   +   + DV +     V  ELRRSKRR  +P+R
Sbjct  281   SSSLSAMNITVEDGVFMSKVVLFNP-AEDTHQDTDVKQEIEEEVM-ELRRSKRRSGRPDR  338

Query  3308  Y  3306
             +
Sbjct  339   F  339



>ref|XP_006286914.1| hypothetical protein CARUB_v10000058mg [Capsella rubella]
 gb|EOA19812.1| hypothetical protein CARUB_v10000058mg [Capsella rubella]
Length=1262

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/791 (61%), Positives = 586/791 (74%), Gaps = 20/791 (3%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTKSCQR---EPIek  2559
             R  RK ++SA  Y +LI   M NI+ T+  +  P  ++D+W+E +      +   +  + 
Sbjct  481   RVCRKVTLSAGAYNKLIDTYMNNIEVTIAAKDEPTNVVDKWEELKKNNFVSKVHSDMEQT  540

Query  2558  sstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRL  2379
             S+ +++ E SE +MLW+EM+L LAS Y+LDD E      A   + A +K    C H++RL
Sbjct  541   SNGDDKGETSENEMLWREMDLCLASSYILDDNE------ARVDNEAFEKARSGCEHEYRL  594

Query  2378  NEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +EEIGL CRLCG V TEIK V  PF      +   +Q  E  +  +    +A+   F I 
Sbjct  595   DEEIGLCCRLCGHVGTEIKHVSAPFAERKKWTIETKQIEEHDLKTKWSQVEAERKDF-IM  653

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
              S +    E E  DN WALIP L+ KL  HQ+RAFEFLW+N+AGS+ P  +DP S K GG
Sbjct  654   SSDSSEMLEAEASDNVWALIPQLKRKLHVHQQRAFEFLWRNLAGSVEPALMDPTSDKIGG  713

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             CVISHSPGAGKT LIIAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ IH
Sbjct  714   CVISHSPGAGKTFLIIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLIH  773

Query  1838  GGQTYKGEVLRQKMKL-CPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR  1665
             G +TY    L+Q   +   G+P+ +QDVMHVLDCLEK+QKW AHPSVL+MGYTSFLTL R
Sbjct  774   GRETYC--TLKQNSTVQFNGVPKPSQDVMHVLDCLEKIQKWHAHPSVLVMGYTSFLTLMR  831

Query  1664  EDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNN  1485
             EDS +AHRKYM +VLR+ PG+L+LDEGHNPRSTKSRLRKALMKV T LRILLSGTLFQNN
Sbjct  832   EDSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTKSRLRKALMKVGTDLRILLSGTLFQNN  891

Query  1484  FGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssk  1305
             F EYFNTLCLARP+F+ EVL ELD KY       K    LENRARK F+D+I+KKID+S 
Sbjct  892   FCEYFNTLCLARPKFIHEVLMELDQKYNTSQGVNKAPHLLENRARKFFLDRIAKKIDASV  951

Query  1304  ererkEGLNILKKLTTGFIDVYEG---GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQR  1134
               ER +GLN+LK +T  FID YEG   GS D LPGLQ YTL+M S  +Q +IL KLQD  
Sbjct  952   GDERLQGLNMLKNMTNSFIDNYEGSGTGSGDALPGLQIYTLLMNSADVQHKILTKLQDVI  1011

Query  1133  PIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMS  954
                 G+ LE+EL +TL AIHPWL++T+ C  ++F  +EL  +EK K D K GSKV FV++
Sbjct  1012  KTNYGYQLEVELQVTLAAIHPWLVKTSNCCTKFFNPQELLEIEKLKHDAKKGSKVMFVLN  1071

Query  953   LIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKF  774
             L+ R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD+ELFERGRV+DKF
Sbjct  1072  LVYR-VVKREKILIFCHNIAPIRLFIEMFENVFRWQRGREILTLTGDLELFERGRVIDKF  1130

Query  773   EEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
             EE G PS+++LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVVYVY
Sbjct  1131  EEHGNPSRILLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVVYVY  1190

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLF  414
             QLL+ GTLEE+KY+RTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDRA  F
Sbjct  1191  QLLSRGTLEEDKYRRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRAKSF  1250

Query  413   HMIMKNEKASN  381
             HMIMKNEKAS 
Sbjct  1251  HMIMKNEKAST  1261


 Score =   229 bits (583),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 185/312 (59%), Gaps = 28/312 (9%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKRR  +  +HPFD  PFE F +G+W+ VE IRI++G   + +L+   ++E+      +R
Sbjct  1     MKRRRFYGLKHPFDPCPFEFFYSGTWKAVEHIRIEDGRMAIRLLENVYVLEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC CFLRP +D+ V    H+              + EP W+D +I SIERK
Sbjct  61    LRSRKATLTDCICFLRPDIDVCVLYRLHED-------------DLEPVWVDGRIVSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+F++ +Y+ Q      ++ ++K+  ++ LNQIAILQ+  ++   D++YRW+ 
Sbjct  108   PHESECSCKFNVRIYIDQDCIGSERQRINKDSVLIGLNQIAILQRFYKEQSTDQFYRWNF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC++L + +L  GKF  DLSW+ V S  K + F +++V  ++VY+I+ DE       S
Sbjct  168   SEDCTSLMRTRLSLGKFLPDLSWLTVTSIMKSIVFHIRTVQTKMVYQIITDE------GS  221

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DI------PERGPEGDVYEAGPLVVYDELRRSKR  3330
                  +++  +E+ VS   + QFNP DI      PE   E D Y     V+  ELRRSKR
Sbjct  222   SSSLSSMNITVEDGVSLSKVFQFNPADIVDDSQDPEIKQETDFYPEEEEVM--ELRRSKR  279

Query  3329  RFVQPERYLGCD  3294
             R+V+P+RY GCD
Sbjct  280   RYVRPDRYTGCD  291



>emb|CDX92463.1| BnaA10g15020D [Brassica napus]
Length=1265

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/794 (61%), Positives = 580/794 (73%), Gaps = 27/794 (3%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTKSCQR----EPIe  2562
             + ++K ++SA  Y +LI   M+NID T+  +  P  ++DQW+E + T    +    E   
Sbjct  485   KVYKKVTLSAGAYNKLIDAYMSNIDSTIASKNEPASVVDQWEELKKTNFASKPHGWEMGG  544

Query  2561  ksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFR  2382
              S  + E E SE DMLW+EMEL LAS Y+LDD E   ++   E     K G   C H++ 
Sbjct  545   ASGEDGEGETSENDMLWREMELCLASSYILDDNE---VRVDNEAFEKAKSG---CEHEYM  598

Query  2381  LNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAI  2202
             L+EEIG+ CRLCG V +EIK V  PF      +   +Q  E+ +  +    ++    F +
Sbjct  599   LDEEIGMCCRLCGHVGSEIKHVSAPFAKHKKWTIETKQIEEDDIKTKLSHKESTSKDFTM  658

Query  2201  PVSSNKPSSEVEVE--DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK  2028
                SN+ S  +  E  DN WALIP L+ KL  HQRRAFEFLW+N+AGS+ P  +DP S  
Sbjct  659   ---SNESSEMLTAEESDNVWALIPHLKRKLHMHQRRAFEFLWRNLAGSVEPPLMDPTSDN  715

Query  2027  RGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVY  1848
              GGCVISH+PGAGKT L+IAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+
Sbjct  716   IGGCVISHAPGAGKTFLMIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVH  775

Query  1847  QIHGGQTY----KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSF  1680
              IHG +TY    K  V+       P    +QDVMHVLDCLEK+QKW AHPSVL+MGYTSF
Sbjct  776   LIHGRRTYCVFKKNSVVNFNRVPKP----SQDVMHVLDCLEKIQKWHAHPSVLVMGYTSF  831

Query  1679  LTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGT  1500
             LTL REDS +AHRKYM +VLR+ PG+LILDEGHNPRSTKSRLRK LMKV T LR+LLSGT
Sbjct  832   LTLMREDSKFAHRKYMAKVLRESPGLLILDEGHNPRSTKSRLRKGLMKVGTDLRVLLSGT  891

Query  1499  LFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskk  1320
             LFQNNF EYFNTLCLARP+FV EVL ELD K+K      K    LENRARK F+D I+KK
Sbjct  892   LFQNNFCEYFNTLCLARPKFVHEVLMELDQKFKANQGVNKAPHLLENRARKFFLDNIAKK  951

Query  1319  idsskererkEGLNILKKLTTGFIDVYEG-GSSDNLPGLQCYTLMMKSTTLQQEILVKLQ  1143
             ID+    ER +GLN+L+ +TT FID YEG G  D LPGLQ YTL+M ST +Q +IL KL 
Sbjct  952   IDAGVGDERLQGLNMLRNMTTSFIDNYEGSGGGDALPGLQIYTLLMNSTDIQHKILTKLG  1011

Query  1142  DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKF  963
             +    Y GF LELELL+TL AIHPWL++T+AC  ++   +EL  +EK K D K GSKV F
Sbjct  1012  NVMASYHGFLLELELLVTLAAIHPWLVKTSACCAKFLNPQELLEIEKLKPDAKKGSKVMF  1071

Query  962   VMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVM  783
             V++L+ R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD ELFERGRV+
Sbjct  1072  VLNLVFR-VVKREKILIFCHNIAPIRLFIELFESIFRWQRGREILTLTGDQELFERGRVI  1130

Query  782   DKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVV  603
             DKFEE G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVV
Sbjct  1131  DKFEEPGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVV  1190

Query  602   YVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRA  423
             YVYQLL+ GTLEE+KYKRTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR 
Sbjct  1191  YVYQLLSRGTLEEDKYKRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRV  1250

Query  422   TLFHMIMKNEKASN  381
               FHMIMKNEKAS 
Sbjct  1251  KSFHMIMKNEKAST  1264


 Score =   239 bits (611),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 188/308 (61%), Gaps = 24/308 (8%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKRR  +  +HPFD +PFE F  G+W+PVE IRIQ+G   + +L+ G ++E+      +R
Sbjct  1     MKRRRFYDLKHPFDPFPFEIFSCGTWKPVEYIRIQHGKMTVPLLENGYILEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC CFLRPG+D+ V    H+              + EP WIDA+I SIERK
Sbjct  61    LRSRKATLNDCTCFLRPGIDVCVLYPLHED-------------DLEPVWIDARIVSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+ ++ +Y+ QG   +  + ++++  ++ LNQI+ILQK  ++   D++YRW  
Sbjct  108   PHESECTCEIYVRIYIDQGCIGMEGQRINRDSVIIGLNQISILQKFYKEQSSDQFYRWKF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC+TL K +L  G F  DLSW+LV S  K + F V++V  ++VY+I+ DE       S
Sbjct  168   SEDCTTLMKTRLSLGNFLPDLSWLLVTSVMKNIVFHVRTVQTKMVYQIVTDE------AS  221

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIP--ERGPEGDVYEAGPLVVYDELRRSKRRFVQ  3318
                  +++  +E+ VS   +++F+P DI   E   E ++Y     VV  ELRRSKRR ++
Sbjct  222   SSSLSSMNITVEDGVSLSKVVKFSPADIVDLEVNQETELYSEEDEVV--ELRRSKRRVMR  279

Query  3317  PERYLGCD  3294
             P+RY GCD
Sbjct  280   PDRYTGCD  287



>emb|CDY56857.1| BnaC09g54090D [Brassica napus]
Length=1265

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/795 (61%), Positives = 578/795 (73%), Gaps = 31/795 (4%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTKSCQR----EPIe  2562
             + ++K ++SA  Y +LI   M+NID T+     P  ++DQW+E + T    +    E   
Sbjct  485   KVYKKVTLSAGAYNKLIDAYMSNIDSTIASLNEPASVVDQWEELKKTNFASKPHGWEMGG  544

Query  2561  ksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFR  2382
              SS + E E SE DMLW+EMEL LAS Y+LDD E   ++   E     K G   C H++ 
Sbjct  545   ASSEDGEGETSENDMLWREMELCLASSYILDDNE---VRVDNEAFEKAKSG---CEHEYM  598

Query  2381  LNEEIGLVCRLCGVVSTEIKDVPPPFMPS---TCSSSGKEQRPEEVVMEEKQGDDADLDH  2211
             L+EEIG+ CRLCG V +EIK V  PF      T  +   E+   +  +  K+    D   
Sbjct  599   LDEEIGMCCRLCGHVGSEIKHVSAPFAKHKKWTIETKQIEEDDIKTKLSHKKSTSKDF--  656

Query  2210  FAIPVSSNKPSS-EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES  2034
                 +S++ P     E  DN WALIP L+ KL  HQRRAFEFLW+N+AGS+ P  +DP S
Sbjct  657   ---TMSNDSPEMLTAEESDNVWALIPHLKRKLHMHQRRAFEFLWRNLAGSVEPPLMDPTS  713

Query  2033  KKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIP  1854
                GGCVISH+PGAGKT L+IAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+P
Sbjct  714   DNIGGCVISHAPGAGKTFLMIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVP  773

Query  1853  VYQIHGGQTY----KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYT  1686
             V+ IHG +TY    K  V+       P    +QDVMHVLDCLEK+QKW AHPSVL+MGYT
Sbjct  774   VHLIHGRRTYCVFKKNSVVNFNRVPKP----SQDVMHVLDCLEKIQKWHAHPSVLVMGYT  829

Query  1685  SFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
             SFLTL REDS +AHRKYM +VLR+ PG+LILDEGHNPRSTKSRLRK LMKV T LRILLS
Sbjct  830   SFLTLMREDSKFAHRKYMAKVLRESPGLLILDEGHNPRSTKSRLRKGLMKVGTDLRILLS  889

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GTLFQNNF EYFNTLCLARP+FV EVL ELD K+K      K    LENRARK F+D I+
Sbjct  890   GTLFQNNFCEYFNTLCLARPKFVHEVLMELDKKFKANQGVNKAPHLLENRARKFFLDNIA  949

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEG-GSSDNLPGLQCYTLMMKSTTLQQEILVK  1149
             KKID+    ER +GLN+L+ +TT FID YEG G  D LPGLQ YTL+M ST +Q +IL K
Sbjct  950   KKIDAGVGDERLQGLNMLRNMTTSFIDNYEGSGGGDALPGLQIYTLLMNSTDIQHKILTK  1009

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             L +    Y GF LELELL+TL AIHPWL++T+AC  ++   +EL  +E+ K D K GSKV
Sbjct  1010  LGNVMASYHGFLLELELLVTLAAIHPWLVKTSACCAKFLNAQELLEIERLKHDAKKGSKV  1069

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
              FV++L+ R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD ELFERGR
Sbjct  1070  MFVLNLVFR-VVKREKILIFCHNIAPIRLFIELFESIFRWQRGREILTLTGDQELFERGR  1128

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
             V+DKFEE G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ K
Sbjct  1129  VIDKFEEPGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQK  1188

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             VVYVYQLL+ GTLEE+KYKRTTWKEWVSSMIFSED VEDPS WQA KIED++L EIV ED
Sbjct  1189  VVYVYQLLSRGTLEEDKYKRTTWKEWVSSMIFSEDFVEDPSLWQAEKIEDDVLREIVGED  1248

Query  428   RATLFHMIMKNEKAS  384
             R   FHMIMKNEKAS
Sbjct  1249  RVKSFHMIMKNEKAS  1263


 Score =   241 bits (615),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 188/315 (60%), Gaps = 24/315 (8%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKRR  +  +HPFD +PFE F  G+W PVE IRIQ+G   + +L+ G ++E+      +R
Sbjct  1     MKRRRFYDLKHPFDPFPFEIFSCGTWNPVEYIRIQHGKMTVPLLENGYILEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC CFLRPG+D+ V    H+              + EP WIDA+I SIERK
Sbjct  61    LRSRKATLNDCTCFLRPGIDVCVLYPLHED-------------DLEPVWIDARIVSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+ ++ +Y+ QG   +  + ++++  ++ LNQI+ILQK  ++   D++YRW  
Sbjct  108   PHESECTCEIYVKIYIDQGCIGMEGQRINRDSVIIGLNQISILQKFYKEQSGDQFYRWKF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC+TL K +L  G F  DLSW+LV S  K + F V++V  ++VYEI+ DE       S
Sbjct  168   SEDCTTLMKTRLSLGNFLPDLSWLLVTSVMKNIVFHVRTVQTKMVYEIVTDE------AS  221

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIP--ERGPEGDVYEAGPLVVYDELRRSKRRFVQ  3318
                  +++  +E+ VS   ++ FNP DI   E   E ++Y     VV  ELRRSKRR ++
Sbjct  222   SSSLSSMNITVEDGVSLSKVVMFNPADIVDLEVNQETELYSEEDDVV--ELRRSKRRVMR  279

Query  3317  PERYLGCDDYLTEFD  3273
             P+RY GCD  L   D
Sbjct  280   PDRYTGCDYQLDTND  294



>ref|XP_009120806.1| PREDICTED: SNF2 domain-containing protein CLASSY 2 [Brassica 
rapa]
Length=1284

 Score =   876 bits (2264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/794 (61%), Positives = 580/794 (73%), Gaps = 27/794 (3%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPP--IIDQWKEFQNTKSCQR----EPIe  2562
             + ++K ++SA  Y +LI   M+NID T+  +  P  ++DQW+E + T    +    E   
Sbjct  504   KVYKKVTLSAGAYNKLIDAYMSNIDSTIASKNEPASVVDQWEELKKTNFASKPHGWEMGG  563

Query  2561  ksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFR  2382
              S  + E E SE DMLW+EMEL LAS Y+LDD E   ++   E     K G   C H++ 
Sbjct  564   ASGEDGEGETSENDMLWREMELCLASSYILDDNE---VRVDNEAFEKAKSG---CEHEYM  617

Query  2381  LNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAI  2202
             L+EEIG+ CRLCG V +EIK V  PF      +   +Q  E+ +  +    ++    F +
Sbjct  618   LDEEIGMCCRLCGHVGSEIKHVSAPFAKHKKWTIETKQIEEDDIKTKLSHKESTSKDFTM  677

Query  2201  PVSSNKPSSEVEVE--DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK  2028
                SN+ S  +  E  DN WALIP L+ KL  HQRRAFEFLW+N+AGS+ P  +DP S  
Sbjct  678   ---SNESSEMLTAEESDNVWALIPHLKRKLHMHQRRAFEFLWRNLAGSVEPPLMDPTSDN  734

Query  2027  RGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVY  1848
              GGCVISH+PGAGKT L+IAFL SYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+
Sbjct  735   IGGCVISHAPGAGKTFLMIAFLTSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVH  794

Query  1847  QIHGGQTY----KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSF  1680
              IHG +TY    K  V+       P    +QDVMHVLDCLEK+QKW AHPSVL+MGYTSF
Sbjct  795   LIHGRRTYCVFKKNSVVNFNRVPKP----SQDVMHVLDCLEKIQKWHAHPSVLVMGYTSF  850

Query  1679  LTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGT  1500
             LTL REDS +AHRKYM +VLR+ PG+LILDEGHNPRSTKSRLRK LMKV T LR+LLSGT
Sbjct  851   LTLMREDSKFAHRKYMAKVLRESPGLLILDEGHNPRSTKSRLRKGLMKVGTDLRVLLSGT  910

Query  1499  LFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskk  1320
             LFQNNF EYFNTLCLARP+FV EVL ELD K+K      K    LENRARK F+D I+KK
Sbjct  911   LFQNNFCEYFNTLCLARPKFVHEVLMELDQKFKANQGVNKAPHLLENRARKFFLDNIAKK  970

Query  1319  idsskererkEGLNILKKLTTGFIDVYEG-GSSDNLPGLQCYTLMMKSTTLQQEILVKLQ  1143
             ID+    ER +GLN+L+ +TT FID YEG G  D LPGLQ YTL+M ST +Q +IL KL 
Sbjct  971   IDAGVGDERLQGLNMLRNMTTSFIDNYEGSGGGDALPGLQIYTLLMNSTDIQHKILTKLG  1030

Query  1142  DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKF  963
             +    Y GF LELELL+TL AIHPWL++T+AC  ++   +EL  +EK K D K GSKV F
Sbjct  1031  NVMASYHGFLLELELLVTLAAIHPWLVKTSACCAKFLNPQELLEIEKLKPDAKKGSKVMF  1090

Query  962   VMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVM  783
             V++L+ R ++++EK+LIFCHNIAPI LF+E+FE  + W++G E+L L GD ELFERGRV+
Sbjct  1091  VLNLVFR-VVKREKILIFCHNIAPIRLFIELFESIFRWQRGREILTLTGDQELFERGRVI  1149

Query  782   DKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVV  603
             DKFEE G PS+V+LASIT CAEGISLTAASRVI+LDSEWNPSK+KQAIARAFRPGQ KVV
Sbjct  1150  DKFEEPGNPSRVLLASITACAEGISLTAASRVIMLDSEWNPSKTKQAIARAFRPGQQKVV  1209

Query  602   YVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRA  423
             YVYQLL+ GTLEE+KYKRTTWKEWVSSMIFSE+ VEDPS WQA KIED++L EIV EDR 
Sbjct  1210  YVYQLLSRGTLEEDKYKRTTWKEWVSSMIFSEEFVEDPSLWQAEKIEDDVLREIVGEDRV  1269

Query  422   TLFHMIMKNEKASN  381
               FHMIMKNEKAS 
Sbjct  1270  KSFHMIMKNEKAST  1283


 Score =   239 bits (610),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 188/308 (61%), Gaps = 24/308 (8%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKRR  +  +HPFD +PFE F  G+W+PVE IRIQ+G   + +L+ G ++E+      +R
Sbjct  1     MKRRRFYDLKHPFDPFPFEIFSCGTWKPVEYIRIQHGKMTVPLLENGYILEDIRPFQRLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR AT +DC CFLRPG+D+ V    H+              + EP WIDA+I SIERK
Sbjct  61    LRSRKATLNDCTCFLRPGIDVCVLYPLHED-------------DLEPVWIDARIVSIERK  107

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C+ ++ +Y+ QG   +  + ++++  ++ LNQI+ILQK  ++   D++YRW  
Sbjct  108   PHESECTCEIYVRIYIDQGCIGMEGQRINRDSVIIGLNQISILQKFYKEQSSDQFYRWKF  167

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DC+TL K +L  G F  DLSW+LV S  K + F V++V  ++VY+I+ DE       S
Sbjct  168   SEDCTTLMKTRLSLGNFLPDLSWLLVTSVMKNIVFHVRTVQTKMVYQIVTDE------AS  221

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNP-DIP--ERGPEGDVYEAGPLVVYDELRRSKRRFVQ  3318
                  +++  +E+ VS   +++F+P DI   E   E ++Y     VV  ELRRSKRR ++
Sbjct  222   SSSLSSMNITVEDGVSLSKVVKFSPADIVDLEVNQETELYSEEDEVV--ELRRSKRRVMR  279

Query  3317  PERYLGCD  3294
             P+RY GCD
Sbjct  280   PDRYTGCD  287



>ref|XP_010271708.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like [Nelumbo 
nucifera]
Length=1288

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/788 (57%), Positives = 581/788 (74%), Gaps = 17/788 (2%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnne  2541
             S RK  +S + Y+E+I RCM NI+    +E  P++DQW+  Q      +      ++   
Sbjct  504   SRRKIFLSTSEYKEMIERCMKNIESETKREHLPVVDQWEAIQAVNLSSKRWFCNLTSITI  563

Query  2540  eelseLDM--LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEI  2367
             ++  E ++  +W+EMEL++A+ + L + + +++  ++E+   ++ G + C H+++++E+I
Sbjct  564   DQAEEPELKVMWEEMELSMATFHFLAENQGSHIGLSSEIPNLSRDG-QSCQHEYKMDEQI  622

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQG----DDADLDHFAIP  2199
             G++C+LCG VSTEI+D+ PPF+  T   + KE     +   +K G       +LD F   
Sbjct  623   GIICQLCGFVSTEIRDISPPFLQRTGWITSKE-----LHNGDKSGTTLTKHGNLDLFQTT  677

Query  2198  VSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG  2019
             VSS   S   E  DN WALIPDL+ KL  HQ++ FEFLW+NIAGS+IP  + P  ++ GG
Sbjct  678   VSSRNISFS-ERNDNVWALIPDLKMKLHFHQKKGFEFLWRNIAGSLIPADMQPTLRRTGG  736

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             C+ISHSPGAGKTLLII+FL SYLKLFPG +PL+LAPKTTLYTW KE  KW +  PV+QIH
Sbjct  737   CIISHSPGAGKTLLIISFLESYLKLFPGKKPLILAPKTTLYTWCKEFKKWDVSFPVHQIH  796

Query  1838  GGQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE  1662
               + Y  E+  Q+ +   G  R NQ VMH +DCLEK+QKW  HPS+LLMGYTSFL+LTRE
Sbjct  797   VRRNYINEIRSQRCRESVGGRRANQVVMHAIDCLEKIQKWHEHPSILLMGYTSFLSLTRE  856

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             DS + +R+ M ++LR+ PGILILDEGHNPR+T SRLRK+LM+VNT LRILLSGTLFQNNF
Sbjct  857   DSKHEYRRCMGRILRESPGILILDEGHNPRNTGSRLRKSLMRVNTGLRILLSGTLFQNNF  916

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLE-NRARKMFidkiskkidssk  1305
              EYFNTLCLARP F+ EVL+E D K+K R KG K   SLE ++AR MFI+ I+KKI+S  
Sbjct  917   VEYFNTLCLARPSFISEVLEEFDSKFKNR-KGKKNVSSLEESKARSMFIENIAKKINSRV  975

Query  1304  ererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIY  1125
                RK GL++L  +T GFIDVYEGG  D LP LQ YTL +K T++QQ+IL KLQD +   
Sbjct  976   AEVRKHGLDMLMSITKGFIDVYEGGKLDGLPDLQTYTLSLKPTSIQQKILSKLQDYKDSC  1035

Query  1124  KGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIP  945
             +G PLEL+LLITLG+IHPWLI+T A +G+Y   EELE L + + D+  G K++FV+SL+ 
Sbjct  1036  RGNPLELDLLITLGSIHPWLIKTVAGAGKYLSSEELENLAENRVDVNKGPKLRFVVSLVH  1095

Query  944   RCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEV  765
              C  ++EKVL+FCHNIAPIN  +EIFERF+GW+ G +VLVL+GD ELFER RVMD+FEE 
Sbjct  1096  GCSSKREKVLVFCHNIAPINFLVEIFERFFGWKAGEQVLVLKGDQELFERARVMDQFEEP  1155

Query  764   GGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLL  585
             GG S+++LASIT CAEGISLTAASRV+LLDSEWNPSK+KQAIARAFRPGQ++VVYVYQLL
Sbjct  1156  GGASRLLLASITACAEGISLTAASRVVLLDSEWNPSKTKQAIARAFRPGQERVVYVYQLL  1215

Query  584   ATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMI  405
             A+GT EEEKY +T +KEWVSSMIF+  LVEDPS  Q   I+D++L +IVE+D A LFH I
Sbjct  1216  ASGTWEEEKYGKTIYKEWVSSMIFNGALVEDPSCRQTQNIDDDVLRQIVEDD-AKLFHQI  1274

Query  404   MKNEKASN  381
              K+EK  N
Sbjct  1275  TKHEKLFN  1282


 Score =   266 bits (681),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/319 (43%), Positives = 197/319 (62%), Gaps = 26/319 (8%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M +R ++Q+ HP   YPFEAF +GSW+ VE +RI++G+  MH  +    IE+ ISISN+R
Sbjct  1     MVKRRLYQSWHPIGEYPFEAFCHGSWKTVEHLRIRDGSIAMHFKNHAYEIEDTISISNLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             IRSR A  SDC CFLRPGLD+ +  +   +   +               +DAKI SIERK
Sbjct  61    IRSRRACLSDCTCFLRPGLDVCILPSHSDNLMXEX--------------VDAKISSIERK  106

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH  GC C+F++  Y  Q P  + K TL +EI+ V+L  I ILQK+++KP ED YYRW  
Sbjct  107   PHDSGCACRFYVICYRAQEPHSMAKMTLGEEIREVKLENIGILQKLQRKPSEDVYYRWRY  166

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNS  3489
             S+DCS + +  L  G+F SD+SW+LVAS  K +GFDVK+V N++VY++L  ++D+  P S
Sbjct  167   SEDCSFMHRAILHRGQFSSDISWLLVASIWKGLGFDVKTVQNKMVYQLLDSDHDMCPPTS  226

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIP----------ERGPEGDVYEAGPLVVYD--EL  3345
               +   ++F+++NEV  P  + F+P +P          +     D+ E  P   Y+  +L
Sbjct  227   LNNVKTINFQIDNEVMKPSNMNFSPVVPVNTFVLNDPMDVDLVHDMKEDKPFPFYNFLDL  286

Query  3344  RRSKRRFVQPERYLGCDDY  3288
             RRSKRR VQPER++   D+
Sbjct  287   RRSKRRHVQPERFVSHCDF  305



>gb|AET79246.1| chromatin remodeling 38 [Glycine max]
Length=1245

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/785 (58%), Positives = 585/785 (75%), Gaps = 19/785 (2%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnne  2541
             S++  S++A  Y+E+I   + +++ T   E+PP++DQ KE  N    Q++  E     +E
Sbjct  472   SYKDRSLNATAYKEMIDSYLKDVNRTPTTEEPPVMDQRKEIGNFG--QKKEAEIPEREDE  529

Query  2540  eelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGL  2361
             E++SE+DMLW+EME+ALAS YL ++TE +N   +      T++  R C HD+RL+EEIG+
Sbjct  530   EQISEIDMLWREMEMALASSYL-EETEGSN---SANFAKTTEESNRTCPHDYRLSEEIGI  585

Query  2360  VCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRP-EEVVMEEKQGDDADLDHFAIPVSSNK  2184
              C  CG V TEIK + PPF+    S   +E++       +EK   D D  H    +S++ 
Sbjct  586   YCYKCGFVKTEIKYITPPFIEMQRSVRHQEEKQCNGKDTKEKASKDDDF-HL---LSTHA  641

Query  2183  PSSEVEV--EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
             P+ E      DN W LIP  R KL  HQ++AFEFLW+NI GS+ P  +D ESK+RGGCVI
Sbjct  642   PTDEHNSMEHDNVWKLIPQFREKLHDHQKKAFEFLWQNIGGSMEPKLMDAESKRRGGCVI  701

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG-G  1833
             SH+PGAGKT LIIAFLVSYLKLFPG +PL+LAPK TLYTW KE  KW+I +PVY IHG G
Sbjct  702   SHAPGAGKTFLIIAFLVSYLKLFPGKKPLILAPKGTLYTWCKEFNKWEISMPVYLIHGRG  761

Query  1832  QTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
              T K     Q   + PG P  N+ V HVLDCL+K++ W   PSVL+M YT+FL L RE S
Sbjct  762   GTQKD--TEQNSIVLPGFPNPNKYVKHVLDCLQKIKLWQEKPSVLVMSYTAFLALMREGS  819

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              +AHRKYM + LR+ PGILILDEGHNPRSTKSRLRK LMK+ T LRILLSGTLFQNNF E
Sbjct  820   EFAHRKYMAKALREGPGILILDEGHNPRSTKSRLRKGLMKLKTDLRILLSGTLFQNNFCE  879

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidssker  1299
             YFNTLCLARP+F+ EVL  LDP  +++ K   K    LE+RARK+F+DKI+KKIDS    
Sbjct  880   YFNTLCLARPKFISEVLDTLDPITRRKSKTVEKAGHLLESRARKLFLDKIAKKIDSGIGN  939

Query  1298  erkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
             ER +GLN+L++ T GF+DVYE  + D+ PGLQ YTL+M +T  Q+EIL KL  +     G
Sbjct  940   ERMQGLNMLRETTNGFVDVYESENFDSAPGLQIYTLLMNTTDKQREILPKLHTRVDECNG  999

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
             +PLELELL+TLG+IHPWL++TT+C+ ++F  ++L+ L+K+K+D+K GSKVKFV+SL+ R 
Sbjct  1000  YPLELELLVTLGSIHPWLVKTTSCANKFFTADQLKQLDKYKYDMKAGSKVKFVLSLVFR-  1058

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGG  759
             ++++EKVLIFCHN+AP+ L +E+FE F+ W+K  E+L+L G+++LFERG+V+DKFEE GG
Sbjct  1059  VMQREKVLIFCHNLAPVKLLIELFEMFFKWKKDREILLLSGELDLFERGKVIDKFEEHGG  1118

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
              SKV+LASIT CAEGISLTAASRVI LDSEWNPSK+KQAIARAFRPGQ+K+VYVYQLL T
Sbjct  1119  ASKVLLASITACAEGISLTAASRVIFLDSEWNPSKTKQAIARAFRPGQEKMVYVYQLLVT  1178

Query  578   GTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMK  399
             GTLEE+KYKRTTWKEWVSSMIFSE   E+ SH +A  IED++L E+VEED++   HMI+K
Sbjct  1179  GTLEEDKYKRTTWKEWVSSMIFSEAFEENLSHSRAVNIEDDILREMVEEDKSKTIHMILK  1238

Query  398   NEKAS  384
             NEKAS
Sbjct  1239  NEKAS  1243


 Score =   215 bits (547),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 133/332 (40%), Positives = 192/332 (58%), Gaps = 22/332 (7%)
 Frame = -3

Query  4166  VYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACF  3987
             V  FEA+ + SW+ VE I+ ++GT  ++ +D   +  ++ S S+VR+RSR AT SDC+ F
Sbjct  26    VMAFEAYLSRSWRAVELIKFESGTTTLYFVDNHHMTIKKGSFSDVRVRSRKATLSDCS-F  84

Query  3986  LRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHISV  3807
             LR G+DI V S           N+  ++      W+DAKI SI+RKPH   C CQ++++ 
Sbjct  85    LRTGIDICVLSASQ-------GNDNSDESSANHVWLDAKINSIQRKPHNPECSCQYYVNF  137

Query  3806  YVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFT  3627
             YV QG      +TL KE+KVV +N+IAILQK+E+  C+ KYYRW  S+DCS +   KL  
Sbjct  138   YVNQGSLGTELRTLRKEVKVVGINEIAILQKLERNTCQHKYYRWESSEDCSKVPHTKLL-  196

Query  3626  GKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEYHSYAVSFKL-EN  3450
             GKF SDLSW++VASA ++V F  +SV N IVY+IL  +    +   +     V+FK+ E+
Sbjct  197   GKFISDLSWLVVASAIRKVSFCARSVENNIVYQILGSDATTSSLYMDSEISVVNFKVNED  256

Query  3449  EVSTPIII---QFNPDIPERGPEGDVY--EAGPLVVYDELRRSKRRFVQPERYLGCDDYL  3285
              +  P+I     F  D    G + D +  E      ++ LRRSKRR +QPERY  C + +
Sbjct  257   GMQMPVIHLVDLFETDTNTSGDKHDSHYDEVPSSYGFEGLRRSKRRNIQPERYSDCGN-V  315

Query  3284  TEFDVEMTRLVGGKMYKSE------LEELPMA  3207
             +E  V   R    K+ K +       E LP+A
Sbjct  316   SEIKVGNVRTWPYKLNKRKDDDGGGEESLPLA  347



>ref|XP_006603095.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Glycine 
max]
Length=1269

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/784 (58%), Positives = 585/784 (75%), Gaps = 16/784 (2%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnne  2541
             S++  S++A  Y+E+I   + +++ T   E+PP++DQ KE  N    Q++  E     +E
Sbjct  495   SYKDRSLNATAYKEMIDSYLKDVNRTPTTEEPPVMDQRKEIGNFG--QKKEAEIPEREDE  552

Query  2540  eelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGL  2361
             E++SE+DMLW+EME+ALAS YL ++TE +N   +      T++  R C HD+RL+EEIG+
Sbjct  553   EQISEIDMLWREMEMALASSYL-EETEGSN---SANFAKTTEESNRTCPHDYRLSEEIGI  608

Query  2360  VCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
              C  CG V TEIK + PPF+    +    ++  +    + K+    D D F + +S++ P
Sbjct  609   YCYKCGFVKTEIKYITPPFVSQVQNHVWHQEEKQCNGKDTKEKASKD-DDFHL-LSTHAP  666

Query  2180  SSEVEV--EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVIS  2007
             + E      DN W LIP  R KL  HQ++AFEFLW+NI GS+ P  +D ESK+RGGCVIS
Sbjct  667   TDEHNSMEHDNVWKLIPQFREKLHDHQKKAFEFLWQNIGGSMEPKLMDAESKRRGGCVIS  726

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG-GQ  1830
             H+PGAGKT LIIAFLVSYLKLFPG +PL+LAPK TLYTW KE  KW+I +PVY IHG G 
Sbjct  727   HAPGAGKTFLIIAFLVSYLKLFPGKKPLILAPKGTLYTWCKEFNKWEISMPVYLIHGRGG  786

Query  1829  TYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
             T K     Q   + PG P  N+ V HVLDCL+K++ W   PSVL+M YT+FL L RE S 
Sbjct  787   TQKD--TEQNSIVLPGFPNPNKYVKHVLDCLQKIKLWQEKPSVLVMSYTAFLALMREGSE  844

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
             +AHRKYM + LR+ PGILILDEGHNPRSTKSRLRK LMK+ T LRILLSGTLFQNNF EY
Sbjct  845   FAHRKYMAKALREGPGILILDEGHNPRSTKSRLRKGLMKLKTDLRILLSGTLFQNNFCEY  904

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskere  1296
             FNTLCLARP+F+ EVL  LDP  +++ K   K    LE+RARK+F+DKI+KKIDS    E
Sbjct  905   FNTLCLARPKFISEVLDTLDPITRRKSKTVEKAGHLLESRARKLFLDKIAKKIDSGIGNE  964

Query  1295  rkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGF  1116
             R +GLN+L++ T GF+DVYE  + D+ PGLQ YTL+M +T  Q+EIL KL  +     G+
Sbjct  965   RMQGLNMLRETTNGFVDVYESENFDSAPGLQIYTLLMNTTDKQREILPKLHTRVDECNGY  1024

Query  1115  PLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCL  936
             PLELELL+TLG+IHPWL++TT+C+ ++F  ++L+ L+K+K+D+K GSKVKFV+SL+ R +
Sbjct  1025  PLELELLVTLGSIHPWLVKTTSCANKFFTADQLKQLDKYKYDMKAGSKVKFVLSLVFR-V  1083

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGP  756
             +++EKVLIFCHN+AP+ L +E+FE F+ W+K  E+L+L G+++LFERG+V+DKFEE GG 
Sbjct  1084  MQREKVLIFCHNLAPVKLLIELFEMFFKWKKDREILLLSGELDLFERGKVIDKFEEHGGA  1143

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
             SKV+LASIT CAEGISLTAASRVI LDSEWNPSK+KQAIARAFRPGQ+K+VYVYQLL TG
Sbjct  1144  SKVLLASITACAEGISLTAASRVIFLDSEWNPSKTKQAIARAFRPGQEKMVYVYQLLVTG  1203

Query  575   TLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKN  396
             TLEE+KYKRTTWKEWVSSMIFSE   E+ SH +A  IED++L E+VEED++   HMI+KN
Sbjct  1204  TLEEDKYKRTTWKEWVSSMIFSEAFEENLSHSRAVNIEDDILREMVEEDKSKTIHMILKN  1263

Query  395   EKAS  384
             EKAS
Sbjct  1264  EKAS  1267


 Score =   228 bits (580),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 202/347 (58%), Gaps = 23/347 (7%)
 Frame = -3

Query  4208  MKRRS-IHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNV  4032
             M R+S + Q +HPF   PFEA+ + SW+ VE I+ ++GT  ++ +D   +  ++ S S+V
Sbjct  34    MHRKSHLRQRKHPFHACPFEAYLSRSWRAVELIKFESGTTTLYFVDNHHMTIKKGSFSDV  93

Query  4031  RIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIER  3852
             R+RSR AT SDC+ FLR G+DI V S           N+  ++      W+DAKI SI+R
Sbjct  94    RVRSRKATLSDCS-FLRTGIDICVLSASQ-------GNDNSDESSANHVWLDAKINSIQR  145

Query  3851  KPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWS  3672
             KPH   C CQ++++ YV QG      +TL KE+KVV +N+IAILQK+E+  C+ KYYRW 
Sbjct  146   KPHNPECSCQYYVNFYVNQGSLGTELRTLRKEVKVVGINEIAILQKLERNTCQHKYYRWE  205

Query  3671  LSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPN  3492
              S+DCS +   KL  GKF SDLSW++VASA ++V F  +SV N IVY+IL  +    +  
Sbjct  206   SSEDCSKVPHTKLL-GKFISDLSWLVVASAIRKVSFCARSVENNIVYQILGSDATTSSLY  264

Query  3491  SEYHSYAVSFKL-ENEVSTPIII---QFNPDIPERGPEGDVY--EAGPLVVYDELRRSKR  3330
              +     V+FK+ E+ +  P+I     F  D    G + D +  E      ++ LRRSKR
Sbjct  265   MDSEISVVNFKVNEDGMQMPVIHLVDLFETDTNTSGDKHDSHYDEVPSSYGFEGLRRSKR  324

Query  3329  RFVQPERYLGCDDYLTEFDVEMTRLVGGKMYKSE------LEELPMA  3207
             R +QPERY  C + ++E  V   R    K+ K +       E LP+A
Sbjct  325   RNIQPERYSDCGN-VSEIKVGNVRTWPYKLNKRKDDDGGGEESLPLA  370



>ref|XP_002315134.2| hypothetical protein POPTR_0010s19110g [Populus trichocarpa]
 gb|EEF01305.2| hypothetical protein POPTR_0010s19110g [Populus trichocarpa]
Length=1240

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/897 (54%), Positives = 600/897 (67%), Gaps = 87/897 (10%)
 Frame = -3

Query  3047  HLAIVPLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLNL  2868
              LAIVP+    +   F+Q ++PL   DN     E  E   +     G S         ++
Sbjct  420   QLAIVPVPTEDDLVTFEQYDSPLKTPDN--FPQECIEFPIRSYSKKGYSVQRKNDFDEDM  477

Query  2867  MQGRRWG----QVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSI  2700
             M G  WG    + KV + ++    +                   +RD     +++++ ++
Sbjct  478   MFGSGWGGKSSRKKVQRARYQSTHL-------------------KRDDSCKPKTYKQTAL  518

Query  2699  SANVYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelse  2526
             SA  Y +LI   M N D T+ +KE   IIDQW+EF+   S  Q+E +E S   ++ E SE
Sbjct  519   SAGAYDKLISFYMKNFDSTIKSKEVTRIIDQWEEFKAKHSSDQKETMEPSLVEDDGESSE  578

Query  2525  LDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLC  2346
              +MLW+EMEL L S Y+ +D E    + +T+    T+  +  C H+F+L+EEIG++C  C
Sbjct  579   TEMLWREMELCLTSAYIFEDNES---RVSTQ---TTQNSSECCQHEFKLDEEIGILCHKC  632

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVE  2166
               V TE K V  PF                 V +  +  DA                   
Sbjct  633   SFVKTEKKYVSAPF-----------------VSQIFETHDA-------------------  656

Query  2165  VEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGK  1986
             V DN W LIP+LR KL  H+++AFE LW+NIAGS++P  ++  SKK GGCVISH+PGAGK
Sbjct  657   VNDNVWDLIPELRAKLHMHRKKAFECLWRNIAGSLVPALMEKASKKIGGCVISHTPGAGK  716

Query  1985  TLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLR  1806
             T L IAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV  IHG  T    V R
Sbjct  717   TFLKIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVLLIHG--TRSSRVFR  774

Query  1805  QK-MKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYM  1632
             Q  + L    PR +QDV+H+LDCLEKMQKW A PSVL+MGYTSFLTL REDS Y  RKYM
Sbjct  775   QTPVALRGSCPRPSQDVVHILDCLEKMQKWHAQPSVLVMGYTSFLTLMREDSKYNRRKYM  834

Query  1631  NQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLA  1452
              +VLR+ PG+L+LDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTLCLA
Sbjct  835   AKVLRESPGMLVLDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTLCLA  894

Query  1451  RPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererkEGLNI  1275
             RP F+ EVLK LDPK+K++ KGA K R  LE+RARK FID I+ KI+  +  E+ +GLN+
Sbjct  895   RPLFIREVLKALDPKFKRKKKGAQKARHFLESRARKFFIDNIASKINLDEAEEKMQGLNM  954

Query  1274  LKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELL  1095
             L+ +T GFIDVYEG +SD LPGLQ YT+M+  T +Q EILVKL        G+PLE+ELL
Sbjct  955   LRNMTNGFIDVYEGTASDTLPGLQIYTIMINPTDIQHEILVKLHKIMEKCPGYPLEVELL  1014

Query  1094  ITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVL  915
             ITL +IHP +I ++ C  +++++EEL  LEK +FD K GSKV FV++L+ R +++K+KVL
Sbjct  1015  ITLASIHPSIINSSVCVKKFYEQEELMELEKLRFDCKKGSKVMFVLNLVYR-VVKKDKVL  1073

Query  914   IFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLAS  735
             IFCHNIAPI LFLE+FE  + W+ G EVL              MDKFEE+GGP +V+LAS
Sbjct  1074  IFCHNIAPIKLFLELFENVFRWQLGKEVL------------EEMDKFEELGGPLRVLLAS  1121

Query  734   ITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKY  555
             IT CA+GISLTAASRVILLDSEWNPSK+KQAIARAFRPGQ K+VYVYQLLATGT+EE+KY
Sbjct  1122  ITACAKGISLTAASRVILLDSEWNPSKTKQAIARAFRPGQQKMVYVYQLLATGTVEEDKY  1181

Query  554   KRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
              RT WK WVS MIFSE+ VEDPS WQA KIED++L EIVEEDR   FHMIMKNEKAS
Sbjct  1182  HRTAWKNWVSRMIFSEESVEDPSRWQAEKIEDDVLREIVEEDRVKSFHMIMKNEKAS  1238


 Score =   212 bits (540),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 164/291 (56%), Gaps = 35/291 (12%)
 Frame = -3

Query  4172  FDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCA  3993
             F +  FEA   GSWQ VE I I++G   +H  D    IEE+   SN+R++SR +T SDC 
Sbjct  2     FHLIAFEALYGGSWQSVELIEIRDGAMTLHFADSHHRIEEKGPFSNIRVKSRKSTLSDCT  61

Query  3992  CFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHI  3813
             CFLRPG+D+ V S   +++ S+       +   EP W+DA+I SI+RKPH   C CQF +
Sbjct  62    CFLRPGIDVCVLSFSERAKSSE-------EGNSEPVWVDARINSIKRKPHESQCSCQFFV  114

Query  3812  SVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPC-------EDKYYRWSLSDDCS  3654
             ++YV QGP    + TLSKE + V ++QI+ILQK++  PC       E ++YRW   +DCS
Sbjct  115   NLYVNQGPLGSERATLSKETEAVGIDQISILQKLDNDPCEADNNRHETQFYRWEFCEDCS  174

Query  3653  TLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEYHSY  3474
              +Q+                  S  KQV FDV+SV N+I Y+I   ++D  +  S  H  
Sbjct  175   LVQR-----------------TSIPKQVAFDVRSVQNKIAYQIFGGDDDHCSLKSNNHIN  217

Query  3473  AVSFKLENEVSTPIIIQFNP--DIPERGPEGDVYEAGPLVVYD--ELRRSK  3333
              V+FK+E+ +STP ++Q +P     ERGP  D         YD   LRRSK
Sbjct  218   CVTFKVEDGISTPFVVQLDPIDTCSERGPISDTNGTEKPPCYDVMNLRRSK  268



>ref|XP_003600991.1| DNA repair and recombination protein RAD54-like protein [Medicago 
truncatula]
 gb|AES71242.1| chromatin remodeling complex subunit [Medicago truncatula]
Length=1267

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/808 (56%), Positives = 577/808 (71%), Gaps = 29/808 (4%)
 Frame = -3

Query  2750  SQRDSIYDIRSFRKG-SISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQR  2574
             S R  +++ +  + G + +A+  +E+I   M N D    +E+P + +  KE  +    + 
Sbjct  472   SNRSHVHEEQDHKGGRTFNADARKEIIDSYMKNFDSLPTEEEPTVNENRKE-TSMLEKKE  530

Query  2573  EPIeksstnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKG-TRVC  2397
             E     S + EE   +LD LW+EM  AL S YLLD T      S++E+   TKK     C
Sbjct  531   EEKVSKSDDEEENADDLDALWEEMNTALTSSYLLDGT----AGSSSEVVADTKKEFNESC  586

Query  2396  HHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMP--------STCSSSGKEQRPEEVVMEE  2241
              HD+RL+EEIG+ C  CG V T I+D+  PF+           CS   KE + E  V E 
Sbjct  587   EHDYRLDEEIGIYCLRCGFVKTAIRDISEPFVECPKRYKEEKQCSEENKEHKSEPKVDE-  645

Query  2240  KQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSI  2061
                 D + D F+  V+        E+ DN W LIP+L  K+  HQ++AFEFLW+NIAGS+
Sbjct  646   ----DYNNDMFSTHVTDPDEPLTNEI-DNVWELIPELEEKMHEHQKKAFEFLWQNIAGSM  700

Query  2060  IPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKE  1881
              P+ ++ +S   GGCVISH+PGAGKT LII+FLVSYLKLFPG RPLVLAPKTTLYTW KE
Sbjct  701   EPSLMEEKSNSSGGCVISHAPGAGKTFLIISFLVSYLKLFPGKRPLVLAPKTTLYTWRKE  760

Query  1880  IIKWKIPIPVYQIHGGQTYKGEV-LRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPS  1707
               KWKI +PVY IHG +T  G      K  + PG PR + DV HVLDCL K+QKW +HPS
Sbjct  761   FKKWKISVPVYLIHGRRTSPGSSSTTPKSMILPGFPRPSSDVKHVLDCLSKIQKWHSHPS  820

Query  1706  VLLMGYTSFLTLTR-EDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVN  1530
             VL+MGYTSFL L R +D+ + HRKYM + LR+ PGILILDEGHNPRSTKSRLRK LMK+ 
Sbjct  821   VLVMGYTSFLQLMRSKDTKFEHRKYMAKALRESPGILILDEGHNPRSTKSRLRKCLMKLP  880

Query  1529  TSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVK--GAKTRFSLENR  1356
             T LRILLSGTLFQNNF EYFNTLCLARP+FV EVL+ELD KY+++      K R  LE R
Sbjct  881   TELRILLSGTLFQNNFCEYFNTLCLARPKFVHEVLQELDSKYRRKGGKIAKKERHLLEAR  940

Query  1355  ARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYE-GGSSDNLPGLQCYTLMMKS  1179
             ARK F++ I KKI+S  + E+ +GL +L+K+T+ FIDVY+ G SS+ LPGLQ YTL+M +
Sbjct  941   ARKFFLNNIEKKINSDIDEEKMQGLYVLRKITSSFIDVYDSGNSSETLPGLQIYTLLMNT  1000

Query  1178  TTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTA-CSGQYfkeeelealek  1002
             +  Q EI+ KLQ +      +PLE+ELLITLG+IHPWLI+T A C+ ++F EEEL+ LE 
Sbjct  1001  SDEQHEIVQKLQKKMAESTSYPLEVELLITLGSIHPWLIKTAASCATKFFAEEELKKLEI  1060

Query  1001  fkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVL  822
              KFDL+  SKV+FV+SLI R +++ EKVLIFCHN+AP+   +E+FE+++ W+ G E++VL
Sbjct  1061  SKFDLRKSSKVRFVLSLISR-VVKNEKVLIFCHNLAPVRFLIELFEKYFQWQNGKEIMVL  1119

Query  821   QGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQA  642
              G+++LFERG+V+DKFE+    SK++LASI  CAEGISLTAASRVI LDSEWNPSK+KQA
Sbjct  1120  TGELDLFERGKVIDKFEDQSSGSKILLASINACAEGISLTAASRVIFLDSEWNPSKTKQA  1179

Query  641   IARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIE  462
             IARAFRPGQ K+VYVYQLL TG++EE+KY+RTTWKEWVS MIFSE+ VEDPS WQA KIE
Sbjct  1180  IARAFRPGQQKMVYVYQLLTTGSMEEDKYRRTTWKEWVSCMIFSEEFVEDPSKWQAEKIE  1239

Query  461   DELLGEIVEEDRATLFHMIMKNEKASNM  378
             D++L E+VEED++   HMIMKNEKAS +
Sbjct  1240  DDILREMVEEDKSKAIHMIMKNEKASTI  1267


 Score =   237 bits (605),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 134/314 (43%), Positives = 190/314 (61%), Gaps = 25/314 (8%)
 Frame = -3

Query  4202  RRSIHQNEHPFDV-YPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             +R +HQ +HPFD  YPFEA  NGSWQPVE ++I++G   +  +D  + I+  +S S++RI
Sbjct  5     KRHLHQWKHPFDSNYPFEAVFNGSWQPVELLKIESGKTTLRFID-TEQIQSTLS-SDIRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR ATSSDC+ FLRPG+DIS+             N+  ++    P WIDA+I SI R+P
Sbjct  63    RSRKATSSDCSSFLRPGIDISML-------LGYRYNDNSDQFRSIPMWIDARINSIHRQP  115

Query  3845  HGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED-------  3690
             H    C CQF+++ Y  QG      KTL+KE+  + ++QI ILQ+++   CE        
Sbjct  116   HKSDQCSCQFYVNFYDDQGSLGTEVKTLNKEVNAIGMDQIFILQRLQHNTCEGLLKENDT  175

Query  3689  ---KYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILK  3519
                K YRW  S+DCS+L + +L  GKF SDLSW ++ S  K+V F ++SV N+IVY+++ 
Sbjct  176   SEIKPYRWDSSEDCSSLSQSRLLVGKFSSDLSWFVITSFLKKVSFHIRSVQNKIVYQVMG  235

Query  3518  DENDIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYDELRR  3339
             ++ DI +P   +    V+F L+ E   PI+ QF+      G E D     P    + LRR
Sbjct  236   NDTDIISP---WLINVVNFSLKKESLVPIVSQFDVFYDYDGEE-DEAPPNPSNEVEGLRR  291

Query  3338  SKRRFVQPERYLGC  3297
             SKRR VQPERY+GC
Sbjct  292   SKRRNVQPERYVGC  305



>gb|AES78270.2| chromatin remodeling complex subunit [Medicago truncatula]
Length=1181

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/787 (56%), Positives = 572/787 (73%), Gaps = 25/787 (3%)
 Frame = -3

Query  2705  SISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelse  2526
             +++ +  +E+I   M N+D +L  E+ P ID+      T   + E + KS    E     
Sbjct  387   TLNVDAKKEIIDTYMKNLD-SLRAEEEPTIDE-----ETNKLEEEKVSKSDDGEENPDDL  440

Query  2525  LDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLC  2346
                +W+EM+ A+A+  LLD TE +N +   +          +C HD+  NEEIG+ C  C
Sbjct  441   S-AIWEEMDTAMAASCLLDGTEGSNAEVLADTE-------EICEHDYTFNEEIGIFCLSC  492

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNK--PSSE  2172
             G V TEI+D+  P +        ++Q  EE   E+K     D D      S+N   P   
Sbjct  493   GSVKTEIRDISEPVVERQKWRKEEKQYSEEDNDEQKSEAKVDEDDNKDMFSTNATDPDEP  552

Query  2171  VEVE-DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPG  1995
             +  E D  W  IP+L+ K+ AHQ++AF+FLW+NIAGS+ P+ +   S+  GGCVISH+PG
Sbjct  553   ISAEKDTVWESIPELKEKMHAHQKKAFKFLWQNIAGSMEPSLMQERSETNGGCVISHAPG  612

Query  1994  AGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE  1815
             AGKT L+I+FLVSYLKLFPG RPLVLAPK+TLYTW KE  KWK+P+PVY I G QT +  
Sbjct  613   AGKTFLVISFLVSYLKLFPGKRPLVLAPKSTLYTWCKEFKKWKVPVPVYLIQGRQTQRDS  672

Query  1814  VLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRK  1638
                 K  + PG+PR + DV HVLDCL K++KW +HPSVL+MGYTSFL L R+D+ +AHRK
Sbjct  673   TA-PKPTVLPGVPRPSGDVKHVLDCLGKIKKWHSHPSVLVMGYTSFLALMRQDTKFAHRK  731

Query  1637  YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLC  1458
             YM + LR+ PGILILDEGHNPRSTKSRLRK LM++ T LRILLSGTLFQNNFGEYFNTLC
Sbjct  732   YMAKTLRESPGILILDEGHNPRSTKSRLRKCLMELPTELRILLSGTLFQNNFGEYFNTLC  791

Query  1457  LARPRFVDEVLKELDPKYKKR-VKGAKTRFSLENRARKMFidkiskkidsskererkEGL  1281
             LARP+FV EVL+ELD KY +R  +  K +  LE RARK F+D I++KI+S  + E+ +GL
Sbjct  792   LARPKFVHEVLRELDSKYLRRGNREKKAQHLLEARARKFFLDNIARKINSDNDEEKMQGL  851

Query  1280  NILKKLTTGFIDVYE-GGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLEL  1104
             ++L+K+T+ FIDVYE G SSD LPGLQ YTL+M +   Q EIL KLQ +     G+PLE+
Sbjct  852   HVLRKITSSFIDVYESGNSSDTLPGLQIYTLLMNTYDEQLEILQKLQKKMAECTGYPLEV  911

Query  1103  ELLITLGAIHPWLIRT-TACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
             ELLITLG+IHPWLI+T TAC+ ++F E+EL+ L++ KFDL+ GSK++FV+SLI R +++ 
Sbjct  912   ELLITLGSIHPWLIKTATACAEKFFAEDELKRLDRIKFDLRKGSKIRFVLSLISR-VVKN  970

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVLIFCH +AP+  F+E+FE+++ W+ G EVL+L GD++LFERG+V+DKFE+    SK+
Sbjct  971   EKVLIFCHYLAPVRFFIELFEKYFQWQNGKEVLILTGDLDLFERGKVIDKFEDPRSGSKI  1030

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LASI  CAEGISLTAASRVI LDSEWNPSK+KQAIARAFRPGQ K+VYVYQLL TG++E
Sbjct  1031  LLASINACAEGISLTAASRVIFLDSEWNPSKTKQAIARAFRPGQQKMVYVYQLLTTGSME  1090

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKA  387
             E+K+++TTWKEWVSSMIFSE+ VEDPS WQA KIEDE+L E+VEED++   HMIMKNEK 
Sbjct  1091  EDKFRKTTWKEWVSSMIFSEEFVEDPSKWQAEKIEDEILREMVEEDKSKAIHMIMKNEKD  1150

Query  386   S--NMGR  372
             S  NM R
Sbjct  1151  SVRNMPR  1157


 Score =   192 bits (488),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 118/303 (39%), Positives = 168/303 (55%), Gaps = 35/303 (12%)
 Frame = -3

Query  4166  VYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACF  3987
             +  FEA RN SWQPVE I+I  G   +H +D   + +  +S S++RIRSR ATS DC+ F
Sbjct  8     ITTFEAIRNDSWQPVELIKIDFGKTTLHFMDTQQM-QTPLS-SDIRIRSRKATSFDCSSF  65

Query  3986  LRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH-GFGCVCQFHIS  3810
             LR G+DIS+     Q               P P  IDA+I SI+R+PH    C CQF+++
Sbjct  66    LRRGMDISMLQISDQ-------------FRPIPTSIDARINSIQRQPHESDQCSCQFYVN  112

Query  3809  VYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED-----------KYYRWSLSD  3663
              Y  QG      KTL+KE+    +++I ILQ+++   CE            K YRW  S+
Sbjct  113   FYEDQGSLGRNIKTLNKEVYATGIDRIFILQRLQHNSCEGLIKNSDSSEVVKPYRWDSSE  172

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DCS+L + +L  G+F SDLSW +  S  K+V F ++SV N+I Y ++ ++ DI  P+   
Sbjct  173   DCSSLSESRLILGRFLSDLSWFVTTSFLKKVSFSIRSVQNKIFYHVMGNDADIINPSL--  230

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVV--YDELRRSKRRFVQPER  3309
                 V+FK E     P++  F+      G E    EA P++    + LRRSKRR VQP+R
Sbjct  231   -LNVVNFKSEKGSIVPVVSLFDMFCDYDGEED---EALPMLSNQIEGLRRSKRRNVQPKR  286

Query  3308  YLG  3300
             Y+G
Sbjct  287   YIG  289



>ref|XP_003622052.1| DNA repair and recombination protein RAD54-like protein [Medicago 
truncatula]
Length=1184

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/792 (56%), Positives = 574/792 (72%), Gaps = 32/792 (4%)
 Frame = -3

Query  2705  SISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelse  2526
             +++ +  +E+I   M N+D +L  E+ P ID+      T   + E + KS    E     
Sbjct  387   TLNVDAKKEIIDTYMKNLD-SLRAEEEPTIDE-----ETNKLEEEKVSKSDDGEENPDDL  440

Query  2525  LDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLC  2346
                +W+EM+ A+A+  LLD TE +N +   +          +C HD+  NEEIG+ C  C
Sbjct  441   S-AIWEEMDTAMAASCLLDGTEGSNAEVLADTE-------EICEHDYTFNEEIGIFCLSC  492

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGK-------EQRPEEVVMEEKQGDDADLDHFAIPVSSN  2187
             G V TEI+D+  P +        +       E+  +E   E K  +D + D F+   ++ 
Sbjct  493   GSVKTEIRDISEPVVSQVERQKWRKEEKQYSEEDNDEQKSEAKVDEDDNKDMFS--TNAT  550

Query  2186  KPSSEVEVE-DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
              P   +  E D  W  IP+L+ K+ AHQ++AF+FLW+NIAGS+ P+ +   S+  GGCVI
Sbjct  551   DPDEPISAEKDTVWESIPELKEKMHAHQKKAFKFLWQNIAGSMEPSLMQERSETNGGCVI  610

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PGAGKT L+I+FLVSYLKLFPG RPLVLAPK+TLYTW KE  KWK+P+PVY I G Q
Sbjct  611   SHAPGAGKTFLVISFLVSYLKLFPGKRPLVLAPKSTLYTWCKEFKKWKVPVPVYLIQGRQ  670

Query  1829  TYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
             T +      K  + PG+PR + DV HVLDCL K++KW +HPSVL+MGYTSFL L R+D+ 
Sbjct  671   TQRDSTA-PKPTVLPGVPRPSGDVKHVLDCLGKIKKWHSHPSVLVMGYTSFLALMRQDTK  729

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
             +AHRKYM + LR+ PGILILDEGHNPRSTKSRLRK LM++ T LRILLSGTLFQNNFGEY
Sbjct  730   FAHRKYMAKTLRESPGILILDEGHNPRSTKSRLRKCLMELPTELRILLSGTLFQNNFGEY  789

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKR-VKGAKTRFSLENRARKMFidkiskkidsskere  1296
             FNTLCLARP+FV EVL+ELD KY +R  +  K +  LE RARK F+D I++KI+S  + E
Sbjct  790   FNTLCLARPKFVHEVLRELDSKYLRRGNREKKAQHLLEARARKFFLDNIARKINSDNDEE  849

Query  1295  rkEGLNILKKLTTGFIDVYE-GGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
             + +GL++L+K+T+ FIDVYE G SSD LPGLQ YTL+M +   Q EIL KLQ +     G
Sbjct  850   KMQGLHVLRKITSSFIDVYESGNSSDTLPGLQIYTLLMNTYDEQLEILQKLQKKMAECTG  909

Query  1118  FPLELELLITLGAIHPWLIRT-TACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
             +PLE+ELLITLG+IHPWLI+T TAC+ ++F E+EL+ L++ KFDL+ GSK++FV+SLI R
Sbjct  910   YPLEVELLITLGSIHPWLIKTATACAEKFFAEDELKRLDRIKFDLRKGSKIRFVLSLISR  969

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
              +++ EKVLIFCH +AP+  F+E+FE+++ W+ G EVL+L GD++LFERG+V+DKFE+  
Sbjct  970   -VVKNEKVLIFCHYLAPVRFFIELFEKYFQWQNGKEVLILTGDLDLFERGKVIDKFEDPR  1028

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               SK++LASI  CAEGISLTAASRVI LDSEWNPSK+KQAIARAFRPGQ K+VYVYQLL 
Sbjct  1029  SGSKILLASINACAEGISLTAASRVIFLDSEWNPSKTKQAIARAFRPGQQKMVYVYQLLT  1088

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIM  402
             TG++EE+K+++TTWKEWVSSMIFSE+ VEDPS WQA KIEDE+L E+VEED++   HMIM
Sbjct  1089  TGSMEEDKFRKTTWKEWVSSMIFSEEFVEDPSKWQAEKIEDEILREMVEEDKSKAIHMIM  1148

Query  401   KNEKAS--NMGR  372
             KNEK S  NM R
Sbjct  1149  KNEKDSVRNMPR  1160


 Score =   192 bits (489),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 118/303 (39%), Positives = 168/303 (55%), Gaps = 35/303 (12%)
 Frame = -3

Query  4166  VYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACF  3987
             +  FEA RN SWQPVE I+I  G   +H +D   + +  +S S++RIRSR ATS DC+ F
Sbjct  8     ITTFEAIRNDSWQPVELIKIDFGKTTLHFMDTQQM-QTPLS-SDIRIRSRKATSFDCSSF  65

Query  3986  LRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH-GFGCVCQFHIS  3810
             LR G+DIS+     Q               P P  IDA+I SI+R+PH    C CQF+++
Sbjct  66    LRRGMDISMLQISDQ-------------FRPIPTSIDARINSIQRQPHESDQCSCQFYVN  112

Query  3809  VYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED-----------KYYRWSLSD  3663
              Y  QG      KTL+KE+    +++I ILQ+++   CE            K YRW  S+
Sbjct  113   FYEDQGSLGRNIKTLNKEVYATGIDRIFILQRLQHNSCEGLIKNSDSSEVVKPYRWDSSE  172

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DCS+L + +L  G+F SDLSW +  S  K+V F ++SV N+I Y ++ ++ DI  P+   
Sbjct  173   DCSSLSESRLILGRFLSDLSWFVTTSFLKKVSFSIRSVQNKIFYHVMGNDADIINPSL--  230

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVV--YDELRRSKRRFVQPER  3309
                 V+FK E     P++  F+      G E    EA P++    + LRRSKRR VQP+R
Sbjct  231   -LNVVNFKSEKGSIVPVVSLFDMFCDYDGEED---EALPMLSNQIEGLRRSKRRNVQPKR  286

Query  3308  YLG  3300
             Y+G
Sbjct  287   YIG  289



>ref|XP_007163582.1| hypothetical protein PHAVU_001G246400g [Phaseolus vulgaris]
 gb|ESW35576.1| hypothetical protein PHAVU_001G246400g [Phaseolus vulgaris]
Length=1178

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/785 (56%), Positives = 567/785 (72%), Gaps = 28/785 (4%)
 Frame = -3

Query  2723  RSFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnn  2544
             R++R  S++A  Y+E+I   + +I+ T  KE+P ++D WKE   TK  +++  E      
Sbjct  415   RNYR--SLNATDYKEIIDSYLKDINRTPTKEEPTVMDLWKEI--TKLEKKKEAEIPQREE  470

Query  2543  eeelseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIG  2364
             EE++SE+DMLW+EME+AL S ++ + +   N    +E      +    C HD+RL EEIG
Sbjct  471   EEQISEMDMLWREMEMALTSSHIEEGSIGANFAENSE------ESNHTCQHDYRLYEEIG  524

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNK  2184
             + C  CG V TEIK V PPFM         + R +E      + DD D D   +      
Sbjct  525   IYCFKCGFVKTEIKYVTPPFMKKYY-----QVRQQEEKQCSGKEDDKDDDFHQLSSRDEL  579

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISH  2004
              S E    DN W LIP+LR K+  HQ++AFEFLW+NI+GS+ PT +D ESK+RGGCVISH
Sbjct  580   ISME---HDNVWKLIPELREKMHVHQKKAFEFLWQNISGSMDPTLMDAESKRRGGCVISH  636

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             SPG+GKT LIIAFL+SYLKLFPG +PLVLAP TTL+TW+KE IKW I +PVY IHG    
Sbjct  637   SPGSGKTFLIIAFLISYLKLFPGMKPLVLAPTTTLHTWHKEFIKWDISVPVYLIHG----  692

Query  1823  KGEVLRQKMKLCPGLPR----NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
             + E  +  M+    LP     N++V H+L+CL+K++KW  HP VL+M YTSFL L RE S
Sbjct  693   RSEPQKDDMQNSTVLPHFRNPNKNVKHILNCLDKIKKWQTHPGVLVMSYTSFLALMREGS  752

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
              +  RKYM + LR+  GILILDEGHNPRSTKSRLRK LMKV T +RILLSGTLFQNNF E
Sbjct  753   EFTPRKYMAKALRERSGILILDEGHNPRSTKSRLRKVLMKVQTDIRILLSGTLFQNNFSE  812

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidssker  1299
             YFNTLCLARP+F+ EVLKELD   +++ K   K+R  LE++ARK+F+D I+KKIDSS   
Sbjct  813   YFNTLCLARPKFIYEVLKELDTNGRRKGKTTEKSRHLLESQARKLFLDNITKKIDSSNRH  872

Query  1298  erkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
             ER +GLN+L+++T GFID+YE  S +++PGL+ +TL+M +T LQ E+L+KL  +     G
Sbjct  873   ERMQGLNMLREITNGFIDIYESASFNSVPGLKMFTLLMNTTDLQSEVLMKLHKRMAECTG  932

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
             +PLELELLITLG+IHPWL++T + + ++   ++L+ LEK K DLK GSKVKFVMSL+   
Sbjct  933   YPLELELLITLGSIHPWLVKTASYANKFMALDQLQQLEKCKLDLKAGSKVKFVMSLVLH-  991

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGG  759
             ++ KEKVLIFCHN AP+ L +E+FE  + W KG E+L+L G+ +LFERG+V+DKFEE  G
Sbjct  992   VMEKEKVLIFCHNHAPVKLLVELFEMVFKWEKGREILLLNGEQDLFERGKVIDKFEEPRG  1051

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
              SKV+LASI  C EGISLT+ASRVI LDSEWNPSK+KQAIARAFRPGQ K+VY YQLLA 
Sbjct  1052  ASKVLLASIKACGEGISLTSASRVIFLDSEWNPSKTKQAIARAFRPGQQKMVYAYQLLAR  1111

Query  578   GTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMK  399
             GTLEE+KY+RTTWKEWVSSMIFSE   E+ SH QA  IED++L E+VEED++   HMI+K
Sbjct  1112  GTLEEDKYRRTTWKEWVSSMIFSEAFQENTSHSQAKMIEDDILREMVEEDKSKSIHMILK  1171

Query  398   NEKAS  384
             NEKAS
Sbjct  1172  NEKAS  1176


 Score =   249 bits (637),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 185/305 (61%), Gaps = 9/305 (3%)
 Frame = -3

Query  4202  RRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIR  4023
             RR+  Q++HPF  YPFE   +GSWQ VE I+I+ GT  +  +D      E+  +S++RIR
Sbjct  5     RRNSRQSKHPFHAYPFETLLSGSWQAVEFIKIEAGTTSLQCIDNHHRTTEKGLLSDLRIR  64

Query  4022  SRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPH  3843
             SR AT SDC+ FLR G+DI V S     + + +      +   +  W+DAKI SI+RK H
Sbjct  65    SRKATLSDCSNFLRRGIDICVLSASQSGDTNSD------RFCADNVWLDAKINSIQRKHH  118

Query  3842  GFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSD  3663
               GC C +++++YV QG      +TLSKE+KV+ +N+IAILQK+E+  CED++YRW  S+
Sbjct  119   NSGCSCLYYVNLYVNQGSLGREIRTLSKEVKVIGINEIAILQKLERNTCEDQHYRWESSE  178

Query  3662  DCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSEY  3483
             DCS +   KL  GKF SDLSW++V SA K+V F  +SV N+IVY+IL  +    + N   
Sbjct  179   DCSQVLHTKLVLGKFLSDLSWLVVTSALKKVSFYARSVENKIVYQILGSDATGSSLNMHS  238

Query  3482  HSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVY-EAGPLVVYDELRRSKRRFVQPERY  3306
                  +F++ +    PI+ Q   D+ +       Y E  P    + LRRSKR  +QPERY
Sbjct  239   SMRVANFEVNDGTMKPIVTQV--DVSDTNTHDSHYDEVSPSYDVEGLRRSKRMNIQPERY  296

Query  3305  LGCDD  3291
             LGC +
Sbjct  297   LGCGN  301



>gb|KEH43046.1| chromatin remodeling complex subunit [Medicago truncatula]
Length=1116

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/777 (55%), Positives = 557/777 (72%), Gaps = 23/777 (3%)
 Frame = -3

Query  2702  ISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelseL  2523
             ++A+   E+I   M N D +L  E+ P I + ++F+     ++E + +     E      
Sbjct  357   LNADACEEVIDAYMDNFD-SLPTEEDPTISEERQFEQ----EKENVSEKGDEVENPDDLA  411

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             DM W+EME AL S YLLD  E  N     E+   T K    C HD+RL+E+IG+ CR CG
Sbjct  412   DM-WEEMETALTSSYLLDGNEGAN---GDEVLADTNKE---CKHDYRLDEQIGIYCRTCG  464

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS-NKPSSEVE  2166
              V TEI+ +  P +        K+QR E+    E+  +D + D F+   +   +P S+  
Sbjct  465   FVKTEIRYISEPIVERLKWYEQKKQRSEDT---EQVDEDVNNDTFSTDATDLGEPISKEN  521

Query  2165  VEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGK  1986
               D+ W LIP+L+  + AHQ++AFEFLWKNIAGS+  + ++ +S   GGCVISH+PGAGK
Sbjct  522   --DSVWELIPELKENMHAHQKKAFEFLWKNIAGSMEQSLMEEKSNTSGGCVISHAPGAGK  579

Query  1985  TLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLR  1806
             T LII+FLVSYLKLFP  RPLVLAPKTTLYTW KE  KW IP+PVY IH  QT +  +  
Sbjct  580   TFLIISFLVSYLKLFPEKRPLVLAPKTTLYTWQKEFEKWNIPMPVYLIHSSQTQRHSMTP  639

Query  1805  QKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR-EDSTYAHRKYMN  1629
             + + L PG+  +  V H  DCL+K++ W +HPSVL+MGY+SFL L R ED   +HRK   
Sbjct  640   KSVVL-PGVSNSNGVKHDFDCLQKIKSWNSHPSVLVMGYSSFLALMRTEDKKNSHRKRTA  698

Query  1628  QVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLAR  1449
             + LR+ PG+LILDEGHNPRST S+LRK LM +  +LRILLSGTLFQNNFGEYFNTLCLAR
Sbjct  699   KALRESPGLLILDEGHNPRSTTSKLRKCLMDLPAALRILLSGTLFQNNFGEYFNTLCLAR  758

Query  1448  PRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILK  1269
             P+F+ EVL+ELD KY++     +    LE RARK F++ I KKI+S+ + E+ +G+++L+
Sbjct  759   PKFIHEVLEELDSKYRRGKLEEEVPHLLEARARKFFLENIEKKINSNIDAEKMKGIDVLR  818

Query  1268  KLTTGFIDVYEGGSS-DNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLI  1092
             K+T GFIDVY+GGSS D LPGLQ YTL++ ++  Q EI+ KLQ +     G+ LE+ELLI
Sbjct  819   KITNGFIDVYDGGSSSDTLPGLQIYTLLVNASDEQHEIVQKLQKKMVGSTGYSLEVELLI  878

Query  1091  TLGAIHPWLIRTT-ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVL  915
             TLG+IHPWLI+T  +C+ ++F EEELE LE+ KF L+ GSKV+FV+SLI R ++RKEKVL
Sbjct  879   TLGSIHPWLIKTAESCAAKFFSEEELERLEQNKFALRKGSKVRFVLSLISR-VMRKEKVL  937

Query  914   IFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLAS  735
             IFCHN+AP+   +E+FE  + W+ G E+L L G+ + FER  V+DKFE+  G SK++LAS
Sbjct  938   IFCHNLAPVRFLIELFENHFRWKNGKEILQLTGEQDFFERTNVIDKFEDRCGDSKILLAS  997

Query  734   ITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKY  555
             I  CAEGISLTAASRVI LDSEWNPSK+KQAIARAFRPGQ+K+VYVY LL TG++EE+KY
Sbjct  998   INACAEGISLTAASRVIFLDSEWNPSKTKQAIARAFRPGQEKMVYVYHLLMTGSMEEDKY  1057

Query  554   KRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
             +RTTWKEWVS MIFSE+LVEDPS WQA KIED++L E+VEED++ L HMIMKNEK S
Sbjct  1058  RRTTWKEWVSCMIFSEELVEDPSKWQAEKIEDDILREMVEEDKSKLIHMIMKNEKTS  1114


 Score =   174 bits (440),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 148/251 (59%), Gaps = 23/251 (9%)
 Frame = -3

Query  4211  AMKRRSIHQNEHPFDV-YPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISN  4035
             A ++  +HQ++HPFD  YPFEA  N SWQPVE I+I++G   ++ +   ++      +S+
Sbjct  2     APEKSYLHQSKHPFDANYPFEAVLNRSWQPVELIKIESGKTIVNFIHAQNIHSH--LLSD  59

Query  4034  VRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIE  3855
             +R+RSR AT +DC+ F+RPG+DISV S+              +  +  P   DA++ S+ 
Sbjct  60    IRLRSREATPADCSSFVRPGIDISVLSS---------FEYNKKSRQSSPISTDARVNSVH  110

Query  3854  RKPHGFG-CVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED----  3690
             RKPH    C C+F ++ Y  Q       +TL KE+ V+ + QI+ILQ++++  CE     
Sbjct  111   RKPHKSDQCSCRFKVNFYNDQDSVGTEIRTLKKEVSVIGIKQISILQRLQRNTCEGSLRE  170

Query  3689  ------KYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYE  3528
                     Y W  S+DCS+L + +L  GKF SDLS  + AS+ K+V + ++SV N+IVYE
Sbjct  171   NDSSKFNLYMWDSSEDCSSLPQSRLLFGKFLSDLSRFVTASSLKKVSYVIRSVQNKIVYE  230

Query  3527  ILKDENDIDAP  3495
             ++ ++ +I  P
Sbjct  231   VMGNDPNISGP  241



>gb|KHN31310.1| DNA repair and recombination protein RAD54-like [Glycine soja]
Length=639

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/633 (63%), Positives = 494/633 (78%), Gaps = 16/633 (3%)
 Frame = -3

Query  2246  EEKQGDDADL-------DHFAIPVSSNKPSSEVEV--EDNAWALIPDLRNKLRAHQRRAF  2094
             EEKQ +  D        D F + +S++ P+ E      DN W LIP  R KL  HQ++AF
Sbjct  9     EEKQCNGKDTKEKASKDDDFHL-LSTHAPTDEHNSMEHDNVWKLIPQFREKLHDHQKKAF  67

Query  2093  EFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLA  1914
             EFLW+NI GS+ P  +D ESK+RGGCVISH+PGAGKT LIIAFLVSYLKLFPG +PL+LA
Sbjct  68    EFLWQNIGGSMEPKLMDAESKRRGGCVISHAPGAGKTFLIIAFLVSYLKLFPGKKPLILA  127

Query  1913  PKTTLYTWYKEIIKWKIPIPVYQIHG-GQTYKGEVLRQKMKLCPGLPR-NQDVMHVLDCL  1740
             PK TLYTW KE  KW+I +PVY IHG G T K     Q   + PG P  N+DV HVLDCL
Sbjct  128   PKGTLYTWCKEFNKWEISMPVYLIHGRGGTQKDT--EQNSIVLPGFPNPNKDVKHVLDCL  185

Query  1739  EKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKS  1560
             +K++ W   PSVL+M YT+FL L RE S +AHRKYM + LR+ PGILILDEGHNPRSTKS
Sbjct  186   QKIKLWQEKPSVLVMSYTAFLALMREGSEFAHRKYMAKALREGPGILILDEGHNPRSTKS  245

Query  1559  RLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA-  1383
             RLRK LMK+ T LRILLSGTLFQNNF EYFNTLCLARP+F+ EVL  LDP  +++ K   
Sbjct  246   RLRKGLMKLKTDLRILLSGTLFQNNFCEYFNTLCLARPKFISEVLDTLDPITRRKSKTVE  305

Query  1382  KTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQ  1203
             K    LE+RARK+F+DKI+KKIDS    ER +GLN+L++ T GF+DVYE  + D+ PGLQ
Sbjct  306   KAGHLLESRARKLFLDKIAKKIDSGIGNERMQGLNMLRETTNGFVDVYESENFDSAPGLQ  365

Query  1202  CYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkee  1023
              YTL+M +T  Q+EIL KL  +     G+PLELELL+TLG+IHPWL++TT+C+ ++F  +
Sbjct  366   IYTLLMNTTDKQREILPKLHTRVDECNGYPLELELLVTLGSIHPWLVKTTSCANKFFTAD  425

Query  1022  elealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRK  843
             +L+ L+K+K+D+K GSKVKFV+SL+ R ++++EKVLIFCHN+AP+ L +E+FE F+ W+K
Sbjct  426   QLKQLDKYKYDMKAGSKVKFVLSLVFR-VMQREKVLIFCHNLAPVKLLIELFEMFFKWKK  484

Query  842   GIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWN  663
               E+L+L G+++LFERG+V+DKFEE GG SKV+LASIT CAEGISLTAASRVI LDSEWN
Sbjct  485   DREILLLSGELDLFERGKVIDKFEEHGGASKVLLASITACAEGISLTAASRVIFLDSEWN  544

Query  662   PSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSH  483
             PSK+KQAIARAFRPGQ+K+VYVYQLL TGTLEE+KYKRTTWKEWVSSMIFSE   ++PSH
Sbjct  545   PSKTKQAIARAFRPGQEKMVYVYQLLVTGTLEEDKYKRTTWKEWVSSMIFSEAFEQNPSH  604

Query  482   WQAPKIEDELLGEIVEEDRATLFHMIMKNEKAS  384
              +A  IED++L E+VEED++   HMI+KNEKAS
Sbjct  605   SRAVNIEDDILREMVEEDKSKTIHMILKNEKAS  637



>ref|XP_009412628.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Musa 
acuminata subsp. malaccensis]
Length=1199

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/790 (48%), Positives = 532/790 (67%), Gaps = 23/790 (3%)
 Frame = -3

Query  2735  IYDIRSFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeks  2556
             +Y  R  RK   + N  +E+I +C+ NI   + ++  PI+ Q   +Q T S + E  E  
Sbjct  420   VYKRRFKRKKLANPNECKEVIEKCIGNIRNQIERQFEPIVPQ-AAYQPTASPKEEEEEDF  478

Query  2555  s----tnneeelseLDMLWKEMELALASCYLLDDTEDTNLKSATE-LHMATKKGTRVCHH  2391
             +     +   E  E + LWKEME +L +  LL+  +  N +S TE    + + G   C H
Sbjct  479   NWTPLADTPAEQKEHEDLWKEMEHSLTTLALLEQKQAVNFESQTEGTFNSVEYGEEKCQH  538

Query  2390  DFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH  2211
             D+ L++EIGL CRLC  V TEIK V PPF+     +S KE+  ++ +  E+   D +L+ 
Sbjct  539   DYELHDEIGLRCRLCSFVCTEIKHVSPPFLQVDGWNSFKEKFVDQTLWIERY--DLELNA  596

Query  2210  FAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESK  2031
                 +SS + S     E N W+LI DL++KL  HQ++AFEF+WKN  GS+ P +++  S+
Sbjct  597   LGDAISSREISLSERCE-NVWSLIDDLQSKLHLHQKKAFEFIWKNTTGSLKPEEMNHLSE  655

Query  2030  KRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPV  1851
               GGCVISHSPG+GKTLLIIAF+VSYL+LFP SRPLVLAPK+ ++TW KE  KW I +PV
Sbjct  656   NTGGCVISHSPGSGKTLLIIAFIVSYLRLFPKSRPLVLAPKSAIHTWSKEFQKWGISVPV  715

Query  1850  YQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTL  1671
             Y I     ++    R  M        ++ +  ++D ++K+Q+W  +PS+LLM Y+SF  L
Sbjct  716   YLIQRENKFRTSSFRTSMP-------SRKMRQIMDSVKKLQQWHENPSILLMNYSSFFAL  768

Query  1670  TREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQ  1491
             +++ S   H +++ +VL++ PGILILDEGHNPRSTKS+LRK LM+V T  R+LLSGT+FQ
Sbjct  769   SKQYSKLEHIRFVAEVLQKSPGILILDEGHNPRSTKSKLRKLLMEVKTENRVLLSGTVFQ  828

Query  1490  NNFGEYFNTLCLARPRFVDEVLKELDPKY-----KKRVKGAKTRFSLENRARKMFidkis  1326
             NNF EYFNTL LARPRFVD+V+ EL+P       + + K AKT+   E  ARK+F++K+ 
Sbjct  829   NNFEEYFNTLALARPRFVDDVVNELEPNMLNLFDRNKQKQAKTKIRKERLARKLFMEKVG  888

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKL  1146
             + I+S+KE +RK+G  +L K+T GF+DVY     D LPGL+ YT+M+ ST LQ E+L+KL
Sbjct  889   QNIESNKEHDRKQGFGLLNKITGGFVDVYGSEILDMLPGLEIYTIMLASTELQHEMLMKL  948

Query  1145  QDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVK  966
             Q+  P +K +PLELE+L+T+ +IHPWL+++  C   +F  +ELE + K + + +LGSKV 
Sbjct  949   QNSVP-HKRYPLELEILVTVCSIHPWLVKSVGCVTSFFSADELETISKCRENFRLGSKVN  1007

Query  965   FVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRV  786
             FV+ L+ +  +R EKVL+FCHNI+P+N  +++F+  +GW KG EVL+LQGD EL  R ++
Sbjct  1008  FVIDLVHKSDIRGEKVLVFCHNISPLNFLVDLFKLIFGWNKGEEVLILQGDQELPLRAKI  1067

Query  785   MDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
             MDKF  +V G  KV+LAS T CAEGISLTAASR+++LDSEWN SK++QAIARAFRPGQ+K
Sbjct  1068  MDKFNGDVHGKCKVLLASTTACAEGISLTAASRLVMLDSEWNHSKTRQAIARAFRPGQEK  1127

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             VVYVY LLA+GT EE KYK    K W+S MIF    +E  S  Q   I+DELL E+VEED
Sbjct  1128  VVYVYLLLASGTWEEGKYKSNARKAWMSKMIFLGRYIEFSSSRQVEHIDDELLRELVEED  1187

Query  428   RATLFHMIMK  399
                +  MIM+
Sbjct  1188  EIKMLQMIMR  1197


 Score =   146 bits (368),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 101/328 (31%), Positives = 161/328 (49%), Gaps = 32/328 (10%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M +R +    HP +  PFEA+ +GSW  V+ I I+NG+    +   G +I +++    +R
Sbjct  1     MSKRRLSHCSHPINGTPFEAYYHGSWHGVDHISIRNGSTFAKLNYHGTMIVDKVDGDCLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A+ SDC  FL+PG+++ V S           N   E  +P  +W DA I SI++ 
Sbjct  61    MRSRKASLSDCIHFLKPGVEVCVLS-----RHPVSANFGQEVQKPLLSWHDAIIISIKKV  115

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
              H   C   F + +   +      K    +  +VV ++ I+ILQK++ +PCED YY+W+ 
Sbjct  116   RHVDHCSFLFSVMICTNKSSVSEKKGRNDRWAEVVPIDNISILQKLQSEPCEDGYYQWNS  175

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEI------------  3525
             + DC +  K KL    F S+++W+LV S  K + FD+K V N++V  I            
Sbjct  176   TVDCVSYGKSKLLNEAFSSEVAWLLVLSTLKGMSFDLKLVQNKLVSFITKSYQESASLSN  235

Query  3524  LKDENDIDAPNSEYHSY--AVSFKLENEVSTPII--IQFNPD---IPERGPEGDVY----  3378
             L+ +   +  NS  H     + F+  NE+  P I  +   P     PE+  E + +    
Sbjct  236   LQSDGATNITNSSSHETIKIMRFQWSNEILKPKIQTVVMAPSEEITPEKATEANHHVVNV  295

Query  3377  ----EAGPLVVYDELRRSKRRFVQPERY  3306
                 E   L  +  LR SKR  V P+R+
Sbjct  296   ESDSEVEFLYEHTSLRHSKRLKVVPDRF  323



>ref|XP_010937952.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like isoform 
X2 [Elaeis guineensis]
Length=1163

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/800 (48%), Positives = 535/800 (67%), Gaps = 42/800 (5%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnne  2541
             S RK  +SA   + LI +C+ NI     +   P++ QW   + T   +  P  + + + +
Sbjct  382   SNRKKLLSAAECKHLIEKCIGNIKCETERNIEPVV-QWLTQKTTNFPEEPPYFRWTPSVD  440

Query  2540  eelseLDM--LWKEMELALASCYLL-----------DDTEDTNLKSATELHMATKKGTRV  2400
              +L   +   LWKEME +L +  LL           D + D++++   +L          
Sbjct  441   TQLENEEHEDLWKEMEQSLTTLALLEQNKVLDSKFLDGSTDSSMRDPEQLE---------  491

Query  2399  CHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDAD  2220
             CHHD+ L E+IG++CRLC  + TEI+ V PPF     S + KE+        +K G    
Sbjct  492   CHHDYTLKEDIGVICRLCNFICTEIRYVSPPF--GDYSVAWKEK-----FGVKKLGIMGL  544

Query  2219  LDHFAIPVSSNKPSSEVEVE---DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ  2049
              D  + P+     S ++ +    D+ W LIPD ++KL AHQ+RAFEF+W+NIAGS+ P +
Sbjct  545   YDLESDPLGEAISSWDISLSEGCDDIWTLIPDFKSKLHAHQKRAFEFIWRNIAGSLKPEE  604

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
             ++ +S   GGCVISHSPG+GKTLLII+FLVSYLKLFP SRPLVLAPKT ++TW +E  KW
Sbjct  605   MNHQSGNTGGCVISHSPGSGKTLLIISFLVSYLKLFPRSRPLVLAPKTAVHTWCREFQKW  664

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR--NQDVMHVLDCLEKMQKWLAHPSVLLM  1695
             ++PIP+Y IH  Q Y  E+   K+++     R  N+ +MH++ C+EK++ W   PS+LLM
Sbjct  665   EVPIPLYLIHREQGYGKELSASKIRMFSIDARRPNRKMMHIMSCVEKLRMWHEEPSILLM  724

Query  1694  GYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRI  1515
              Y+SF ++ +EDS   +R++M  +L++ PG+LILDEGHNPRST S+LRK LMKV T  RI
Sbjct  725   NYSSFFSMAKEDSNLEYRRFMAGILQKSPGLLILDEGHNPRSTNSKLRKLLMKVKTEYRI  784

Query  1514  LLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPK-----YKKRVKGAKTRFSLENRAR  1350
             LLSGTLFQNNF EYFNTL LARPRF+ + + ELDP      + ++ K  K +   E  AR
Sbjct  785   LLSGTLFQNNFEEYFNTLSLARPRFIHDAISELDPYMVNIFHSRKHKREKKKNRKERLAR  844

Query  1349  KMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTL  1170
             K+F++K+ +KI+SS+E +RK+GL++L ++T+GF+DV+EG   + LPGLQ YTL++ ST L
Sbjct  845   KLFVEKVGQKIESSEEDDRKQGLDLLNRITSGFVDVHEGEILNRLPGLQIYTLLLSSTDL  904

Query  1169  QQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfd  990
             Q++IL KLQ+    +K  PLELE L+T+G+IHPWLI+T A    YF  +EL+ ++  K +
Sbjct  905   QRQILTKLQNS-VTHKRCPLELESLVTVGSIHPWLIKTIAGVDNYFSVDELKNVDALKEN  963

Query  989   lkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDI  810
                G KVKFV+ L+ +   + E+VLIFCHNI+P+NL ++ FE  +GW +  EVLVLQGD 
Sbjct  964   YMCGPKVKFVIDLVHKSTSKGERVLIFCHNISPMNLLVQYFELVFGWHREEEVLVLQGDQ  1023

Query  809   ELFERGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIAR  633
             EL  R ++MDKF  +V G SKV+LAS T CAEGISLTAASR+++LDSEWN SK++QAIAR
Sbjct  1024  ELSMRAKIMDKFNGDVKGKSKVLLASTTACAEGISLTAASRLVMLDSEWNHSKTRQAIAR  1083

Query  632   AFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDEL  453
             AFRPGQ++VVYVY LLA+GT EE KY+    K W+S MIF    +E  S  QA  I+DEL
Sbjct  1084  AFRPGQERVVYVYLLLASGTWEEGKYESNARKAWMSKMIFIGQYIEHGSSRQADDIDDEL  1143

Query  452   LGEIVEEDRATLFHMIMKNE  393
             L E+VEED+   F MI K++
Sbjct  1144  LRELVEEDQRKTFQMIKKHD  1163


 Score =   145 bits (367),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 166/312 (53%), Gaps = 36/312 (12%)
 Frame = -3

Query  4064  LIEEEISISNVRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPA  3885
             ++E++I    +R+RSR A+S DC+ FL+PG+D+ V S           ++E+E   P  +
Sbjct  1     MLEDKIHGDCLRMRSRKASSFDCSHFLKPGIDVCVLSA-----LPVATSSEEELQTPLLS  55

Query  3884  WIDAKIRSIERKPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQ  3705
             W DAKI SI++ PH   C C F ++   +  P  + + T  +  +VV ++ I ILQK++ 
Sbjct  56    WHDAKIISIKKAPHVNRCACLFSVAYCKSNSPTSMKRSTNERMAEVVTIDNITILQKLKN  115

Query  3704  KPCEDKYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEI  3525
             +PCE+ +Y+W+ ++DC +  K KL +  F S++SW+LV S  K++ FD++ + NRIVY I
Sbjct  116   EPCENGFYQWNSTEDCISSSKSKLLSDAFSSEISWLLVLSTLKRMDFDLRLMQNRIVYYI  175

Query  3524  L-------------KDENDIDAPNSEYHSYAVSFKLENEVSTPIIIQF------NPDIPE  3402
             L               ++D+ +P+S+     + F+  NE   P +  F         +PE
Sbjct  176   LYSDGKSSITDVQSDGDSDVVSPSSDKSIKVMCFQRLNEYLQPKVETFVLGTHKEMPVPE  235

Query  3401  RGPEGDVYEAGP------LVVYDE--LRRSKRRFVQPERYLGCDDYLT-EFDVEMTRLVG  3249
             R  E D  ++         ++YD   LR SKRR  QP+R+     Y +  FD    R V 
Sbjct  236   RTTEMDTNDSDADNDPDVEILYDHMNLRHSKRRKTQPDRF---SSYCSPNFDRCSIRNVT  292

Query  3248  GKMYKSELEELP  3213
              +M + E +E P
Sbjct  293   CEMNRMEQDETP  304



>ref|XP_010937951.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X1 [Elaeis guineensis]
Length=1211

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/800 (48%), Positives = 535/800 (67%), Gaps = 42/800 (5%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnne  2541
             S RK  +SA   + LI +C+ NI     +   P++ QW   + T   +  P  + + + +
Sbjct  430   SNRKKLLSAAECKHLIEKCIGNIKCETERNIEPVV-QWLTQKTTNFPEEPPYFRWTPSVD  488

Query  2540  eelseLDM--LWKEMELALASCYLL-----------DDTEDTNLKSATELHMATKKGTRV  2400
              +L   +   LWKEME +L +  LL           D + D++++   +L          
Sbjct  489   TQLENEEHEDLWKEMEQSLTTLALLEQNKVLDSKFLDGSTDSSMRDPEQLE---------  539

Query  2399  CHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDAD  2220
             CHHD+ L E+IG++CRLC  + TEI+ V PPF     S + KE+        +K G    
Sbjct  540   CHHDYTLKEDIGVICRLCNFICTEIRYVSPPF--GDYSVAWKEK-----FGVKKLGIMGL  592

Query  2219  LDHFAIPVSSNKPSSEVEVE---DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ  2049
              D  + P+     S ++ +    D+ W LIPD ++KL AHQ+RAFEF+W+NIAGS+ P +
Sbjct  593   YDLESDPLGEAISSWDISLSEGCDDIWTLIPDFKSKLHAHQKRAFEFIWRNIAGSLKPEE  652

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
             ++ +S   GGCVISHSPG+GKTLLII+FLVSYLKLFP SRPLVLAPKT ++TW +E  KW
Sbjct  653   MNHQSGNTGGCVISHSPGSGKTLLIISFLVSYLKLFPRSRPLVLAPKTAVHTWCREFQKW  712

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR--NQDVMHVLDCLEKMQKWLAHPSVLLM  1695
             ++PIP+Y IH  Q Y  E+   K+++     R  N+ +MH++ C+EK++ W   PS+LLM
Sbjct  713   EVPIPLYLIHREQGYGKELSASKIRMFSIDARRPNRKMMHIMSCVEKLRMWHEEPSILLM  772

Query  1694  GYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRI  1515
              Y+SF ++ +EDS   +R++M  +L++ PG+LILDEGHNPRST S+LRK LMKV T  RI
Sbjct  773   NYSSFFSMAKEDSNLEYRRFMAGILQKSPGLLILDEGHNPRSTNSKLRKLLMKVKTEYRI  832

Query  1514  LLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPK-----YKKRVKGAKTRFSLENRAR  1350
             LLSGTLFQNNF EYFNTL LARPRF+ + + ELDP      + ++ K  K +   E  AR
Sbjct  833   LLSGTLFQNNFEEYFNTLSLARPRFIHDAISELDPYMVNIFHSRKHKREKKKNRKERLAR  892

Query  1349  KMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTL  1170
             K+F++K+ +KI+SS+E +RK+GL++L ++T+GF+DV+EG   + LPGLQ YTL++ ST L
Sbjct  893   KLFVEKVGQKIESSEEDDRKQGLDLLNRITSGFVDVHEGEILNRLPGLQIYTLLLSSTDL  952

Query  1169  QQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfd  990
             Q++IL KLQ+    +K  PLELE L+T+G+IHPWLI+T A    YF  +EL+ ++  K +
Sbjct  953   QRQILTKLQNS-VTHKRCPLELESLVTVGSIHPWLIKTIAGVDNYFSVDELKNVDALKEN  1011

Query  989   lkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDI  810
                G KVKFV+ L+ +   + E+VLIFCHNI+P+NL ++ FE  +GW +  EVLVLQGD 
Sbjct  1012  YMCGPKVKFVIDLVHKSTSKGERVLIFCHNISPMNLLVQYFELVFGWHREEEVLVLQGDQ  1071

Query  809   ELFERGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIAR  633
             EL  R ++MDKF  +V G SKV+LAS T CAEGISLTAASR+++LDSEWN SK++QAIAR
Sbjct  1072  ELSMRAKIMDKFNGDVKGKSKVLLASTTACAEGISLTAASRLVMLDSEWNHSKTRQAIAR  1131

Query  632   AFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDEL  453
             AFRPGQ++VVYVY LLA+GT EE KY+    K W+S MIF    +E  S  QA  I+DEL
Sbjct  1132  AFRPGQERVVYVYLLLASGTWEEGKYESNARKAWMSKMIFIGQYIEHGSSRQADDIDDEL  1191

Query  452   LGEIVEEDRATLFHMIMKNE  393
             L E+VEED+   F MI K++
Sbjct  1192  LRELVEEDQRKTFQMIKKHD  1211


 Score =   180 bits (457),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/360 (33%), Positives = 191/360 (53%), Gaps = 36/360 (10%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             M +R   +  HP DV PFEAF +GSW   + + I+ G+  +     G ++E++I    +R
Sbjct  1     MLKRPPSRCSHPIDVTPFEAFYDGSWHGTKHVSIKTGSIFVQFNHGGSMLEDKIHGDCLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             +RSR A+S DC+ FL+PG+D+ V S           ++E+E   P  +W DAKI SI++ 
Sbjct  61    MRSRKASSFDCSHFLKPGIDVCVLSA-----LPVATSSEEELQTPLLSWHDAKIISIKKA  115

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
             PH   C C F ++   +  P  + + T  +  +VV ++ I ILQK++ +PCE+ +Y+W+ 
Sbjct  116   PHVNRCACLFSVAYCKSNSPTSMKRSTNERMAEVVTIDNITILQKLKNEPCENGFYQWNS  175

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEIL-----------  3522
             ++DC +  K KL +  F S++SW+LV S  K++ FD++ + NRIVY IL           
Sbjct  176   TEDCISSSKSKLLSDAFSSEISWLLVLSTLKRMDFDLRLMQNRIVYYILYSDGKSSITDV  235

Query  3521  --KDENDIDAPNSEYHSYAVSFKLENEVSTPIIIQF------NPDIPERGPEGDVYEAGP  3366
                 ++D+ +P+S+     + F+  NE   P +  F         +PER  E D  ++  
Sbjct  236   QSDGDSDVVSPSSDKSIKVMCFQRLNEYLQPKVETFVLGTHKEMPVPERTTEMDTNDSDA  295

Query  3365  ------LVVYDE--LRRSKRRFVQPERYLGCDDYLT-EFDVEMTRLVGGKMYKSELEELP  3213
                    ++YD   LR SKRR  QP+R+     Y +  FD    R V  +M + E +E P
Sbjct  296   DNDPDVEILYDHMNLRHSKRRKTQPDRF---SSYCSPNFDRCSIRNVTCEMNRMEQDETP  352



>ref|XP_008776285.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Phoenix 
dactylifera]
Length=1211

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/793 (49%), Positives = 523/793 (66%), Gaps = 28/793 (4%)
 Frame = -3

Query  2720  SFRKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnne  2541
             S RK  +SA   + LI +CM NI         P++ QW   + T   +  P  + + + +
Sbjct  430   STRKKLLSAAECKHLIEQCMGNIKCETEGNIEPVV-QWPTHKPTNFPEEPPYFRWTPSVD  488

Query  2540  eelseLDM--LWKEMELALASCYLLDDTE--DTNLKSATELHMATKKGTRVCHHDFRLNE  2373
              +    +   LWKEME +L +  LL+     D+     T            C HD+ L E
Sbjct  489   TQHQNQEHEDLWKEMEQSLTTLTLLEQKRVLDSKFLDGTTNSSMRDPEQPQCRHDYMLKE  548

Query  2372  EIGLVCRLCGVVSTEIKDVPPPF--MPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIP  2199
             +IG++CRLC  + TEI+ V PPF     TC         +E    +K G     D  + P
Sbjct  549   DIGVICRLCNFICTEIRYVSPPFGDYSVTC---------KEKFGVKKLGFLGLYDLESDP  599

Query  2198  VSSNKPSSEVEVE---DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK  2028
             +S    S ++ +    DN W LIPD R+KL  HQ+RAFEF+W+N+AGS+ P +++ +S K
Sbjct  600   LSKAISSWDISLSEGCDNIWTLIPDFRSKLHPHQKRAFEFIWRNVAGSLKPEEMNHQSGK  659

Query  2027  RGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVY  1848
              GGCVISHSPG+GKTLLII+FLVSYLKLFP SRPLVLAPKT ++TW +E  KW++ IP+Y
Sbjct  660   TGGCVISHSPGSGKTLLIISFLVSYLKLFPRSRPLVLAPKTAVHTWCREFQKWEVSIPLY  719

Query  1847  QIHGGQTYKGEVLRQKMKLCPGLPR--NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLT  1674
              IH  + Y  E+   K+++     R  N+ +M+++ CLEK++KW   PS+LLM Y+SF +
Sbjct  720   LIHREECYGKELSACKIRMFSIDARRPNRKMMYIMSCLEKLRKWHEEPSILLMNYSSFFS  779

Query  1673  LTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLF  1494
             + +EDS   +RK+M  VL++ PG+LILDEGHNPRST S+LRK LMKV T  RILLSGTLF
Sbjct  780   MAKEDSNVEYRKFMAGVLQKSPGLLILDEGHNPRSTNSKLRKLLMKVKTEYRILLSGTLF  839

Query  1493  QNNFGEYFNTLCLARPRFVDEVLKELDPK-----YKKRVKGAKTRFSLENRARKMFidki  1329
             QNNF EYFNTL LARP F+ + + ELDP      + ++ K  K     E  ARK+F++K+
Sbjct  840   QNNFEEYFNTLSLARPHFIHDAISELDPHMVNIFHSRKHKRGKKINREERLARKLFVEKV  899

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVK  1149
              +KI+SS+E +RK+GL++L ++T+ F+DV+EG  S+ LPGLQ YTL++ ST LQQ+IL K
Sbjct  900   GQKIESSEEDDRKQGLDLLNRITSRFVDVHEGEISNMLPGLQIYTLLLSSTDLQQQILTK  959

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             LQ+    +K  PLELE LIT+G+IHP LI+  A    YF  E+L+ ++  K +   G KV
Sbjct  960   LQNS-VTHKRCPLELESLITVGSIHPCLIKAIAGVDNYFSAEQLKNIDACKENYMCGPKV  1018

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             KFV+ L+ +   R E+VLIFCHNI+PINL +E FE  +GW +  EVLVL+GD EL  R +
Sbjct  1019  KFVIDLVHKSASRGERVLIFCHNISPINLLVEYFELVFGWHREEEVLVLRGDQELSTRAK  1078

Query  788   VMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
             +MDKF  +V G SKV+LAS T CAEGISLTAASR+++LDSEWN SK++QAIARAFRPGQ+
Sbjct  1079  IMDKFNGDVKGKSKVLLASTTACAEGISLTAASRLVMLDSEWNHSKTRQAIARAFRPGQE  1138

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEE  432
             +VVYVY LLA+GT EE KY+    K W+S MIF    +E  S  QA  I+DELL E+VEE
Sbjct  1139  RVVYVYLLLASGTWEEGKYESNARKGWMSKMIFIGQYIEYSSSRQADDIDDELLRELVEE  1198

Query  431   DRATLFHMIMKNE  393
             D+   F MI K++
Sbjct  1199  DQRKTFQMIKKHD  1211


 Score =   177 bits (449),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/354 (32%), Positives = 189/354 (53%), Gaps = 36/354 (10%)
 Frame = -3

Query  4178  HPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSD  3999
             HP D  PFEAF +GSW   + + I++G+  +     G ++E++I+   +R+RSR A+S D
Sbjct  11    HPIDATPFEAFYHGSWHGTQHVSIKSGSIFVQFNHGGSMLEDQITGDCLRMRSRKASSFD  70

Query  3998  CACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQF  3819
             C+ FL+ G+D+ V S           ++++E   P  +W DAKI SI+R PH   C C F
Sbjct  71    CSHFLKAGIDVCVLSA-----HPIATSSDEELQTPLLSWHDAKIISIKRTPHVNRCACLF  125

Query  3818  HISVYVTQGPPPIVKKTLSKEI-KVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQK  3642
              + +Y     P  +K++ ++ + +VV ++ IAILQK++ +PCE+  ++W+ ++DC +  K
Sbjct  126   SV-IYCKSNSPTSMKRSTNERVAEVVTIDNIAILQKLKNEPCENGCHQWNSTEDCISSSK  184

Query  3641  FKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEIL-------------KDENDID  3501
              KL    F S++SW+LV S  K++ FD+K V N+IVY IL               ++D+ 
Sbjct  185   SKLLNDAFSSEISWLLVLSTLKRMDFDLKLVQNKIVYYILYSDGRPSTTDVQSDGDSDVV  244

Query  3500  APNSEYHSYAVSFKLENEVSTPIIIQF------NPDIPERGPEGDVYEAGPL------VV  3357
             + +S+     + F+  NE   P +  F         +PER  E D+ ++         ++
Sbjct  245   SRSSDKSIKVICFQRCNEYLRPKVETFVLGTHKEMPVPERTIEMDINDSDADNDSDVEIL  304

Query  3356  YDE--LRRSKRRFVQPERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALS  3201
             YD   LR SKRR +QP+R+         FD    R V  +M + + +E P   S
Sbjct  305   YDHMNLRHSKRRKLQPDRFSSYSS--PNFDRCSMRNVTCEMNRMDQDETPTPYS  356



>ref|XP_004958789.1| PREDICTED: uncharacterized protein LOC101783851 [Setaria italica]
Length=1232

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/781 (46%), Positives = 505/781 (65%), Gaps = 19/781 (2%)
 Frame = -3

Query  2714  RKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIe-ksstnnee  2538
             RK  +    Y+E+I +C+ NI   + ++    +D      N  + Q        ST+++E
Sbjct  464   RKKHMREREYKEMIDQCIGNIQYEMERDSDFKLDVQIMNCNGHAYQEGDFTWPPSTDSQE  523

Query  2537  elseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLV  2358
             E  E + LWKEM+ ALAS  LL+  +  + ++  E +    KG   CHHD  L+E++GL 
Sbjct  524   EKDEFEELWKEMDYALASIALLEQKQMQDSEATRESNTDLGKGEH-CHHDCILDEQLGLT  582

Query  2357  CRLCGVVSTEIKDV-PPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
             CRLC VV TE KD+ PP F       SG+    +         DD  LD   + + + + 
Sbjct  583   CRLCNVVCTEAKDIFPPMFAGKDYERSGRSGFCQ---------DDHVLDSSFLEICAPE-  632

Query  2180  SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHS  2001
              S+ +   N WA I DL  KL AHQR+AFEF+WKN+AGS+   ++D  +  RGGCV++H+
Sbjct  633   FSKFKGSGNVWASITDLEPKLHAHQRKAFEFIWKNLAGSLQLEEMDDSTASRGGCVVAHT  692

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH---GGQ  1830
             PGAGKTLL+I+FLVSYLK+ P SRPLVL PK  ++TW +E   W I +P++ +H   G  
Sbjct  693   PGAGKTLLLISFLVSYLKVHPRSRPLVLTPKAAIHTWRREFETWGISLPLHVLHYSNGRG  752

Query  1829  TYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
                G +  +   +     + +  +M ++D L+K+ KW   PS+LLM Y SFL LT+ED+ 
Sbjct  753   KAMGTLSSKTQAILKNFHQPSLKMMRMMDSLDKLCKWHESPSILLMTYPSFLALTKEDTK  812

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
               HR +M +VL   PG+LILDEGHNPRS KS+LRK LMKV T  RILLSGT+FQNNF EY
Sbjct  813   LQHRAFMAKVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFRILLSGTVFQNNFEEY  872

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             FNTL LARPRFV +V+  L P+ ++  +  +T    E  AR++F++K+ +KI+SS   +R
Sbjct  873   FNTLSLARPRFVSDVMTALVPEAERETRN-RTGKHQEAVARRIFVEKVGQKIESSSMHDR  931

Query  1292  kEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
              +G+++L KLT GFID++EG   +NLPG++ YTL MK T +Q+E+L K+    P    +P
Sbjct  932   VDGISLLNKLTCGFIDIFEGTKENNLPGIRVYTLFMKPTDIQEEVLAKVTMPVPGIARYP  991

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
             LE+ELLIT+ +IHPWLI+TT C+  YF  +E+  +EK+K    +G K KFV+ L+ +   
Sbjct  992   LEVELLITIASIHPWLIKTTKCASTYFTPKEVARVEKYKQKYTVGCKTKFVIDLLHKSSF  1051

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE-EVGGP  756
             R E+VLIFCHN++PIN  +++ E  +GWR G EVLVLQGD EL  R  VMDKF  +  G 
Sbjct  1052  RGERVLIFCHNVSPINFLVKLIEIVFGWRLGEEVLVLQGDQELPVRSDVMDKFNGDRKGK  1111

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
              KV++AS T CAEGISLT ASR+++LDSEWN SK+ QAIARAFRPGQ+++VYVY L+A+G
Sbjct  1112  RKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTMQAIARAFRPGQERMVYVYLLVASG  1171

Query  575   TLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKN  396
             T EE+KY     K  ++ M+F    V++P      +I+DE+L E+ +ED+   FH ++K 
Sbjct  1172  TWEEDKYNSNRRKARIAKMVFLGRYVDEPLQNNVTEIDDEVLKELADEDQTKAFHKVVKQ  1231

Query  395   E  393
             +
Sbjct  1232  D  1232


 Score =   140 bits (354),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 101/329 (31%), Positives = 154/329 (47%), Gaps = 40/329 (12%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             +K  + H N HP    PFEAF NGSW  V  IRI+NG+  +  +  G  +E  I    +R
Sbjct  2     IKGTAGHHN-HPIGAVPFEAFHNGSWHGVNSIRIRNGSLFVKFVHSGSAVEHNIDGDYLR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             + SR AT  DC+  LRPG D+ V     + E               P + DA++  I++K
Sbjct  61    LHSRKATCLDCSHVLRPGADVCVKQASSREETKSSV----------PLYRDARLIKIKKK  110

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSL  3669
              H   C+C F +  Y  Q P    K T     KVV    + ILQK+     +D   +WS 
Sbjct  111   HHTDHCLCLFTVIFYKDQCPGSKGKVTTGTIAKVVTAGDVFILQKLHSGELQDGSVQWSS  170

Query  3668  SDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILK-------DEN  3510
             ++DC    + KL + +F ++++ ++V S+ + + F++K V  +I+Y+I+K       D++
Sbjct  171   AEDCLHHNRSKLLSARFSTEVTHLVVLSSLRGMEFNIKVVEGKIIYQIIKGDQERYSDDS  230

Query  3509  DIDAPNSEYHSYAVSFKLENEVSTPIII----------QFNPD-----IPERGPEGDVYE  3375
                 P        +SFK  +E   P II           F  D     + E     DV  
Sbjct  231   MSIPPGFGKSMDIISFKPRDEALRPRIITVQVTQVKKHNFTEDMCTTVMDELDSAQDVE-  289

Query  3374  AGPLVVYD--ELRRSKRRFVQPERYLGCD  3294
                 V+Y+  +LRRSKR   QP+R+   D
Sbjct  290   ----VLYEHVDLRRSKRMKTQPDRFTCYD  314



>tpg|DAA64243.1| TPA: hypothetical protein ZEAMMB73_472688 [Zea mays]
 gb|AIB04640.1| SNF2 transcription factor, partial [Zea mays]
Length=1179

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/720 (48%), Positives = 472/720 (66%), Gaps = 26/720 (4%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LWKEM+ ALA+  +L+  + T+ +   E +    KG   CHHD  L+E++GL CRLC 
Sbjct  476   DELWKEMDYALATVAILEQKQMTDSEVVHESNTDLGKGGEHCHHDCMLDEQLGLTCRLCN  535

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
             VV  E KD+ PP        +GK+    E     + G   DL  F I        S+++ 
Sbjct  536   VVCIEAKDIFPPMF------TGKDHERPERNHFGQDGHVLDLSFFEICAPE---FSKIKE  586

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
               N WA I DL  KL AHQR+AFEF+WKN+AGS+   ++D  S  RGGCV++H+PGAGKT
Sbjct  587   SGNVWASITDLEPKLLAHQRKAFEFIWKNLAGSLQLEEMDG-STSRGGCVVAHTPGAGKT  645

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH---------GGQ  1830
             LL+I+FLVSYLK+ P SRPLVL PK  ++TW  E  KW I +P++ +H         GG 
Sbjct  646   LLLISFLVSYLKVHPRSRPLVLTPKAAIHTWRTEFQKWGILLPLHVLHHSNRTSKLMGGL  705

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
             + K + + +          +   M ++ CL+K+ KW   PS+LLM Y+SFL+LT+EDS  
Sbjct  706   SSKLQAVLKSFH-----QPSWKTMRIMHCLDKLCKWHEEPSILLMTYSSFLSLTKEDSKL  760

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
              H+ ++ +VL   PG+LILDEGHNPRS KS+LRK LMKV T  RILLSGT+FQNNF EYF
Sbjct  761   RHQAFITKVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFRILLSGTVFQNNFEEYF  820

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NTL LARPRFV++V+  L  + +KR + ++T    E  AR +F++++  KI+SS + +R 
Sbjct  821   NTLSLARPRFVNDVMTTLVTESEKRTR-SRTGKHQEALARHVFVERVGHKIESSSKHDRM  879

Query  1289  EGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
             +G+++L +LT GFID +EG   + LPG++ YTL MK T +Q+E+L KL         +PL
Sbjct  880   DGISLLNELTQGFIDSFEGTKLNILPGIRVYTLFMKPTDVQEEVLAKLLMPLSGNARYPL  939

Query  1109  ELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
             E ELLIT+ +IHPWLI TT C+  YF   E+ +++K+K +   G K KFV+ L+ +   R
Sbjct  940   EYELLITIASIHPWLINTTKCASTYFTPAEVASVDKYKRNFAAGCKAKFVIDLLHKSSFR  999

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE-EVGGPS  753
              E+VL+FCHN+API   + + E  +GWR G EVLVLQGD EL  R  VMDKF  +  G  
Sbjct  1000  GERVLVFCHNVAPIAFLVTLIEIVFGWRLGQEVLVLQGDQELHVRSDVMDKFNSDRRGKR  1059

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIARAFRPGQ+++V+VY L+A+GT
Sbjct  1060  KVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRPGQERMVFVYLLVASGT  1119

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNE  393
              EE+KY     K W++ M+F     +DP   +  +I+DE+L E+ +ED    FHMI+K +
Sbjct  1120  WEEDKYNSNRRKAWIAKMVFFGRHFDDPLQNRVTEIDDEVLKELADEDETNTFHMIVKQD  1179


 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 135/292 (46%), Gaps = 36/292 (12%)
 Frame = -3

Query  4100  GTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdee  3921
             G+ G H      +++ +I  S +R+RSR AT SDC+  L+PG D+ V+   ++ E  D  
Sbjct  4     GSTGHHSNPIAPVLQHDIDGSYLRVRSRKATCSDCSHVLKPGADVCVWQAVYRGETKDSV  63

Query  3920  nnedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQ  3741
                           DA++  I+R      C+C F +  Y  Q P    K        VV 
Sbjct  64    LLCCR---------DARLIKIKRNHQSDRCLCLFAVIFYKDQCPGSKEKVISGTIADVVT  114

Query  3740  LNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFD  3561
             ++ I ILQ ++ +  +D   RW+ + DC    + KL + +F  ++++++V S+ +++ F+
Sbjct  115   IDDICILQNLQPEELQDGSVRWNSAVDCFHHNRSKLLSARFSLEVAYLIVLSSLRRMEFN  174

Query  3560  VKSVHNRIVYEILKDENDIDA-------PNSEYHSYAVSFKLENEVSTPIIIQFNPDIP-  3405
             +K V   I+Y+I+K +   D+       P    +   +SFK   E   PI       +P 
Sbjct  175   IKMVDGNIIYQIIKGDQARDSIDSMSIPPGFGKNMDIISFKPRGEALRPI----TRTVPV  230

Query  3404  ERGPEGDVYEAGPLVVYDE---------------LRRSKRRFVQPERYLGCD  3294
              +  EG++ E G + V  E               +RRSKR   QP+R+   D
Sbjct  231   TQVEEGNLTEDGCIAVKGESDSAQDVEILYAHVDIRRSKRMKTQPDRFTSYD  282



>ref|XP_008653528.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 isoform X1 
[Zea mays]
Length=1241

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/720 (48%), Positives = 472/720 (66%), Gaps = 26/720 (4%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LWKEM+ ALA+  +L+  + T+ +   E +    KG   CHHD  L+E++GL CRLC 
Sbjct  538   DELWKEMDYALATVAILEQKQMTDSEVVHESNTDLGKGGEHCHHDCMLDEQLGLTCRLCN  597

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
             VV  E KD+ PP        +GK+    E     + G   DL  F I        S+++ 
Sbjct  598   VVCIEAKDIFPPMF------TGKDHERPERNHFGQDGHVLDLSFFEICAPE---FSKIKE  648

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
               N WA I DL  KL AHQR+AFEF+WKN+AGS+   ++D  S  RGGCV++H+PGAGKT
Sbjct  649   SGNVWASITDLEPKLLAHQRKAFEFIWKNLAGSLQLEEMDG-STSRGGCVVAHTPGAGKT  707

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH---------GGQ  1830
             LL+I+FLVSYLK+ P SRPLVL PK  ++TW  E  KW I +P++ +H         GG 
Sbjct  708   LLLISFLVSYLKVHPRSRPLVLTPKAAIHTWRTEFQKWGILLPLHVLHHSNRTSKLMGGL  767

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
             + K + + +          +   M ++ CL+K+ KW   PS+LLM Y+SFL+LT+EDS  
Sbjct  768   SSKLQAVLKSFH-----QPSWKTMRIMHCLDKLCKWHEEPSILLMTYSSFLSLTKEDSKL  822

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
              H+ ++ +VL   PG+LILDEGHNPRS KS+LRK LMKV T  RILLSGT+FQNNF EYF
Sbjct  823   RHQAFITKVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFRILLSGTVFQNNFEEYF  882

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NTL LARPRFV++V+  L  + +KR + ++T    E  AR +F++++  KI+SS + +R 
Sbjct  883   NTLSLARPRFVNDVMTTLVTESEKRTR-SRTGKHQEALARHVFVERVGHKIESSSKHDRM  941

Query  1289  EGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
             +G+++L +LT GFID +EG   + LPG++ YTL MK T +Q+E+L KL         +PL
Sbjct  942   DGISLLNELTQGFIDSFEGTKLNILPGIRVYTLFMKPTDVQEEVLAKLLMPLSGNARYPL  1001

Query  1109  ELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
             E ELLIT+ +IHPWLI TT C+  YF   E+ +++K+K +   G K KFV+ L+ +   R
Sbjct  1002  EYELLITIASIHPWLINTTKCASTYFTPAEVASVDKYKRNFAAGCKAKFVIDLLHKSSFR  1061

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE-EVGGPS  753
              E+VL+FCHN+API   + + E  +GWR G EVLVLQGD EL  R  VMDKF  +  G  
Sbjct  1062  GERVLVFCHNVAPIAFLVTLIEIVFGWRLGQEVLVLQGDQELHVRSDVMDKFNSDRRGKR  1121

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIARAFRPGQ+++V+VY L+A+GT
Sbjct  1122  KVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRPGQERMVFVYLLVASGT  1181

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNE  393
              EE+KY     K W++ M+F     +DP   +  +I+DE+L E+ +ED    FHMI+K +
Sbjct  1182  WEEDKYNSNRRKAWIAKMVFFGRHFDDPLQNRVTEIDDEVLKELADEDETNTFHMIVKQD  1241


 Score =   125 bits (313),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 92/330 (28%), Positives = 153/330 (46%), Gaps = 38/330 (12%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLI--EEEISISN  4035
             M + S   + +P    PFEAF NGSW     I I++G   +  +  G  +  + +I  S 
Sbjct  28    MVKGSTGHHSNPIAPVPFEAFHNGSWHGANSIMIRDGGLLVKFVSSGYAVAVQHDIDGSY  87

Query  4034  VRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIE  3855
             +R+RSR AT SDC+  L+PG D+ V+   ++ E  D                DA++  I+
Sbjct  88    LRVRSRKATCSDCSHVLKPGADVCVWQAVYRGETKDSVLLCCR---------DARLIKIK  138

Query  3854  RKPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRW  3675
             R      C+C F +  Y  Q P    K        VV ++ I ILQ ++ +  +D   RW
Sbjct  139   RNHQSDRCLCLFAVIFYKDQCPGSKEKVISGTIADVVTIDDICILQNLQPEELQDGSVRW  198

Query  3674  SLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDA-  3498
             + + DC    + KL + +F  ++++++V S+ +++ F++K V   I+Y+I+K +   D+ 
Sbjct  199   NSAVDCFHHNRSKLLSARFSLEVAYLIVLSSLRRMEFNIKMVDGNIIYQIIKGDQARDSI  258

Query  3497  ------PNSEYHSYAVSFKLENEVSTPIIIQFNPDIP-ERGPEGDVYEAGPLVVYDE---  3348
                   P    +   +SFK   E   PI       +P  +  EG++ E G + V  E   
Sbjct  259   DSMSIPPGFGKNMDIISFKPRGEALRPI----TRTVPVTQVEEGNLTEDGCIAVKGESDS  314

Query  3347  ------------LRRSKRRFVQPERYLGCD  3294
                         +RRSKR   QP+R+   D
Sbjct  315   AQDVEILYAHVDIRRSKRMKTQPDRFTSYD  344



>ref|XP_008653529.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 isoform X2 
[Zea mays]
 ref|XP_008653530.1| PREDICTED: SNF2 domain-containing protein CLASSY 1 isoform X2 
[Zea mays]
Length=1214

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/720 (48%), Positives = 472/720 (66%), Gaps = 26/720 (4%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LWKEM+ ALA+  +L+  + T+ +   E +    KG   CHHD  L+E++GL CRLC 
Sbjct  511   DELWKEMDYALATVAILEQKQMTDSEVVHESNTDLGKGGEHCHHDCMLDEQLGLTCRLCN  570

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
             VV  E KD+ PP        +GK+    E     + G   DL  F I        S+++ 
Sbjct  571   VVCIEAKDIFPPMF------TGKDHERPERNHFGQDGHVLDLSFFEICAPE---FSKIKE  621

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
               N WA I DL  KL AHQR+AFEF+WKN+AGS+   ++D  S  RGGCV++H+PGAGKT
Sbjct  622   SGNVWASITDLEPKLLAHQRKAFEFIWKNLAGSLQLEEMDG-STSRGGCVVAHTPGAGKT  680

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH---------GGQ  1830
             LL+I+FLVSYLK+ P SRPLVL PK  ++TW  E  KW I +P++ +H         GG 
Sbjct  681   LLLISFLVSYLKVHPRSRPLVLTPKAAIHTWRTEFQKWGILLPLHVLHHSNRTSKLMGGL  740

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
             + K + + +          +   M ++ CL+K+ KW   PS+LLM Y+SFL+LT+EDS  
Sbjct  741   SSKLQAVLKSFH-----QPSWKTMRIMHCLDKLCKWHEEPSILLMTYSSFLSLTKEDSKL  795

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
              H+ ++ +VL   PG+LILDEGHNPRS KS+LRK LMKV T  RILLSGT+FQNNF EYF
Sbjct  796   RHQAFITKVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFRILLSGTVFQNNFEEYF  855

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NTL LARPRFV++V+  L  + +KR + ++T    E  AR +F++++  KI+SS + +R 
Sbjct  856   NTLSLARPRFVNDVMTTLVTESEKRTR-SRTGKHQEALARHVFVERVGHKIESSSKHDRM  914

Query  1289  EGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
             +G+++L +LT GFID +EG   + LPG++ YTL MK T +Q+E+L KL         +PL
Sbjct  915   DGISLLNELTQGFIDSFEGTKLNILPGIRVYTLFMKPTDVQEEVLAKLLMPLSGNARYPL  974

Query  1109  ELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
             E ELLIT+ +IHPWLI TT C+  YF   E+ +++K+K +   G K KFV+ L+ +   R
Sbjct  975   EYELLITIASIHPWLINTTKCASTYFTPAEVASVDKYKRNFAAGCKAKFVIDLLHKSSFR  1034

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE-EVGGPS  753
              E+VL+FCHN+API   + + E  +GWR G EVLVLQGD EL  R  VMDKF  +  G  
Sbjct  1035  GERVLVFCHNVAPIAFLVTLIEIVFGWRLGQEVLVLQGDQELHVRSDVMDKFNSDRRGKR  1094

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIARAFRPGQ+++V+VY L+A+GT
Sbjct  1095  KVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRPGQERMVFVYLLVASGT  1154

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNE  393
              EE+KY     K W++ M+F     +DP   +  +I+DE+L E+ +ED    FHMI+K +
Sbjct  1155  WEEDKYNSNRRKAWIAKMVFFGRHFDDPLQNRVTEIDDEVLKELADEDETNTFHMIVKQD  1214


 Score =   125 bits (313),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 92/330 (28%), Positives = 153/330 (46%), Gaps = 38/330 (12%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLI--EEEISISN  4035
             M + S   + +P    PFEAF NGSW     I I++G   +  +  G  +  + +I  S 
Sbjct  1     MVKGSTGHHSNPIAPVPFEAFHNGSWHGANSIMIRDGGLLVKFVSSGYAVAVQHDIDGSY  60

Query  4034  VRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIE  3855
             +R+RSR AT SDC+  L+PG D+ V+   ++ E  D                DA++  I+
Sbjct  61    LRVRSRKATCSDCSHVLKPGADVCVWQAVYRGETKDSVLLCCR---------DARLIKIK  111

Query  3854  RKPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRW  3675
             R      C+C F +  Y  Q P    K        VV ++ I ILQ ++ +  +D   RW
Sbjct  112   RNHQSDRCLCLFAVIFYKDQCPGSKEKVISGTIADVVTIDDICILQNLQPEELQDGSVRW  171

Query  3674  SLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDA-  3498
             + + DC    + KL + +F  ++++++V S+ +++ F++K V   I+Y+I+K +   D+ 
Sbjct  172   NSAVDCFHHNRSKLLSARFSLEVAYLIVLSSLRRMEFNIKMVDGNIIYQIIKGDQARDSI  231

Query  3497  ------PNSEYHSYAVSFKLENEVSTPIIIQFNPDIP-ERGPEGDVYEAGPLVVYDE---  3348
                   P    +   +SFK   E   PI       +P  +  EG++ E G + V  E   
Sbjct  232   DSMSIPPGFGKNMDIISFKPRGEALRPI----TRTVPVTQVEEGNLTEDGCIAVKGESDS  287

Query  3347  ------------LRRSKRRFVQPERYLGCD  3294
                         +RRSKR   QP+R+   D
Sbjct  288   AQDVEILYAHVDIRRSKRMKTQPDRFTSYD  317



>ref|XP_002461267.1| hypothetical protein SORBIDRAFT_02g043870 [Sorghum bicolor]
 gb|EER97788.1| hypothetical protein SORBIDRAFT_02g043870 [Sorghum bicolor]
Length=1205

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/796 (45%), Positives = 503/796 (63%), Gaps = 41/796 (5%)
 Frame = -3

Query  2714  RKGSISANVYRELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIe-ksstnnee  2538
             RK  +    Y+ +I +C+ NI   + ++    ID         + Q E     SS +++E
Sbjct  429   RKKGMCQREYKRMIEQCIGNIQCEVERDSDFKIDAQILNGCGHAYQEEDFMWPSSADSQE  488

Query  2537  elseLDMLWKEMELALASCYLLD--------DTEDTNLKSATELHMATKKGTRVCHHDFR  2382
             E  EL  LWKEM+ ALA+  + +        D + T+ ++  E +    K    CHHD  
Sbjct  489   EKDELQELWKEMDYALATVAIDEQKQLIKCLDFQTTDSEADHESNTDLGKRGEHCHHDCM  548

Query  2381  LNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAI  2202
             L+E++GL CRLC VV TE KD+ PP        +GK+ +  E     +     DL  F I
Sbjct  549   LDEQLGLTCRLCNVVCTEAKDIFPPMF------TGKDHKRLEQSHFGQDDHVLDLSFFEI  602

Query  2201  PVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRG  2022
                 +  S E     N W+ IP L  KL AHQR+AFEF+WKN+AGS+   ++D +S  RG
Sbjct  603   CAPESSKSKE---SGNVWSSIPVLEPKLLAHQRKAFEFIWKNLAGSLQLEEMD-DSTSRG  658

Query  2021  GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQI  1842
             GCV++H+PGAGKTLL+I+FLVSYLK+ P SRPLVL PK  ++TW +E  KW I +P++ +
Sbjct  659   GCVVAHTPGAGKTLLLISFLVSYLKVHPRSRPLVLTPKAAIHTWRREFQKWGILLPLHVL  718

Query  1841  HGGQTYKGEVLRQKMKLCPGLPRNQDV------------MHVLDCLEKMQKWLAHPSVLL  1698
             H           +  KL  GL     V            M ++DCL+K+ KW   PS+LL
Sbjct  719   HHSN--------RTSKLMRGLSSKLQVVLKNFHQPTWKTMRIMDCLDKLCKWHEEPSILL  770

Query  1697  MGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLR  1518
             M Y+SFL+LT+EDS   H++++ +VL   PG+LILDEGHNPRS KS+LRK LMKV T  R
Sbjct  771   MTYSSFLSLTKEDSKLHHQEFITKVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFR  830

Query  1517  ILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFi  1338
             ILLSGT+FQNNF EYFNTL LARPRFV++V+  L P+ +K+ + ++T    E  AR++F+
Sbjct  831   ILLSGTVFQNNFEEYFNTLSLARPRFVNDVMTTLVPESEKKTR-SRTGKHQEALARRIFV  889

Query  1337  dkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEI  1158
             +++ +KI+SS + +R +G+++L  LT GFID +EG   + LPG+  YTL MK T +Q+E+
Sbjct  890   ERVGQKIESSSKHDRMDGISLLNDLTHGFIDSFEGTKLNILPGIHVYTLFMKPTDVQEEV  949

Query  1157  LVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLG  978
             L KL         + LE+ELLIT+ +IHPWLI TT C+  YF   E+  + K+K +  +G
Sbjct  950   LAKLSMPLADNARYLLEIELLITIASIHPWLINTTRCASTYFTPAEVARVGKYKRNFAVG  1009

Query  977   SKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFE  798
              K KFV+ L+ +   R E+VLIFCHN+API   +++ E  +GWR G EVLVLQGD EL  
Sbjct  1010  CKAKFVIDLLHKSSFRGERVLIFCHNVAPITFLVKLIEIVFGWRLGQEVLVLQGDQELPV  1069

Query  797   RGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRP  621
             R  VMDKF  +  G  KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIARAFRP
Sbjct  1070  RSDVMDKFNSDREGKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRP  1129

Query  620   GQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEI  441
             GQ+++V+VY L+A+GT EE+KY     K W++ M+F     +DP   +  +I+DE+L E+
Sbjct  1130  GQERMVFVYLLVASGTWEEDKYNSNRRKAWIAKMVFFGRYFDDPMQNRVTEIDDEVLKEL  1189

Query  440   VEEDRATLFHMIMKNE  393
              +ED    FHMI+K +
Sbjct  1190  ADEDETNTFHMIVKQD  1205


 Score =   102 bits (253),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 136/288 (47%), Gaps = 29/288 (10%)
 Frame = -3

Query  4100  GTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdee  3921
             G+ G H    G +++ +I  S +RIRSR AT SDC+  L+PG D+ V+   +  E     
Sbjct  4     GSTGHHNNPIGSVLQHDIDGSYLRIRSRKATCSDCSHVLKPGADVCVWQATYGGETK---  60

Query  3920  nnedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQ  3741
                    +  P   DA++  I+R      C+C F +  Y  Q P    K        VV 
Sbjct  61    -------DSVPLCRDARLIKIKRNHQLDRCLCLFAVIFYKDQCPGSKEKVISGTIADVVT  113

Query  3740  LNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFD  3561
             ++ + ILQ ++ +  +D   +W+ + DC    + KL + +F  ++++++V S+ + + F 
Sbjct  114   IDDVCILQNLQSEELQDGSVQWNSAVDCFHHNRSKLLSARFSLEVAYLIVLSSLRGMEFS  173

Query  3560  VKSVHNRIVYEILKDEN---DIDA----PNSEYHSYAVSFKLENEVSTPI-----IIQFN  3417
             +K V   I+Y+I+K +     ID+    P        +SFK   E   PI     I Q  
Sbjct  174   IKLVDGNIIYQIIKGDQARYSIDSMSIPPGFGKSMDIISFKPRAEALRPIIRTVLITQVK  233

Query  3416  PD-IPERGPEGDVYEAGPL----VVYD--ELRRSKRRFVQPERYLGCD  3294
              D + E G     +E+       V+Y+  ++RRSKR   QP+R+   D
Sbjct  234   EDNLIEDGCTAVKHESDSAQDVEVLYEHVDIRRSKRMKTQPDRFTSYD  281



>ref|XP_010229549.1| PREDICTED: SNF2 domain-containing protein CLASSY 1-like [Brachypodium 
distachyon]
Length=1245

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/724 (48%), Positives = 477/724 (66%), Gaps = 29/724 (4%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL----LDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             D LWKEM+ +L +  L    + D+ED +  +A       K G   C+HD  L+EE+GL+C
Sbjct  537   DELWKEMDFSLTTLELDRMQVPDSEDVHESTAR----LGKNGEIPCYHDCILDEELGLMC  592

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSG-KEQRP--EEVVMEEKQGDDADLDHFAIPVSSNK  2184
             RLC VV  E KD+     P   + +G  + RP       ++   D + L  FA   S  +
Sbjct  593   RLCNVVCIEAKDI----FPQMFNGNGYNKDRPGCSNFFHDDHVLDPSLLATFAPEFSEPR  648

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID-PESKKRGGCVIS  2007
              S       N W+LIPDL  KL  HQ+ AFEF+WKN+AGS+   ++D P +   GGCV++
Sbjct  649   GSG------NLWSLIPDLEPKLLPHQKEAFEFIWKNLAGSLQLEEMDNPTASSTGGCVVA  702

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQT  1827
             H+PG+GKTLL+I+FLVSYLK+ P SRPL+LAPK+ ++TW +E  KW I +P++ +H   +
Sbjct  703   HTPGSGKTLLLISFLVSYLKVHPRSRPLILAPKSAIHTWKREFEKWGISLPLHVLHHADS  762

Query  1826  YK---GEVLRQKMKLCPGLPRNQ-DVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
                  G +  +  ++     R+    M  +DC++K+ KW A PSVLLM Y+SFL LTRE 
Sbjct  763   RGRSMGAIDPRMQEILSKFHRSSWKNMRFVDCMDKLCKWHASPSVLLMTYSSFLGLTREG  822

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S    R  M QVL   PG+L+LDEGHNPRS KS+LRK LMKV T  RILLSGT+FQNNF 
Sbjct  823   SRMQQRASMVQVLINNPGLLVLDEGHNPRSNKSKLRKMLMKVKTEYRILLSGTVFQNNFE  882

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             EYFNTL LARPRFVD+V+  L  + KK ++G + +   E  AR++F++++++K++SS  R
Sbjct  883   EYFNTLSLARPRFVDDVMAALVMERKKEMRGRRAKHR-EAVARRIFVERVAQKMESSSSR  941

Query  1298  erkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
             +R +GLN+L KLT GFID +EG    NLPG+  YT+ MK   +Q+EIL K+         
Sbjct  942   DRIDGLNLLNKLTCGFIDSFEGAKLSNLPGIHVYTVFMKPGKIQEEILAKVSMSTSCTGR  1001

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
             +PLE+ELLIT+G+IHPWLI+TT C+  +F   EL+ ++K+K D   G K KFV+ L+ +C
Sbjct  1002  YPLEIELLITVGSIHPWLIKTTNCASTFFTSAELDKVDKYKKDFAAGCKAKFVIDLLHKC  1061

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG-  762
               R E+VLIFCHN++PIN  +++ E  +GWR G EVLVLQGD +L  R  VMDKF   G 
Sbjct  1062  SFRGERVLIFCHNVSPINFLVKLIENVFGWRLGEEVLVLQGDQDLPVRSDVMDKFNSDGE  1121

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
             G  KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIAR FRPGQ++ VYVY L+A
Sbjct  1122  GKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARVFRPGQERTVYVYLLVA  1181

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDE-LLGEIVEEDRATLFHMI  405
             +GT EE KY R   K W+S M+F    ++ P       ++D+ +L E+V+ED+   FHMI
Sbjct  1182  SGTWEEGKYNRNRRKAWMSKMVFFGRYLDYPLQNAVTAVDDDGVLKELVDEDKTNTFHMI  1241

Query  404   MKNE  393
             +K +
Sbjct  1242  VKQD  1245


 Score =   126 bits (317),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 94/325 (29%), Positives = 157/325 (48%), Gaps = 39/325 (12%)
 Frame = -3

Query  4178  HPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSD  3999
             HP    PFEAF +GSW  V  IR+QN    +  +  G  +E  I   ++R+RSR AT  D
Sbjct  15    HPICATPFEAFHHGSWHGVNCIRVQNSRLFVRFVYSGSTVERNIDRDHLRLRSRRATCFD  74

Query  3998  CACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQF  3819
             C+  L+PG+D+ V  +PH      +  +  ++        DA+I +I+R  +   C+C F
Sbjct  75    CSHVLKPGVDVCV-QSPHP----LQACSTGDQKSSISLCHDARIVTIKRNHNADQCLCLF  129

Query  3818  HISVYVTQGPPPIVK--KTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQ  3645
              + +  +Q P    K  K   +  +VV LN I +LQK++ K  ++   +W+ ++DC    
Sbjct  130   LVILDDSQCPGNTEKGGKATDRRQEVVTLNNIFLLQKLQPKELQEGSVQWNSAEDCLYQN  189

Query  3644  KFKLFT-GKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN---DIDA----PNS  3489
             + +L +  +F S++S ++V SA + + F +K V   I+Y ++K +     +D     P  
Sbjct  190   RSRLLSAARFSSEISHLIVLSALRGMEFSIKLVEGNIIYRVIKGDQARRGVDCMSIPPGF  249

Query  3488  EYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEG--------------------DVYEAG  3369
               +   VSF+L ++   P I     +IP    +                     D ++ G
Sbjct  250   GRNMEIVSFQLHDKNLRPTI----RNIPVTHAKKHNLTEDNRVAVKIELDDQLEDQFDVG  305

Query  3368  PLVVYDELRRSKRRFVQPERYLGCD  3294
              L  + +LRRSKR   QPER+   D
Sbjct  306   LLYKHVDLRRSKRLKTQPERFTSYD  330



>ref|XP_011004020.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like isoform 
X3 [Populus euphratica]
Length=1149

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/721 (51%), Positives = 477/721 (66%), Gaps = 51/721 (7%)
 Frame = -3

Query  3044  LAIVPLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKKSSLN--  2871
             LAIVP+        F+Q ++P+  +  E  S    E    Y Y   SS    +K+ L+  
Sbjct  465   LAIVPVHTEDVLVTFEQFDSPV--KTPEHYSQAFIEFPISY-YRKTSSPAAHRKNDLDED  521

Query  2870  LMQGRRWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRSFRKGSISAN  2691
             LM G  WG       KF    V+             R+   ++D+     ++++ ++SA 
Sbjct  522   LMFGNGWGG------KFSTKKVQRARY---------RSTHLKQDNSCAPMTYKRTALSAG  566

Query  2690  VYRELIRRCMANIDETL-NKEQPPIIDQWKEFQNTKSC-QREPIeksstnneeelseLDM  2517
              Y +LI   M  ID T+ +KE P IIDQW+EF+   S  Q+E +E SS  ++ E SE +M
Sbjct  567   AYNKLISSYMKKIDATIKSKEVPRIIDQWEEFKAKHSSDQKEKMEPSSVKDDGESSETEM  626

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             LW+EMEL LAS Y+L+D E           ++T+   + C H+F+L+EEIG++C++CG V
Sbjct  627   LWREMELCLASAYILEDNEAL---------LSTQTTQKNCQHEFKLDEEIGILCQICGFV  677

Query  2336  STEIKDVPPPFMPS---TCSSSGKEQRPEEVVMEEKQGDDADLDHFA---IPVSSNKPSS  2175
              TEIK V  PFM     T  S  + +   EV  +E +G     +H +   +PVS      
Sbjct  678   KTEIKYVSAPFMEHKGWTAESKPQNEEDSEVKTDEDEGSSLFGNHTSGEDVPVS------  731

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPG  1995
               EV DN W LIP+LR KL  HQ++AFEFLWKN AGS++P  ++  SKK GGCV+SH+PG
Sbjct  732   --EVNDNVWDLIPELRPKLHMHQKKAFEFLWKNTAGSLVPAHMEKTSKKIGGCVVSHTPG  789

Query  1994  AGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE  1815
             AGKT LIIAFLVSYLKLFPG RPLVLAPKTTLYTWYKE IKW+IP+PV+ I+G  T    
Sbjct  790   AGKTFLIIAFLVSYLKLFPGKRPLVLAPKTTLYTWYKEFIKWEIPVPVHLING--TRSSR  847

Query  1814  VLRQKMKLCPGL-PR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHR  1641
             V +Q   +  G  PR +QDV+H+LDCLEKMQKW AHPSVL+MGY SFLTL REDS Y HR
Sbjct  848   VFKQTPAVLRGSGPRPSQDVVHILDCLEKMQKWHAHPSVLVMGYPSFLTLMREDSKYNHR  907

Query  1640  KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTL  1461
             KYM +VLR+ PG+LILDEGHNPRSTKSRLRK LMKV T LRILLSGTLFQNNF EYFNTL
Sbjct  908   KYMAKVLRESPGMLILDEGHNPRSTKSRLRKVLMKVETDLRILLSGTLFQNNFCEYFNTL  967

Query  1460  CLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskererkEG  1284
              LARP F+ EVLK LDPK+K++ KGA K R  LE+RARK FID I+ KI+S +  E+ +G
Sbjct  968   SLARPMFIKEVLKALDPKFKRKKKGAQKARHLLESRARKFFIDNIASKINSDEAEEKMQG  1027

Query  1283  LNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLEL  1104
             LN+L+ +T GFIDVYEG +SD LPGLQ YT++M  T +Q +ILVKL        G+PLE+
Sbjct  1028  LNMLRNMTNGFIDVYEGTASDTLPGLQIYTILMNPTDIQHQILVKLHKIMEKCPGYPLEV  1087

Query  1103  ELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKE  924
             ELLITL +IHP L+ ++ C  + +  EEL  LEK +FD K GSKV FV++L+ R +++ E
Sbjct  1088  ELLITLASIHPSLVNSSVCVKKIYNLEELMELEKLRFDCKKGSKVMFVLNLVYR-VVKNE  1146

Query  923   K  921
             K
Sbjct  1147  K  1147


 Score =   275 bits (702),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 199/315 (63%), Gaps = 18/315 (6%)
 Frame = -3

Query  4208  MKRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVR  4029
             MKR+ +HQ++H F+ +PFEA   GSWQ VE I+I++G   +H +D    I+E+   SN+R
Sbjct  1     MKRKRLHQSKHSFNAHPFEALCCGSWQNVELIQIRDGAMTLHFVDNHHRIDEKGPFSNIR  60

Query  4028  IRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERK  3849
             ++SR AT SDC CFLRPG+D+ V S+   ++++        +   EP W+DAKI SI+RK
Sbjct  61    VKSRKATLSDCTCFLRPGIDVCVLSSSEHAKNTG-------EGNSEPVWVDAKISSIKRK  113

Query  3848  PHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCED-------  3690
             PH   C CQF +++YV QGP    +  LSKE   V +N+I++LQK++  PCE        
Sbjct  114   PHVSHCSCQFFVNLYVNQGPLGSERARLSKETVAVGINEISVLQKLDNDPCEAGNNQQEA  173

Query  3689  KYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN  3510
             ++YRW   +DCS +Q+ KLF G+F +DL+W+LVAS  KQV FDV+SV N+IVY+I   EN
Sbjct  174   QFYRWEFCEDCSLVQRSKLFLGRFSADLTWLLVASVLKQVEFDVRSVQNKIVYQISGGEN  233

Query  3509  DIDAPNSEYHSYAVSFKLENEVSTPIIIQFNPD--IPERGPEGDVYEAGPLVVYD--ELR  3342
             +  +  S  H   V+FK+++ +STP ++Q  P     E G   D         YD   LR
Sbjct  234   EHCSLKSNNHINCVTFKVKDSISTPFVVQLVPTDACSEVGHIRDTNGTEQSPCYDVMSLR  293

Query  3341  RSKRRFVQPERYLGC  3297
             RSKR+ +QPER+L C
Sbjct  294   RSKRQNIQPERFLAC  308



>ref|XP_006828119.1| hypothetical protein AMTR_s00023p00029140 [Amborella trichopoda]
 gb|ERM95535.1| hypothetical protein AMTR_s00023p00029140 [Amborella trichopoda]
Length=644

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/646 (50%), Positives = 434/646 (67%), Gaps = 28/646 (4%)
 Frame = -3

Query  2279  GKEQRPEEVVMEEKQGDDADLDHFAIPVSSN--KPSSEVEVEDNAWALIPDLRNKLRAHQ  2106
             GK ++  + V+E     D  LD F +P +    + + ++E   N WAL+P+L  KL  HQ
Sbjct  8     GKRKQHIDKVLEA----DEILDVFTMPCNGTVLREAHKLEEYGNVWALVPELERKLHTHQ  63

Query  2105  RRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRP  1926
             ++AFEF+W+NIAG++ P  +D  S + GGCVISHSPG GKT LII+FL SYL LFPGSRP
Sbjct  64    KKAFEFIWRNIAGTLNPKDMDCGSNQTGGCVISHSPGTGKTCLIISFLKSYLALFPGSRP  123

Query  1925  LVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY--KGEVLRQKMKLCPGLPRNQDVMHV  1752
             L+L PK TLYTW KE  KW   +P+Y +H  + Y  KG V R+K      LPR   + H+
Sbjct  124   LILVPKVTLYTWSKEFEKWNADVPLYIVHAWRDYERKGNV-REKSGNNRKLPRR--IAHI  180

Query  1751  LDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPR  1572
              DCL+K+  W  +PSVLLM Y +F  +TRE   Y  +K M+ VL    G+LILDEGH PR
Sbjct  181   TDCLKKIHTWHEYPSVLLMSYPTFFCITRERCEY--KKKMSGVLLNNTGLLILDEGHKPR  238

Query  1571  STKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRV  1392
             S  S+LRKALM V TS RILLSGTLFQNNF EYFNTL LARP FV EVL E      + V
Sbjct  239   SNSSKLRKALMAVKTSKRILLSGTLFQNNFEEYFNTLYLARPSFVFEVLMEF-----REV  293

Query  1391  KGAKTRFS---LENR----ARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEG  1233
             + A        +E R    AR  F+D+I+++IDS  ++ER+ GL  L+K+T+ FID YEG
Sbjct  294   QVANCGMGSPDMERRNERVARGFFVDEIARRIDSGIKQERQRGLQKLRKITSNFIDTYEG  353

Query  1232  GSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTT  1053
             G  ++LPGLQ YT+M+K T +QQ IL  LQ      K F LELE LIT+ +IHPWL++T 
Sbjct  354   GVLESLPGLQTYTIMIKPTLMQQPILNNLQMAIERSKVFSLELEFLITVASIHPWLLKTM  413

Query  1052  ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLE  873
              C  +Y  E E+  L         GSKV+F++ L+  C ++KEKVLIF   I PIN  +E
Sbjct  414   GCGRKYLTEAEIGGLSCHPEQ---GSKVEFIVDLVQLCAIKKEKVLIFSKYIEPINFLVE  470

Query  872   IFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAAS  693
             IFE  +GW+ G EVLVLQG+ +L+ERG V+++F +VGG +KV+LAS + C+EGI+LT AS
Sbjct  471   IFELKFGWQVGNEVLVLQGNQDLYERGVVIEEFNKVGGSAKVLLASTSACSEGINLTGAS  530

Query  692   RVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIF  513
             R++LLD+EWNPSK KQAIARAFR GQ+++VYVY+L+A GT+EE+KY++T WKEW+S ++F
Sbjct  531   RLVLLDAEWNPSKIKQAIARAFRLGQERMVYVYKLVALGTIEEDKYRKTVWKEWLSRLVF  590

Query  512   SEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNEKASNMG  375
                  E+ +H QA  IED++L  +V +D+     M+ +      +G
Sbjct  591   EGGKAEESTHRQAEHIEDDMLRAMVGQDQGRRLQMVTQESDKQVLG  636



>ref|XP_006658997.1| PREDICTED: SNF2 domain-containing protein CLASSY 2-like [Oryza 
brachyantha]
Length=1332

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/682 (49%), Positives = 442/682 (65%), Gaps = 16/682 (2%)
 Frame = -3

Query  2417  KKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEK  2238
             K G   CHH++ L+EE+GL CR+C VV TE KD+ P       +          + +++ 
Sbjct  660   KNGGIPCHHEYTLDEELGLACRICNVVCTEAKDIFPEMFNG--NDYKDRSGSSNICLDDH  717

Query  2237  QGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSII  2058
               D + L +FA  +S +K S  V      W+ I DL  KL  HQR+A +FLWKN+AGSI 
Sbjct  718   VLDPSLLANFAPDLSESKSSESV------WSAIADLDPKLLPHQRKALDFLWKNLAGSIQ  771

Query  2057  PTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEI  1878
                +D      GGCVI+H+PG+GKTLLII+FLVSY+K  P SRPLVL PK  + TW +E 
Sbjct  772   VEGMDSSKVSTGGCVIAHTPGSGKTLLIISFLVSYMKAHPRSRPLVLTPKAAINTWRREF  831

Query  1877  IKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPR----NQDVMHVLDCLEKMQKWLAHP  1710
              KW I +P++  H        +     KL   L          M ++D L+K+ KW AHP
Sbjct  832   QKWSISLPLHVFHHASRSGKPMSAVDSKLQSFLKNFHRPTWTNMRLMDSLDKLVKWHAHP  891

Query  1709  SVLLMGYTSFLTLTREDSTYAHR--KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMK  1536
             SVLLM Y+SFL +T++DS   +R  +++ +VL   PGILILDEGHNPRSTKS+LRK LMK
Sbjct  892   SVLLMTYSSFLGMTKQDSKVRNRGREFVAEVLMNNPGILILDEGHNPRSTKSKLRKLLMK  951

Query  1535  VNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENR  1356
             V T  RILLSGT FQNNF EY+NTLCLARP F+  ++ EL P+ KK     KT+   E  
Sbjct  952   VKTEFRILLSGTAFQNNFEEYYNTLCLARPWFIGHIMSELVPERKKETLKRKTKLQ-EAV  1010

Query  1355  ARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKST  1176
             AR+ F++K+ +KI+SS + +R +G+ +L KLT GFID +EG    NLPG+  Y + MK T
Sbjct  1011  ARRAFVEKVGQKIESSNKHDRIDGIFLLNKLTRGFIDSFEGAKLINLPGIHVYAVFMKPT  1070

Query  1175  TLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfk  996
              +Q+EIL K+   +     FPLE+ELLIT+G+IHPWLIRTT     +F   E+E + + K
Sbjct  1071  DIQKEILAKVTMPKLGCSRFPLEVELLITIGSIHPWLIRTTKAVNTFFSPAEVEKVNRCK  1130

Query  995   fdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQG  816
             +DL  G K KFV+ L+ +   R E+VLIFCHN++PI   +++ E   GWR G EVLVLQG
Sbjct  1131  WDLAAGCKAKFVIDLLHKSSFRGERVLIFCHNVSPITFLVKLIEMVLGWRLGEEVLVLQG  1190

Query  815   DIELFERGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAI  639
             D EL  R  VMDKF  +  G  KV++AS T CAEGISLT ASR+++LDSEWN SK++QAI
Sbjct  1191  DQELPVRSDVMDKFNCDTAGKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAI  1250

Query  638   ARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIED  459
             ARAFRPGQ++ VYVY L+A+GT EE+KY     K W+S M+F    V+DP   +   I+D
Sbjct  1251  ARAFRPGQERTVYVYLLVASGTWEEDKYNSNRRKAWISKMVFLGRYVDDPLQNRVTAIDD  1310

Query  458   ELLGEIVEEDRATLFHMIMKNE  393
             ++L E+ +ED    FHMI+K +
Sbjct  1311  DVLKELADEDDTGSFHMIVKQD  1332


 Score =   103 bits (257),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/277 (29%), Positives = 137/277 (49%), Gaps = 32/277 (12%)
 Frame = -3

Query  4061  IEEEISISNVRIRSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAW  3882
             +E  +    +R+RSR AT SDC   LRPG+D+ V S PH  ++S +   +   +      
Sbjct  51    VEHNVDGDCLRLRSRRATCSDCTNVLRPGVDVCVLS-PHTLQESLQGKTKASVLLCH---  106

Query  3881  IDAKIRSIERKPHGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQK  3702
              DA++ +I++      C+C F + +Y  Q P    K    +  +VV +N + +LQK++ +
Sbjct  107   -DARLITIKKNHQEDKCLCLFAVMLYKNQCPGNAEKVVTDRRAEVVTINNVFLLQKLQSE  165

Query  3701  PCEDKYYRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEIL  3522
               +D   +WS S+D  +L + KL + +F S+++ ++V S  + + F++K V  +IVY+I+
Sbjct  166   DFQDGSMKWSSSEDRLSLNRGKLLSARFSSEITHLIVLSILRGMEFNIKLVDCQIVYQII  225

Query  3521  KDEN---DIDA----PNSEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPE-GDVYEAGP  3366
             K +     +D+    P        +SF+L +E   P I     +IP    E  ++ E   
Sbjct  226   KRDQSRYSLDSMAIPPGFGNTMEIISFQLRDEALWPTI----RNIPITHVEKNNITEDKR  281

Query  3365  LVVYDE---------------LRRSKRRFVQPERYLG  3300
               V  E               LRRSKR   QP+R++ 
Sbjct  282   FTVKSEMDSELDVEVLYEHVDLRRSKRLKTQPDRFMS  318



>gb|EEE67867.1| hypothetical protein OsJ_25679 [Oryza sativa Japonica Group]
Length=1390

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/684 (48%), Positives = 446/684 (65%), Gaps = 20/684 (3%)
 Frame = -3

Query  2417  KKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRP--EEVVME  2244
             K G   CHH+  L+EE+GL CRLC VV TE KD+     P   + +  + RP    + ++
Sbjct  718   KVGGIPCHHECILDEELGLACRLCNVVCTEAKDI----FPEMFNGNDYKDRPGCSNICLD  773

Query  2243  EKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGS  2064
             +   D + L + A  +S  K S  V      W+ I DL  KL  HQR+A +FLWKN+AGS
Sbjct  774   DDILDPSLLANLAPELSELKNSGSV------WSAISDLDPKLLPHQRKALDFLWKNLAGS  827

Query  2063  IIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYK  1884
             I    +D  +   GGCVI+H+PG+GKTLL+I+FLVSY+K  P SRPLVL PK  ++TW +
Sbjct  828   IQVEGMDNSNVSTGGCVIAHTPGSGKTLLLISFLVSYMKAHPRSRPLVLTPKAAIHTWKR  887

Query  1883  EIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQ----DVMHVLDCLEKMQKWLA  1716
             E  KW I +P++  H        +     KL   L          M ++D L+K+ KW A
Sbjct  888   EFEKWGISLPLHVFHHANRSGKPLGAMDSKLRSLLNNFHRPTWTNMRLMDSLDKLFKWHA  947

Query  1715  HPSVLLMGYTSFLTLTREDSTYA--HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKAL  1542
             HPSVLLM Y+SFL +T++DS     +R+++ +VL   PG+LILDEGHNPRS KS+LRK L
Sbjct  948   HPSVLLMTYSSFLGMTKQDSKVRNRYREFIAEVLMNNPGLLILDEGHNPRSNKSKLRKLL  1007

Query  1541  MKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLE  1362
             MKV T  RILLSGT FQNNF EYFNTLCLARPRF+ +++ EL P+ K+   G + +   E
Sbjct  1008  MKVKTEFRILLSGTAFQNNFEEYFNTLCLARPRFIGDIMSELVPERKRETVGRRAKHQ-E  1066

Query  1361  NRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMK  1182
               AR+ F++K+ +KI+S  +  R +G+++L KLT GFID +EG    NLPG+  YT+ MK
Sbjct  1067  AVARRAFVEKVGQKIESDNKHIRSDGISLLNKLTRGFIDSFEGAKLINLPGIHVYTVFMK  1126

Query  1181  STTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealek  1002
              T +Q+E+L K+   +     FPLE+ELLIT+G+IHPWLI+TT     +F   E++ +E+
Sbjct  1127  PTDIQEEMLAKVTMPKLGSSRFPLEVELLITIGSIHPWLIKTTKAVSTFFSPAEVKKVER  1186

Query  1001  fkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVL  822
             +K D   G K KFV+ L+ +   R E+VLIFCHN++PI   +++ E  +GWR G EVLVL
Sbjct  1187  YKRDFAAGCKAKFVIDLLHKSSFRGERVLIFCHNVSPITFLVKLIEMVFGWRLGEEVLVL  1246

Query  821   QGDIELFERGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQ  645
             QGD EL  R  VMDKF  +  G  KV++AS T CAEGISLT ASR+++LDSEWN SK++Q
Sbjct  1247  QGDQELPVRSDVMDKFNGDSAGKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQ  1306

Query  644   AIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKI  465
             AIARAFR GQ++ VYVY L+A+GT EEEKY     K W+S M+F    V+D S  +   I
Sbjct  1307  AIARAFRRGQERTVYVYLLVASGTWEEEKYNSNRRKAWMSKMVFLGRYVDDSSQNRVTDI  1366

Query  464   EDELLGEIVEEDRATLFHMIMKNE  393
             +DE+L E+ +ED    FHMI+K +
Sbjct  1367  DDEVLKELADEDHTGTFHMIVKQD  1390


 Score =   121 bits (303),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 151/317 (48%), Gaps = 41/317 (13%)
 Frame = -3

Query  4157  FEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACFLRP  3978
             FE F +GSW  V  IRI+NG   +  +  G  +E  +    +R+RSR AT SDC+  L+P
Sbjct  74    FEVFYDGSWHGVNCIRIRNGNLFVKFIYSGSTVEHNVDGDCLRLRSRRATCSDCSNVLKP  133

Query  3977  GLDISVFS--TPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHISVY  3804
             G+D+ V S  TP  S       +   +        DA++ +I++      C+C F + +Y
Sbjct  134   GVDVCVQSSHTPEASSQGGTNASVLLRH-------DARLITIKKNHQEDKCLCLFVVILY  186

Query  3803  VTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTG  3624
               Q P    K    +  +VV +N I +LQK+ Q    +   +WS S D  +L K +L + 
Sbjct  187   KNQCPGNAEKVITDRRAEVVTINDIFLLQKL-QPEVHEGSMKWSFSKDRLSLNKGRLISA  245

Query  3623  KFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN---DIDA----PNSEYHSYAVS  3465
             +F S+++ ++V S  + + F++K V  +IVY+I+K +    ++D+    P        +S
Sbjct  246   RFSSEITHLIVLSILRGMEFNIKLVEGQIVYQIIKGDQAQWNLDSMAIPPGFGNTMEIIS  305

Query  3464  FKLENEVSTPIIIQFNPDIP-------------------ERGPEGD-VYEAGPLVVYDEL  3345
             F+L +E   P I     +IP                   E   E D   +   L  + +L
Sbjct  306   FQLRDEALRPTIT----NIPITHVKKNNITEDMRFTVKSEMDSELDRALDVEILYEHVDL  361

Query  3344  RRSKRRFVQPERYLGCD  3294
             RRSKR   QP+R+   D
Sbjct  362   RRSKRLKTQPDRFTSYD  378



>dbj|BAC79886.1| putative DNA repair protein rhp54 [Oryza sativa Japonica Group]
Length=637

 Score =   566 bits (1458),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 301/602 (50%), Positives = 408/602 (68%), Gaps = 8/602 (1%)
 Frame = -3

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSP  1998
             SE++   + W+ I DL  KL  HQR+A +FLWKN+AGSI    +D  +   GGCVI+H+P
Sbjct  37    SELKNSGSVWSAISDLDPKLLPHQRKALDFLWKNLAGSIQVEGMDNSNVSTGGCVIAHTP  96

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK-  1821
             G+GKTLL+I+FLVSY+K  P SRPLVL PK  ++TW +E  KW I +P++  H       
Sbjct  97    GSGKTLLLISFLVSYMKAHPRSRPLVLTPKAAIHTWKREFEKWGISLPLHVFHHANRSGK  156

Query  1820  --GEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
               G +  +   L     R     M ++D L+K+ KW AHPSVLLM Y+SFL +T++DS  
Sbjct  157   PLGAMDSKLRSLLNNFHRPTWTNMRLMDSLDKLFKWHAHPSVLLMTYSSFLGMTKQDSKV  216

Query  1649  A--HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
                +R+++ +VL   PG+LILDEGHNPRS KS+LRK LMKV T  RILLSGT FQNNF E
Sbjct  217   RNRYREFIAEVLMNNPGLLILDEGHNPRSNKSKLRKLLMKVKTEFRILLSGTAFQNNFEE  276

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskere  1296
             YFNTLCLARPRF+ +++ EL P+ K+   G + +   E  AR+ F++K+ +KI+S  +  
Sbjct  277   YFNTLCLARPRFIGDIMSELVPERKRETVGRRAKHQ-EAVARRAFVEKVGQKIESDNKHI  335

Query  1295  rkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGF  1116
             R +G+++L KLT GFID +EG    NLPG+  YT+ MK T +Q+E+L K+   +     F
Sbjct  336   RSDGISLLNKLTRGFIDSFEGAKLINLPGIHVYTVFMKPTDIQEEMLAKVTMPKLGSSRF  395

Query  1115  PLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCL  936
             PLE+ELLIT+G+IHPWLI+TT     +F   E++ +E++K D   G K KFV+ L+ +  
Sbjct  396   PLEVELLITIGSIHPWLIKTTKAVSTFFSPAEVKKVERYKRDFAAGCKAKFVIDLLHKSS  455

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE-EVGG  759
              R E+VLIFCHN++PI   +++ E  +GWR G EVLVLQGD EL  R  VMDKF  +  G
Sbjct  456   FRGERVLIFCHNVSPITFLVKLIEMVFGWRLGEEVLVLQGDQELPVRSDVMDKFNGDSAG  515

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
               KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIARAFR GQ++ VYVY L+A+
Sbjct  516   KRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRRGQERTVYVYLLVAS  575

Query  578   GTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMK  399
             GT EEEKY     K W+S M+F    V+D S  +   I+DE+L E+ +ED    FHMI+K
Sbjct  576   GTWEEEKYNSNRRKAWMSKMVFLGRYVDDSSQNRVTDIDDEVLKELADEDHTGTFHMIVK  635

Query  398   NE  393
              +
Sbjct  636   QD  637



>gb|EEC82733.1| hypothetical protein OsI_27432 [Oryza sativa Indica Group]
Length=1770

 Score =   597 bits (1538),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 328/684 (48%), Positives = 445/684 (65%), Gaps = 20/684 (3%)
 Frame = -3

Query  2417  KKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRP--EEVVME  2244
             K G   CHH+  L+EE+GL CRLC VV TE KD+     P   + +  + R     + ++
Sbjct  1098  KVGGIPCHHECILDEELGLACRLCNVVCTEAKDI----FPEMFNGNDYKDRTGCSNICLD  1153

Query  2243  EKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGS  2064
             +   D + L + A  +S  K S  V      W+ I DL  KL  HQR+A +FLWKN+AGS
Sbjct  1154  DDILDPSLLANLAPELSELKNSGSV------WSAISDLDPKLLPHQRKALDFLWKNLAGS  1207

Query  2063  IIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYK  1884
             I    +D  +   GGCVI+H+PG+GKTLL+I+FLVSY+K  P SRPLVL PK  ++TW +
Sbjct  1208  IQVEGMDNSNVSTGGCVIAHTPGSGKTLLLISFLVSYMKAHPRSRPLVLTPKAAIHTWKR  1267

Query  1883  EIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQ----DVMHVLDCLEKMQKWLA  1716
             E  KW I +P++  H        +     KL   L          M ++D L+K+ KW A
Sbjct  1268  EFEKWGISLPLHVFHHANRSGKPLGAMDSKLRSLLNNFHRPTWTNMRLMDSLDKLFKWHA  1327

Query  1715  HPSVLLMGYTSFLTLTREDSTYA--HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKAL  1542
             HPSVLLM Y+SFL +T++DS     +R+++ +VL   PG+LILDEGHNPRS KS+LRK L
Sbjct  1328  HPSVLLMTYSSFLGMTKQDSKVRNRYREFIAEVLMNNPGLLILDEGHNPRSNKSKLRKLL  1387

Query  1541  MKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLE  1362
             MKV T  RILLSGT FQNNF EYFNTLCLARPRF+ +++ EL P+ K+   G + +   E
Sbjct  1388  MKVKTEFRILLSGTAFQNNFEEYFNTLCLARPRFIGDIMSELVPERKRETVGRRAKHQ-E  1446

Query  1361  NRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMK  1182
               AR+ F++K+ +KI+S  +  R +G+++L KLT GFID +EG    NLPG+  YT+ MK
Sbjct  1447  AVARRAFVEKVGQKIESDNKHIRSDGISLLNKLTRGFIDSFEGAKLINLPGIHVYTVFMK  1506

Query  1181  STTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealek  1002
              T +Q+E+L K+   +     FPLE+ELLIT+G+IHPWLI+TT     +F   E++ +E+
Sbjct  1507  PTDIQEEMLAKVTMPKLGSSRFPLEVELLITIGSIHPWLIKTTKAVSTFFSPAEVKKVER  1566

Query  1001  fkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVL  822
             +K D   G K KFV+ L+ +   R E+VLIFCHN++PI   +++ E  +GWR G EVLVL
Sbjct  1567  YKRDFAAGCKAKFVIDLLHKSSFRGERVLIFCHNVSPITFLVKLIEMVFGWRLGEEVLVL  1626

Query  821   QGDIELFERGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQ  645
             QGD EL  R  VMDKF  +  G  KV++AS T CAEGISLT ASR+++LDSEWN SK++Q
Sbjct  1627  QGDQELPVRSDVMDKFNGDSAGKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQ  1686

Query  644   AIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKI  465
             AIARAFR GQ++ VYVY L+A+GT EEEKY     K W+S M+F    V+D S  +   I
Sbjct  1687  AIARAFRRGQERTVYVYLLVASGTWEEEKYNSNRRKAWMSKMVFLGRYVDDSSQNRVTDI  1746

Query  464   EDELLGEIVEEDRATLFHMIMKNE  393
             +DE+L E+ +ED    FHMI+K +
Sbjct  1747  DDEVLKELADEDHTGTFHMIVKQD  1770


 Score =   122 bits (305),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 151/317 (48%), Gaps = 41/317 (13%)
 Frame = -3

Query  4157  FEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACFLRP  3978
             FE F +GSW  V  IRI+NG   +  +  G  +E  +    +R+RSR AT SDC+  L+P
Sbjct  454   FEVFYDGSWHGVNCIRIRNGNLFVKFIYSGSTVEHNVDGDCLRLRSRRATCSDCSNVLKP  513

Query  3977  GLDISVFS--TPHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGCVCQFHISVY  3804
             G+D+ V S  TP  S       +   +        DA++ +I++      C+C F + +Y
Sbjct  514   GVDVCVQSSHTPEASSQGGTNASVLLRH-------DARLITIKKNHQEDKCLCLFVVILY  566

Query  3803  VTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDCSTLQKFKLFTG  3624
               Q P    K    +  +VV +N I +LQK+ Q    +   +WS S D  +L K +L + 
Sbjct  567   KNQCPGNAEKVITDRRAEVVTINDIFLLQKL-QPEVHEGSMKWSFSKDSLSLNKGRLISA  625

Query  3623  KFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDEN---DIDA----PNSEYHSYAVS  3465
             +F S+++ ++V S  + + F++K V  +IVY+I+K +    ++D+    P        +S
Sbjct  626   RFSSEITHLIVLSILRGMEFNIKLVEGQIVYQIIKGDQAQWNLDSMAIPPGFGNTMEIIS  685

Query  3464  FKLENEVSTPIIIQFNPDIP-------------------ERGPEGD-VYEAGPLVVYDEL  3345
             F+L +E   P I     +IP                   E   E D   +   L  + +L
Sbjct  686   FQLRDEALRPTIT----NIPITHVKKNNITEDMRFTVKSEMDSELDRALDVEILYEHVDL  741

Query  3344  RRSKRRFVQPERYLGCD  3294
             RRSKR   QP+R+   D
Sbjct  742   RRSKRLKTQPDRFTSYD  758



>gb|EMT24130.1| DNA repair protein rhp54 [Aegilops tauschii]
Length=1203

 Score =   571 bits (1471),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 301/607 (50%), Positives = 415/607 (68%), Gaps = 20/607 (3%)
 Frame = -3

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSP  1998
             SE+    N W+LIPDL  KL  HQR AFEF+WKN+AGS+   ++D  +   GGCV++H+P
Sbjct  605   SELRGSGNLWSLIPDLEPKLLPHQRNAFEFIWKNLAGSLQLEEMDNPTASTGGCVVAHTP  664

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             G+GKTLL+I+FLVSYLK+ P SRPLVL PK+ ++TW +E  KW I +P++ +H       
Sbjct  665   GSGKTLLLISFLVSYLKVHPRSRPLVLTPKSAIHTWMREFEKWGISLPLHVLH-------  717

Query  1817  EVLRQKMKLCPGLPRNQDVMH-----------VLDCLEKMQKWLAHPSVLLMGYTSFLTL  1671
             +V ++   + P  PR Q ++            ++D L+K+ KW  HPSVLLM Y+SFL L
Sbjct  718   QVDKRGKPMGPIDPRLQAILSNFRRPNWKNICLVDRLDKLCKWHEHPSVLLMTYSSFLRL  777

Query  1670  TREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQ  1491
              ++DS    R +M QVL   PG+LILDEGHNPRS KS+LR+ LMKV T  RIL+SGT+FQ
Sbjct  778   AKQDSRMPQRAFMAQVLINNPGLLILDEGHNPRSNKSKLRRVLMKVKTEFRILMSGTVFQ  837

Query  1490  NNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkids  1311
             NNF EYFNTL LARPRFVD+V+  L P+ KK  +G + +   E  AR++F+D++ + I+S
Sbjct  838   NNFEEYFNTLSLARPRFVDDVMTALVPERKKETRGRRAKHR-EAVARRIFVDRVGQMIES  896

Query  1310  skererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
             S   +R+ G+++L KLT GFID +EG    +LPG+  YT+ MK T +Q++IL ++     
Sbjct  897   SDNWDRQGGISLLNKLTCGFIDSFEGSKLRSLPGIHVYTIFMKPTEIQEDILSRISMATS  956

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
                 + LE+ELLIT+ +IHPWLI+TT  S  YF  EE+  ++++K D  +G K +FV+ L
Sbjct  957   CGGRYLLEVELLITIASIHPWLIKTTKSSSTYFTPEEIHKVDRYKRDFAVGCKARFVIDL  1016

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             + +   R E+VLIFCHN++PI+  +E+ E  +GWR G EVLVLQGD EL  R  VMDKF 
Sbjct  1017  LHKSSYRGERVLIFCHNVSPISFLVELIENVFGWRLGEEVLVLQGDQELPVRSDVMDKFN  1076

Query  770   -EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
              +  G  KV++AS T CAEGISLT ASR+++LDSEWN SK++QAIARAFRPGQ++ VYVY
Sbjct  1077  TDSQGKRKVLIASTTACAEGISLTGASRLVMLDSEWNHSKTRQAIARAFRPGQERTVYVY  1136

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRATLF  414
              L+A+GT EE+KY R   K W++ M+F     + P       I+D LL E+ +ED+   F
Sbjct  1137  LLVASGTWEEDKYSRNRRKAWMAKMVFHGRYFDVPLRNAVTAIDDGLLKELADEDKTKTF  1196

Query  413   HMIMKNE  393
             HMI+K +
Sbjct  1197  HMIVKQD  1203


 Score =   117 bits (292),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 93/334 (28%), Positives = 155/334 (46%), Gaps = 42/334 (13%)
 Frame = -3

Query  4187  QNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNAT  4008
             +  HP    PFEAF +GSW  V  I++++G   +  +  G  +E  +   ++R+RSR AT
Sbjct  13    RRSHPISETPFEAFYDGSWHGVNCIKVRDGGLFVIFIYSGSTVEHNVDGEHLRLRSRRAT  72

Query  4007  SSDCACFLRPGLDISVFST-PHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHGFGC  3831
               DC+  L+PG+DI V S+ P Q   + E  +            DA++ +I+R      C
Sbjct  73    YFDCSHVLKPGVDICVQSSHPLQGSPTGELKSLMLLSH------DARLITIKRNHIEDQC  126

Query  3830  VCQFHISVYVTQGPPPIVKKTL--SKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLSDDC  3657
             +C F I ++  Q P       +   +  ++V LN I +LQK++ K   +   +WS ++DC
Sbjct  127   LCLFVIMLHKNQCPDNTENGEVISDRREQLVTLNNIFLLQKLQPKELHEGSVQWSSAEDC  186

Query  3656  STLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILK------DENDIDAP  3495
              +  + KL + +F  +++ ++V S    + F +K V   I+Y I+K      + + +  P
Sbjct  187   LSHNRSKLLSARFSQEIAHLVVLSILNGMEFSIKLVEGNIIYRIIKGGRARCNLDSMSTP  246

Query  3494  NSEYHSY-AVSFKLENEVSTPII----------------------IQFNPDIPERGPEGD  3384
                 +S   VSF+L NE   PII                       + +  + +R     
Sbjct  247   PGFGNSMEIVSFQLRNEALCPIIRNIPVTHAKKRNLTEDAGFTMKAELDGQLEDRRFTVK  306

Query  3383  VYEAGPLVVYD----ELRRSKRRFVQPERYLGCD  3294
                 G L V+     +LRRSKRR  Q ER+   D
Sbjct  307   TELDGLLDVFSYEQVDLRRSKRRKTQAERFTSYD  340



>ref|XP_006293059.1| hypothetical protein CARUB_v10019346mg [Capsella rubella]
 gb|EOA25957.1| hypothetical protein CARUB_v10019346mg [Capsella rubella]
Length=658

 Score =   547 bits (1410),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 290/449 (65%), Positives = 347/449 (77%), Gaps = 22/449 (5%)
 Frame = -3

Query  1730  QKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLR  1551
             +KW A PSVL+MGYTSFLTL REDS +AHRKYM +VLR+ PG+L+LDEGHNPRST+SRLR
Sbjct  209   KKWHAEPSVLVMGYTSFLTLMREDSKFAHRKYMAKVLRESPGLLVLDEGHNPRSTESRLR  268

Query  1550  KALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRF  1371
             KALMKV+  LRILLSGTLFQNNF EYFNTLCLARP+FV EVL ELD K++K     K   
Sbjct  269   KALMKVDIDLRILLSGTLFQNNFCEYFNTLCLARPKFVYEVLIELDQKFQKNQAVQKAPP  328

Query  1370  SLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDN---LPGLQC  1200
              LE RA K F+D I+KKID     ER +GLN+L+ +T+GFID YEG  S +   LPGLQ 
Sbjct  329   LLEKRAWKFFLDIIAKKIDRKVGDERLQGLNMLRNMTSGFIDNYEGSGSGSGGVLPGLQI  388

Query  1199  YTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeee  1020
             YTL+M ST++Q EIL KLQ+    Y G+PL+LELLITL   +P LI       +      
Sbjct  389   YTLLMNSTSIQHEILTKLQNIMSTYHGYPLKLELLITLVPSYPSLIEKLKHDAK------  442

Query  1019  lealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKG  840
                          GSKV F+++L+ + ++ KEK++IFCHNIAPI LFLE+FE+ + W++G
Sbjct  443   ------------KGSKVMFMLNLVLQ-VVNKEKIIIFCHNIAPICLFLELFEKIFKWQRG  489

Query  839   IEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNP  660
              E+L L GD+ELFERGRV+DKFEE GG S+++LASIT CAEGISLTAASRVI++DSEWNP
Sbjct  490   REILTLIGDLELFERGRVIDKFEEPGGESRILLASITACAEGISLTAASRVIMVDSEWNP  549

Query  659   SKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHW  480
             SK+KQAIARAFRPGQ KVVYVYQLL+ GTLEE+KYKR TWKEWVSSMIF E+ VEDPS W
Sbjct  550   SKTKQAIARAFRPGQQKVVYVYQLLSRGTLEEDKYKRKTWKEWVSSMIFREEFVEDPSQW  609

Query  479   QAPKIEDELLGEIVEEDRATLFHMIMKNE  393
             QA KIED++L EIVEED+   FHMIMKNE
Sbjct  610   QAEKIEDDVLREIVEEDKVKSFHMIMKNE  638



>ref|XP_006435813.1| hypothetical protein CICLE_v10030786mg [Citrus clementina]
 ref|XP_006435814.1| hypothetical protein CICLE_v10030786mg [Citrus clementina]
 gb|ESR49053.1| hypothetical protein CICLE_v10030786mg [Citrus clementina]
 gb|ESR49054.1| hypothetical protein CICLE_v10030786mg [Citrus clementina]
Length=751

 Score =   486 bits (1250),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 255/447 (57%), Positives = 324/447 (72%), Gaps = 26/447 (6%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             LWKEMELA+A  Y+L+D E +N   ++E     +  + VC H+F L+EEIG++C  CG V
Sbjct  321   LWKEMELAMAEAYILEDNEGSNAGLSSE---DPQISSIVCQHEFTLDEEIGILCPKCGFV  377

Query  2336  STEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHF-----AIPVSSNKPSSE  2172
              TEIK V P F+            P+  +   K  ++ D +H       + +  N  SS+
Sbjct  378   KTEIKYVTPAFL-----------EPKRWITSNKVDNEEDTEHGLDSNEGLNLCCNLASSD  426

Query  2171  V---EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHS  2001
             +      DN WALIP+L+ KL  HQ++AFEFLW+NIAGS++P  +D ESK  GGCVISH+
Sbjct  427   ILSPNENDNVWALIPELKMKLHLHQKKAFEFLWRNIAGSLVPASMDAESKNTGGCVISHT  486

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PGAGKT LIIAFLVSYLKLFPG R LVL P+TTLYTW +E IKWKIP+PV+ IHG +T++
Sbjct  487   PGAGKTFLIIAFLVSYLKLFPGKRALVLVPETTLYTWCEEFIKWKIPLPVHLIHGRRTHR  546

Query  1820  GEVLRQK-MKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYA  1647
               V RQK +    G  R   DVMH+LD LEK+QKW A PS+L+MGYTSFLTL  ED+ +A
Sbjct  547   --VFRQKRISSFKGDVRPTPDVMHILDFLEKIQKWHAQPSILVMGYTSFLTLIHEDAKFA  604

Query  1646  HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFN  1467
             HRKYM +VLR+ PGI++LDEGH PRSTKSRLRKALMKV T+ R+LLSGTLFQNNF EYFN
Sbjct  605   HRKYMAKVLRESPGIVVLDEGHKPRSTKSRLRKALMKVETAQRVLLSGTLFQNNFCEYFN  664

Query  1466  TLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkE  1287
             TLCLARP+F+ EVL+ELD  +K++    K    LE+RARK+F+D I++KI+S    ER +
Sbjct  665   TLCLARPKFIHEVLRELDQNFKRKKMRMKNPRQLESRARKIFVDTIARKINSDNGEERIQ  724

Query  1286  GLNILKKLTTGFIDVYEGGSSDNLPGL  1206
             GLN+L+ +T+GFIDVYEGG+SDNLPGL
Sbjct  725   GLNMLRNITSGFIDVYEGGASDNLPGL  751


 Score =   283 bits (723),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 200/302 (66%), Gaps = 10/302 (3%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             +RR ++Q++ PFD +PFEAF + SW+ VE IRI++GT  MH+ D     E+    SN+RI
Sbjct  3     RRRHLYQSKQPFDDHPFEAFFHDSWRTVELIRIKDGTMTMHLKDNQCYTEKRRPFSNLRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR ATSSDC CFLRPG+D+ V S    +E  D       +   EP W+DAKI SIERKP
Sbjct  63    RSRKATSSDCTCFLRPGIDVCVLSASQDAECLD-------EENEEPVWVDAKISSIERKP  115

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             H   C C+F++  YV  GP  + +  LSKE K+V ++QI ILQK+ +  CED+YYRW+ S
Sbjct  116   HEGQCSCRFYVEFYVNPGPLGLERGALSKETKLVGIDQITILQKLGRDACEDQYYRWNFS  175

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSE  3486
             +DCS+LQK K+  GKF SDLS+++VAS  KQ  FD++SV  +IVY+IL  ++D  + NS 
Sbjct  176   EDCSSLQKTKMLLGKFSSDLSFLIVASVLKQTAFDIRSVQKKIVYQILGSDDDNSSLNSI  235

Query  3485  YHSYAVSFKLENEVSTPIIIQF-NPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
              +  A++FK+E+ VS+  + QF  PD  E    G   E G L +YD   L+RSKRR VQP
Sbjct  236   NNLNAINFKVEDGVSSSHLFQFIPPDTKEVSIAGGTEEVGLLPIYDVMNLQRSKRRNVQP  295

Query  3314  ER  3309
             +R
Sbjct  296   DR  297



>ref|NP_001060723.1| Os07g0692600 [Oryza sativa Japonica Group]
 dbj|BAF22637.1| Os07g0692600, partial [Oryza sativa Japonica Group]
Length=475

 Score =   452 bits (1164),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 239/459 (52%), Positives = 323/459 (70%), Gaps = 4/459 (1%)
 Frame = -3

Query  1760  MHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYA--HRKYMNQVLRQCPGILILDE  1587
             M ++D L+K+ KW AHPSVLLM Y+SFL +T++DS     +R+++ +VL   PG+LILDE
Sbjct  18    MRLMDSLDKLFKWHAHPSVLLMTYSSFLGMTKQDSKVRNRYREFIAEVLMNNPGLLILDE  77

Query  1586  GHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPK  1407
             GHNPRS KS+LRK LMKV T  RILLSGT FQNNF EYFNTLCLARPRF+ +++ EL P+
Sbjct  78    GHNPRSNKSKLRKLLMKVKTEFRILLSGTAFQNNFEEYFNTLCLARPRFIGDIMSELVPE  137

Query  1406  YKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS  1227
              K+   G + +   E  AR+ F++K+ +KI+S  +  R +G+++L KLT GFID +EG  
Sbjct  138   RKRETVGRRAKHQ-EAVARRAFVEKVGQKIESDNKHIRSDGISLLNKLTRGFIDSFEGAK  196

Query  1226  SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTAC  1047
               NLPG+  YT+ MK T +Q+E+L K+   +     FPLE+ELLIT+G+IHPWLI+TT  
Sbjct  197   LINLPGIHVYTVFMKPTDIQEEMLAKVTMPKLGSSRFPLEVELLITIGSIHPWLIKTTKA  256

Query  1046  SGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIF  867
                +F   E++ +E++K D   G K KFV+ L+ +   R E+VLIFCHN++PI   +++ 
Sbjct  257   VSTFFSPAEVKKVERYKRDFAAGCKAKFVIDLLHKSSFRGERVLIFCHNVSPITFLVKLI  316

Query  866   ERFYGWRKGIEVLVLQGDIELFERGRVMDKFE-EVGGPSKVMLASITTCAEGISLTAASR  690
             E  +GWR G EVLVLQGD EL  R  VMDKF  +  G  KV++AS T CAEGISLT ASR
Sbjct  317   EMVFGWRLGEEVLVLQGDQELPVRSDVMDKFNGDSAGKRKVLIASTTACAEGISLTGASR  376

Query  689   VILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             +++LDSEWN SK++QAIARAFR GQ++ VYVY L+A+GT EEEKY     K W+S M+F 
Sbjct  377   LVMLDSEWNHSKTRQAIARAFRRGQERTVYVYLLVASGTWEEEKYNSNRRKAWMSKMVFL  436

Query  509   EDLVEDPSHWQAPKIEDELLGEIVEEDRATLFHMIMKNE  393
                V+D S  +   I+DE+L E+ +ED    FHMI+K +
Sbjct  437   GRYVDDSSQNRVTDIDDEVLKELADEDHTGTFHMIVKQD  475



>ref|XP_003622049.1| Chromatin remodeling complex subunit [Medicago truncatula]
 gb|AES78267.1| chromatin remodeling protein, putative [Medicago truncatula]
Length=644

 Score =   379 bits (972),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 269/690 (39%), Positives = 368/690 (53%), Gaps = 159/690 (23%)
 Frame = -3

Query  2711  KGSISANVY--RELIRRCMANIDETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnnee  2538
             KG I+  ++  +E+I   M N+D    +E+P I ++  + +  K+ +             
Sbjct  105   KGDITLKIHAHKEIIDTYMKNLDSFSTEEEPTINEETNKLEEEKASKS------------  152

Query  2537  elseLDMLWKEMELALASCYLLDDTE---DTNLKSATELHMATKKGTRVCHHDFRLNEEI  2367
                                   DD E   D    S  E+   TK+   +C HD+  NEEI
Sbjct  153   ----------------------DDEEENIDDLFGSNAEVLADTKE---ICKHDYNFNEEI  187

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPV-SS  2190
             G+ CR C                                 E K  +D +   F   V   
Sbjct  188   GIFCRSC---------------------------------EPKVDEDYNKHMFTTHVIDP  214

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVI  2010
             ++P S+ E  DN W LIP+ + K+ AHQ+ AFEFLW+NI GS+ P+ +   SK  GGCVI
Sbjct  215   DEPLSKEE--DNVWKLIPEFKEKMHAHQKSAFEFLWQNIIGSMEPSLMQERSKTSGGCVI  272

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH PG  KT LII+F V YLKLF G RPL+L PK+TLYTW+KE+                
Sbjct  273   SHVPG--KTFLIISFRVRYLKLFLGKRPLILTPKSTLYTWHKEL----------------  314

Query  1829  TYKGEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
                     +KM++ P +PR   DV HVLDCL             L G         + + 
Sbjct  315   --------KKMEVLPKVPRPTGDVKHVLDCL------------ALKG--------SQQTK  346

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
             +AH  YM + LR+ PGILILDE +NPRSTKSRL+K LM++   LR LLSGTLFQNNF EY
Sbjct  347   FAHGNYMAKTLREIPGILILDEAYNPRSTKSRLKKCLMELPIELRKLLSGTLFQNNFCEY  406

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGA-KTRFSLENRARKMFidkiskkidsskere  1296
             FNT CLARP+FV EVL+ELD KY +R  G  K +  LE R R+ F++ I++KI+S  + E
Sbjct  407   FNTPCLARPKFVHEVLRELDFKYLRRGYGENKAQHFLEARPRRFFMENIARKINSHNDEE  466

Query  1295  rkEGLNILKKLTTGFIDVYE-GGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
             + +GL +L+K+T+ FIDVYE G SSD  PGLQ YTL+  +   Q E++ KLQ +      
Sbjct  467   KMQGLPVLQKITSSFIDVYESGNSSDTPPGLQIYTLVRNTYDEQHEVIYKLQKKMAECTS  526

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
             + LE +       +H            +F +EEL+ LE  +FDL  GSK++F MSLI   
Sbjct  527   YSLEQQ------HVHI----------NFFSKEELKRLEGIEFDLSKGSKIRFFMSLISH-  569

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGG  759
             +++ EK  +                  +  + G EVL+L  D++LFERG+++DKFE+   
Sbjct  570   VVKNEKSYL---------------RSTFNGKNGKEVLLLTSDLDLFERGKIIDKFEDPHS  614

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSE  669
              S+++LASI  CA+GISLT+ASRVI LDSE
Sbjct  615   GSEILLASINACAKGISLTSASRVIFLDSE  644



>ref|XP_006375169.1| hypothetical protein POPTR_0014s04910g [Populus trichocarpa]
 gb|ERP52966.1| hypothetical protein POPTR_0014s04910g [Populus trichocarpa]
Length=1178

 Score =   381 bits (978),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 257/735 (35%), Positives = 394/735 (54%), Gaps = 43/735 (6%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNL-KSATELHMATKKGTRVCH---HDFRLNEEIGLVCRL  2349
             LW +M LAL    L D T+D  L ++  + H        +CH   H+  L+EEIGL+C+ 
Sbjct  457   LWADMALALC---LKDTTDDAALDENEDDAHEVEPDTVTLCHQGNHELYLDEEIGLLCKY  513

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE-  2172
             C  V  EIK   PPF        GK  R + V M+    +D    H         P  + 
Sbjct  514   CSFVDLEIKYYVPPF---DRYPRGKSARRDFVTMQHNIFNDL---HHQDSGHDTHPDYDP  567

Query  2171  -VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISHS  2001
                V+   W LIP +   +  HQR  FEFLWKNIAG I   ++   +   GG  C+ISH+
Sbjct  568   CTLVQGTVWNLIPGIGKGMHGHQREGFEFLWKNIAGGIYLDKLKENANLNGGTGCIISHA  627

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I FL +Y++L+P SRP+++AP + L TW  E +KW + IP + I   +   
Sbjct  628   PGTGKTRLTIVFLQTYMQLYPTSRPVIVAPCSMLLTWEAEFLKWGVDIP-FHIMNKKNLS  686

Query  1820  GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED------  1659
             G+  R  M L   L   +  ++ +  + K+  W    S+L + Y  F  L  E+      
Sbjct  687   GKENRTAMDLFRELKPAERGLNAIRMV-KLYSWKKERSILGISYRLFEELVGEEKSKTKV  745

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S       + +VL + PG+L+LDEGH PR+ +SR+ KAL KV T  RI+LSGT FQNNF 
Sbjct  746   SDKTEDDQVRKVLLELPGLLVLDEGHTPRNDRSRIWKALSKVQTQKRIILSGTPFQNNFD  805

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             E +NTLCL +P+F DE+  +      KR      R      AR+ +    +     + ++
Sbjct  806   ELYNTLCLVKPKFADEISSKHHRACPKR-----RRCKRNTDARRNWASLTTAIGKVTDDK  860

Query  1298  erkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
                + +  L+K+   F+ V++GG   + LPGL+   ++++   LQ+ +L   ++ + I  
Sbjct  861   LEAQRVEELRKMIWQFVHVHKGGVLRERLPGLRDSVVILQPVHLQKTLL---ENVKQING  917

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
                 E+E L+++ ++HP L+   +     FK  +   LE  +   + G K KF+M LI  
Sbjct  918   LDHFEMEYLLSVLSVHPSLLPEKSVGTLEFKFVDRMELEMLRSKPEAGVKTKFLMELIRL  977

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
             C  R EKVL+F   + P+NL ++  E  + W +G ++L + G +++ ER  ++  F    
Sbjct  978   CQARNEKVLVFSQYLEPLNLVIKQLESNFSWIQGEDILYMHGKLKIDERQILIKHFNNAN  1037

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               +KV+LAS   C+EGI+L  ASRV+LLD  WNPS  +QAI+RA+R GQ+KVVY+Y L+ 
Sbjct  1038  SNAKVLLASTRACSEGINLVGASRVVLLDVLWNPSVERQAISRAYRLGQEKVVYIYHLIT  1097

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQ------APKIEDELLGEIVEEDRAT  420
             +GT+EEEKY     KE +S+++F  D     S+ Q      A   +D++L E+V+ D+  
Sbjct  1098  SGTMEEEKYFCQVEKERLSNLVF--DCTNRSSNHQKGVFDIAEDKKDKILEEMVQHDKLK  1155

Query  419   -LFHMIMKNEKASNM  378
              +F  I+   K +N+
Sbjct  1156  FMFKRIVYQPKDTNI  1170



>ref|XP_010055396.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Eucalyptus 
grandis]
 gb|KCW71855.1| hypothetical protein EUGRSUZ_E00332 [Eucalyptus grandis]
Length=1277

 Score =   381 bits (978),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 248/742 (33%), Positives = 386/742 (52%), Gaps = 65/742 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASC----YLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIG  2364
             D LW E++  L +     Y  D  E  ++    +    T     +C   +H+F L+EE G
Sbjct  564   DKLWDELDFCLRASEIDSYNADLVESKDVDPQPDFDRVT-----LCSQGNHEFILDEETG  618

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKE----QRPEEVVMEEKQGDDADLDHFAIPV  2196
             + C+ C  +  EIK V PPF       SG+        E+ ++E+ +  D+  +  A   
Sbjct  619   VRCKHCLFLQLEIKYVVPPFSNDPLERSGQRVFGRYDYEDYLLEKIRSQDSSCNLQAGLP  678

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR---  2025
             S+N       V    W LIPD+R+ L  HQR  FEF+W+NIAG I   Q+D   +++   
Sbjct  679   SAN-------VHGTVWDLIPDVRSDLYPHQREGFEFIWRNIAGGI---QLDELRRQKTVG  728

Query  2024  --GGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPV  1851
               GGC+ISH+PG GK+ L I FL +Y++LFP  RP+++AP++ L TW +E  KWK  IP 
Sbjct  729   CDGGCIISHAPGTGKSRLTIVFLRTYMELFPSCRPVIIAPRSMLLTWEEEFQKWKEDIPF  788

Query  1850  YQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTL  1671
             + ++  +    E    K  L      +Q   HV   + K+  W    S+L + YT F +L
Sbjct  789   HNLNNPELSGKE---SKAALSVLKHGDQSTKHVR--MVKLYSWTKESSILGISYTLFKSL  843

Query  1670  TREDSTYAHRKYMNQ-----VLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
             T ++      ++  +     +L + PG+L+LDEGH PR+ +S + KAL KV T  RI+LS
Sbjct  844   TGQNRKVGSPRHTTEDEQRKILLEFPGLLVLDEGHTPRNDQSLIWKALCKVETQRRIILS  903

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKY--KKRVKGAKTRFSLENRARKMFidk  1332
             GT FQNNF E FNTLCL RP+F + +  E    +  K   K +K R   +  AR +    
Sbjct  904   GTPFQNNFDELFNTLCLVRPKFAERISLECYGNFSVKHGRKRSKVREEWDVMARSILKKD  963

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL  1155
                             L  LK +   F+ V++G    + LPGLQ   ++++   LQ+ +L
Sbjct  964   KD-------------ALEKLKAMINPFVHVHKGIILQERLPGLQDSVIVLRPGKLQKSLL  1010

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGS  975
               +Q  +      P  L  L++L ++HP L    + S       ++  LE  +   + G 
Sbjct  1011  ENVQSMKN-----PFLLSHLVSLISVHPSLFSQCSVSESEGLTVDISELESLRKKPEAGV  1065

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             K +F+M LI  C    EKVL+F   I P++   ++ +  + W  G E+L + G  ++ +R
Sbjct  1066  KTRFLMELIRLCEATHEKVLVFSQFIVPLSFIRDLLKSNFHWTDGKELLYMDGQADIKQR  1125

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
                ++ F +     +V+LASI  C+EGISL  ASRV+L+D  WNPS  +QAI+RA+R GQ
Sbjct  1126  QSSINAFNDPTSEVRVLLASIKACSEGISLVGASRVVLVDVVWNPSVERQAISRAYRLGQ  1185

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSH-WQAPKIEDELLGEI  441
               VVY+Y L+ +GT+E EKY R   K+ +S ++F S D   +P     +   +D++L E+
Sbjct  1186  KNVVYIYHLITSGTMEAEKYCRQVEKDRLSKLVFASSDGTGNPGQKVTSTGSDDKVLEEL  1245

Query  440   VEEDR-ATLFHMIMKNEKASNM  378
             +     + +F  I+   K SN+
Sbjct  1246  IHHSTLSDMFEKIINQPKESNL  1267



>ref|XP_009378410.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like, partial 
[Pyrus x bretschneideri]
Length=677

 Score =   361 bits (926),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 235/673 (35%), Positives = 358/673 (53%), Gaps = 47/673 (7%)
 Frame = -3

Query  2393  HDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSG-KEQRPEEV-VMEEKQGDDAD  2220
             H   L+EEIG  CR C  +  EIK + P F+   C   G +   P+ + + +E Q     
Sbjct  9     HQLMLDEEIGSRCRFCSYLDQEIKYIVPEFVKYPCERFGARVSEPDNLSIFDELQS----  64

Query  2219  LDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP  2040
             LD+ + P S    SS V  E   W  IP +++ + +HQR  FEF+W +IAG I   ++  
Sbjct  65    LDYGSDPHSG--CSSHVHAEGTVWDFIPGVKSSMYSHQREGFEFIWNHIAGGIHVEELKR  122

Query  2039  ESKKR--GGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWK  1866
              S      GC+ISH+PG GKT L I FL +YLKLFP  RPL++AP++ L TW +E  KW+
Sbjct  123   RSSDYSGNGCIISHAPGTGKTRLTIVFLQTYLKLFPKCRPLLIAPRSMLLTWEEEFKKWE  182

Query  1865  IPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDC-LEKMQKWLAHPSVLLMGY  1689
               IP + ++  +   GE     + L   +   + +  V +  + K+  W    S+L + Y
Sbjct  183   FDIPFHNLNNTEL-SGEENEAAVDLMMKIDGPKSINRVNNSRMLKLYSWAKERSILGISY  241

Query  1688  TSFLTLTREDSTYAHRKYMNQVLR----QCPGILILDEGHNPRSTKSRLRKALMKVNTSL  1521
               F  L+  D + A +K + +V+R    + PG+++ DEGH PR+ KS + KAL ++ T  
Sbjct  242   HLFEKLSGADHSGAKKKGLAEVMRDILVEFPGLVVFDEGHTPRNNKSHIWKALSEIKTKK  301

Query  1520  RILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAK-TRFSLENRARKM  1344
             RILLSGT FQNNF E FNT+C+ RP F               +  AK T   L +RARK 
Sbjct  302   RILLSGTPFQNNFQELFNTICVVRPMFA------------ASIDSAKFTGDFLRSRARKS  349

Query  1343  ----FidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKS  1179
                 +              E+++    +K+    F++VY+G    D+LPGL+   +++  
Sbjct  350   NVEKWQWTSVANCSEKVADEKEQHATEVKEKIAPFVNVYKGSVLQDSLPGLRNSVVVLHP  409

Query  1178  TTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHP-WLIRTTACSGQYfkeeelealek  1002
               LQ++   ++Q  +  +     + E L  + +IHP  L+   A SG +      + L++
Sbjct  410   MQLQKKFHQRIQGVKEQF-----QYEHLEAINSIHPSLLLHEDAFSGDW------DRLKE  458

Query  1001  fkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVL  822
              K +   G K KF+M LI       E+VL+FC  I+P+ L  ++    + W +G EVL +
Sbjct  459   LKLNPDAGVKTKFLMELIRLSDALNERVLVFCQYISPLTLARDLLRSQFHWSEGEEVLYM  518

Query  821   QGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQA  642
              G  ++ +R   M  F +    +KV+LAS   C EGISL  ASRV+LLD  WNPS  +QA
Sbjct  519   DGKCDMKQRQSSMKIFNDPSSKAKVLLASTKGCCEGISLVGASRVVLLDVTWNPSVERQA  578

Query  641   IARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKI-  465
             I+RA+R GQ K+VYVY LL  GT EE KY+R   K  +S ++FS+    D    +   + 
Sbjct  579   ISRAYRLGQKKIVYVYHLLMDGTNEEHKYRRQVDKSRLSELVFSDSDRNDSLEKKIRAVS  638

Query  464   EDELLGEIVEEDR  426
             ED++L E+ + ++
Sbjct  639   EDKILEEMAQHEK  651



>gb|EPS60956.1| hypothetical protein M569_13845, partial [Genlisea aurea]
Length=636

 Score =   359 bits (921),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 252/677 (37%), Positives = 350/677 (52%), Gaps = 83/677 (12%)
 Frame = -3

Query  4208  MKRRSIH-QNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNV  4032
             MKRR +H Q  HPFD  PFEAF+ GSW+ V+ +++  G     V+++G+  E++I +SN+
Sbjct  1     MKRRVLHHQTLHPFDSCPFEAFQCGSWRAVDHLKVAGGAISTVVVEKGEAFEKDIPMSNL  60

Query  4031  RIRSRNATSSDCACFLRPGLDISVF--STPHQsedsdeennedEKMEPEPAWIDAKIRSI  3858
             R+RSR A+S DC  FLRPG+DI V   S+P      +           E  WIDAKIRS+
Sbjct  61    RVRSRKASSDDCVWFLRPGVDICVLYPSSPDSESSVNGG---------ELVWIDAKIRSV  111

Query  3857  ERKPHGF-GCVCQFHISVYVTQGPPPIV-KKTLSKEIKVVQLNQIAILQKIEQKPCEDKY  3684
              RK H F  C C+F++S Y+ QGP      K +SKE  VV+L+QI+I+Q +E +PC  KY
Sbjct  112   ARKRHEFFECYCEFYVSFYMDQGPALYYGAKRVSKETAVVKLDQISIIQHLELRPCYGKY  171

Query  3683  YRWSLSDDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDI  3504
             YRW  S+DC ++QKF+L   +F SD+SW+LVAS  K+  F + +  N +VY + +     
Sbjct  172   YRWCFSEDCCSIQKFRLMNCEFTSDVSWLLVASVVKRAAFFIGAFKNHVVYSVSE-----  226

Query  3503  DAPNSEYHSYAVSFKLENEVSTPIIIQFNPDIPERGPEGDVYEAGPLVVYD--ELRRSKR  3330
               P S   +Y +SF  EN V  P  I+F+P + E   EG   E G    YD  ELRRS R
Sbjct  227   --PGSSAATYTLSFTWENGVLNPRTIRFDPSMIEEECEG--REVGFASCYDSTELRRSTR  282

Query  3329  RFVQPERYLGCDDYLTEFDVEMTRLVGGKMYKSELEELPMALSIQADH------------  3186
             R V+P+R+L  D  L  ++VE+TR+   K+Y+ E      +     DH            
Sbjct  283   RAVRPDRFLAMDKPLA-YEVEVTRISESKIYELEYRHTASSPYDDDDHEEEEEEEEEEEE  341

Query  3185  -----AYQNGDID---------NKTLACYQQElrdnsllsrnrnssksDTNRKR-----V  3063
                  A  NGD D          +  + YQ+ + D     +  +S K  T+ K       
Sbjct  342   EEESEADDNGDNDVDLPLLPFTVQADSEYQKRIGDGKRPFKFPSSPKKKTHSKEKRNPSQ  401

Query  3062  SGDKAHLAIVPLQLSAENNLFDQKENPLSFEDNEDLSAEIREIVSKYIYVNGSSAVEMKK  2883
              G K  LA+V       NN     +N  S +D       + ++VSK+   + S  +   K
Sbjct  402   GGKKKELALVLSNGDDANN----NKNSSSIDDR------LEDMVSKFFQTSSSPLLHRNK  451

Query  2882  SSLNLMQGRRWGQVKVSKLKFMGLDVkgggigsskkkakKRTCPSQRDSIYDIRS-FRKG  2706
              +  +    R G+ K    +            S+   + ++ C   RD   D R+ FRKG
Sbjct  452   KAAEVEFHGRGGEAKKQARR-------KYHRQSNYHASLRKNCFYVRD---DARTCFRKG  501

Query  2705  SISANVYRELIRRCMANIDETLNKE---QPPIIDQWKEFQNTKSCQREPIeksstnneee  2535
             S +A + RELIRRCM NID TL  E    PP++DQW E +  +      +          
Sbjct  502   SATAQLCRELIRRCMKNIDATLTNEPIHPPPVLDQWNEEKEEERAA-GGVGTGEGERSSS  560

Query  2534  lseLDMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
              SE+DMLWKEMELALAS YL+D+ ED+    A   H A         HD  LNEEIG VC
Sbjct  561   TSEIDMLWKEMELALASWYLVDEGEDSGGVGARS-HEARGPSFGCSQHDLMLNEEIGTVC  619

Query  2354  RLCGVVSTEIKDVPPPF  2304
             R+CG V TEIKD+ P F
Sbjct  620   RMCGFVETEIKDILPTF  636



>ref|XP_010274543.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Nelumbo 
nucifera]
Length=1235

 Score =   374 bits (959),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 245/738 (33%), Positives = 380/738 (51%), Gaps = 55/738 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL--LDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             D LW E + AL S  +       +    +  E  M      R+  H+  L+E IG+ C+ 
Sbjct  517   DQLWTEFDFALKSDEIGSFSSVVENEYSNVPESEMNQDTLCRLGKHELILDERIGIRCKF  576

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD---HFAIPVSSNKPS  2178
             C  +  EIK V PP   +    SGK     E        DDA L    HF    S +   
Sbjct  577   CSFIKLEIKYVLPPLGTNPVERSGKRTTSAE--------DDASLLDGLHFE-DASVDLCG  627

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE--SKKRGGCVISH  2004
             S V      W ++P +R  +  HQ+  FEF+WKN+AG +   +++    S   GGCVISH
Sbjct  628   SSVHTRGTVWDIVPGVRETMYPHQQEGFEFMWKNLAGDVDLEKLNKSTGSDGVGGCVISH  687

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKTLL I FL +Y++ +P  RPL++AP++ L TW +E  KWK+ IP + ++  +  
Sbjct  688   APGTGKTLLTIIFLQTYMRQYPSCRPLIIAPRSMLLTWEEEFKKWKVDIPFHNLNKLEFS  747

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
               E L     +     RN++   ++    K+  W +  S+L + Y  F  L  E      
Sbjct  748   GKEKLAALSLMKISAHRNKNFTRMI----KLFSWNSETSILGISYPLFEKLAGERFVLDK  803

Query  1643  R-KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFN  1467
               + + ++L Q PG+L+LDEGH PR+ +S++ KAL K+ T  RI+LSGT FQNNF E +N
Sbjct  804   EGEQIRKILLQKPGLLVLDEGHTPRNERSQIWKALSKIETEKRIILSGTPFQNNFNELYN  863

Query  1466  TLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkE  1287
             TLCL RP F +++  +    Y+ ++   K        A+  +    S             
Sbjct  864   TLCLVRPTFAEKIQSQPRKIYQGKIVAEK------KEAKGKWTSLTSSIGKHDDR-----  912

Query  1286  GLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
              L  L+ +   F+ V++G    +NLPGL+   +++    LQ+ +L  +Q  +      PL
Sbjct  913   -LEELRAMIDPFVHVHKGNILKENLPGLRDCVIVLHPPPLQKRLLQAIQGIQN-----PL  966

Query  1109  ELELLITLGAIHPWLI--------RTTACSGQYfkeeelealekfkfdlkLGSKVKFVMS  954
             ELE +++L ++HP L+        R   C+    +    + LE+ K D   G K++F+M 
Sbjct  967   ELEYMVSLLSVHPSLLISMKGSFPRKEECN--IEESINEDMLERIKLDPNEGVKIRFLME  1024

Query  953   LIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKF  774
             LI       EKVL+F   I P +   E    F+GW +G EVL + G +++  R   ++ F
Sbjct  1025  LIRLSEAMNEKVLVFSQFIEPFSFIKEQLRSFFGWTEGKEVLQMDGKLDVKIRQSSINLF  1084

Query  773   EEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
              +     +++LAS+  C+EGI+L  ASRV+LLD  WNPS  +QAI+RA+R GQ KVVY Y
Sbjct  1085  NDPTSEVRILLASMKACSEGINLVGASRVVLLDVVWNPSVERQAISRAYRLGQKKVVYTY  1144

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKI-----EDELLGEIVEED  429
              L+ +GT E EKY R   K+ +S ++FS   ++      +P +     ED++L E+V  +
Sbjct  1145  HLITSGTKEGEKYCRQAEKDRLSELVFSSRHMDGDKLNASPTVLKDEMEDKILEEMVRHN  1204

Query  428   R-ATLFHMIMKNEKASNM  378
             +   +F  I+   K SN+
Sbjct  1205  KLKGMFEKIIYQPKDSNL  1222



>ref|XP_011032462.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Populus 
euphratica]
Length=1205

 Score =   373 bits (957),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 254/732 (35%), Positives = 386/732 (53%), Gaps = 39/732 (5%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDD-TEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             LW +M LAL      DD T D N   A E+   T    R  +H+  L+EEIGL+C+ C  
Sbjct  486   LWADMALALCLKDTTDDSTLDENDDDAHEVEPDTVTLCRQGNHELYLDEEIGLLCKYCSF  545

Query  2339  VSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE--VE  2166
             V  EIK   PPF        GK  R + V M+    +D    H         P  +    
Sbjct  546   VDLEIKYHVPPF---DRYPRGKSARRDFVTMQHNIFNDL---HHQDSGRGTHPDYDPCTL  599

Query  2165  VEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISHSPGA  1992
              +   W LIP +   +  HQR  FEFLWKNIAG I   ++   S   GG  C+ISH+PG 
Sbjct  600   AQGTVWNLIPGIGKGMHGHQREGFEFLWKNIAGGIYLDKLKDNSNLNGGTGCIISHAPGT  659

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEV  1812
             GKT L I FL +Y++L+P SRP+++AP + L TW  E +KW + IP + I   +   G+ 
Sbjct  660   GKTRLTIVFLQTYMQLYPTSRPVIVAPCSMLLTWEAEFLKWGVDIP-FHIMNKKNLSGKE  718

Query  1811  LRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED------STY  1650
              R  M L   L   +  ++ +  + K+  W    S+L + Y  F  L  E+      S  
Sbjct  719   NRTAMDLFRELKPAERGLNAIRMV-KLYSWKKERSILGISYRLFEELVGEEKSKTKVSDK  777

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
                  + +VL + PG+L+LDEGH PR+ +SR+ KAL KV T  RI+LSGT FQNNF E +
Sbjct  778   TEDDQVRKVLLELPGLLVLDEGHTPRNDRSRIWKALSKVRTQKRIILSGTPFQNNFDELY  837

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NTLCL +P+F +E+  +    + KR    +        AR+ +    +     +  +   
Sbjct  838   NTLCLVKPKFAEEISSKHHRAFPKRRDCKRN-----TDARRNWASLTTAIGKVTDHKLEA  892

Query  1289  EGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
             + +  L+K+   F+ V++GG   + LPGL+   ++++   LQ+ +L   ++ + I     
Sbjct  893   QRVEELRKMIWQFVHVHKGGVLRERLPGLRDSVVILQPVHLQKTLL---ENFKQINGLDH  949

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
              E+E  +++ ++HP L+   +         +   LE  +   + G K KF+M LI  C  
Sbjct  950   FEMEYSLSVLSVHPSLLPEKSVG--TLDFVDRMELEMLRSKPEAGIKTKFLMELIRLCQA  1007

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
             R EKVL+F   + P+NL ++  E  + W +G ++L + G +++ ER  ++  F      +
Sbjct  1008  RNEKVLVFSQYLEPLNLVIKQLELNFSWIQGEDMLYMHGKLKIDERQTLIKHFNNASSNA  1067

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV+LAS   C+EGI+L  ASRV+LLD  WNPS  +QAI+RA+R GQ+KVVY+Y L+ +GT
Sbjct  1068  KVLLASTRACSEGINLVGASRVVLLDVLWNPSVERQAISRAYRLGQEKVVYIYHLITSGT  1127

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQ------APKIEDELLGEIVEEDRATL-F  414
             +EEEKY     KE +S ++F  D     S+ Q      A   +D +L E+V+ D+  L F
Sbjct  1128  MEEEKYFCQVEKERLSKLVF--DCTNRSSNHQTGVFDIAEDKKDRILEEMVQHDKLKLMF  1185

Query  413   HMIMKNEKASNM  378
               I+   K +N+
Sbjct  1186  KKIVYQPKDTNL  1197



>ref|XP_006844384.1| hypothetical protein AMTR_s00142p00081110 [Amborella trichopoda]
 gb|ERN06059.1| hypothetical protein AMTR_s00142p00081110 [Amborella trichopoda]
Length=1320

 Score =   371 bits (952),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 249/712 (35%), Positives = 392/712 (55%), Gaps = 39/712 (5%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKS--ATELHMATKKGTRVCH---HDFRLNEEIGLV  2358
             D LW+E   AL  C  L++   + + S  A+ L  A  K +  C    H + +N++IG+V
Sbjct  628   DELWREFNFAL-ECQSLENMNPSTMNSNIASNLPEAESKSSNSCSEGGHLYIINDQIGIV  686

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
             CR C  V  EI+ V PPF+ +    S K+   EE       G     +   +P + + PS
Sbjct  687   CRYCHHVQLEIQYVLPPFVTNVTRKSRKKNSDEEGNAS-LLGATFSQEVNVLPCNYSTPS  745

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-SKKRGGCVISHS  2001
                  +   W +IP ++N++ AHQ   FEFLW N+AG I   ++ PE S+  GGCVISH+
Sbjct  746   -----KGTVWDMIPGVKNRMHAHQIEGFEFLWYNLAGGITLDKLKPEGSEGIGGCVISHA  800

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKTLL IAFL S+++++P  +P+++AP + + +W +E+ KWK+ I ++ I     + 
Sbjct  801   PGTGKTLLTIAFLQSFMQVYPDCKPILIAPLSMMCSWREELKKWKVDISLH-ILNIDAFS  859

Query  1820  GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED-STYAH  1644
              E      ++      ++ ++ ++    K+  W    S+L + Y  F  LT E+  T   
Sbjct  860   REEDAAMHEMVSEYTSDKTLVRLV----KIYSWSKGRSILGISYELFSKLTMEEHKTKDK  915

Query  1643  RKY--MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
             RKY  + ++L +  G+L+LDEGH  R+  S + KAL +V T  RI+LSGT FQNNF E F
Sbjct  916   RKYKEIQELLFKESGLLVLDEGHTARNQSSNIWKALTQVKTLRRIMLSGTPFQNNFIELF  975

Query  1469  NTLCLARPRFVDEV--LKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskere  1296
             NTL L RP F D++  +  L+  +  R    K R +   R R  F+ KI  KI+  KE  
Sbjct  976   NTLYLVRPFFADDIFEMSSLNHPFWLRNLSEKKRAA---RIRSSFMAKIGHKIECRKEDS  1032

Query  1295  rkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGF  1116
              +  L +L+ +   FI  ++G   DNLPGL+ Y +++    +Q  IL     +  ++   
Sbjct  1033  NEC-LAVLRNMVDPFIHSHDGSVLDNLPGLREYKVVLILFPIQDTILKSKMSKVNLFDN-  1090

Query  1115  PLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCL  936
                 E +++  AIHP L+++ +      ++     L+  +   + G K +FV+ LI    
Sbjct  1091  ----ECIVSSVAIHPSLLKSPS-----KEDMLKFKLDDIRLKWEEGVKTRFVIDLIRLSN  1141

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDI-ELFERGRVMDKFEEVGG  759
             +  E+VLIF   I P+ L +      +GW++G E+L L GD+ ++  R  ++ KF +   
Sbjct  1142  VANERVLIFSQYIPPLRLLMHQLVSCFGWKEGCEILQLDGDVRDVGLRQSMIHKFNDPNS  1201

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
              ++V+L SI  C+EGI+LT ASRVILLD  WNP+  KQA++RAFR GQ K+VY+Y L+A 
Sbjct  1202  EARVVLVSIRACSEGINLTGASRVILLDPVWNPAVVKQAVSRAFRLGQKKIVYIYHLIAH  1261

Query  578   GTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
              TLE++KY R  WK  +S  +F + +  ++        IED++L E+ E  R
Sbjct  1262  ETLEQQKYDRHAWKSCLSKSVFGTAEEHKEEQRINGTDIEDDILRELFENAR  1313



>ref|XP_002517508.1| ATP-dependent helicase, putative [Ricinus communis]
 gb|EEF45050.1| ATP-dependent helicase, putative [Ricinus communis]
Length=1138

 Score =   365 bits (936),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 258/714 (36%), Positives = 374/714 (52%), Gaps = 46/714 (6%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCH---HDFRLNEEIGLVCR  2352
             D LW EM LAL +  + +   + ++    EL  A      +CH   H F L+EEIG+ CR
Sbjct  425   DNLWAEMALALCANDVTEGKSEADVCPEVELDTAA-----LCHRGNHQFILDEEIGIKCR  479

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEV--VMEEKQGDDADLDHFAIPVSSNKPS  2178
              C  V  EIK    PF      +S +     E   + EE    D+D D      S +   
Sbjct  480   FCSFVDLEIKYYTAPFGKQPWGNSERRDGNGEKLDIFEELHIQDSDDD------SKHGYD  533

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISH  2004
             S    +   W +IP +   L  HQR  FEFLWKNIAG I   ++   ++  GG  C+ISH
Sbjct  534   SCTHAQGTVWGIIPGIGRDLHEHQREGFEFLWKNIAGGIYLDKLKERTRFDGGSGCIISH  593

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKT L I FL SY+KL+P  RPL++ P T L +W  E  KWK  IP + ++  Q +
Sbjct  594   APGTGKTRLAIVFLQSYMKLYPECRPLIITPSTLLLSWEAEFKKWKFDIPFHNLNT-QKF  652

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              G      ++L      + + + ++    K+  W    SVL + Y  F  L RED   + 
Sbjct  653   CGRENAAALRLIKSGQHSINSVRMV----KLYSWKKDKSVLGISYKLFEELVREDKKRSK  708

Query  1643  RKY-----MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
              +      M   L Q PG+L+LDEGH PR+  S + KAL ++ T  RI+LSGT FQNNF 
Sbjct  709   TQQKSEDDMRNALLQLPGLLVLDEGHTPRNDNSLVFKALSRIRTDKRIILSGTPFQNNFT  768

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             E FNTL L RP+F D +L   +  + K+ +G KT     N AR  +            +R
Sbjct  769   ELFNTLLLVRPKFADSLLYNCNESFGKKRRGRKT-----NGARGTWASLTGSIAKDGNDR  823

Query  1298  erkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
              + E L  ++ +   F+ VY G      LPGL+   ++++   LQ+ +L K+Q     + 
Sbjct  824   FKAEKLEEVRAMIKPFVHVYRGNILQQRLPGLRDAMVILQPVQLQKSLLDKVQGTGNFHS  883

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
                   E L++L ++HP  +          K  E   LEK K + ++G+K KF+M +I  
Sbjct  884   ------EYLVSLVSLHPSSLLLLKKISNLEKFAERSVLEKHKLNPEMGAKTKFLMEIILL  937

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
                 KE+VL+F   + P+ L     E  + W +G E+L + G +++ ER  ++  F +  
Sbjct  938   SEAMKERVLVFSQYLDPLKLIAMQLESRFHWIQGKEILHMHGKLDMGERQSLIKDFNDRK  997

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               +KVMLAS   C+EGI+L  ASRV+LLD  WNPS  +QAI+RA+R GQ+KVVY+Y L+A
Sbjct  998   SEAKVMLASTKACSEGINLVGASRVVLLDVVWNPSVVRQAISRAYRLGQEKVVYIYHLIA  1057

Query  581   TGTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSHWQAPKI----EDELLGEIVE  435
             + TLEE+KY R   KE +S ++F S D    P    +PK+    ED +L EIV+
Sbjct  1058  SETLEEDKYCRQAEKERLSELVFDSSDRASSPQKI-SPKVSDGEEDRILEEIVQ  1110



>ref|XP_007019904.1| Chromatin remodeling 31, putative [Theobroma cacao]
 gb|EOY17129.1| Chromatin remodeling 31, putative [Theobroma cacao]
Length=1003

 Score =   361 bits (926),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 229/708 (32%), Positives = 374/708 (53%), Gaps = 56/708 (8%)
 Frame = -3

Query  2438  TELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPE  2259
             +E+   T    R  HH   L+EEIGL C+ C  V  EIK + PPFM       GK +R +
Sbjct  316   SEVKHDTATLCRQGHHHIILDEEIGLKCKFCSFVQLEIKYIVPPFM---TDPYGKFERRD  372

Query  2258  -----EVVMEEKQGDDADLDHFAIPVSSNKPSSE--VEVEDNAWALIPDLRNKLRAHQRR  2100
                    + +  Q  D+D D          P  +   +++   W +IP ++ +L  HQR 
Sbjct  373   FGMVDSAIFDGLQYHDSDCDM---------PGCDPWADIQGTVWEIIPKVKGQLYPHQRE  423

Query  2099  AFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLV  1920
              FEF+W NIAG I   +    S   GGC+ISH+PG GKTLL I FL +YLK +PG RP++
Sbjct  424   GFEFIWNNIAGGIYRDKSKNSSNGGGGCIISHAPGTGKTLLTIVFLYTYLKEYPGCRPVI  483

Query  1919  LAPKTTLYTWYKEIIKWKIPIPVYQIH-----GGQTYKGEVLRQKMKL-CPGLPRNQDVM  1758
             +AP++ L TW  E  KWK+ IP + ++     G +  KG  L +K K   P  P  + ++
Sbjct  484   VAPRSMLLTWAAEFRKWKVDIPFHNLNSLDFTGKEKAKGIGLYEKFKQNVPDGPLARRLV  543

Query  1757  HVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHR-----KYMNQVLRQCPGILIL  1593
              +L        W +   +L + Y  F  L   ++    +     K+++++L + PG+ +L
Sbjct  544   KLL-------SWKSDGGILGVSYRLFEQLAGTENKGKRKCTAIDKHVSRILLELPGLFVL  596

Query  1592  DEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELD  1413
             DEGH PR+  + + KAL  + T  RI+LSGT FQNNF E FNTLCL RP+F + +     
Sbjct  597   DEGHTPRNEGTLMWKALSMIKTERRIILSGTPFQNNFDELFNTLCLVRPKFAEGI----Q  652

Query  1412  PKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEG  1233
              + ++RV G   RF   N A++ +          +   E  + L  L+ +   F+ V++G
Sbjct  653   SRNQERV-GKNCRFK-RNEAKEKWASLTGSIGKVADRDEAGK-LKELRAVIKPFVHVHKG  709

Query  1232  GS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRT  1056
                   LPGL+   ++++ + LQ++IL +L++ +       L L+  ++L +IHP L++ 
Sbjct  710   TILQTTLPGLRHSVVVLQPSDLQKKILERLKETKN-----ALFLDYYVSLISIHPSLLQQ  764

Query  1055  TACSGQYfkeeelealekfkfdlk----LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPI  888
              +      +     A       ++     G K KF+  L+       EKV++F   + P+
Sbjct  765   LSDQKDVMESVSSIARMDELERIRLKPDKGVKTKFLKELLKFSEALDEKVIVFSQYLEPL  824

Query  887   NLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGIS  708
             NL ++  + F+ W++G E+L + G  ++ +R   ++ F +    ++V+LAS   C+EGI+
Sbjct  825   NLIMDQLKDFFKWKEGEEILYMHGKCDIKQRQSSINVFNDPTSKARVLLASTKACSEGIN  884

Query  707   LTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWV  528
             L   SRV+LLD  WNPS  +QAI+RA+R GQ K+VY Y L+++GT+E  K  R   K+ +
Sbjct  885   LVGGSRVVLLDVTWNPSVERQAISRAYRLGQKKIVYTYHLISSGTMEGLKCYRQAGKDRL  944

Query  527   SSMIFSEDLVEDPSHWQAPKI-EDELLGEIVEEDR-ATLFHMIMKNEK  390
             S ++FS     D    +   + ED++L E+ + ++  ++F  I+   K
Sbjct  945   SELVFSSSEKGDDHQKKVYDVLEDKILEEMFQHEKLKSMFEKIINQPK  992



>emb|CDX93009.1| BnaA03g37310D [Brassica napus]
Length=970

 Score =   356 bits (914),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 245/742 (33%), Positives = 363/742 (49%), Gaps = 91/742 (12%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMAT--KKGTRVCH---HDFRLNEEIGLV  2358
             D LW++M LAL               S   LH +T  K G   C    HDF L+EEIGL 
Sbjct  288   DRLWQDMALAL---------------SLEGLHSSTYFKNGDVSCSNGKHDFVLDEEIGLK  332

Query  2357  CRLCGVVSTEIKDVPPPFM------------PSTCSSSGKEQRPEEVVMEEKQGDDADLD  2214
             CR C  VS E+KDV P                +TC + G                D  LD
Sbjct  333   CRCCSYVSVEMKDVSPAMYRANVKYRDTVNYKNTCRTKG----------------DPLLD  376

Query  2213  HFAIPVSSNKP--SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP  2040
                +  S +    +S  + +   W  IP ++N L  HQR  FEF+WKN+AG+    ++  
Sbjct  377   SLDLEASEHNSNVASLKDTQGTVWEYIPGIKNTLYPHQREGFEFMWKNLAGTTKLDELKS  436

Query  2039  ES-KKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI  1863
                K+ GGC+ISH+PG GKT L I FL SYL+ FP S P+V+AP + L TW +E  KW  
Sbjct  437   SVVKESGGCIISHAPGTGKTRLTIVFLQSYLQQFPDSHPVVIAPASLLLTWEEEFKKWNS  496

Query  1862  PIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLE--KMQKWLAHPSVLLMGY  1689
              IP Y +   Q   G      + L   L  N+      D +   K+  W    S+L + Y
Sbjct  497   NIPFYNM-SNQELSGLENPSAVSL---LKVNRQHRSKTDSVRMVKLYSWRNKKSILGISY  552

Query  1688  TSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILL  1509
             + +  LT         +   ++L   PG+L+LDEGH PR+  S + K L +V T  RI+L
Sbjct  553   SLYEKLTGNKCASGETQKFRKMLLDFPGLLVLDEGHTPRNQNSCIWKVLTEVKTEKRIIL  612

Query  1508  SGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidki  1329
             SGT FQNNF E  N LCL RP + D++   L    +   +G   RF  E           
Sbjct  613   SGTPFQNNFKELSNVLCLTRPAYKDKISSRLHDLTRLSQEGKNGRFDEE-----------  661

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILV  1152
                           G+  LK +   F+ V++G    ++LPGL+   +++ +   Q +IL 
Sbjct  662   -------------IGIAELKDMIAPFVHVHKGNILRESLPGLRDCVVVLNAPFQQAKILT  708

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLI---RTTACSGQYfkeeelealekfkfdlkL  981
             ++   +  +     +LE  ++  ++HP L    + T           L++LE    + K 
Sbjct  709   RIDHSQKTF-----DLEHKLSAVSVHPSLYLRRKQTDKERLTIGPVVLKSLESLTLESKE  763

Query  980   GSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELF  801
             G+K +F++  I      KEKVL+F  +I  + L  +     +GW +G E+L + G ++  
Sbjct  764   GAKTRFLIDFIRFSETVKEKVLVFSQHIDTLELIRDQLSAVFGWTEGEEILYMHGQLQQK  823

Query  800   ERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRP  621
              R R+++ F +    SKV+LAS   C+EGI+L  ASRV+LLD +WNPS  +QAI+RA+R 
Sbjct  824   FRQRLINNFNKSDSKSKVLLASTKACSEGINLVGASRVVLLDVDWNPSVERQAISRAYRI  883

Query  620   GQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEI  441
             GQ +VVY Y L+  GT E +KY +   K  +S M+FS    +D         ED++L E+
Sbjct  884   GQKRVVYTYHLMVKGTTEWDKYCKQNKKHRISEMVFSPTNEKDKLIENEVVSEDKILDEM  943

Query  440   VEEDR-ATLFHMIMKNEKASNM  378
             V  ++   +F  I+  +K S+M
Sbjct  944   VRHEKLKDMFEKILYRKKESDM  965



>ref|XP_009135889.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Brassica 
rapa]
Length=1066

 Score =   358 bits (919),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 243/742 (33%), Positives = 364/742 (49%), Gaps = 89/742 (12%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMAT--KKGTRVCH---HDFRLNEEIGLV  2358
             D LW++M LAL               S   LH +T  K G   C    HDF L+EEIGL 
Sbjct  382   DRLWQDMALAL---------------SLEGLHSSTYFKNGDVSCSNGKHDFVLDEEIGLK  426

Query  2357  CRLCGVVSTEIKDVPPPF--------------MPSTCSSSGKEQRPEEVVMEEKQGDDAD  2220
             CR C  VS E+KDV P                  +TC + G                D  
Sbjct  427   CRCCSYVSVEMKDVSPAMDKYRANVKYRDTVNYKNTCRTKG----------------DPL  470

Query  2219  LDHFAIPVSSNKP--SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI  2046
             LD   +  S +    +S  + +   W  IP ++N L  HQR  FEF+WKN+AG+    ++
Sbjct  471   LDSLDLEASEHNSNVASLKDTQGTVWEYIPGIKNTLYPHQREGFEFMWKNLAGTTKLDEL  530

Query  2045  DPES-KKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
                  K+ GGC+ISH+PG GKT L I FL SYL+ FP S P+V+AP + L TW +E  KW
Sbjct  531   KSSVVKESGGCIISHAPGTGKTRLTIVFLQSYLQQFPDSHPVVIAPASLLLTWEEEFKKW  590

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGY  1689
                IP Y +   Q   G      + L  G  +++     +  + K+  W    S+L + Y
Sbjct  591   NSNIPFYNM-SNQELSGLENPSAVSLLKGNRQHRSKTDSVRMV-KLYSWRNKKSILGISY  648

Query  1688  TSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILL  1509
             + +  LT         +   ++L   PG+L+LDEGH PR+  S + K L +V T  RI+L
Sbjct  649   SLYEKLTGNKCASGETQKFRKMLLDFPGLLVLDEGHTPRNQNSCIWKVLTEVKTEKRIIL  708

Query  1508  SGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidki  1329
             SGT FQNNF E  N LCL RP + D++   L    +   +G   RF  E           
Sbjct  709   SGTPFQNNFKELSNVLCLTRPAYKDKISSRLHDLTRLSQEGKNGRFDEE-----------  757

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILV  1152
                           G+  LK +   F+ V++G    ++LPGL+   +++ +   Q +IL 
Sbjct  758   -------------IGIAELKDMIAPFVHVHKGNILRESLPGLRDCVVVLNAPFQQAKILT  804

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLI---RTTACSGQYfkeeelealekfkfdlkL  981
             ++   +  +     +LE  ++  ++HP L    + T           L++LE    + K 
Sbjct  805   RIDHSQKTF-----DLEHKLSAVSVHPSLYLRRKQTDKERLTIGPVVLKSLESLTLESKE  859

Query  980   GSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELF  801
             G+K +F++  I      KEKVL+F  +I  + L  +     +GW +G E+L + G ++  
Sbjct  860   GAKTRFLIDFIRFSETVKEKVLVFSQHIDTLELIRDQLSAVFGWTEGEEILYMHGQLQQK  919

Query  800   ERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRP  621
              R R+++ F +    SKV+LAS   C+EGI+L  ASRV+LLD +WNPS  +QAI+RA+R 
Sbjct  920   FRQRLINNFNKSDSKSKVLLASTKACSEGINLVGASRVVLLDVDWNPSVERQAISRAYRI  979

Query  620   GQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEI  441
             GQ +VVY Y L+  GT E +KY +   K  +S M+FS    +D         ED++L E+
Sbjct  980   GQKRVVYTYHLMVKGTTEWDKYCKQNKKHRISEMVFSPTNEKDKLIENEVVSEDKILDEM  1039

Query  440   VEEDR-ATLFHMIMKNEKASNM  378
             V  ++   +F  I+  +K S+M
Sbjct  1040  VRHEKLKDMFEKILYRKKESDM  1061



>ref|XP_008342502.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Malus 
domestica]
Length=1055

 Score =   356 bits (914),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 241/715 (34%), Positives = 364/715 (51%), Gaps = 48/715 (7%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-----TNLKSATELHMAT--KKGTRVCHHDFRLNEEIGLV  2358
             LW E   +L SC +     +      +L +  E   AT  K+G+    H   L+EEIGL 
Sbjct  344   LWDEFRFSLRSCEIGSTGSNKVGNQDSLPAVHEEDTATLCKRGS----HQLILDEEIGLR  399

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGK---EQRPEEVVMEEKQGDDADLDHFAIPVSSN  2187
             C+ C  ++ EIK + P F+ +     G+   E     V  E +  D     H        
Sbjct  400   CKXCTYLAKEIKYIFPEFVENPYEKFGRRGFETDNWSVFDELRSHDSGSGPHSGC-----  454

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CV  2013
               SS +  E   W  IP +++ +  HQR  FEFLW +IAG I   ++   S    G  C+
Sbjct  455   --SSHLPDEGTVWDFIPGVKSSMYPHQREGFEFLWNHIAGGIHVEELKKRSSDYAGNGCI  512

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PG GKTLL I FL +Y++LFP  RPL++AP++ L TW +E  KW   IP + ++  
Sbjct  513   ISHAPGTGKTLLAIVFLQTYMQLFPNCRPLLIAPRSMLLTWEEEFQKWGFDIPFHNLNN-  571

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDC-LEKMQKWLAHPSVLLMGYTSFLTL--TRE  1662
                 GE +   + L   +   + +  V +  + K+  W    S+L + Y  F  L  T  
Sbjct  572   TDLSGEEIEAXVNLVMRIEGRKSINRVKNSRMLKLCSWTKKRSILGISYQLFEKLCGTNH  631

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
                    +   +++ + PG+++ DEGH PR+ +SR+ KAL  + T  RILLSGT FQNNF
Sbjct  632   SGALKQAEEWRKIIXEFPGLVVFDEGHTPRNDQSRIWKALSDLKTKRRILLSGTPFQNNF  691

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              E FNT+CL RP F D +          +  G   R   + R  + +          +  
Sbjct  692   QELFNTICLVRPTFADSI-------DSNKFTGDFRRNQSQKRNLETWQWTXVTNCSGNXN  744

Query  1301  rerkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIY  1125
              +R+     +K     F++VY+G    D+LPGL+   ++++ T LQ+E   ++Q  +  +
Sbjct  745   BKRERHATEVKAKIAPFVNVYKGSVLQDSLPGLRNSVVVLRPTQLQEEXHKRIQVIKSQF  804

Query  1124  KGFPLELELLITLGAIHP-WLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
                  E E L +L +IHP  L+   A SG++      + L K K +  +G KVKFVM L+
Sbjct  805   -----EYEHLESLISIHPSLLLNKEAFSGEW------DKLNKLKLNPDVGVKVKFVMDLM  853

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
                    E+VL+F   I P+ L  ++    + W +G EVL + G  ++ +R   M  F +
Sbjct  854   RLSDALNERVLVFSQYIKPLVLTRDLLRSRFHWTEGEEVLYMDGSCDMKQRQSSMKVFND  913

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
                 +KV+LAS   C EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ KVVYVY L
Sbjct  914   PSSKAKVLLASTKGCCEGISLVGASRVVLLDVTWNPSVERQAISRAYRLGQKKVVYVYHL  973

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIE-DELLGEIVEEDR  426
             L  GT EE KY+R   K  +S ++FS+    D    +   +  D++L E+ + ++
Sbjct  974   LMGGTNEEHKYQRQVDKSRLSELVFSDSDRSDACEKKVRAVSADKVLEEMAQHEK  1028



>ref|XP_001773860.1| SNF2 family DNA-dependent ATPase [Physcomitrella patens]
 gb|EDQ61350.1| SNF2 family DNA-dependent ATPase [Physcomitrella patens]
Length=1566

 Score =   362 bits (929),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 246/742 (33%), Positives = 394/742 (53%), Gaps = 64/742 (9%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATEL--HMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             +W+EM  A  SC  ++   D     +T L        G++   H    ++E+G+VC +CG
Sbjct  772   VWEEMRAAQESCKKVNGAMDEKSPDSTSLIAECENPDGSKCQEHAVIFDQEVGIVCAVCG  831

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              V  EI+++   +           +  +E + +E      D +       S+K    +E 
Sbjct  832   NVLLEIENM---WERDNAKRITATKDNDEDIYDENMLASWDFEDL-----SHKQQDSIEK  883

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
               N + LIP+L   ++ HQ+  F+FLW+N+AG           ++ GGCVISH+PG GKT
Sbjct  884   GSN-FELIPELAKHMQRHQKHGFQFLWRNLAGQDANGNPCFPPREPGGCVISHAPGTGKT  942

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQ  1803
              LII+FL SY+K +P  RP+++APK  L  W +E  KW + IPVY  +     +G +  Q
Sbjct  943   FLIISFLHSYIKKYPHCRPVIVAPKIMLQPWEREFRKWNVGIPVYNFNKA-AEQGRIFLQ  1001

Query  1802  KMKLCPGLPRN-------QDVMHVLDCLEKM-QKWLAHPSVLLMGYTSFLTLTREDSTYA  1647
             + +    +  N       Q  M+   C E M  +W   PSVL++ Y+ F  +T ++   +
Sbjct  1002  QHEEAGDVQLNSGGRWKKQRSMNA--CREAMLWQWTKTPSVLVISYSMFALMTTQERMTS  1059

Query  1646  HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFN  1467
                 +  +L + P IL+LDEGH  R++++++ K LM V T LRI+LSGTLFQNNF E + 
Sbjct  1060  --STVRTILLERPHILVLDEGHFARNSRAQILKPLMAVKTPLRIMLSGTLFQNNFEELYT  1117

Query  1466  TLCLARPRFVDEVLKELDPKYKKR----VKG------------AKTRFSLENRARKMFid  1335
             +L L R  FV    K+   K+  +    +KG             K   + E +A+K+F++
Sbjct  1118  SLNLVRSGFVKTYAKDAGLKFNIQQEIELKGDDEVEHHTAEWKEKAAKAAEVQAKKLFME  1177

Query  1334  kiskkidsske-----rerkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTL  1170
             ++  KID  ++         +GL  L++LT+ FI  Y+GG   +LP L+ + +M++ T L
Sbjct  1178  EVGNKIDKGQKGELSPGSLAQGLEQLRRLTSPFIHHYKGGVLRDLPPLRDFAIMLQPTAL  1237

Query  1169  Q----QEILVKLQDQRPIYKGFPLELELLITLGAIHP--WLIRTTACSGQYfkeeeleal  1008
             Q    Q +  +L+D+        LE E L++L  IHP  +L      +      +E    
Sbjct  1238  QVKLVQSVTRRLEDKT------MLERECLLSLICIHPSLFLEHNVGKALTDLLSQEEMNE  1291

Query  1007  ekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVL  828
                  D ++G K +FV++L+ +    +EK+LIFC N+ P  L  E+ +  +GW +  E+L
Sbjct  1292  VATNRDPEVGVKTRFVINLLNQLRYGQEKILIFCQNLVPFILLEEMLKNEFGWVREQEIL  1351

Query  827   VLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSK  648
              L G ++  ER  ++++F +  G  +V+LAS   C EGI+LT ASRV+ +D  WNP+  +
Sbjct  1352  QLDGKVDPDERQSIIERFNDRKGKIRVLLASTKACGEGITLTGASRVVFMDVLWNPAVIR  1411

Query  647   QAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIF---SEDLVEDPSH--  483
             QAI RAFR GQ   V+VY+L+A+GT+EE KY+R   K+W S  IF    E+++ +  H  
Sbjct  1412  QAIHRAFRIGQRNAVHVYRLVASGTMEESKYQRMVSKDWKSQSIFRGSDENIIGEVQHCF  1471

Query  482   WQAPK--IEDELLGEIVEEDRA  423
             W+  K   +D  L E+  +D A
Sbjct  1472  WEVKKQTSKDPALNELRRQDEA  1493


 Score = 60.1 bits (144),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 16/121 (13%)
 Frame = -3

Query  4157  FEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRIRSRNATSSDCACFLRP  3978
              EA+ NGSW  VE ++     + +H +  G+ I + +   ++R+RSR +   DC   ++P
Sbjct  95    LEAYSNGSWWDVEILKKNRDKYYVHYVKFGNQIVQWVPFGHLRMRSRTSQLLDCDG-IKP  153

Query  3977  GLDISVFST-PHQsedsdeennedEKMEPEPAWIDAKIRSIERKPHG-FGCVCQFHISVY  3804
             G+D+ V S  PH +             E   AW DAK+  + RK H    C C F I++Y
Sbjct  154   GVDVCVMSQHPHAN-------------ESSRAWYDAKVVDVTRKQHTPKTCKCFFQIALY  200

Query  3803  V  3801
              
Sbjct  201   T  201



>emb|CDX94823.1| BnaC03g43650D [Brassica napus]
Length=974

 Score =   353 bits (906),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 237/724 (33%), Positives = 364/724 (50%), Gaps = 54/724 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LW++M LAL+    L+    +      ++  +  K      HDF L+EEIGL CR C 
Sbjct  291   DRLWQDMALALS----LEGLHSSTYFKNEDVSCSNGK------HDFVLDEEIGLKCRYCS  340

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP--SSEV  2169
              VS E+KDV P    +           +      +   D  LD   +  S +    +S  
Sbjct  341   YVSIEMKDVSPAMYRANVKYRDTVNYKKTC----RNKGDPLLDSLDLEASGHNSNLASLK  396

Query  2168  EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES--KKRGGCVISHSPG  1995
             +++   W  IP ++N L  HQ+  FEF+WKN+AG+    ++   S  K+ GGC+ISHSPG
Sbjct  397   KIQGTVWEYIPGIKNTLYPHQQEGFEFMWKNLAGTTKLHELKSSSVVKESGGCIISHSPG  456

Query  1994  AGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE  1815
              GKT L I FL SYL+ FP S P+V+AP + L TW +E  KW   IP Y +   Q   G 
Sbjct  457   TGKTRLTIVFLQSYLQQFPDSHPVVIAPASLLLTWEEEFKKWNSNIPFYNM-SNQELSGL  515

Query  1814  VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
                  + L  G  +++     +  + K+  W    S+L + Y+ +  LT         + 
Sbjct  516   ENPSAVSLLNGSRQHRSKKDSVRMV-KLYSWRNKKSILGISYSLYEKLTGNKCASGETQK  574

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
               ++L   PG+L+LDEGH PR+  S + K L +V T  RI+LSGT FQNNF E  N LCL
Sbjct  575   FRKMLLDFPGLLVLDEGHTPRNNNSCIWKVLTEVKTEKRIILSGTPFQNNFKEISNVLCL  634

Query  1454  ARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNI  1275
              RP + D++   L    +   +G   RF  E                         G+  
Sbjct  635   TRPAYKDKISSRLHDLTRLSQEGKNGRFDEE------------------------IGIAE  670

Query  1274  LKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELEL  1098
             LK +   F+ V++G    ++LPGL+   +++ +   Q +IL ++      +    LELE 
Sbjct  671   LKDMIAPFVHVHKGNILRESLPGLRDCVVVLNAPFQQAKILTRID-----HSENTLELEH  725

Query  1097  LITLGAIHPWLI---RTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
              ++  ++HP L    + T           L++LE+   D K G+K +F++  I      K
Sbjct  726   KLSAVSVHPSLYLRRKQTDKERLTIGPVVLKSLERLTLDSKEGAKTRFLIDFIRFSDTVK  785

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVL+F  +I  + L  +     +GW +G E+L + G ++   R R+++ F +    SK+
Sbjct  786   EKVLVFSQHIDTLELIRDQLSAVFGWTEGEEILYMHGQLQQKFRQRLINNFNKSDSKSKL  845

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LAS   C+EGI+L  ASRV+LLD +WNPS  +QAI+RA+R GQ +VVY Y L+  GT E
Sbjct  846   LLASTKACSEGINLVGASRVVLLDVDWNPSVERQAISRAYRIGQKRVVYTYHLMVKGTTE  905

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMKNEK  390
              +KY +   K  +S M+FS    +D         ED++L E+V  ++   +F  I+  + 
Sbjct  906   WDKYCKQNKKHRISEMVFSPTNEKDKLIGNEVVSEDKILDEMVRHEKLKDMFEKILYRKT  965

Query  389   ASNM  378
              S+M
Sbjct  966   ESDM  969



>ref|XP_010919917.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Elaeis 
guineensis]
Length=1187

 Score =   357 bits (916),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 228/687 (33%), Positives = 360/687 (52%), Gaps = 43/687 (6%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTN------LKSATELHMATKKGTRVCHHDFRLNEEIGL  2361
             D LW ++E AL S  +     D        L+  ++L     +G     H F L+E IG 
Sbjct  479   DELWADLEFALESNNIGTYNNDEGQIEVDILEDESDLLTLCSQGK----HQFILDERIGT  534

Query  2360  VCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSN-K  2184
              C+ C  V+ EIK + P      C  S +       +   K       D     V  + K
Sbjct  535   RCKFCSFVNMEIKYIIPSLATHICEGSAR-------INSAKVEGTLLFDDLCRTVKDDGK  587

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVI  2010
             P+S    +   W LIP +++K+  HQ+ AFEF+WKN+AG I   ++   ++    GGCVI
Sbjct  588   PNSCGLPKGTVWELIPGIKDKMYEHQQEAFEFMWKNLAGGIDLDELKSGARSDVIGGCVI  647

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I F+ +Y+K+FP  RP+++AP   L TW +E  KW + +P++ ++   
Sbjct  648   SHAPGTGKTRLSIIFIQTYMKVFPECRPVIVAPSGMLLTWEEEFRKWNVDVPIHNLNA-P  706

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
              Y G       +L     RN  +M ++    K+  W+   S+L + Y  F  LT ++S  
Sbjct  707   DYSGREDIAFRQLAAKEHRNISLMRLV----KLYSWVKGSSILGISYGLFKKLTADNSCD  762

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
                  ++QVL + PG+L+LDEGH PR+ +S + KAL K+ T  RI+LSGT FQNNFGE +
Sbjct  763   PK---LSQVLLERPGLLVLDEGHTPRNERSLIWKALGKIKTEKRIILSGTPFQNNFGELY  819

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVK---GAKTRFSLE-NRARKMFidkiskkidsske  1302
             N +CL +P+F +++      + +++ K        F  E N  + +++   +   D + E
Sbjct  820   NIMCLVKPKFAEKISIRPSKQGQRKAKFFSDMDQDFLPEKNEGKGIWVSLTNHVTDDNAE  879

Query  1301  rerkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
                      ++ +   F+ ++ G   + LPGL+   + +     Q++I+ K++    I  
Sbjct  880   E--------VRSILKPFVHIHSGNILNTLPGLRECVIELDPPPHQKDIIEKMEH---IGS  928

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
                 E E   +L +IHP L+     S +     +   LEK K +  +G K +FVM ++  
Sbjct  929   NVIFENEYKTSLASIHPSLVTYLNLSEEEETLLDRPLLEKQKLNPYIGVKTRFVMEVVRL  988

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
             C   KEKVLIF   I P+++  +   + + W +G EVL + G I    R   +D F ++ 
Sbjct  989   CEALKEKVLIFSQYIQPLSMIKDQLIKLFNWSEGKEVLQMDGKIRTKYRQSSIDIFNDME  1048

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               ++V+LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RA+R GQ K VY Y L+ 
Sbjct  1049  SEARVLLASTKACCEGISLTGASRVVLLDVVWNPAVGRQAISRAYRIGQKKFVYTYNLMT  1108

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDL  501
             +GT E +KY R   K+ +S ++FS ++
Sbjct  1109  SGTGERDKYDRQAKKDHLSKLVFSTEI  1135



>ref|XP_006586199.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Glycine 
max]
Length=1246

 Score =   357 bits (917),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 245/721 (34%), Positives = 370/721 (51%), Gaps = 64/721 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             DMLW EME+ L +  +    ++     A E + A +     C HD   NEEIG+ CRLCG
Sbjct  546   DMLWAEMEMLLRAGEIGIQVDEAR---AKEENPALQ-----CKHDTIFNEEIGVYCRLCG  597

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              ++TEIK + PPF+ S    SG+E  P     +  Q D A  D        +  ++    
Sbjct  598   WIATEIKYIMPPFVDS--KRSGREAFPG--AWKTSQFDGATFDD----CGDDSGAAWSHN  649

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ---IDPESKKRGGCVISHSPGA  1992
             E   W +I D++  L  HQ+  FEF+W ++AG+    +   +DP ++  GGC+ISH+PG 
Sbjct  650   EGTVWDIISDIKKGLFPHQQEGFEFIWTSLAGTTNLAELKRVDPGTE--GGCIISHAPGT  707

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEV  1812
             GKT L + FL +YL+LFP   P+++AP   L TW  E+ KW I IP + ++  +    E 
Sbjct  708   GKTKLTMVFLQTYLQLFPKCLPVIIAPANILLTWEDELRKWNIGIPFHNLNNAELSGKEN  767

Query  1811  LRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---REDSTYAHR  1641
             +  +         N+D + +L    K+  W    S+LL+ Y  +  L     ED     +
Sbjct  768   VINEFGY---QELNKDAIRML----KLCSWYKEKSILLISYNLYEKLAGGKSEDDGEKEK  820

Query  1640  K---------------YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
             K                M +VLR  PG+L+LDEGH PR+ +S + K L +  +  RILLS
Sbjct  821   KNRKIRKEKKRASIETAMGKVLRDYPGLLVLDEGHTPRNQRSCIWKVLSESRSQKRILLS  880

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E FN  CL +P F D + +EL        K  +++   E +A K    +  
Sbjct  881   GTPFQNNFLELFNIFCLMKPSFSDNIPQELK-------KFCQSKLIQERKASKDVSWESI  933

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVK  1149
                + + E+     +  LK L   F+ V++G     NL GLQ   L++K   LQQ+IL  
Sbjct  934   NSGNPADEK-----IKQLKLLMNPFVHVHKGSILQKNLLGLQDCVLILKPEILQQKILDS  988

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             ++  +       L  E  + L ++HP L    + S +     +++ L+K + D   G K 
Sbjct  989   IECSQN-----GLNFEHKLALVSVHPSLFLNCSLSKKEESVIDMDQLKKCRLDSYEGVKT  1043

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             KF+M  +  C    EKVL+F   I  + L  +  E  + W +G EVL + G ++  ++  
Sbjct  1044  KFLMEFVNLCDAVDEKVLVFSQFIDTLILIKDQLESAFNWSEGREVLFMHGRVDQKQKQS  1103

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
             ++  F +    +KV+LASI   +EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ K
Sbjct  1104  LIHSFNDANSQAKVLLASIKASSEGINLVGASRVVLLDVVWNPSVERQAICRAYRLGQKK  1163

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             VVY Y LLA GT E  KY +   K  +S ++FS    E     ++  IED++L  +V+ +
Sbjct  1164  VVYTYHLLAQGTPECTKYCKQAEKNRLSELVFSNRNAESDKLKRSGVIEDKVLDAMVQHE  1223

Query  428   R  426
             +
Sbjct  1224  K  1224



>ref|XP_006655286.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Oryza 
brachyantha]
Length=1205

 Score =   355 bits (912),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 233/707 (33%), Positives = 360/707 (51%), Gaps = 33/707 (5%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             DMLW +++  L S     Y  D+ + ++L    +L +A         H+F ++E+IG+ C
Sbjct  487   DMLWADLDFTLESENIGTYYDDEGQQSSL---LDLALAPITPCSRGKHEFIIDEQIGIRC  543

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
             + C +V+ EI+ + P        +S   ++P        +      D +    + +  S 
Sbjct  544   KYCSLVNLEIRFILPLL------ASNFAEKPAWRNSSCLKTALMCPDLYEQTGAGDGQSQ  597

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVISHS  2001
             +  +    W LIP +   +  HQR AFEF+W N+ G I   +I   +K    GGCVI H+
Sbjct  598   DFHINGTVWDLIPGVITSMYQHQREAFEFMWTNLVGDIRLNEIKHGAKADVVGGCVICHA  657

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I     Y 
Sbjct  658   PGTGKTRLAIVFIETYMKVFPDCRPVIIAPRGMLFAWEQEFKKWNVNVP-FHIMNTTDYS  716

Query  1820  GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHR  1641
             G+  R   +L     R + +  ++    K+  W     VL + Y  ++ LT E S     
Sbjct  717   GKEDRDICRLIKKEHRTEKLTRLV----KLFSWNKGHGVLGISYGLYMKLTSEKSGCTGE  772

Query  1640  KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTL  1461
               +  +L + PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNNF E +N L
Sbjct  773   NKVRSILLENPGLLVLDEGHTPRNERSVIWKTLGKVTTEKRIILSGTPFQNNFLELYNIL  832

Query  1460  CLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskki-dsskererkEG  1284
             CL RPRF +  L       K RV     R  +  + R  F DK  K +  S       + 
Sbjct  833   CLVRPRFGEMFLT------KTRVG---RRHHVSKKQRDKFSDKYEKGVWASLTSNVTDDN  883

Query  1283  LNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLEL  1104
                ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G   E 
Sbjct  884   AEKVRSILKPFVHIHNGTILRTLPGLRECVIVLKPLPLQKSIIRKVEN---IGSGNNFEH  940

Query  1103  ELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKE  924
             E +I+L + HP L+     S +     +   L + + +   G K +FVM ++  C   KE
Sbjct  941   EYVISLASTHPSLVTAINMSEEEASLIDKPMLGRLRSNPYEGVKTRFVMEVVRLCEALKE  1000

Query  923   KVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVM  744
             KVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      ++V+
Sbjct  1001  KVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQNSIEVFNNPDSEARVL  1060

Query  743   LASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEE  564
             LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT E 
Sbjct  1061  LASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGEG  1120

Query  563   EKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRA  423
             +KY R   K+ +S ++FS +   +       K E E   +++ ED+ 
Sbjct  1121  DKYDRQAEKDHLSKLVFSTEDEFNNVRNMLSKAEMEHCSKLISEDKV  1167



>ref|XP_007210413.1| hypothetical protein PRUPE_ppa000588mg [Prunus persica]
 gb|EMJ11612.1| hypothetical protein PRUPE_ppa000588mg [Prunus persica]
Length=1085

 Score =   353 bits (905),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 236/688 (34%), Positives = 357/688 (52%), Gaps = 53/688 (8%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNL-KSATELHMATKKGT-----RVCHHDFRLNEEIGLVC  2355
             LW ++E AL +  +  D+ D+N+ +S   L +A +  T     R   H   L+EEIGL C
Sbjct  378   LWDDLEFALRASEI--DSSDSNVVESQDSLPIADEVETVASLCRRGVHQLILDEEIGLRC  435

Query  2354  RLCGVVSTEIKDVPPPFM--PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
             + C  +  EIK + P F+  P     +   +     + +E Q   +D D  +        
Sbjct  436   KFCSYLDQEIKYILPDFLDCPYGRFGTRGSETDNRSIFDELQSHASDSDRHS------GY  489

Query  2180  SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID-PESKKRGGCVISH  2004
             +S   V+   W LIP +++ +  HQ   FEF+W +IAG I   ++  P S    GC+ISH
Sbjct  490   NSHPHVDGTVWDLIPGVKSSMYPHQCEGFEFIWNHIAGGIHLDKLKRPSSVGGNGCIISH  549

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKT L I FL +Y+KLFP  RPL++AP++ L TW +E  KWK+ IP + ++  +  
Sbjct  550   APGTGKTRLTIVFLQTYMKLFPECRPLLIAPRSMLLTWEEEFKKWKLDIPFHNLNNWE-L  608

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              G+  +  +       R + V      + K+  W    S+L + Y  F  L+    T + 
Sbjct  609   SGKENQTAVNYVMQAQRRKSVNIESRRMLKLYSWRKKRSILGISYRLFEQLSGAQKTGSV  668

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
              + M ++L + PG+++ DEGH PR+ +S + KAL ++ T  RILLSGT FQNNF E FNT
Sbjct  669   DE-MGKILLEFPGLVVFDEGHTPRNDQSHMWKALSEIKTKRRILLSGTPFQNNFQELFNT  727

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLE---NRARKM----Fidkiskkidssk  1305
             +CL RP F   +                T+FS +   NR RK     +            
Sbjct  728   ICLVRPTFAASI--------------ESTKFSRDLPRNRGRKSNGEKWKWTSLASSSGKV  773

Query  1304  ererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
               ++++    +K     F+ VY+G    D+LPGL+   +++  T LQ+    ++Q  + +
Sbjct  774   VDDKEKHATEVKAQIAPFVHVYKGSVLQDSLPGLRNSVVVLHPTQLQERFHKRIQVVKEL  833

Query  1127  YKGFPLELELLITLGAIHP-WLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
             ++      E L  L + HP  L++  A S           L++ K +   G K KFVM L
Sbjct  834   FR-----YENLEALISFHPSLLLKEDAFSAD------QGRLQELKLNPDAGVKAKFVMEL  882

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             I      KEKVL+F   I P+NL  ++ +  + W +G EVL + G  ++ +R   M  F 
Sbjct  883   IRLSDALKEKVLVFSQYIDPLNLTRDLLKSQFQWTEGEEVLYMDGKSDMKQRQSSMKVFN  942

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             +    +KV+LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ KVV+VY 
Sbjct  943   DPSSKAKVLLASTKACSEGISLVGASRVVLLDVTWNPSVERQAISRAYRLGQKKVVFVYH  1002

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSE  507
             LL  GT EE KY R   K  +S ++FS+
Sbjct  1003  LLMDGTNEEHKYSRQVDKSRLSELVFSD  1030



>ref|XP_008794871.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Phoenix 
dactylifera]
Length=1175

 Score =   354 bits (909),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 226/714 (32%), Positives = 371/714 (52%), Gaps = 47/714 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNL------KSATELHMATKKGTRVCHHDFRLNEEIGL  2361
             D LW + E AL S  +     D         +  ++L     KG     H F L+E+IG 
Sbjct  467   DELWADFEFALESNNIGTYNNDEGQIEVDIPEDESDLLTLCSKGK----HQFILDEQIGT  522

Query  2360  VCRLCGVVSTEIKDVPPPFMPSTCSSSGK--EQRPEEVVMEEKQGDDADLDHFAIPVSSN  2187
              C+ C  V+ EIK + P         S +    + E  ++          D     V  +
Sbjct  523   RCKFCSFVNLEIKYIIPSLATHIWEGSARINSAKVEGTLL---------FDDLCRTVKDD  573

Query  2186  -KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGC  2016
               P+S   ++   W L+P +++K+  HQ+ AFEF+WKN+AG I   ++   ++    GGC
Sbjct  574   GNPNSCGLLKGTVWDLVPGIKDKMYEHQQEAFEFMWKNLAGGIDLDELKSGARSDVIGGC  633

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             VISH+PG GKT L I F+ +Y+K+FP  RP+++AP   L TW +E  KW + +P++ ++ 
Sbjct  634   VISHAPGTGKTRLSIIFIQTYMKVFPECRPVIVAPSGMLLTWEEEFRKWNVDLPIHNLNA  693

Query  1835  GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS  1656
                Y G+      +L    PRN   M ++    K+  W+    +L + Y  F  LT ++S
Sbjct  694   -PDYSGKEDIAFRQLAAKEPRNISFMRLV----KLYSWVKSNGILGISYGLFKKLTADNS  748

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
                    ++QVL + PG+L+LDEGH PR+ +S + KAL K+ T  RI+LSGT FQNNFGE
Sbjct  749   CDPK---LSQVLLEKPGLLVLDEGHTPRNERSLIWKALGKIKTEKRIILSGTPFQNNFGE  805

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVK----GAKTRFSLENRARKMFidkiskkidss  1308
              +N +CL +P+F +++      + +++ K      +     +N  ++++    +   D +
Sbjct  806   LYNIMCLVKPKFAEKISIRTSKRGQRKAKFISYMEQDILPEKNEGKEIWASLTNHVTDDN  865

Query  1307  kererkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
              E         ++ +   F+ ++ G   + LPGL+   + +     Q++I+ K++    I
Sbjct  866   AEE--------IRSILKPFVHIHSGNILNTLPGLRECVIELDPPPHQKDIIEKMEH---I  914

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
                   E E   +L +IHP L+     S +     +   LEK K +  +G K +FVM ++
Sbjct  915   GSNVIFENEYKTSLASIHPSLVTYLNLSTEEESLLDKPLLEKQKLNPYIGVKTRFVMEVV  974

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
               C   KEKVLIF   I P+++  +   + + W +G EVL + G I    R   +D F +
Sbjct  975   RLCEALKEKVLIFSQYIQPLSMIKDQLIKLFNWSEGKEVLQMDGKIRTKYRQSSIDIFND  1034

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
             +   ++V+LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RA+R GQ K VY Y L
Sbjct  1035  MESEARVLLASTKACCEGISLTGASRVVLLDVVWNPAVGRQAISRAYRIGQKKFVYTYNL  1094

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
             + +GT E +KY R   K+ +S ++FS ++        + + ++E   +++ ED+
Sbjct  1095  MTSGTGERDKYDRQAKKDHLSKLVFSTEIDFTNVRNSSSQAKEEHSTKLISEDK  1148



>gb|KHN01842.1| DNA repair and recombination protein RDH54 [Glycine soja]
Length=1246

 Score =   355 bits (910),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 244/721 (34%), Positives = 369/721 (51%), Gaps = 64/721 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             DMLW EME+ L +  +    ++     A E + A +     C HD   NEEIG+ CR CG
Sbjct  546   DMLWAEMEMLLRAGEIGIQVDEAR---AKEENPALQ-----CKHDTIFNEEIGVYCRWCG  597

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              ++TEIK + PPF+ S    SG+E  P     +  Q D A  D        +  ++    
Sbjct  598   WIATEIKYIMPPFVDS--KRSGREAFPG--AWKTSQFDGATFDD----CGDDSGAAWSHN  649

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ---IDPESKKRGGCVISHSPGA  1992
             E   W +I D++  L  HQ+  FEF+W ++AG+    +   +DP ++  GGC+ISH+PG 
Sbjct  650   EGTVWDIISDIKKGLFPHQQEGFEFIWTSLAGTTNLAELKRVDPGTE--GGCIISHAPGT  707

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEV  1812
             GKT L + FL +YL+LFP   P+++AP   L TW  E+ KW I IP + ++  +    E 
Sbjct  708   GKTKLTMVFLQTYLQLFPKCLPVIIAPANILLTWEDELRKWNIGIPFHNLNNAELSGKEN  767

Query  1811  LRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---REDSTYAHR  1641
             +  +         N+D + +L    K+  W    S+LL+ Y  +  L     ED     +
Sbjct  768   VINEFGY---QELNKDAIRML----KLCSWYKEKSILLISYNLYEKLAGGKSEDDGEKEK  820

Query  1640  K---------------YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
             K                M +VLR  PG+L+LDEGH PR+ +S + K L +  +  RILLS
Sbjct  821   KNRKIRKEKKRASIETAMGKVLRDYPGLLVLDEGHTPRNQRSCIWKVLSESRSQKRILLS  880

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E FN  CL +P F D + +EL        K  +++   E +A K    +  
Sbjct  881   GTPFQNNFLELFNIFCLMKPSFSDNIPQELK-------KFCQSKLIQERKASKDVSWESI  933

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVK  1149
                + + E+     +  LK L   F+ V++G     NL GLQ   L++K   LQQ+IL  
Sbjct  934   NSGNPADEK-----IKQLKLLMNPFVHVHKGSILQKNLLGLQDCVLILKPEILQQKILDS  988

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             ++  +       L  E  + L ++HP L    + S +     +++ L+K + D   G K 
Sbjct  989   IECSQN-----GLNFEHKLALVSVHPSLFLNCSLSKKEESVIDMDQLKKCRLDSYEGVKT  1043

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             KF+M  +  C    EKVL+F   I  + L  +  E  + W +G EVL + G ++  ++  
Sbjct  1044  KFLMEFVNLCDAVDEKVLVFSQFIDTLILIKDQLESAFNWSEGREVLFMHGRVDQKQKQS  1103

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
             ++  F +    +KV+LASI   +EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ K
Sbjct  1104  LIHSFNDANSQAKVLLASIKASSEGINLVGASRVVLLDVVWNPSVERQAICRAYRLGQKK  1163

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             VVY Y LLA GT E  KY +   K  +S ++FS    E     ++  IED++L  +V+ +
Sbjct  1164  VVYTYHLLAQGTPECTKYCKQAEKNRLSELVFSNRNAESDKLKRSGVIEDKVLDAMVQHE  1223

Query  428   R  426
             +
Sbjct  1224  K  1224



>ref|XP_007140761.1| hypothetical protein PHAVU_008G139600g [Phaseolus vulgaris]
 gb|ESW12755.1| hypothetical protein PHAVU_008G139600g [Phaseolus vulgaris]
Length=1142

 Score =   352 bits (903),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 238/714 (33%), Positives = 364/714 (51%), Gaps = 87/714 (12%)
 Frame = -3

Query  2522  DMLWKEMELALAS---CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCR  2352
             DMLW+EME+ L +    + +D+T+ TN     E + A++     C HD   +E+IG+ CR
Sbjct  432   DMLWEEMEMLLQAEKIGFQVDNTK-TNEGRENEKNPASQ-----CKHDTIFDEQIGIYCR  485

Query  2351  LCGVVSTEIKDVPPPFMPST-CS----SSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSN  2187
              CG + TEIK + P F+ S  C     S G      + V+  + G D++       V S 
Sbjct  486   WCGWIETEIKYITPEFIDSERCGRRMLSDGGRTMGFDGVLFTETGKDSE------AVRSQ  539

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ---IDPESKKRGGC  2016
                +        W L P ++  L  HQ+  FEF+W N+AG+   ++   +D ES+  GGC
Sbjct  540   NLGT-------VWDLTPGIKESLFPHQQEGFEFIWANLAGTTELSKLKRVDAESE--GGC  590

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             ++SH+PG GKT L + FL +YL++FP   P+++AP   L TW  E+ KW I IP + ++ 
Sbjct  591   IVSHAPGTGKTRLTMVFLQTYLQVFPKCLPVIIAPANILLTWEDELKKWNIGIPFHNLNN  650

Query  1835  GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT----  1668
              +    E   +++       +N+DV+ +L    K+  W    S+LL+ Y  +  LT    
Sbjct  651   AELSGKEHAIREVDWSFNQQQNKDVIRML----KLCSWYKEKSILLISYNLYEKLTGGKS  706

Query  1667  --------------REDSTYAHRKY----MNQVLRQCPGILILDEGHNPRSTKSRLRKAL  1542
                           +E      R+Y    +  VLR  PG+L+LDEGH PR+ +S + K L
Sbjct  707   ERDAEKEKKNRKIGKEKKRARSREYVETELGNVLRDYPGLLVLDEGHTPRNKRSCIWKVL  766

Query  1541  MKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRF---  1371
              +  +  RILLSGT FQNNF E +N LCL +P F + + +EL    K ++      +   
Sbjct  767   SESRSQKRILLSGTPFQNNFRELYNILCLMKPSFPESIPQELKKFLKNKLIQETVSWEPI  826

Query  1370  SLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYT  1194
             S+EN AR+                     +N LK L   F+ V++G     +LPGL+   
Sbjct  827   SVENPAREK--------------------INQLKLLMNPFVHVHKGSILEKHLPGLKDCV  866

Query  1193  LMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeele  1014
             L++K   LQQ IL  +   +       L  E  + L ++HP L  +   S +     + E
Sbjct  867   LILKPECLQQTILESIDCSQN-----ALNFEHKLALVSVHPSLFLSCTLSKKEKSVVDSE  921

Query  1013  alekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIE  834
              L++ + D   G K KF++  +  C    EKVL+F   I  + L  +  E  + W  G E
Sbjct  922   QLKRIRSDPYEGVKTKFLIEFVRLCDAVNEKVLVFSQFIDTLCLIKDQLESAFDWSMGTE  981

Query  833   VLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSK  654
             VL + G ++  ++  ++  F +    +KV+LAS   C EGI+L  ASRV+L+D  WNPS 
Sbjct  982   VLYMHGKLDQKQKQILIHSFNDANSQAKVLLASTKACCEGINLVGASRVVLVDVVWNPSV  1041

Query  653   SKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVED  492
              +QAI RA+R GQ +VVY Y LLA GT E  KY R + K+ +S ++FS   VE+
Sbjct  1042  ERQAICRAYRLGQKRVVYTYHLLAQGTPECAKYCRQSEKDRLSELVFSSRNVEN  1095



>gb|KHN01841.1| DNA repair and recombination protein RAD54-like [Glycine soja]
Length=956

 Score =   348 bits (893),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 243/751 (32%), Positives = 371/751 (49%), Gaps = 81/751 (11%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL---LDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCR  2352
             D LW EM++ L    +   +D   +    SA++           C HD   NEEIG+ CR
Sbjct  245   DNLWGEMDMLLRVEEIGSQIDKVGENEENSASQ-----------CKHDTIFNEEIGIYCR  293

Query  2351  LCGVVSTEIKDVPPPFMPS------TCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS  2190
              CG + TEIK + PPF+ +        S  GK  + + V+  +       +D      S 
Sbjct  294   WCGWIHTEIKYITPPFVDNERSGREALSDGGKTSQFDGVLFNDS------VDDSEAVWSH  347

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP-ESKKRGGCV  2013
             N        E   W LIPD++  L  HQ+  FEF+W ++AG+I   ++   +    GGC+
Sbjct  348   N--------EGTVWDLIPDIKESLFPHQQEGFEFIWTSLAGTIDLAELKRVDMHTEGGCI  399

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PG GKT L + FL +YL+LFP   P+++AP   L TW  E+ KW + IP + ++  
Sbjct  400   ISHAPGTGKTKLTMVFLQTYLQLFPKCLPIIIAPANILLTWEDELRKWNLGIPFHNLNNA  459

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR---E  1662
             +    E    ++ L     +N+D + ++    K+  W    S+LL+ Y  +  L R   E
Sbjct  460   ELSGNEQDINEVDLSGNQRQNKDAIRMV----KLCSWYKEKSILLISYHLYERLARGLCE  515

Query  1661  DSTYAH---------------RKY----MNQVLRQCPGILILDEGHNPRSTKSRLRKALM  1539
             D                    R+Y    M +VLR  PG+LILDEGH PR+ +S + K L 
Sbjct  516   DDGKKEKKNKKMKKGKKRARTREYIETAMGKVLRDYPGLLILDEGHTPRNQRSYIWKVLS  575

Query  1538  KVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLEN  1359
             +  +  R+LLSGT FQNNF E +N LCL +P F D + +EL        K  ++R   E 
Sbjct  576   ESRSQKRVLLSGTPFQNNFLELYNILCLMKPSFPDSIPQELK-------KFCQSRLRKER  628

Query  1358  RARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMK  1182
             +A K      +            E +  LK L   F+ V++G     NLPGL+   L++K
Sbjct  629   KASKY-----ASYEPIYSGNSADEKIKQLKSLMNPFVHVHKGSILQKNLPGLRDCVLVLK  683

Query  1181  STTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealek  1002
                LQQE L  +   + I     L  E  + L ++HP L    + S +     + + LEK
Sbjct  684   PDRLQQETLDIIDSSQNI-----LNFEHKLALVSVHPSLFLNCSLSKKEESVLDKDQLEK  738

Query  1001  fkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVL  822
              + +   G K  F++ L+  C    EKVL+F   I  + L  +  E  + W  G EVL +
Sbjct  739   LRLNPYGGVKTNFLLELVRLCDAVNEKVLVFSQFIDTLCLIKDQLESAFHWSVGTEVLYM  798

Query  821   QGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQA  642
              G ++  ++  ++  F +    +KV+LASI   +EGI+L  ASRV+LLD  WNPS  +QA
Sbjct  799   YGKLDQKQKQSLIHSFNDTNSKAKVLLASIKASSEGINLIGASRVVLLDVVWNPSVERQA  858

Query  641   IARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS-EDLVEDPSHWQAPKI  465
             I RA+R GQ KVVY Y LLA  T E  K+ +   K+ +S ++FS ++   D  +     +
Sbjct  859   ICRAYRLGQKKVVYTYHLLAQDTPECIKFCKQAEKDRLSELVFSNKNAKSDKLNSCGAAL  918

Query  464   EDELLGEIVEEDR-ATLFHMIMKNEKASNMG  375
             ED +L  +V+ ++   +F  ++   K  + G
Sbjct  919   EDAVLDIMVQHEKLKDMFGELLVQPKERDFG  949



>gb|KFK39738.1| hypothetical protein AALP_AA3G281500 [Arabis alpina]
Length=1071

 Score =   350 bits (898),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 251/733 (34%), Positives = 374/733 (51%), Gaps = 79/733 (11%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCR  2352
             D LW++M  AL S          +L S+T      KKG   C    HDF L+EEIGL CR
Sbjct  397   DTLWEDMAFALKS---------EDLHSST----TAKKGDVPCIKGEHDFILDEEIGLKCR  443

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDD--ADLDHFAIPVSSNKPS  2178
              C  VS EIKD+ P   P   + S K +        +++GD   + LD F     SN  +
Sbjct  444   HCSYVSVEIKDISPAMEPYRVNVSDKNK------CSDRKGDPLPSGLD-FEASDHSNYVT  496

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP----ESKKRGGCVI  2010
             S    E   W  IP +++ L  HQ+  FEF+WKN+AG+   T++D     E K+ GGC+I
Sbjct  497   SLNNTEGTVWQYIPGVKDTLYQHQQEGFEFIWKNLAGA---TKLDGLESLEEKESGGCII  553

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SHSPG GKT L I FL SYL+ FP S P+V+AP + L+TW +E  KW   IP Y + G  
Sbjct  554   SHSPGTGKTRLTIVFLQSYLERFPDSHPVVIAPASLLFTWEEEFRKWNANIPFYNM-GSL  612

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
              + G      + L  G   ++  + ++    K+  W    S+L + Y  F  L +     
Sbjct  613   EFSGLEDPSAVSLLKGNKGDKRSIRMV----KLYSWRKKKSILGVSYHLFEKLAKNKDAG  668

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
               +++  ++L + PG+L+LDEGH PR+  S + K + +V T  RI+LSGT FQNNF E  
Sbjct  669   EMQEF-RRMLLELPGLLVLDEGHTPRNQNSCIWKVISEVRTEKRIILSGTPFQNNFKELS  727

Query  1469  NTLCLARPRFVDEV---LKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             N LCLARP + D +   L++L  +  +R  G                             
Sbjct  728   NVLCLARPAYTDSISSRLQDLSKRSGERNNGMSNE-------------------------  762

Query  1298  erkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
               + G+  L+ +   F+ VY+G    ++LPGL+   +++    +Q+++L ++  Q     
Sbjct  763   --EIGIVELRAMIAPFVHVYKGLILRESLPGLRDCVVVLNPPFVQKKLLDRIDSQN----  816

Query  1121  GFPLELELLITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
                 ELE  ++  ++HP L      T           L+ LE  + + K G K++F++  
Sbjct  817   --TFELEHKLSAVSVHPSLYLDCNPTKTEEILIGPVFLKTLESLRHNSKEGVKMRFLIDF  874

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             I      KEKVL+F   I  + L +E     +GW +G E+L + G ++   R  +++ F 
Sbjct  875   IRFSETVKEKVLVFSQYIDTLKLIMEHLSAVFGWEEGKEILFMHGQLDQRVRQHLINNFN  934

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             +    SKV+LAS    +EGISL  ASRVILLD  WNPS   QAI+RA+R GQ +VVY Y 
Sbjct  935   KSDSESKVLLASTKASSEGISLVGASRVILLDVVWNPSVESQAISRAYRIGQKRVVYTYH  994

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLF  414
             L+  GT E EKY + T K  +S ++FS    +D    +    ED +L E+V  ++   +F
Sbjct  995   LMVKGTSEWEKYCKQTKKHHISELVFSSTNEKDAVINKEVVSEDRILDEMVRHEKLKDMF  1054

Query  413   HMIMKNEKASNMG  375
               I+ + K S+M 
Sbjct  1055  EKILYHPKESDMS  1067



>ref|XP_004962180.1| PREDICTED: uncharacterized protein LOC101781575 [Setaria italica]
Length=1508

 Score =   355 bits (912),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 230/705 (33%), Positives = 351/705 (50%), Gaps = 30/705 (4%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCH--HDFRLNEEIGLVCRL  2349
             DMLW + + AL S  +    +D   +   +L  A    T      H+F ++++IG+ C+ 
Sbjct  791   DMLWADFDFALESENIGTYYDDEGQEEGNQLEFALAPVTPCSRGKHEFIIDDQIGIRCKY  850

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSG--KEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
             C +V+ EIK + P  +      S     +  +  +M     D+A          + + S 
Sbjct  851   CSLVNLEIKFMFPSLVSGFAEKSAWPNAKGVKNALMFHDLYDEAG--------GATEHSQ  902

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVISHS  2001
             +  +    W LIP +   +  HQR AFEF+W N+ G I   ++   +K    GGCVI H+
Sbjct  903   DFHLYGTVWDLIPGVITTMYEHQREAFEFMWTNLVGDIRLDELKHGAKPDVVGGCVICHA  962

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW I +P + I     Y 
Sbjct  963   PGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNINVP-FHIMNTTDYT  1021

Query  1820  GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHR  1641
             G+  R   KL     + Q     L  L K+  W     +L + Y  +  LT E       
Sbjct  1022  GKEDRDICKLV----KKQHRTEKLTRLVKLLSWNKGHGILGISYGLYTKLTSEKPGCTEE  1077

Query  1640  KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTL  1461
               +  +L   PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNNF E +N L
Sbjct  1078  NKVRSILLDNPGLLVLDEGHTPRNERSVMWKTLGKVKTEKRIILSGTPFQNNFLELYNIL  1137

Query  1460  CLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGL  1281
             CL RPRF +  L       K RV   +  +  + +  K           S       +  
Sbjct  1138  CLVRPRFGEMFLT------KARV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVTDDNA  1189

Query  1280  NILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
               ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G   E E
Sbjct  1190  EKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIRKVEN---IGSGNNFEHE  1246

Query  1100  LLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEK  921
              +I+L + HP L+     S +     +   LE+ + +   G K +FV+ ++  C   +EK
Sbjct  1247  YVISLASTHPSLVTAINMSEEEASLIDKPMLERLRSNPYEGVKTRFVIEVVRLCEALREK  1306

Query  920   VLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVML  741
             VLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S+V+L
Sbjct  1307  VLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNDSRVLL  1366

Query  740   ASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEE  561
             AS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT E +
Sbjct  1367  ASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGEGD  1426

Query  560   KYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
             KY R   K+ +S ++FS +   +       K E E   +++ ED+
Sbjct  1427  KYDRQAEKDHLSKLVFSTEDEFNNVRNMLSKAEMEHCSKLISEDK  1471



>ref|XP_006593004.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Glycine 
max]
Length=1109

 Score =   351 bits (900),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 238/702 (34%), Positives = 346/702 (49%), Gaps = 71/702 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D+LW EM++ L    +    ++     A E     +     C HD   NEEIG+ CR CG
Sbjct  394   DILWGEMDMLLRGEEIGSQVDNIGTNEARE---NEENSASQCKHDTIFNEEIGIYCRWCG  450

Query  2342  VVSTEIKDVPPPFMPST-----CSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
              ++TEIK + PPF+ S       SS G      +  +    GDD++       V S+   
Sbjct  451   WIATEIKYITPPFVDSERCCRRVSSGGGNTSQFDGDLFNDPGDDSE------AVWSHN--  502

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ---IDPESKKRGGCVIS  2007
                  E   W LIPD++  L  HQ+  FEF+W N+AG+    +   +DP S+  GGC++S
Sbjct  503   -----EGTVWDLIPDIKQSLYPHQQEGFEFIWTNLAGTTDLAKLKRVDPCSE--GGCIVS  555

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQT  1827
             H+PG GKT L + FL +YL+ FP   P+++AP   L TW  E+ KW I IP + ++  + 
Sbjct  556   HAPGTGKTRLTMVFLQTYLQSFPKCLPIIIAPANILLTWEDELRKWNIGIPFHNLNNSEL  615

Query  1826  YKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTL---TREDS  1656
                E L  ++       +N+D + ++    K+  W    S+LL+ Y  +  L   T E  
Sbjct  616   SGKEKLINEVDWSGNQKQNKDAIRMV----KLCSWYKEKSILLISYNLYEKLAGSTAEGD  671

Query  1655  TYAH---------------RKY----MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKV  1533
                                R+Y    M +VLR  PG+L+LDEGH PR+  S + K L + 
Sbjct  672   GKKEKKNNKMKKKKKRARPREYIESGMGKVLRDYPGLLVLDEGHTPRNQNSYIWKVLSES  731

Query  1532  NTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRA  1353
              T  RILLSGT FQNNF E +N LCL +P F D + +EL    + R    +   S +   
Sbjct  732   RTKKRILLSGTPFQNNFLELYNILCLMKPSFPDSIPQELKKFCQSRQMQERKDVSWD---  788

Query  1352  RKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKST  1176
                           S      E + +LK L   F+ V++G     NLPGL+   L++K  
Sbjct  789   ----------WEPVSSGNTADEKIKLLKLLMNPFVHVHKGSILQKNLPGLRDCVLVLKPD  838

Query  1175  TLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfk  996
              LQQE L  ++     Y    L  E  + L ++HP L    + S +     +   LEK +
Sbjct  839   ILQQETLESIE-----YSQSALNFEHKLALVSVHPSLFLNCSLSKKEESVVDKGKLEKLR  893

Query  995   fdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQG  816
              +   G K KF+   I  C    EKVLIF   I  + L  +  E  + W  G EVL + G
Sbjct  894   LNPYGGVKTKFLFEFIRLCDAVNEKVLIFSQFIDTLCLIKDQLESAFNWSVGTEVLYMYG  953

Query  815   DIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIA  636
              ++  ++  ++  F +    +KV+LASI   +EGI+L  ASRV+LLD  WNPS  +QAI 
Sbjct  954   KLDHKQKQSLIRSFNDSNSQAKVLLASIKASSEGINLIGASRVVLLDVVWNPSVERQAIC  1013

Query  635   RAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             RA+R GQ +VV+ Y LLA GT E  KY +   K  +S ++FS
Sbjct  1014  RAYRLGQKRVVFTYHLLAQGTPECTKYCKQAEKNRLSELVFS  1055



>ref|XP_008229682.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Prunus 
mume]
Length=1260

 Score =   352 bits (904),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 242/708 (34%), Positives = 373/708 (53%), Gaps = 36/708 (5%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNL-KSATELHMATKKGT-----RVCHHDFRLNEEIGLVC  2355
             LW ++E AL +  +   + D+N+ +S   L +A +  T     R   H   L+EEIGL+C
Sbjct  552   LWDDLEFALRASEI--GSPDSNVVESQDSLPIANEVETVAGLCRRGVHQLILDEEIGLLC  609

Query  2354  RLCGVVSTEIKDVPPPFM--PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
             + C  V  EIK + P F+  P     +   +     + +E Q   +D D  +        
Sbjct  610   KFCSYVDQEIKYILPDFIDCPYGRFGTRGSETDNRSIFDELQSHVSDSDRHS------GC  663

Query  2180  SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID-PESKKRGGCVISH  2004
             +S   VE   W LIP ++N +  HQR  FEF+W +IAG I   ++  P S    GC+ISH
Sbjct  664   NSHPHVEGTVWDLIPGVKNSMYPHQREGFEFIWNHIAGGIHLDKLKKPSSVGGNGCIISH  723

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKT L I FL +Y++LFP  RPL++AP++ L TW +E  KWK  IP + ++  +  
Sbjct  724   APGTGKTRLTIVFLQTYMELFPDCRPLLIAPRSMLLTWEEEFKKWKFDIPFHNLNNLE-L  782

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              GE  +  + L       + V      + K+  W  + S+L + Y  F  L+    T + 
Sbjct  783   SGEENQTAVNLVMQAQGRKSVNKENSRMLKLYSWKKNRSILGITYRLFEQLSGAQKTGSA  842

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
              + M ++L + PG+++ DEGH PR+ +S + KAL ++ T  RILLSGT FQNNF E FNT
Sbjct  843   DE-MGKILLEFPGLVVFDEGHTPRNDQSHMWKALSEIKTKSRILLSGTPFQNNFQELFNT  901

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG  1284
             + L RP F   +      K+ + +   + R S   + ++ F+   + K+   KE+   E 
Sbjct  902   IYLVRPTFAASIDS---TKFSRDLPRKRGRKSNGEKWKRTFVASSNGKVADDKEKHATE-  957

Query  1283  LNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
                +K     F+ VY+G    D+LPGL+   +++  T LQ     ++Q  + +++     
Sbjct  958   ---VKAQIAPFVHVYKGSVLQDSLPGLRNSVVVLHPTPLQVRFHKRIQGVKELFR-----  1009

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
              E L  L  IHP L+       +     +   LE+ K +   G K KFVM LI      K
Sbjct  1010  YENLEALICIHPSLLLKDK---EDAFSADRGRLEELKLNPDAGVKAKFVMELIRLSDAMK  1066

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             E+VL+F   + P+ L  ++ +  + W +G EVL + G  ++ +R   M  F +    +KV
Sbjct  1067  ERVLVFSQYLDPLILIRDLLKSLFQWTEGEEVLYMDGKCDMKQRQSSMKVFNDPSSNAKV  1126

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ KVV+VY LL  GT E
Sbjct  1127  LLASTKACSEGISLVGASRVVLLDVAWNPSVERQAISRAYRLGQKKVVFVYHLLMDGTNE  1186

Query  566   EEKYKRTTWKEWVSSMIFSE-DLVEDPSHWQAPKIEDELLGEIVEEDR  426
             E+KY R   K  +S ++FS+ D        +A   ED++L E+ + ++
Sbjct  1187  EDKYSRQVDKSRLSELVFSDSDKKALEKEIRATVSEDKILEEMAQHEK  1234



>ref|XP_011086198.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Sesamum 
indicum]
Length=1727

 Score =   356 bits (914),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 245/742 (33%), Positives = 383/742 (52%), Gaps = 67/742 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D  W   EL  +  Y   D E+T  ++    H    +G     H+  L ++ GL+C  C 
Sbjct  1018  DFNWALEELG-SFVYPEVDQENTKDRAEETQHARCTRGK----HELVLQDDQGLICIYCR  1072

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPE-EVVMEEKQGDDADLDHFAIPVSSNKPSSEVE  2166
              +    +D+ P ++  TC+ S +++  E E ++E         D F +  SS    +E  
Sbjct  1073  HLELGPRDILPEWVEKTCTESERKRYSETEQLLE--------FDGFHLQ-SSKDNFAEFN  1123

Query  2165  VEDNA--WALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI---DPESKKRGGCVISHS  2001
                N   W++ P +R  +  HQ+  FEFLWKN+AGSI   ++   DP     GGC+ISH+
Sbjct  1124  NSANGTVWSIKPGIRESMYEHQQEGFEFLWKNLAGSINLDELKSTDPGGV--GGCIISHA  1181

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I FL SYLKLFP  RP+++ P + L TW +E  KW +  P Y ++  + + 
Sbjct  1182  PGTGKTRLTIVFLESYLKLFPNCRPVIITPASMLLTWEEEFRKWNVEFPFYNLNNLE-FL  1240

Query  1820  GEVLRQKMKLCPGLPR-NQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRE----DS  1656
             G+  +  ++L  G  R N+D + ++    K+  W    S+L + Y+ F  LT E    + 
Sbjct  1241  GKENKNALRLLAGAKRGNKDAIRMV----KIYSWNMGRSILGISYSLFEKLTGEKYIKER  1296

Query  1655  TYAHR---------KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSG  1503
             T   R         K + ++L + PG++ILDEGH PR+ +S +   L+KV T  R++LSG
Sbjct  1297  TTEKRERVIIDGKTKALRKILLEKPGLVILDEGHTPRNRRSNIWNVLLKVQTKKRVILSG  1356

Query  1502  TLFQNNFGEYFNTLCLARPRFVDEVLKE--LDPKYKKRVKGAKTRFSLENRARKMFidki  1329
             T FQNNFGE FNTL + RP   D + +E         R   +K ++  EN    +  + I
Sbjct  1357  TPFQNNFGELFNTLHIVRPAIADVLAQEKTFAEMIASRRMSSKRKYKEENSHSTLITEAI  1416

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILV  1152
              +             +  LK   + F+ V++G     +LPGL+   +++K   LQ+ ++ 
Sbjct  1417  DR------------AVEKLKISMSPFVHVHKGTILQQSLPGLRDCVILLKPPALQKSLIE  1464

Query  1151  KLQDQRPIYKGFP--LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLG  978
             +L+       G P     E  + L ++HP+L + +  + +   E +LEA++  K +   G
Sbjct  1465  RLE-------GSPSTFHFEHKVALISVHPYLFQHSDSTEEERIEIDLEAVQASKLNPNEG  1517

Query  977   SKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFE  798
              K KF++  +   +   EKVLIF   I P+ L  E  +  + W  G ++L +QG +E  +
Sbjct  1518  VKTKFILEFVRLSVAMNEKVLIFSQYIQPLELIKEQLKEIFKWVDGKQILRMQGKLEQKQ  1577

Query  797   RGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPG  618
             R  +++ F +    SKVMLAS   C+EGISL  ASRVILLD  WNPS  +QAI RA+R G
Sbjct  1578  RQMLINVFNDPQSESKVMLASTRCCSEGISLVGASRVILLDVVWNPSVERQAICRAYRIG  1637

Query  617   QDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQ-APKIEDELLGEI  441
             Q K VY Y L+ +GT E +KY R   K+ +S ++F+    E        P IED +L E+
Sbjct  1638  QKKFVYTYHLMTSGTTEADKYCRQAEKDRLSELVFTSSSNESNKQKHPCPSIEDRILEEM  1697

Query  440   VEEDR-ATLFHMIMKNEKASNM  378
             V   +   +F  I+   K +++
Sbjct  1698  VGHAKLKEMFEKIINQPKDADL  1719



>ref|XP_007140762.1| hypothetical protein PHAVU_008G139700g [Phaseolus vulgaris]
 gb|ESW12756.1| hypothetical protein PHAVU_008G139700g [Phaseolus vulgaris]
Length=1218

 Score =   352 bits (902),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 238/703 (34%), Positives = 355/703 (50%), Gaps = 72/703 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTED--TNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             D+LW EM++ L    +     +  TN     E   A+K     C HD   NE+IG+ CR 
Sbjct  502   DVLWGEMDMLLRVEEIGTQVNNIGTNEARENEESPASK-----CKHDTIFNEQIGIYCRW  556

Query  2348  CGVVSTEIKDVPPPFMPS-------TCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS  2190
             CG + TEIK + PPF+ S         S  G   + +  ++ E    D DL+      S 
Sbjct  557   CGWIETEIKYITPPFVDSERYGGRRVASDGGNISKLDRALLNEY---DDDLEEIW---SH  610

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESK-KRGGCV  2013
             N        E   W LIP+++  L  HQ+  FEF+W N+ G+I   ++   +    GGC+
Sbjct  611   N--------EGTVWDLIPNIKQSLYPHQQEGFEFIWTNLGGTIDLAKLKTVNPCNEGGCI  662

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PG GKT L + FL +YL+LFP   P+++AP   L TW  E+ KW + IP + ++  
Sbjct  663   ISHAPGTGKTRLTMVFLQTYLQLFPKCLPVIIAPSNILLTWEDELRKWNLGIPFHNLNST  722

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR----  1665
             +    E +  ++       +N+D + ++    K+  W    S+LL+ Y  +  L      
Sbjct  723   ELSGKEQVINEVDWSGNQRQNKDAIRMV----KLCSWYKEKSILLISYNLYEKLAGATSE  778

Query  1664  ------------EDSTYAH-RKY----MNQVLRQCPGILILDEGHNPRSTKSRLRKALMK  1536
                         E   +A  R+Y    M +VLR  PG+L+LDEGH PR+  S + K L +
Sbjct  779   GDGEKDKNNGKIEKKKHARTREYIESGMGKVLRDYPGLLVLDEGHTPRNQNSYIWKVLSE  838

Query  1535  VNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENR  1356
               T  RILLSGT FQNNF E +N LCL +P F D + +EL        K  ++R     +
Sbjct  839   SRTQKRILLSGTPFQNNFLELYNILCLMKPSFPDSIPQELK-------KFCQSRLMHRRK  891

Query  1355  ARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKS  1179
             A K    +     + + E+ ++  L     L   F+ V++G     NLPGL+   L++K 
Sbjct  892   ASKDMSWEPVSSRNPADEKIKQLNL-----LMNPFVHVHDGSILQKNLPGLRECVLVLKP  946

Query  1178  TTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekf  999
              T QQE L  ++     Y    L  E  + L ++HP L  + + S +     +   LEK 
Sbjct  947   DTFQQETLESIE-----YAQNVLNFEHKLALVSVHPSLFLSCSLSKKEESIVDKGKLEKV  1001

Query  998   kfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQ  819
             + +   G K KF++  I  C    EKVL+F   I  +NL  +  E  + W  G+EVL + 
Sbjct  1002  RLNPYAGVKTKFLIEFIRLCDAVNEKVLVFSQFIDTLNLIKDQLESAFNWTLGMEVLYMY  1061

Query  818   GDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAI  639
             G ++  ++  +++ F E    +KV+LASI   +EGISL  ASRV++LD  WNPS  +QAI
Sbjct  1062  GKLDQKQKQFLINSFNEANSQAKVLLASIKASSEGISLVGASRVVILDVVWNPSVERQAI  1121

Query  638   ARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
              RA+R GQ KVV+ Y LLA GT E  KY +   K  +S ++FS
Sbjct  1122  CRAYRLGQKKVVFTYHLLAQGTPECTKYCKQAEKNRLSELVFS  1164



>gb|KHN32424.1| DNA repair and recombination protein RAD54-like, partial [Glycine 
soja]
Length=1174

 Score =   351 bits (900),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 238/702 (34%), Positives = 346/702 (49%), Gaps = 71/702 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D+LW EM++ L    +    ++     A E     +     C HD   NEEIG+ CR CG
Sbjct  459   DILWGEMDMLLRGEEIGSQVDNIGTNEARE---NEENSASQCKHDTIFNEEIGIYCRWCG  515

Query  2342  VVSTEIKDVPPPFMPST-----CSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
              ++TEIK + PPF+ S       SS G      +  +    GDD++       V S+   
Sbjct  516   WIATEIKYITPPFVDSERCCRRVSSGGGNTSQFDGDLFNDPGDDSE------AVWSHN--  567

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ---IDPESKKRGGCVIS  2007
                  E   W LIPD++  L  HQ+  FEF+W N+AG+    +   +DP S+  GGC++S
Sbjct  568   -----EGTVWDLIPDIKQSLYPHQQEGFEFIWTNLAGTTDLAKLKRVDPCSE--GGCIVS  620

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQT  1827
             H+PG GKT L + FL +YL+ FP   P+++AP   L TW  E+ KW I IP + ++  + 
Sbjct  621   HAPGTGKTRLTMVFLQTYLQSFPKCLPIIIAPANILLTWEDELRKWNIGIPFHNLNNSEL  680

Query  1826  YKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTL---TREDS  1656
                E L  ++       +N+D + ++    K+  W    S+LL+ Y  +  L   T E  
Sbjct  681   SGKEKLINEVDWSGNQKQNKDAIRMV----KLCSWYKEKSILLISYNLYEKLAGSTAEGD  736

Query  1655  TYAH---------------RKY----MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKV  1533
                                R+Y    M +VLR  PG+L+LDEGH PR+  S + K L + 
Sbjct  737   GKKEKKNNKMKKKKKRARPREYIESGMGKVLRDYPGLLVLDEGHTPRNQNSYIWKVLSES  796

Query  1532  NTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRA  1353
              T  RILLSGT FQNNF E +N LCL +P F D + +EL    + R    +   S +   
Sbjct  797   RTKKRILLSGTPFQNNFLELYNILCLMKPSFPDSIPQELKKFCQSRQMQERKDVSWD---  853

Query  1352  RKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKST  1176
                           S      E + +LK L   F+ V++G     NLPGL+   L++K  
Sbjct  854   ----------WEPVSSGNTADEKIKLLKLLMNPFVHVHKGSILQKNLPGLRDCVLVLKPD  903

Query  1175  TLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfk  996
              LQQE L  ++     Y    L  E  + L ++HP L    + S +     +   LEK +
Sbjct  904   ILQQETLESIE-----YSQSALNFEHKLALVSVHPSLFLNCSLSKKEESVVDKGKLEKLR  958

Query  995   fdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQG  816
              +   G K KF+   I  C    EKVLIF   I  + L  +  E  + W  G EVL + G
Sbjct  959   LNPYGGVKTKFLFEFIRLCDAVNEKVLIFSQFIDTLCLIKDQLESAFNWSVGTEVLYMYG  1018

Query  815   DIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIA  636
              ++  ++  ++  F +    +KV+LASI   +EGI+L  ASRV+LLD  WNPS  +QAI 
Sbjct  1019  KLDHKQKQSLIRSFNDSNSQAKVLLASIKASSEGINLIGASRVVLLDVVWNPSVERQAIC  1078

Query  635   RAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             RA+R GQ +VV+ Y LLA GT E  KY +   K  +S ++FS
Sbjct  1079  RAYRLGQKRVVFTYHLLAQGTPECTKYCKQAEKNRLSELVFS  1120



>gb|ABV80237.2| required to maintain repression 1 [Zea mays]
 gb|ABV80239.2| required to maintain repression 1 [Zea mays]
Length=1435

 Score =   353 bits (906),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 226/681 (33%), Positives = 344/681 (51%), Gaps = 39/681 (6%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             DMLW + + AL S     Y  D+ ++ N     +  +A+        H+F ++++IG+ C
Sbjct  719   DMLWADFDFALESENIGTYYDDECQEGN---QLDFSLASVTPCSRGKHEFVIDDQIGIRC  775

Query  2354  RLCGVVSTEIKDVPPPFM-PSTCSSSGKEQRPEEVVMEEKQGDDADL---DHFAIPVSSN  2187
             + C +V+ EIK     FM PS  S  G     E+      +G    L   D +   V+  
Sbjct  776   KYCSLVNLEIK-----FMFPSLVSVFG-----EKSAWPNDKGVKNTLMFHDLYEQGVNDT  825

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCV  2013
             + S ++      W LIP + + +  HQR AFEF+W N+ G I   +I   +K    GGCV
Sbjct  826   EQSQDIHQYGTVWNLIPGVISTMYEHQREAFEFMWTNLVGDIRLDEIKHGAKPDVVGGCV  885

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             I H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I   
Sbjct  886   ICHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNVDVP-FHILNT  944

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
               Y G+  R   KL     R + +  ++    K+  W     +L + Y  +  LT E   
Sbjct  945   TDYTGKEDRDICKLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYTKLTSEKPG  1000

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
                   +  +L   PG+L+LDEGH PR+ +S + K L  V T  RI+LSGT FQNNF E 
Sbjct  1001  CTEENKVRSILLDNPGLLVLDEGHTPRNERSVMWKTLGNVKTEKRIILSGTPFQNNFLEL  1060

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             +N LCL RPRF +  L       K RV   +  +  + +  K           S      
Sbjct  1061  YNILCLVRPRFGEMFLT------KSRV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVT  1112

Query  1292  kEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
              +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G  
Sbjct  1113  DDNAEKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIKKVEN---IGSGNN  1169

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
              E E +I+L + HP L+     S +     +   L K + +   G K +FV+ ++     
Sbjct  1170  FEHEYVISLASTHPSLVTAINMSEEEASLIDKPMLAKVRSNPYEGVKTRFVIEVVRLSEA  1229

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
              +EKVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S
Sbjct  1230  LREKVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNDS  1289

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             +V+LAS   C EGISLT ASR++LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT
Sbjct  1290  RVLLASTRACCEGISLTGASRIVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGT  1349

Query  572   LEEEKYKRTTWKEWVSSMIFS  510
              E +KY R   K+ +S ++FS
Sbjct  1350  GEGDKYDRQAEKDHLSKLVFS  1370



>ref|XP_010664213.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Vitis 
vinifera]
Length=1021

 Score =   347 bits (890),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 239/741 (32%), Positives = 387/741 (52%), Gaps = 58/741 (8%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTR--VCH---HDFRLNEEIGLV  2358
             + LW E +  L S  +   +++TN+    +   A  +  +  +CH   H   L+E+IG+ 
Sbjct  304   NQLWAEFDFVLRSAEI--GSKETNVDGEEDFGSAEVEIDQAVLCHQGNHQLVLDEQIGMT  361

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEE---VVMEEKQGDDADLDHFAIPVSSN  2187
             C  C  V  EIK + P F  +    S K    +E    + +E Q        F  P   +
Sbjct  362   CCFCSFVQLEIKYILPSFSRNPWGGSEKGNAGKEDCNSIFDELQ--------FQKPGCGS  413

Query  2186  KPSSE--VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--  2019
             +  S+  +  E   W +IP +RN +  HQ   FEF+WKN+AG I   ++   S   GG  
Sbjct  414   QSGSDHGLHPEGTVWDIIPGIRNSMYRHQCEGFEFIWKNVAGGIYLDELKRSSFSDGGSG  473

Query  2018  CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH  1839
             C+ISH+PG GKT L I FL +Y++L+P  RP+++AP+T L TW +E  KW + IP + ++
Sbjct  474   CIISHAPGTGKTRLTIVFLQTYMELYPACRPVIIAPRTMLLTWEEEFKKWNVDIPFHNLN  533

Query  1838  GGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---  1668
               + Y G+     +     +         +  + K+  W    S+L + YT F  L    
Sbjct  534   KLE-YSGKENITALNFLRRISHQGQSAKSIRMV-KLYSWKKDRSILGISYTLFEKLAGER  591

Query  1667  ----REDSTYAHRKYMNQVLRQCPGILIL----DEGHNPRSTKSRLRKALMKVNTSLRIL  1512
                 +E+     + Y    +R+    L      DEGH PR+ +S + KAL K++T  RI+
Sbjct  592   VLADQENKKVKVQDYTKVQVRKILLELPGLLVLDEGHTPRNEQSLIWKALSKIDTERRII  651

Query  1511  LSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidk  1332
             LSGT FQNNF E +NTLCL RP+F D +  E    ++ + +G K+     N AR  +   
Sbjct  652   LSGTPFQNNFKELYNTLCLVRPKFADRIAVEQYGGFRGK-RGRKS-----NAARGKWDLL  705

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL  1155
              S     + ++     +  L+ +   F+ +++G    +NLPGL+   ++++ + LQ+ +L
Sbjct  706   TSSIGKIADDK-----VEELRAMIEPFVHIHKGTILQENLPGLKDSVVVLQPSDLQRRLL  760

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGS  975
               +++++      PLEL  L++L ++HP L+     S +     +   LEK K +  +G 
Sbjct  761   ESIREKKN-----PLELGYLVSLISVHPSLL----PSDERKLFFDQTKLEKIKLNPDIGV  811

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             K KF+M+ I       EKVL+F   + P+   ++  +  + W  G EVL + G  ++ +R
Sbjct  812   KTKFLMAFIRFSETMNEKVLVFSQFLDPLTYLMDQLKYHFHWIVGKEVLYMDGQRDVKQR  871

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
                ++ F +     +V+LAS   C+EGISL  ASRVILLD  WNPS  +QAI+RA+R GQ
Sbjct  872   QSSINTFNDPASQVRVLLASTKACSEGISLVGASRVILLDVVWNPSVERQAISRAYRLGQ  931

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSHWQAPKIEDELLGEIV  438
              KVVY+Y LL +GT+EEEKY R   K+ +S ++F S+D     +   +   ED++L E+V
Sbjct  932   RKVVYIYHLLTSGTMEEEKYCRQAKKDRLSELVFSSKDKTSAGNKISSTVSEDKILEEMV  991

Query  437   EEDR-ATLFHMIMKNEKASNM  378
             + ++   +F  I+   K SN+
Sbjct  992   QHNKLKDMFDKIINQPKESNL  1012



>gb|KEH22459.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1239

 Score =   350 bits (899),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 232/682 (34%), Positives = 353/682 (52%), Gaps = 71/682 (10%)
 Frame = -3

Query  2399  CHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDAD  2220
             C HD  L+EEIGL C+LC  V TEIK + PP +   C   G  +R     + +   + + 
Sbjct  567   CEHDTFLDEEIGLFCKLCHEVVTEIKYISPP-VNDRCPDKGSGKR----ALSDDSVNASL  621

Query  2219  LDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI-D  2043
              D     VS     + + +E + W LIPD++ KL  HQ+  FEF+WKN+AG+I   ++ +
Sbjct  622   FDGSQFNVSDGDSDANLFLEGSVWDLIPDVKEKLYPHQQEGFEFIWKNLAGNIELQKLKN  681

Query  2042  PESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI  1863
              + ++ GGC+ISH+PG GKT L I FL +YLK+FPG  P+++AP + L TW  E  KW+I
Sbjct  682   ADPRREGGCIISHAPGTGKTRLTIEFLKAYLKVFPGCLPIIVAPASLLLTWEYEFKKWEI  741

Query  1862  PIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDC-----------LEKMQKWLA  1716
              +P + ++  +                +  ++DV +  +            + K+  W  
Sbjct  742   GVPFHNLNNSEL--------------SVKDHEDVFNANNWSNTRQSTEETRMMKLISWFK  787

Query  1715  HPSVLLMGYTSFLTLT------------REDSTYAHRKY---MNQVLRQCPGILILDEGH  1581
               S+L + Y+ +  +             R+ ++   RK    M +VL + PG+L+LDEGH
Sbjct  788   AKSILGISYSLYEKIAGGGEYGDGDEKKRKRASADKRKENSCMRKVLLETPGLLVLDEGH  847

Query  1580  NPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKY-  1404
              PR+  S + K L K+ T  RI+LSGT FQNNF E +NTL L RP F   + +EL  K+ 
Sbjct  848   TPRNKNSLIWKVLSKIQTRKRIILSGTPFQNNFLELYNTLSLVRPSFHKTIPQEL-KKFC  906

Query  1403  -KKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS  1227
              K+  K A   +S E     +F +      D          +  LK L   F+ V++G  
Sbjct  907   QKQERKKAPKEWSWE----PVFGNTAGNTSDDK--------IKQLKLLMDPFVHVHKGAI  954

Query  1226  -SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTA  1050
                 LPGL+   L +K  +  ++IL   +  +  +      LE   TL +IHP L+    
Sbjct  955   LQKKLPGLRDCVLCLKPDSFHKQILESFKSSQNSFI-----LENKQTLASIHPSLLLECK  1009

Query  1049  CSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEI  870
                +     + + LEK + D   G K KF++  +  C    EKVL+F   + P+ L ++ 
Sbjct  1010  FLTEEESFVDKDRLEKLRLDHNAGVKTKFLLEFVNLCAAHNEKVLVFSQLLDPLRLIIDQ  1069

Query  869   FERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASR  690
                   W +G E+L + G  E+ +R  +++ F +    SK++LAS   C+EGISL  ASR
Sbjct  1070  LNSALKWTEGKEILYMSG--EVRDRQSLINNFNDANSQSKILLASTRACSEGISLVGASR  1127

Query  689   VILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             V+LLD EWNPS  KQAI+RA+R GQ KVVY Y LL  GT E +KY +   K  +S ++FS
Sbjct  1128  VVLLDVEWNPSVEKQAISRAYRIGQKKVVYTYHLLTQGTKECDKYCKQAEKHRLSELVFS  1187

Query  509   EDLVEDPSHWQ--APKIEDELL  450
                 ++ +  +  A  IED +L
Sbjct  1188  AKNADNHNEPKNCAADIEDRIL  1209



>gb|ABV80241.2| mutant required to maintain repression 1 [Zea mays]
Length=1435

 Score =   352 bits (903),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 230/709 (32%), Positives = 354/709 (50%), Gaps = 39/709 (6%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             DMLW + + AL S     Y  D+ ++ N     +  +A+        H+F ++++IG+ C
Sbjct  719   DMLWADFDFALESENIGTYYDDECQEGN---QLDFSLASVTPCSRGKHEFVIDDQIGIRC  775

Query  2354  RLCGVVSTEIKDVPPPFM-PSTCSSSGKEQRPEEVVMEEKQGDDADL---DHFAIPVSSN  2187
             + C +V+ EIK     FM PS  S  G     E+      +G    L   D +   V+  
Sbjct  776   KYCSLVNLEIK-----FMFPSLVSVFG-----EKSAWPNDKGVKNTLMFHDLYEQGVNDT  825

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCV  2013
             + S ++      W LIP + + +  HQR AFEF+W N+ G I   +I   +K    GGCV
Sbjct  826   EQSQDIHQYGTVWNLIPGVISTMYEHQREAFEFMWTNLVGDIRLDEIKHGAKPDVVGGCV  885

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             I H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I   
Sbjct  886   ICHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNVDVP-FHILNT  944

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
               Y G+  R   KL     R + +  ++    K+  W     +L + Y  +  LT E   
Sbjct  945   TDYTGKEDRDICKLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYTKLTSEKPG  1000

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
                   +  +L   PG+L+LDEGH PR+ ++ + K L  V T  RI+LSGT FQNNF E 
Sbjct  1001  CTEENKVRSILLDNPGLLVLDEGHTPRNERNVMWKTLGNVKTEKRIILSGTPFQNNFLEL  1060

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             +N LCL RPRF +  L       K RV   +  +  + +  K           S      
Sbjct  1061  YNILCLVRPRFGEMFLT------KSRV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVT  1112

Query  1292  kEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
              +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G  
Sbjct  1113  DDNAEKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIKKVEN---IGSGNN  1169

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
              E E +I+L + HP L+     S +     +   L K + +   G K +FV+ ++     
Sbjct  1170  FEHEYVISLASTHPSLVTAINMSEEEASLIDKPMLAKVRSNPYEGVKTRFVIEVVRLSEA  1229

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
              +EKVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S
Sbjct  1230  LREKVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNDS  1289

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             +V+LAS   C EGISLT ASR++LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT
Sbjct  1290  RVLLASTRACCEGISLTGASRIVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGT  1349

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
              E +KY R   K+ +S ++FS +   +       K E E   + + ED+
Sbjct  1350  GEGDKYDRQAEKDHLSKLVFSTEDEFNNVRNMLSKAEMEHCSKFISEDK  1398



>gb|ABV80240.2| mutant required to maintain repression 1 [Zea mays]
Length=1435

 Score =   352 bits (903),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 226/681 (33%), Positives = 343/681 (50%), Gaps = 39/681 (6%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             DMLW + + AL S     Y  D+ ++ N     +  +A+        H+F ++++IG+ C
Sbjct  719   DMLWADFDFALESENIGTYYDDECQEGN---QLDFSLASVTPCSRGKHEFVIDDQIGIRC  775

Query  2354  RLCGVVSTEIKDVPPPFM-PSTCSSSGKEQRPEEVVMEEKQGDDADL---DHFAIPVSSN  2187
             + C +V+ EIK     FM PS  S  G     E+      +G    L   D +   V+  
Sbjct  776   KYCSLVNLEIK-----FMFPSLVSVFG-----EKSAWPNDKGVKNTLMFHDLYEQGVNDT  825

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCV  2013
             + S ++      W LIP + + +  HQR AFEF+W N+ G I   +I   +K    GGCV
Sbjct  826   EQSQDIHQYGTVWNLIPGVISTMYEHQREAFEFMWTNLVGDIRLDEIKHGAKPDVVGGCV  885

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             I H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I   
Sbjct  886   ICHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNVDVP-FHILNT  944

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
               Y G+  R   KL     R + +  ++    K+  W     +L + Y  +  LT E   
Sbjct  945   TDYTGKEDRDICKLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYTKLTSEKPG  1000

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
                   +  +L   PG+L+LDEGH PR+ +S + K L  V T  RI+LSGT FQNNF E 
Sbjct  1001  CTEENKVRSILLDNPGLLVLDEGHTPRNERSVMWKTLGNVKTEKRIILSGTPFQNNFLEL  1060

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             +N LCL RPRF +  L       K RV   +  +  + +  K           S      
Sbjct  1061  YNILCLVRPRFGEMFLT------KSRV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVT  1112

Query  1292  kEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
              +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G  
Sbjct  1113  DDNAEKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIKKVEN---IGSGNN  1169

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
              E E +I+L + HP L+     S +     +   L K + +   G K +FV+ ++     
Sbjct  1170  FEHEYVISLASTHPSLVTAINMSEEEASLIDKPMLAKVRSNPYEGVKTRFVIEVVRLSEA  1229

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
              +EKVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S
Sbjct  1230  LREKVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNDS  1289

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             +V+LAS   C EGISLT ASR++LLD  WNP   +QAI+RAFR GQ K VY Y L+  GT
Sbjct  1290  RVLLASTRACCEGISLTGASRIVLLDVVWNPVVGRQAISRAFRIGQKKFVYTYNLITYGT  1349

Query  572   LEEEKYKRTTWKEWVSSMIFS  510
              E +KY R   K+ +S ++FS
Sbjct  1350  GEGDKYDRQAEKDHLSKLVFS  1370



>emb|CDX77430.1| BnaA07g05680D [Brassica napus]
Length=673

 Score =   337 bits (864),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 233/684 (34%), Positives = 348/684 (51%), Gaps = 55/684 (8%)
 Frame = -3

Query  2393  HDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD  2214
             HDF L+EE+GL CR C  VS EI+DV P       + + K+        ++K G   D  
Sbjct  28    HDFVLDEEVGLKCRYCSYVSVEIRDVSPTMDKYRANINDKK-----TCSDKKSGGLLDSL  82

Query  2213  HFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-  2037
              FA    S    S    +   W  IP ++N L  HQ+  FEF+W N+AG+    ++    
Sbjct  83    DFAASDHSRDMESLKNTQGTVWEYIPGIKNSLYPHQQEGFEFMWNNLAGTTKLDELKSSV  142

Query  2036  SKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPI  1857
              K+ GGC+ISHSPG GKT L I FL SYL+ FP S P+V+AP + + TW +E  KW   I
Sbjct  143   GKESGGCIISHSPGTGKTRLTIVFLQSYLEQFPESHPVVIAPASLMLTWEEEFKKWNSNI  202

Query  1856  PVYQIHGGQTYKGEVLRQKMKLCPG---LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYT  1686
             P Y +   Q + G+  +  + L  G   L RN+D + ++    K+  W    S+L + Y 
Sbjct  203   PFYNM-SSQDFSGQENQAAVSLLKGNRHLRRNKDSVRMV----KLYSWRNKKSILGISYN  257

Query  1685  SFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
              +  L   +      +   ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LS
Sbjct  258   LYEKLA-GNRCAGEVQEFRKMLLELPGLLVLDEGHTPRNHNSCIWKVLTEVKTEKRIILS  316

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E  N LCL RP + D++   L    +   +G   RF  E            
Sbjct  317   GTPFQNNFKELSNVLCLTRPAYADKISSRLQDLTRLSQEGKNGRFDEE------------  364

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVK  1149
                          G++ LK +   F+ V++G    ++LPGL+   +M+     Q++IL +
Sbjct  365   ------------VGISELKDMIAPFVHVHKGNILRESLPGLRDCVVMLNPPFQQEKILKR  412

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfke------eelealekfkfdl  987
             +   +  +     ELE  ++  ++HP L     C  Q  KE        L+ LE  + D 
Sbjct  413   IDHSQNTF-----ELEHKLSAVSVHPSLY---MCCKQTNKERLTIGPVALKVLESLRLDS  464

Query  986   kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIE  807
             K G+K +F++  I       EKVL+F   I  + L  +     +GW +G E+L + G ++
Sbjct  465   KEGAKTRFLIDFIRFSQTVNEKVLVFSQYIDTLELIRDQLNAVFGWTEGEEILYMHGQLK  524

Query  806   LFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAF  627
                R  +++ F      SKV+LAS   C+EGI L  ASRV+LLD  WNPS  +QAI+RA+
Sbjct  525   QTIRQHLINNFNRPDSKSKVLLASTGACSEGIHLVGASRVVLLDVVWNPSVERQAISRAY  584

Query  626   RPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLG  447
             R GQ +VVY Y L+  GT E  KY + T K  +S M+FS    +D         ED++L 
Sbjct  585   RIGQKRVVYTYHLMVKGTTEWGKYCKQTKKHRISEMVFSPTNEKDKLIENEVVSEDKILD  644

Query  446   EIVEEDR-ATLFHMIMKNEKASNM  378
             E+V  ++   +F  ++  +K S+M
Sbjct  645   EMVRHEKLKDMFGKVLYRKKESDM  668



>ref|XP_010231441.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Brachypodium 
distachyon]
Length=1375

 Score =   351 bits (901),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 221/680 (33%), Positives = 342/680 (50%), Gaps = 36/680 (5%)
 Frame = -3

Query  2522  DMLWKEMELAL-----ASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLV  2358
             DMLW + + AL      + Y  +  E++N+     L +A         H+F ++++IG+ 
Sbjct  656   DMLWADYDFALELENIGTYYDDEHQEESNM---LNLGLACTTPCSRGKHEFIIDDQIGIR  712

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRP--EEVVMEEKQGDDADLDHFAIPVSSNK  2184
             C+ C +V+ EI+ V P  + +    S        ++ +M     + A         S + 
Sbjct  713   CKYCSLVNLEIRFVLPSMVSNYAEKSAWRNSSCLKDALMYHDLCEQAG--------SIDG  764

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVI  2010
              S         W LIP   N +  HQR AFEF+W N+ G I   ++   +K    GGCVI
Sbjct  765   QSQGFHPYGTVWDLIPGAINTMYQHQREAFEFMWTNLVGDIRLDELKHGAKPDVVGGCVI  824

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
              H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I    
Sbjct  825   CHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWEEEFKKWDVNVP-FHILNTT  883

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
              Y G+  R   +L     R   +  ++    K+  W     +L + Y  ++ LT E S  
Sbjct  884   EYSGKEDRDICRLIKKEHRTDKLTRLV----KLLSWNKGHGILGISYGLYMKLTSEKSVC  939

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
                  +  +L + PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNNF E +
Sbjct  940   TEENKVRSILLENPGLLVLDEGHTPRNERSVMWKTLGKVKTEKRIILSGTPFQNNFLELY  999

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             N LCL RPRF +  L         + K  +  +  + +  K           S       
Sbjct  1000  NILCLVRPRFGEMFLT--------KTKVGRRHYVSKKQRDKFSDKYEKGVWASLTSNVTD  1051

Query  1289  EGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
             +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G   
Sbjct  1052  DNAEKVRSILKPFVHIHNGTILRTLPGLRESVIVLKPPPLQKSIIRKVEN---IGSGNNF  1108

Query  1109  ELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
             E E +I+L + HP L+     S +     +   LE+ + +   G K +FV+ ++  C   
Sbjct  1109  EHEYVISLASTHPSLVTAINMSDEEASLIDKPMLERLRSNPYEGVKTRFVIEVVRLCEAL  1168

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSK  750
             KEKVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      ++
Sbjct  1169  KEKVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQNSIEVFNNPDSDAR  1228

Query  749   VMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTL  570
             V+LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT 
Sbjct  1229  VLLASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTG  1288

Query  569   EEEKYKRTTWKEWVSSMIFS  510
             E +KY R   K+ +S ++FS
Sbjct  1289  EGDKYDRQAEKDHLSKLVFS  1308



>ref|XP_007211028.1| hypothetical protein PRUPE_ppa019972mg [Prunus persica]
 gb|EMJ12227.1| hypothetical protein PRUPE_ppa019972mg [Prunus persica]
Length=1259

 Score =   349 bits (895),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 241/710 (34%), Positives = 377/710 (53%), Gaps = 40/710 (6%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNL-KSATELHMATKKGT--RVCH---HDFRLNEEIGLVC  2355
             LW ++E AL +  +  ++ D+N+ ++   L +A +  T   +C    H   L+EEIGL+C
Sbjct  551   LWDDLEFALRASEI--ESPDSNVVENQDSLPIANEVETVASLCRRGVHQLILDEEIGLLC  608

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEV----VMEEKQGDDADLDHFAIPVSSN  2187
             + C  +  EIK + P F+   C     ++R  E     + +E Q   +D D  +      
Sbjct  609   KFCSYIDQEIKYILPDFL--DCPYGRFDKRGSETDNRSIFDELQSHVSDSDRHS------  660

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID-PESKKRGGCVI  2010
               +S   VE   W LIP +++ +  HQR  FEF+W +IAG I   ++  P S    GC+I
Sbjct  661   GCNSHPHVEGTVWDLIPGVKSSMYPHQREGFEFIWNHIAGGIHLDKLKKPSSVGGNGCII  720

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I FL +Y++LFP  RPL++AP++ L TW +E  KWK  I  + ++  +
Sbjct  721   SHAPGTGKTRLTIVFLQTYMELFPDCRPLLIAPRSMLLTWEEEFKKWKFDITFHNLNNLE  780

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
                GE  +  + L       + V      + K+  W  + S+L + Y  F  L+    T 
Sbjct  781   -LSGEENQTAVNLVMQAQGRRSVNKENRRMLKLYSWKKNRSILGITYRLFEQLSGAQKTG  839

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
             +  + M ++L + PG+++ DEGH PR+ +S + KAL ++ T  RILLSGT FQNNF E F
Sbjct  840   SVDE-MGKILLEFPGLVVFDEGHTPRNDQSHMWKALSEIKTKSRILLSGTPFQNNFQELF  898

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NT+C+ RP F   +      K+ K +   + R S   +++  F+   S K+   KE+   
Sbjct  899   NTICIVRPTFAASIDS---TKFNKDLPKKRGRKSNGEKSKWTFVASSSGKVADDKEKHAT  955

Query  1289  EGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
             E    +K     F+ VY+G    D+LPGL+   +++  T LQ +   ++Q  + +++   
Sbjct  956   E----VKARIAPFVHVYKGSVLQDSLPGLRNSIVVLHPTPLQVKFHKRIQGVKELFR---  1008

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
                E L  L  IHP L+       +     +   LE+ K +   G K KFVM LI     
Sbjct  1009  --YENLEALICIHPSLLLKDK---EDAFSADRGRLEELKLNPDAGVKAKFVMELIRLSDA  1063

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
              KE+VL+F   + P+ L  ++ +  + W +G EVL + G  ++ +R   M  F +    +
Sbjct  1064  MKERVLVFSQYLDPLILIRDLLKSLFQWTEGEEVLYMDGKCDMKQRQSSMKVFNDPSSNA  1123

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV+LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ KVV+VY LL  G 
Sbjct  1124  KVLLASTKACSEGISLVGASRVVLLDVAWNPSVERQAISRAYRLGQKKVVFVYHLLMDGA  1183

Query  572   LEEEKYKRTTWKEWVSSMIFSE-DLVEDPSHWQAPKIEDELLGEIVEEDR  426
              EE+KY R   K  +S ++FS+ D        +A   ED++L E+ + ++
Sbjct  1184  NEEDKYSRQVDKSRLSELVFSDSDKKALEKEIRATVSEDKILEEMAQHEK  1233



>ref|XP_008229511.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Prunus 
mume]
Length=1200

 Score =   348 bits (893),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 237/695 (34%), Positives = 362/695 (52%), Gaps = 66/695 (9%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNL-KSATELHMATKKGT-----RVCHHDFRLNEEIGLVC  2355
             LW ++E AL +  +  D+ D+N+ +S   L +A +  T     R   H   L+EEIGL C
Sbjct  492   LWDDLEFALRASEI--DSSDSNVVESQDSLPIADEVETVASLCRRGVHQLILDEEIGLRC  549

Query  2354  RLCGVVSTEIKDVPPPFM--PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
             + C  +  EIK + P F+  P     +   +     + +E Q   +D D  +        
Sbjct  550   KFCSYLDQEIKYILPDFLDCPYGRFGTRGSETDNRSIFDELQSHASDSDRHS------GY  603

Query  2180  SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVIS  2007
             +S   V+   W LIP +++ +  HQR  FEF+WK+IAG I   ++   S   GG  C+IS
Sbjct  604   NSHPHVDGTVWDLIPGVKSSMYPHQREGFEFIWKHIAGGIHLDKLKKPSSVVGGNGCIIS  663

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG---  1836
             H+PG GKT L I FL +Y+KLFP  RPL++AP++ L TW +E  KWK+  P + ++    
Sbjct  664   HAPGTGKTRLTIVFLQTYMKLFPECRPLLIAPRSMLLTWEEEFKKWKLEFPFHNLNNWEL  723

Query  1835  ----GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT  1668
                  QT    V++ + +    +   +        + K+  W    S+L + Y  F  L+
Sbjct  724   SGKENQTAVNYVMQAQGRKSVNIESGR--------MLKLYSWRKKRSILGISYRLFEQLS  775

Query  1667  REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQN  1488
                 T +  + M ++L + PG+++ DEGH PR+ +S + KAL ++ T  RILLSGT FQN
Sbjct  776   GAQKTGSVDE-MGKILLEFPGLVVFDEGHTPRNDQSHMWKALSEIKTKRRILLSGTPFQN  834

Query  1487  NFGEYFNTLCLARPRFVDEV-----LKELDPKYKKRVKGAKTRF-SLENRARKMFidkis  1326
             NF E FNT+CL RP F   +      ++L  K  ++    K ++ SL + + K+  DK  
Sbjct  835   NFQELFNTICLVRPAFAASIESTKFSRDLPRKRGRKSNAEKWKWTSLASSSGKVVDDKEK  894

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVK  1149
                +             +K     F+ VY+G    D+LPGL+   +++  T LQ+    +
Sbjct  895   HATE-------------VKAQIAPFVHVYKGSVLQDSLPGLRNSVVVLHPTQLQERFHKR  941

Query  1148  LQDQRPIYKGFPLELELLITLGAIHP-WLIRTTACSGQYfkeeelealekfkfdlkLGSK  972
             +Q  + +++      E L  L + HP  L++  A S           L++ K +   G K
Sbjct  942   IQVVKELFR-----YENLEALISFHPSLLLKEDAFSAD------QGRLQELKLNPDAGVK  990

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
              KFVM LI      KEKVL+F   I P+NL  ++ +  + W +G EVL + G  ++ +R 
Sbjct  991   AKFVMELIRLSDALKEKVLVFSQYIDPLNLTRDLLKSQFQWTEGEEVLYMDGKSDMKQRQ  1050

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
               M  F +    +KV+LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ 
Sbjct  1051  SSMKVFNDPSSKAKVLLASTKACSEGISLVGASRVVLLDVTWNPSVERQAISRAYRLGQK  1110

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSE  507
             KVV+VY LL   T EE KY R   K  +S ++FS+
Sbjct  1111  KVVFVYHLLMDRTNEEHKYSRQVDKSRLSELVFSD  1145



>gb|KEH22070.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1324

 Score =   350 bits (897),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 246/732 (34%), Positives = 367/732 (50%), Gaps = 89/732 (12%)
 Frame = -3

Query  2522  DMLWKEMEL------ALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGL  2361
             ++LW E++       A++    L   E TN+KS +         +  C HD  L+EEIG+
Sbjct  623   EVLWDELDTVLRESDAVSMIGNLGTNEATNIKSGSP--------SSRCEHDTFLDEEIGV  674

Query  2360  VCRLCGVVSTEIKDVPPPFMPS-TCSSSGKEQRPEEV---VMEEKQGDDADLDHFAIPVS  2193
              C+LCGVV TEIK + P  +    C  SG++   + V   + +  Q + +D D      S
Sbjct  675   YCKLCGVVITEIKYISPLVVERFPCEGSGRKASFDGVNVSLFDGSQFNVSDKDS-ETNFS  733

Query  2192  SNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQ---IDPESKKRG  2022
              N        E   W LIPDL   L  HQ+  FEF+WKN+AGS+   +   +DP S+  G
Sbjct  734   RN--------EGTVWDLIPDLIQTLYPHQQEGFEFIWKNLAGSVKLQKLKNVDPCSE--G  783

Query  2021  GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQI  1842
             GC+ISH+PG GKT L I FL +YLK FP   P+++AP + L TW  E  KW I +P + +
Sbjct  784   GCIISHAPGTGKTRLTIVFLKAYLKAFPKCLPIIVAPASILLTWEDEFKKWDIGVPFHNL  843

Query  1841  HGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDC-LEKMQKWLAHPSVLLMGYTSFLTLTR  1665
                +       ++         R+    ++ +  + K+  W    S+L + Y  F    +
Sbjct  844   SNPELSG----KEHADAVETFDRSNTQHNIHETRMAKLISWFKETSILGISYNLFGKKCQ  899

Query  1664  EDSTYAHRKY------MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSG  1503
             +     + K       M ++L + PG+L+LDEGH PR+ +S + K L K+    RI+LSG
Sbjct  900   DKKKLENVKERKGNCDMRKILLKSPGLLVLDEGHTPRNQRSHIWKVLSKIQAQKRIILSG  959

Query  1502  TLFQNNFGEYFNTLCLARPRFVDEVLKELDP--------KYKKR----VKGAKTRFSLEN  1359
             T FQNNF E ++TL L +P F + +  EL            KKR    V G  TR   ++
Sbjct  960   TPFQNNFWELYSTLSLVKPSFPNTIPPELKSFCHKQGHKSSKKRSCEPVSGNTTRDPSDD  1019

Query  1358  RARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGSSDN-LPGLQCYTLMMK  1182
             + +K                        LK L   F+ V++G   +N LPGL+   + +K
Sbjct  1020  KIKK------------------------LKMLMDPFVHVHKGAILENKLPGLRDCLVTLK  1055

Query  1181  STTLQQEILVKLQ-DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeeleale  1005
             + +LQ EIL  ++  Q  I+       E  I L ++HP L    + S +     + + LE
Sbjct  1056  ADSLQNEILKSIKRSQNTIFN-----FERKIALTSVHPSLFLECSLSEEEESALDKDQLE  1110

Query  1004  kfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLV  825
             K + +   G K KF+   +  C    EKVL+F    AP+ L  +     + W +G EVL 
Sbjct  1111  KLRLNPHEGVKTKFLFEFVRLCDAFHEKVLVFSQFHAPLQLIKDQLTSAFKWSEGKEVLF  1170

Query  824   LQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQ  645
             + G      +  V+  F +    +KV+LAS   C+EGISL  ASRV+LLD  WNPS  +Q
Sbjct  1171  MSGKDPPKVKQSVIHSFNDANCQAKVLLASTKACSEGISLVGASRVVLLDVVWNPSVERQ  1230

Query  644   AIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDL---VEDPSHWQA  474
             AI+RA+R GQ +VVY Y LLA GT EEEKY +   K+ +S ++FSE     +++ S   A
Sbjct  1231  AISRAYRIGQKRVVYTYHLLAEGTTEEEKYGKQAEKDRLSELVFSEKNATDIDEESKSCA  1290

Query  473   PKIEDELLGEIV  438
                ED +L ++ 
Sbjct  1291  GNFEDRVLDQMT  1302



>ref|XP_008649609.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Zea 
mays]
 gb|ABV80238.2| required to maintain repression 1 [Zea mays]
 gb|AFW77894.1| required to maintain repression1 [Zea mays]
Length=1435

 Score =   351 bits (900),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 220/679 (32%), Positives = 342/679 (50%), Gaps = 35/679 (5%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             DMLW + + AL S     Y  D+ ++ N     +  +A         H+F ++++IG+ C
Sbjct  719   DMLWADFDFALESENIGTYYDDECQEGN---QLDFSLAPVTPCSRGKHEFVIDDQIGIRC  775

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSG--KEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
             + C +V+ EIK + P  +      S    ++  +  +M          D +   V+  + 
Sbjct  776   KYCSLVNLEIKFMFPSLVSVFAEKSAWPNDKGVKNTLMFH--------DLYEQGVNDTEQ  827

Query  2180  SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVIS  2007
             S ++      W LIP + + +  HQR AFEF+W N+ G I   +I   +K    GGCVI 
Sbjct  828   SQDIHQYGTVWNLIPGVISTMYEHQREAFEFMWTNLVGDIRLDEIKHGAKPDVVGGCVIC  887

Query  2006  HSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQT  1827
             H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I     
Sbjct  888   HAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNVDVP-FHILNTTD  946

Query  1826  YKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYA  1647
             Y G+  R+  KL     R + +  ++    K+  W     +L + Y  +  LT E     
Sbjct  947   YTGKEDREICKLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYTKLTSEKPGCT  1002

Query  1646  HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFN  1467
                 +  +L   PG+L+LDEGH PR+ +S + K L  V T  RI+LSGT FQNNF E +N
Sbjct  1003  EENKVRSILLDNPGLLVLDEGHTPRNERSVMWKTLGNVKTEKRIILSGTPFQNNFLELYN  1062

Query  1466  TLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkE  1287
              LCL RPRF +  L       K RV   +  +  + +  K           S       +
Sbjct  1063  ILCLVRPRFGEMFLT------KSRV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVTDD  1114

Query  1286  GLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
                 ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G   E
Sbjct  1115  NAEKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIKKVEN---IGSGNNFE  1171

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
              E +I+L + HP L+     S +     +   L K + +   G K +FV+ ++      +
Sbjct  1172  HEYVISLASTHPSLVTAINMSEEEASLIDKPMLAKVRSNPYEGVKTRFVIEVVRLSEALR  1231

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S+V
Sbjct  1232  EKVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNDSRV  1291

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LAS   C EGISLT ASR++LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT E
Sbjct  1292  LLASTRACCEGISLTGASRIVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGE  1351

Query  566   EEKYKRTTWKEWVSSMIFS  510
              +KY R   K+ +S ++FS
Sbjct  1352  GDKYDRQAEKDHLSKLVFS  1370



>ref|XP_006586198.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Glycine 
max]
Length=1148

 Score =   347 bits (890),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 243/751 (32%), Positives = 372/751 (50%), Gaps = 81/751 (11%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL---LDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCR  2352
             D LW EM++ L    +   +D   +    SA++           C HD   NEEIG+ CR
Sbjct  437   DNLWGEMDMLLRVEEIGSQIDKVGENEENSASQ-----------CKHDTIFNEEIGIYCR  485

Query  2351  LCGVVSTEIKDVPPPFMPS------TCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS  2190
              CG + TEIK + PPF+ +        S  GK  + + V+  +       +D      S 
Sbjct  486   WCGWIHTEIKYITPPFVDNERSGREALSGGGKTSQFDGVLFNDS------VDDSEAVWSH  539

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP-ESKKRGGCV  2013
             N        E   W LIPD++  L  HQ+  FEF+W ++AG+I   ++   +    GGC+
Sbjct  540   N--------EGTVWDLIPDIKESLFPHQQEGFEFIWTSLAGTIDLAELKRVDMHTEGGCI  591

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PG GKT L + FL +YL+LFP   P+++AP   L TW  E+ KW + IP + ++  
Sbjct  592   ISHAPGTGKTKLTMVFLQTYLQLFPKCLPIIIAPANILLTWEDELRKWNLGIPFHNLNNA  651

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR---E  1662
             +    E    ++ L     +N+D + ++    K+  W    S+LL+ Y  +  L R   E
Sbjct  652   ELSGNEQDINEVDLSGNQRQNKDAIRMV----KLCSWYKEKSILLISYHLYERLARGLCE  707

Query  1661  DSTYAH---------------RKY----MNQVLRQCPGILILDEGHNPRSTKSRLRKALM  1539
             D                    R+Y    M +VLR  PG+LILDEGH PR+ +S + K L 
Sbjct  708   DDGKKEKKNKKMKKGKKRARTREYIETAMGKVLRDYPGLLILDEGHTPRNQRSYIWKVLS  767

Query  1538  KVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLEN  1359
             +  +  R+LLSGT FQNNF E +N LCL +P F D + +EL        K  ++R   E 
Sbjct  768   ESRSQKRVLLSGTPFQNNFLELYNILCLMKPSFPDSIPQELK-------KFCQSRLRKER  820

Query  1358  RARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMK  1182
             +A K      +            E +  LK L   F+ V++G     NLPGL+   L++K
Sbjct  821   KASKY-----ASYEPIYSGNSADEKIKQLKSLMNPFVHVHKGSILQKNLPGLRDCVLVLK  875

Query  1181  STTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealek  1002
                LQQE L  +   + I     L  E  + L ++HP L    + S +     + + LEK
Sbjct  876   PDRLQQETLDIIDSSQNI-----LNFEHKLALVSVHPSLFLNCSLSKKEESVLDKDQLEK  930

Query  1001  fkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVL  822
              + +  +G K  F++ L+  C    EKVL+F   I  + L  +  E  + W  G EVL +
Sbjct  931   LRLNPYVGVKTNFLLELVRLCDAVNEKVLVFSQFIDTLCLIKDQLESAFHWSVGTEVLYM  990

Query  821   QGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQA  642
              G ++  ++  ++  F +    +KV+LASI   +EGI+L  ASRV+LLD  WNPS  +QA
Sbjct  991   YGKLDQKQKQSLIHSFNDTNSKAKVLLASIKASSEGINLIGASRVVLLDVVWNPSVERQA  1050

Query  641   IARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS-EDLVEDPSHWQAPKI  465
             I RA+R GQ KVVY Y LLA  T E  K+ +   K+ +S ++FS ++   D  +     +
Sbjct  1051  ICRAYRLGQKKVVYTYHLLAQDTPECIKFCKQAEKDRLSELVFSNKNAKSDKLNSCGAAL  1110

Query  464   EDELLGEIVEEDR-ATLFHMIMKNEKASNMG  375
             ED +L  +V+ ++   +F  ++   K  + G
Sbjct  1111  EDAVLDIMVQHEKLKDMFGELLVQPKERDFG  1141



>ref|XP_009102516.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like isoform 
X3 [Brassica rapa]
Length=914

 Score =   342 bits (877),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 242/727 (33%), Positives = 366/727 (50%), Gaps = 65/727 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LW++M LAL+    L+    +    + ++  +  K      HDF L+EE+GL CR C 
Sbjct  236   DRLWEDMALALS----LEGVRSSAHSRSGDVSCSNGK------HDFVLDEEVGLKCRYCS  285

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              VS EI+DV P       + + K+        ++K G   D   FA    S    S    
Sbjct  286   YVSVEIRDVSPTMDKYRANINDKK-----TCSDKKSGGLLDSLDFAASDHSRDMESLKNT  340

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-SKKRGGCVISHSPGAGK  1986
             +   W  IP ++N L  HQ+  FEF+W N+AG+    ++     K+ GGC+ISHSPG GK
Sbjct  341   QGTVWEYIPGIKNSLYPHQQEGFEFMWNNLAGTTKLDELKSSVGKESGGCIISHSPGTGK  400

Query  1985  TLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLR  1806
             T L I FL SYL+ FP S P+V+AP + + TW +E  KW   IP Y +   Q + G+  +
Sbjct  401   TRLTIVFLQSYLEQFPESHPVVIAPASLMLTWEEEFKKWNSNIPFYNM-SSQDFSGQENQ  459

Query  1805  QKMKLCPG---LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
               + L  G   L RN+D + ++    K+  W    S+L + Y  +  L   +      + 
Sbjct  460   AAVSLLKGNRHLRRNKDSVRMV----KLYSWRNKKSILGISYNLYEKLAG-NRCAGEVQE  514

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
               ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGT FQNNF E  N LCL
Sbjct  515   FRKMLLELPGLLVLDEGHTPRNHNSCIWKVLTEVKTEKRIILSGTPFQNNFKELSNVLCL  574

Query  1454  ARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNI  1275
              RP + D++   L    +   +G   RF  E                         G++ 
Sbjct  575   TRPAYADKISSRLQDLTRLSQEGKNGRFDEE------------------------VGISE  610

Query  1274  LKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELEL  1098
             LK +   F+ V++G    ++LPGL+   +M+     Q++IL ++   +  +     ELE 
Sbjct  611   LKDMIAPFVHVHKGNILRESLPGLRDCVVMLNPPFQQEKILKRIDHSQNTF-----ELEH  665

Query  1097  LITLGAIHPWLIRTTACSGQYfkee------elealekfkfdlkLGSKVKFVMSLIPRCL  936
              ++  ++HP L     C  Q  KE        L+ LE  + D K G+K +F++  I    
Sbjct  666   KLSAVSVHPSLY---MCCKQTNKERLTIGPVALKVLESLRLDSKEGAKTRFLIDFIRFSQ  722

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGP  756
                EKVL+F   I  + L  +     +GW +G E+L + G ++   R  +++ F      
Sbjct  723   TVNEKVLVFSQYIDTLELIRDQLNAVFGWTEGEEILYMHGQLKQTIRQHLINNFNRPDSK  782

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
             SKV+LAS   C+EGI L  ASRV+LLD  WNPS  +QAI+RA+R GQ +VVY Y L+  G
Sbjct  783   SKVLLASTGACSEGIHLVGASRVVLLDVVWNPSVERQAISRAYRIGQKRVVYTYHLMVKG  842

Query  575   TLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMK  399
             T E  KY + T K  +S M+FS    +D         ED++L E+V  ++   +F  ++ 
Sbjct  843   TTEWGKYCKQTKKHRISEMVFSPTNEKDKLIENEVVSEDKILDEMVRHEKLKDMFGKVLY  902

Query  398   NEKASNM  378
              +K S+M
Sbjct  903   RKKESDM  909



>gb|ABV80243.2| mutant required to maintain repression 1 [Zea mays]
Length=1435

 Score =   350 bits (897),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 230/709 (32%), Positives = 353/709 (50%), Gaps = 39/709 (6%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             DMLW + + AL S     Y  D+ ++ N     +  +A+        H+F ++++IG+ C
Sbjct  719   DMLWADFDFALESENIGTYYDDECQEGN---QLDFSLASVTPCSRGKHEFVIDDQIGIRC  775

Query  2354  RLCGVVSTEIKDVPPPFM-PSTCSSSGKEQRPEEVVMEEKQGDDADL---DHFAIPVSSN  2187
             + C +V+ EIK     FM PS  S  G     E+      +G    L   D +   V+  
Sbjct  776   KYCSLVNLEIK-----FMFPSLVSVFG-----EKSAWPNDKGVKNTLMFHDLYEQGVNDT  825

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCV  2013
             + S ++      W LIP + + +  HQR AFEF+W N+ G I   +I   +K    GGCV
Sbjct  826   EQSQDIHQYGTVWNLIPGVISTMYEHQREAFEFMWTNLVGDIRLDEIKHGAKPDVVGGCV  885

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             I H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I   
Sbjct  886   ICHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNVDVP-FHILNT  944

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
               Y G+  R   KL     R + +  ++    K+  W     +L + Y  +  LT E   
Sbjct  945   TDYTGKEDRDICKLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYTKLTSEKPG  1000

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
                   +  +L   PG+L+LDEGH PR+ +S + K L  V T  RI+LS T FQNNF E 
Sbjct  1001  CTEENKVRSILLDNPGLLVLDEGHTPRNERSVMWKTLGNVKTEKRIILSRTPFQNNFLEL  1060

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             +N LCL RPRF +  L       K RV   +  +  + +  K           S      
Sbjct  1061  YNILCLVRPRFGEMFLT------KSRV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVT  1112

Query  1292  kEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
              +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G  
Sbjct  1113  DDNAEKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIKKVEN---IGSGNN  1169

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
              E E +I+L + HP L+     S +     +   L K + +   G K +FV+ ++     
Sbjct  1170  FEHEYVISLASTHPSLVTAINMSEEEASLIDKPMLAKVRSNPYEGVKTRFVIEVVRLSEA  1229

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
              +EKVLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S
Sbjct  1230  LREKVLIFSQFIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNDS  1289

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             +V+LAS   C EGISLT ASR++LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT
Sbjct  1290  RVLLASTRACCEGISLTGASRIVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGT  1349

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
              E +KY R   K+ +S ++FS +   +       K E E   + + ED+
Sbjct  1350  GEGDKYDRQAEKDHLSKLVFSTEDEFNNVRNMLSKAEMEHCSKFISEDK  1398



>gb|KDP45991.1| hypothetical protein JCGZ_11894 [Jatropha curcas]
Length=706

 Score =   335 bits (860),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 230/692 (33%), Positives = 360/692 (52%), Gaps = 54/692 (8%)
 Frame = -3

Query  2393  HDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEV--VMEEKQGDDAD  2220
             H F L+EEIG+ C+ C +V+ EI+    PF       S +    EE   + ++    D+ 
Sbjct  40    HFFILDEEIGIKCKFCSLVNLEIRYYTAPFDRRPLQYSERRDYYEEQPNIFDKLCNQDSG  99

Query  2219  LDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP  2040
              D  A   S N       ++   W +IP +   L AHQR  FEFLWKNI G I   ++  
Sbjct  100   HDSQAGCGSCN------HMQGTVWNIIPGIGKDLHAHQREGFEFLWKNIGGGIHLDKLKE  153

Query  2039  ESKKRG--GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWK  1866
                  G  GC+ISH+PG GKT L I FL +Y+K +P  RPL++AP + L +W  E  KWK
Sbjct  154   PGSSDGETGCIISHAPGTGKTRLAIVFLQTYMKFYPKCRPLIIAPCSMLLSWEAEFKKWK  213

Query  1865  IPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYT  1686
             + IP + ++  + Y G+     +KL   +  N + + ++    K+  W +  SVL + Y 
Sbjct  214   VDIPFHNLNQSK-YSGKENPAAIKLAKSVHNNLNYIRMV----KLYSWKSERSVLGISYK  268

Query  1685  SFLTLTREDS--TYAHRKYMNQVLRQCPGILIL----DEGHNPRSTKSRLRKALMKVNTS  1524
              F  L  E+   +   RK+ + V+R+    L      DEGH  R+ +S + +AL KV T 
Sbjct  269   LFEELVGEEKKRSKGKRKHEDDVVRKVLLGLPGLLVLDEGHTARNEQSLIWQALSKVQTE  328

Query  1523  LRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRF-SLENRARK  1347
              RI+LSGT FQNNF E FN L L RP+F   +      K + R++GA+  + SL +   K
Sbjct  329   KRIILSGTPFQNNFAELFNILILVRPKFAVRISCNKRRKRRGRMQGARRDWASLTSSIGK  388

Query  1346  MFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTL  1170
             +              R+  E L  ++ +    + V+ G      LPGL    +++K   L
Sbjct  389   V--------------RDDAERLAEVRAIIGPMVHVHRGNILQQRLPGLVDSVVILKPVHL  434

Query  1169  QQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfd  990
             Q+ +L K+Q       G    LE L+++ ++HP L+R  + +    +    + L++ + +
Sbjct  435   QEILLDKVQKA----GGTNFNLEYLVSVVSVHPSLMREQSIN--IEEPFAWDKLKRHRLN  488

Query  989   lkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDI  810
              + G K +F++ LI       EKVL+F   +AP+ L  +  +  + WRK  E+L + G +
Sbjct  489   PEFGVKTRFLVELIRLSNAMHEKVLVFSQYLAPLKLIGKQLKYRFKWRKDTEILHMHGRV  548

Query  809   ELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARA  630
             +  +R  ++  F      SKVMLAS   C+EGI+L  ASRV+LLD  WNPS  +QAI+RA
Sbjct  549   DTDKRQSLIKNFNNRNSDSKVMLASTKACSEGINLVGASRVVLLDVVWNPSVERQAISRA  608

Query  629   FRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE--------DPSHWQA  474
             +R GQ+KVV++Y L+ +GT+EEEKY R   K+ +S ++F     E        +    Q 
Sbjct  609   YRLGQEKVVHIYHLITSGTMEEEKYCRQAEKDRLSELVFHSSGTEHGLKRNLSNMHEAQH  668

Query  473   PKIEDELLGEIVEEDRATLFHMIMKNEKASNM  378
              K+ D+++G   +E+   +F  I+   K SN+
Sbjct  669   DKLLDQMVG---QENLKDIFKKIIYQPKESNL  697



>ref|XP_006418756.1| hypothetical protein EUTSA_v10002375mg [Eutrema salsugineum]
 gb|ESQ37192.1| hypothetical protein EUTSA_v10002375mg [Eutrema salsugineum]
Length=1145

 Score =   345 bits (886),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 252/733 (34%), Positives = 370/733 (50%), Gaps = 76/733 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCR  2352
             D LW++M LAL         E  N  SA       K     C    HDF L+EEIGL C 
Sbjct  466   DSLWEDMNLALT-------LEGVNSSSA-----PAKSREVPCTNGKHDFILDEEIGLKCC  513

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD------HFAIPVSS  2190
              C  VS EI+D+ P              +    V E+K   D   D       F     S
Sbjct  514   YCSYVSVEIRDISPAM-----------DKYRGNVNEKKTCRDKKCDPLLNGLDFEASDRS  562

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES-KKRGGCV  2013
             N  +S  + +   W  IP ++  L  HQR  FEF+WKN+AGS    ++     K  GGC+
Sbjct  563   NYDASLKDTQGTVWEYIPGVKETLYPHQREGFEFIWKNLAGSTKLDELKSSVVKGSGGCI  622

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISHSPG GKT L I FL SYL+ FP S P+V+AP + L+TW +E  KW    P Y ++  
Sbjct  623   ISHSPGTGKTRLTIVFLQSYLEQFPDSHPVVIAPASLLFTWEEEFKKWDASAPFYNMNNM  682

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
             + + G+  +  + L  G   ++   H +  + K+  W    S+L + Y  +  L R  + 
Sbjct  683   K-FSGQENQSAIALLKGNSLHRSNKHSVRMV-KLYSWRNKKSILGVSYNLYEKLAR--NK  738

Query  1652  YA-HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
             YA   +   ++L + PG+L+LDEGH PR+  S + KAL +V T  RI+LSGT FQNNF E
Sbjct  739   YAGEMEEFRRMLLELPGLLVLDEGHTPRNQNSCIWKALSEVKTEKRIILSGTPFQNNFKE  798

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskere  1296
               N LCLARP + D +   L    K   +G   +F  E                      
Sbjct  799   LSNVLCLARPAYTDTISSRLQDLSKLSQEGKNGKFDEE----------------------  836

Query  1295  rkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
                G+  LK +   F+ V++G    ++LPGL+   +++  + LQ++IL ++   +  +  
Sbjct  837   --IGIGELKDMIAPFVHVHKGNILRESLPGLRDRVVVLNPSYLQKKILDRIDHTQTTF--  892

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfke-----eelealekfkfdlkLGSKVKFVMS  954
                ELE  ++  ++HP L   T C+    +      + LE LE+ + D K G K +F+++
Sbjct  893   ---ELEHKLSAVSVHPSLY--TLCNPTKIETLTIGPKTLETLERLRLDSKEGVKTRFLIN  947

Query  953   LIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKF  774
              I      KEKVL+F   I  + L ++     +GWR+G E+L++ G++E  +R  ++  F
Sbjct  948   FIRFSETVKEKVLVFSQYIDTLKLIMDQVCAAFGWREGKEILIMHGNLEQKDRPHLIHNF  1007

Query  773   EEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVY  594
              +    SKV+LAS   C+EGISL  ASRV+LLD  WNPS   QAI+RA+R GQ +VVY Y
Sbjct  1008  NKPDSESKVLLASTKACSEGISLVGASRVVLLDVVWNPSVEMQAISRAYRIGQKRVVYTY  1067

Query  593   QLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATL  417
              L+     E EKY++ T K  +S M+FS    +D         ED +L E+V  ++   +
Sbjct  1068  HLMVKDASEWEKYRKQTKKHRISEMVFSPTDDKDKLVKNQVVSEDRILDEMVRHEKLKDM  1127

Query  416   FHMIMKNEKASNM  378
             F  I+   K S+M
Sbjct  1128  FEKILYRPKESDM  1140



>ref|XP_002439747.1| hypothetical protein SORBIDRAFT_09g019410 [Sorghum bicolor]
 gb|EES18177.1| hypothetical protein SORBIDRAFT_09g019410 [Sorghum bicolor]
Length=1535

 Score =   349 bits (896),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 220/677 (32%), Positives = 340/677 (50%), Gaps = 30/677 (4%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCH--HDFRLNEEIGLVCRL  2349
             DMLW + + AL S  +    +D   +   +L  +    T      H+F +++ IG+ C+ 
Sbjct  818   DMLWADFDFALESENIGTYYDDEGQEEGNQLDFSLAPVTPCSRGKHEFIIDDRIGIRCKY  877

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSG--KEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
             C +V+ EIK + P  +      S     +  ++ +M          D +    S  +  S
Sbjct  878   CSLVNLEIKFMFPSLISGFAEKSAWPNAKGVKDTLMFH--------DLYEQTGSDIEQIS  929

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVISHS  2001
             ++      W LI  + + +  HQR AFEF+W N+ G I   ++   +K    GGCVI H+
Sbjct  930   DLHQYGTVWDLISGVISTMYEHQREAFEFMWTNLVGGIRLDELKHGAKPDVVGGCVICHA  989

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I     Y 
Sbjct  990   PGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWDEEFKKWNVDVP-FHIMNTTDYT  1048

Query  1820  GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHR  1641
             G+  R+  KL     R + +  ++    K+  W     +L + Y  +  LT E       
Sbjct  1049  GKEDREICKLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYTKLTSEKPGCTEE  1104

Query  1640  KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTL  1461
               +  +L   PG+L+LDEGH PR+ +S + K L K+ T  RI+LSGT FQNNF E +N L
Sbjct  1105  NKVRSILLDNPGLLVLDEGHTPRNERSIMWKTLGKLKTEKRIILSGTPFQNNFLELYNIL  1164

Query  1460  CLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGL  1281
             CL RPRF +  L       K RV   +  +  + +  K           S       +  
Sbjct  1165  CLVRPRFGEMFLT------KGRV--GRRHYVSKKQKDKFSDKYEKGVWASLTSNVTDDNA  1216

Query  1280  NILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
               ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G   E E
Sbjct  1217  EKVRSILKPFVHIHNGNILRTLPGLRESVIILKPLPLQKSIIRKVEN---IGSGNNFEHE  1273

Query  1100  LLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEK  921
              +I+L + HP L+     S +     +   L K + +   G K +FVM ++  C   +EK
Sbjct  1274  YVISLASTHPSLVTAINMSEEEASLIDKHMLGKLRSNPYEGVKTRFVMEVVRLCEALREK  1333

Query  920   VLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVML  741
             VLIF   I P+ L  E   +F+ WR+G E+L + G I    R   ++ F      S+V+L
Sbjct  1334  VLIFSQYIQPLELIKEHLRKFFKWREGKEILQMDGKILPRYRQASIEAFNNPNNESRVLL  1393

Query  740   ASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEE  561
             AS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT E +
Sbjct  1394  ASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGEGD  1453

Query  560   KYKRTTWKEWVSSMIFS  510
             KY R   K+ +S ++FS
Sbjct  1454  KYDRQAEKDHLSKLVFS  1470



>ref|XP_003566883.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Brachypodium 
distachyon]
Length=1077

 Score =   344 bits (882),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 216/692 (31%), Positives = 362/692 (52%), Gaps = 47/692 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDT--EDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             D+LW E + AL S         E+    +  E+H       +   HD  ++E+IG+ C+ 
Sbjct  375   DLLWAEFDFALESTNACSHACQEEGEKSNGDEIHADRATSCKRGKHDLIMDEQIGIRCKH  434

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFA---IPVSSNKPS  2178
             C  +  EI+DV P  +              +  +E +     +LD F    I     + +
Sbjct  435   CDFIDLEIRDVFPSMV--------------KFSIEREPAMSLNLDLFCEDIIKSMGYEGT  480

Query  2177  SEVEVEDNA--WALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRGGCVI  2010
             S  ++ ++   W LIP +R  +  HQR  FEF+WK +AG I   Q+     +    GCVI
Sbjct  481   SHFDIHESGLVWDLIPGVREHMFPHQREGFEFMWKKLAGGIDIQQVKHTVNTDSTSGCVI  540

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I F+ SYL+LFP  RP+++AP+  L TW +E  KW + +P + +    
Sbjct  541   SHAPGTGKTRLAITFVQSYLELFPWCRPVIIAPRGMLATWEQEFKKWNVKLPFHLLSSSG  600

Query  1829  TYKGE------VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT  1668
              +  E      ++ Q   L   L  N+ +      + K+  W     ++ + Y+ +  L 
Sbjct  601   IHWDEDKTIKKLVAQDESLGQKLSMNK-LSQKSRLMLKLASWYEGSCIIGLSYSLYRNLA  659

Query  1667  REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQN  1488
             + +      + +  +L + PG+L+LDEGH PR+ KS + K L +V+T  RI+LSGT FQN
Sbjct  660   KGEDMDG--ETVRNLLLKNPGLLVLDEGHTPRNKKSLIWKVLAEVSTEKRIILSGTPFQN  717

Query  1487  NFGEYFNTLCLARPRFV-DEVLKELDPK--YKKRVKGAKTRFSLENRARKMFidkiskki  1317
             NF E +N LCL +P+F  D     L+ K    KR   ++    LE    K F   +    
Sbjct  718   NFLELYNILCLVKPKFARDFACTRLNKKDFSSKRTCQSRATHHLEEDEGKEFWKSLRMSN  777

Query  1316  dsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQD  1140
              +         L+ +++    F+ ++ G     +LPGL+   +++     Q+EI+  ++ 
Sbjct  778   ITDDH------LSEIREKLDPFVHIHNGDILQKSLPGLKESVVILNPLPHQKEIITMME-  830

Query  1139  QRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFV  960
              +   KGF L+ E  I+L +IHP+L+ +   S +  +   +  L+  + D   G K +FV
Sbjct  831   -KSAGKGF-LDAEYKISLASIHPFLLTSVKLSDE--EASIVNKLKSSRLDPCEGVKTRFV  886

Query  959   MSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMD  780
             + ++  C   KE+VL+F   + P++L ++   + + W +G E+L++ G++ + +R  +M+
Sbjct  887   LEIVRLCKPLKERVLVFSQYLEPLSLIMDQLTKKFNWTEGKEILLMSGNVRVKQREALME  946

Query  779   KFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVY  600
              F ++   ++VMLAS   C EGI+L  +SRV+LLD  WNPS  +QAI RA+R GQ+K+VY
Sbjct  947   AFNDMNSEARVMLASTKACCEGITLVGSSRVVLLDVVWNPSVGRQAIGRAYRIGQEKIVY  1006

Query  599   VYQLLATGTLEEEKYKRTTWKEWVSSMIFSED  504
              Y L+A GT E+ KY R   K+ +S ++F+++
Sbjct  1007  TYNLIAEGTKEKIKYDRQAKKDHMSKLLFTKE  1038



>ref|XP_009102515.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like isoform 
X2 [Brassica rapa]
Length=1023

 Score =   342 bits (878),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 242/727 (33%), Positives = 366/727 (50%), Gaps = 65/727 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LW++M LAL+    L+    +    + ++  +  K      HDF L+EE+GL CR C 
Sbjct  345   DRLWEDMALALS----LEGVRSSAHSRSGDVSCSNGK------HDFVLDEEVGLKCRYCS  394

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              VS EI+DV P       + + K+        ++K G   D   FA    S    S    
Sbjct  395   YVSVEIRDVSPTMDKYRANINDKK-----TCSDKKSGGLLDSLDFAASDHSRDMESLKNT  449

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-SKKRGGCVISHSPGAGK  1986
             +   W  IP ++N L  HQ+  FEF+W N+AG+    ++     K+ GGC+ISHSPG GK
Sbjct  450   QGTVWEYIPGIKNSLYPHQQEGFEFMWNNLAGTTKLDELKSSVGKESGGCIISHSPGTGK  509

Query  1985  TLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLR  1806
             T L I FL SYL+ FP S P+V+AP + + TW +E  KW   IP Y +   Q + G+  +
Sbjct  510   TRLTIVFLQSYLEQFPESHPVVIAPASLMLTWEEEFKKWNSNIPFYNM-SSQDFSGQENQ  568

Query  1805  QKMKLCPG---LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
               + L  G   L RN+D + ++    K+  W    S+L + Y  +  L   +      + 
Sbjct  569   AAVSLLKGNRHLRRNKDSVRMV----KLYSWRNKKSILGISYNLYEKLAG-NRCAGEVQE  623

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
               ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGT FQNNF E  N LCL
Sbjct  624   FRKMLLELPGLLVLDEGHTPRNHNSCIWKVLTEVKTEKRIILSGTPFQNNFKELSNVLCL  683

Query  1454  ARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNI  1275
              RP + D++   L    +   +G   RF  E                         G++ 
Sbjct  684   TRPAYADKISSRLQDLTRLSQEGKNGRFDEE------------------------VGISE  719

Query  1274  LKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELEL  1098
             LK +   F+ V++G    ++LPGL+   +M+     Q++IL ++   +  +     ELE 
Sbjct  720   LKDMIAPFVHVHKGNILRESLPGLRDCVVMLNPPFQQEKILKRIDHSQNTF-----ELEH  774

Query  1097  LITLGAIHPWLIRTTACSGQYfkee------elealekfkfdlkLGSKVKFVMSLIPRCL  936
              ++  ++HP L     C  Q  KE        L+ LE  + D K G+K +F++  I    
Sbjct  775   KLSAVSVHPSLY---MCCKQTNKERLTIGPVALKVLESLRLDSKEGAKTRFLIDFIRFSQ  831

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGP  756
                EKVL+F   I  + L  +     +GW +G E+L + G ++   R  +++ F      
Sbjct  832   TVNEKVLVFSQYIDTLELIRDQLNAVFGWTEGEEILYMHGQLKQTIRQHLINNFNRPDSK  891

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
             SKV+LAS   C+EGI L  ASRV+LLD  WNPS  +QAI+RA+R GQ +VVY Y L+  G
Sbjct  892   SKVLLASTGACSEGIHLVGASRVVLLDVVWNPSVERQAISRAYRIGQKRVVYTYHLMVKG  951

Query  575   TLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMK  399
             T E  KY + T K  +S M+FS    +D         ED++L E+V  ++   +F  ++ 
Sbjct  952   TTEWGKYCKQTKKHRISEMVFSPTNEKDKLIENEVVSEDKILDEMVRHEKLKDMFGKVLY  1011

Query  398   NEKASNM  378
              +K S+M
Sbjct  1012  RKKESDM  1018



>gb|EYU40331.1| hypothetical protein MIMGU_mgv1a002243mg [Erythranthe guttata]
Length=696

 Score =   334 bits (856),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 233/741 (31%), Positives = 365/741 (49%), Gaps = 84/741 (11%)
 Frame = -3

Query  2516  LWKEMELALA------SCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             LW E ++ LA       C  +D+  + +    T+ H    +G     H+  L +E GL+C
Sbjct  4     LWDEFDVCLALQQVGSFCPEIDEENELSPSEETQ-HARCARG----RHELILQDEEGLIC  58

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
             + C  V    KDV P +                       G D D     +   SN  S 
Sbjct  59    KYCYHVELGPKDVMPDWF---------------------DGMDFDFSIDNLAEYSNSYSG  97

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI-DPESKKRGGCVISHSP  1998
              V      W+L P  R  +  HQ+  FEFLWKN+AGS    ++   +  K GGC+ISH+P
Sbjct  98    TV------WSLNPVARESMYEHQQEGFEFLWKNLAGSTDLDELKSSDPGKVGGCIISHAP  151

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             G GKT L I F+ SYL++FP  RP+++AP + L TW +E  KW +  P + ++  +    
Sbjct  152   GTGKTRLTIVFIESYLRMFPYCRPMIIAPASMLLTWEEEFRKWNVRFPFFNLNNPEILGN  211

Query  1817  EVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED-------  1659
             E  +   +L  G   NQ+ +  +    K+  W    S+L + Y+ F  LT E        
Sbjct  212   ENKKAAERLEGGKRGNQEAIRWV----KIFSWNTGRSILGISYSLFEKLTGEKHLKKEKL  267

Query  1658  -------STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGT  1500
                    S  +  +   ++L + PG++ILDEGH PR+ +S +   L+K+ T  R++LSGT
Sbjct  268   GEKRNGVSLGSRLESQRKILLEKPGLVILDEGHTPRNQRSNIWNVLLKLQTQKRVILSGT  327

Query  1499  LFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFS--LENRARKMFidkis  1326
              FQNNF E FNTL L RP   D             V   +  FS  +  R R+    +I 
Sbjct  328   PFQNNFAELFNTLRLVRPAVAD-------------VLAHERTFSEMVTPRTRRTHKGEIY  374

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVK  1149
              +  +         ++ LK   + F+ V+ G     +LPGL    + +    LQ+ ++ +
Sbjct  375   HQQSTLNPEVVDRAVDKLKLHMSPFVHVHRGTILKQSLPGLMDCVVFLNPPPLQKSLIER  434

Query  1148  LQDQRPIYKGFP--LELELLITLGAIHPWLIR-TTACSGQYfkeeelealekfkfdlkLG  978
             L+       G P   E E  + L ++HP+L + + +   Q     ++ A+E  + +   G
Sbjct  435   LE-------GLPNTFEFEHKVALISVHPYLFKHSDSPEEQQLTGIDMAAVEASRLNPNEG  487

Query  977   SKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFE  798
              K KF++ L+   ++  EKVLIF   I P+ L  +  + F+ W  G ++L ++G ++  +
Sbjct  488   VKTKFILELVRLSVVMNEKVLIFSQYILPLQLINDQLKEFFKWGDGKQILQMRGKLDQKQ  547

Query  797   RGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPG  618
             R  +++ F +    SKVMLAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R G
Sbjct  548   RQVLINVFNDPKSESKVMLASTKCCSEGISLVGASRVVLLDVVWNPSVERQAISRAYRIG  607

Query  617   QDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIV  438
             Q K VY Y L+ +GT E +KY R   K+ +S ++FS     D     +  IED +L E+V
Sbjct  608   QKKFVYTYHLMTSGTTEADKYCRQAEKDRLSELVFSSSNESDKQEHPSLGIEDRILEEMV  667

Query  437   EEDR-ATLFHMIMKNEKASNM  378
              ++R   +F  I+   K +++
Sbjct  668   GQERLKEMFVKIINQPKDTDL  688



>gb|EEE63616.1| hypothetical protein OsJ_18433 [Oryza sativa Japonica Group]
Length=1364

 Score =   346 bits (888),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 232/707 (33%), Positives = 357/707 (50%), Gaps = 35/707 (5%)
 Frame = -3

Query  2522  DMLWKEMELALAS----CYLLDD-TEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLV  2358
             DMLW +++  L S     Y  D+  ED+ L  A        +G     H+F ++E+IG+ 
Sbjct  646   DMLWADLDFTLESENIGTYYDDEGQEDSLLDHALAPITPCSRGK----HEFIIDEQIGIR  701

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
             C+ C +V+ EI+ + P        +S   ++P        +      D +    + +  S
Sbjct  702   CKYCSLVNLEIRFILPLL------ASNFAEKPAWRNSSCLKTALMCPDLYEQTGTGDGQS  755

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVISH  2004
              +  +    W LIP +   +  HQR AFEF+W N+ G I   +I   +K    GGCVI H
Sbjct  756   QDFHINGTVWDLIPGVITDMYQHQREAFEFMWTNLVGDIRLNEIKHGAKPDVVGGCVICH  815

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I     Y
Sbjct  816   APGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWEQEFKKWNVNVP-FHIMNTTDY  874

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              G+  R   +L     R + +  ++    K+  W     VL + Y  ++ LT E      
Sbjct  875   SGKEDRDICRLIKKEHRTEKLTRLV----KLFSWNRGHGVLGISYGLYMKLTSEKVGCTG  930

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
                +  +L + PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNNF E +N 
Sbjct  931   ENKVRTILLENPGLLVLDEGHTPRNERSVIWKTLGKVKTEKRIILSGTPFQNNFLELYNI  990

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskki-dsskererkE  1287
             LCL RPRF +  L       K RV     R  +  + R  F DK  K +  S       +
Sbjct  991   LCLVRPRFGEMFLT------KTRVG---RRHCVSKKQRDKFSDKYEKGVWASLTSNVTDD  1041

Query  1286  GLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
                 ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   +  G   E
Sbjct  1042  NAEKVRSILKPFVHIHNGTILRTLPGLRECVIVLKPLPLQKSIIRKVEN---VGSGNNFE  1098

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
              E +I+L + HP L+     + +     +   LE+ + +   G K +FVM ++  C   K
Sbjct  1099  HEYVISLASTHPSLVNAINMTEEEASLIDKPMLERLRSNPYEGVKTRFVMEVVRLCEALK  1158

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVLIF   I P+ L  E   + + WR+G E+L + G I    R   ++ F      ++V
Sbjct  1159  EKVLIFSQFIQPLELIKEHLRKIFKWREGKEILQMDGKILPRYRQNSIEVFNNPDSDARV  1218

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  GT E
Sbjct  1219  LLASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGE  1278

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
              +KY R   K+ +S ++FS +           K E E   +++ ED+
Sbjct  1279  GDKYDRQAEKDHLSKLVFSTEDEFSNVRNMLSKAEMEHCSKLISEDK  1325



>ref|XP_011098998.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Sesamum 
indicum]
Length=917

 Score =   339 bits (869),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 216/629 (34%), Positives = 332/629 (53%), Gaps = 27/629 (4%)
 Frame = -3

Query  2393  HDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD  2214
             HD  ++E+IG++C+ C  V  EIK V PPF   +       +R E   + E Q    +  
Sbjct  253   HDLVVDEQIGIICKCCYAVLLEIKYVLPPFYVES------PERHERKYVVESQNSIMNQI  306

Query  2213  HFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES  2034
              F      N  SS V  E     LIPD   +L  HQ   F+FLW+NIAG I   +++   
Sbjct  307   PFQGSPCGNLESSSVHSEGTVLDLIPDADKELYPHQLDGFKFLWRNIAGDIHIKKLEKLP  366

Query  2033  KKRG-GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPI  1857
                G GC+ISH+PG GKT L I FL +++KL+P  RP+++AP+  L TW +E+ KW + I
Sbjct  367   GNGGRGCIISHAPGTGKTRLTIVFLQTFMKLYPACRPVIIAPRGMLLTWEQELKKWNVGI  426

Query  1856  PVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFL  1677
               + ++  +    E       +  G   NQ+     +   K+  W+   S+L +GY  F 
Sbjct  427   RFHNLNEAKLSSEETAIAAGII--GQTGNQEKNKDYNRFIKLYSWMKGGSILGVGYRLFE  484

Query  1676  TLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTL  1497
              L  E+          ++L + PGIL+LDEGH PR+ +S + KAL K  T  RI+LSGT 
Sbjct  485   ELAGENEKKHCNGKFKKILLELPGILVLDEGHTPRNNQSLMWKALTKTTTQRRIILSGTP  544

Query  1496  FQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskki  1317
             FQNNF E +NTLCL  PRF  +++ E            + R +  N AR  +    +   
Sbjct  545   FQNNFSELYNTLCLVNPRFSHQIMSETSCGRNLTKNAGRKRKA--NAARDEW---ANLTS  599

Query  1316  dsskererkEGLNILKKLTTGFIDVYEGGSSDN-LPGLQCYTLMMKSTTLQQEILVKLQD  1140
               SK     +GL  L+ +   F+ +++G    N LPG++   ++++ T LQ+++   LQ+
Sbjct  600   SISKTDSDADGLKKLRSMIEPFVHIHKGSILQNTLPGMRDCLVILRPTDLQRKL---LQN  656

Query  1139  QRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFV  960
                + K   LE   L +L ++HP L+     + +    +    L+    D   G K +F+
Sbjct  657   VARVDK--FLEQAYLASLISVHPSLV-----AEKPEFSDHKRKLKSLASDPNAGVKTRFL  709

Query  959   MSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMD  780
             + LI   +   EKVL+F   I P+     + +  + W +G E++ + GD  + +R  +++
Sbjct  710   IKLIQLSIRLHEKVLVFSEFIDPLLHIKNLLKSHFSWNEGREIIYMDGDQGIKQRQHLIN  769

Query  779   KFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVY  600
              F +  G +KV+LAS   C+EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ+KVVY
Sbjct  770   SFNDKHGEAKVLLASQRACSEGINLVGASRVVLLDVVWNPSVERQAICRAYRLGQEKVVY  829

Query  599   VYQLLATGTLEEEKYKRTTWKEWVSSMIF  513
             VY ++    +E +KY R   KE +S +IF
Sbjct  830   VYHVMT--LMEVKKYARQAEKERISELIF  856



>ref|XP_009102514.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like isoform 
X1 [Brassica rapa]
Length=1042

 Score =   342 bits (876),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 241/727 (33%), Positives = 365/727 (50%), Gaps = 65/727 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LW++M LAL+    L+    +    + ++  +  K      HDF L+EE+GL CR C 
Sbjct  364   DRLWEDMALALS----LEGVRSSAHSRSGDVSCSNGK------HDFVLDEEVGLKCRYCS  413

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              VS EI+DV P       + + K+        ++K G   D   FA    S    S    
Sbjct  414   YVSVEIRDVSPTMDKYRANINDKK-----TCSDKKSGGLLDSLDFAASDHSRDMESLKNT  468

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-SKKRGGCVISHSPGAGK  1986
             +   W  IP ++N L  HQ+  FEF+W N+AG+    ++     K+ GGC+ISHSPG GK
Sbjct  469   QGTVWEYIPGIKNSLYPHQQEGFEFMWNNLAGTTKLDELKSSVGKESGGCIISHSPGTGK  528

Query  1985  TLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLR  1806
             T L I FL SYL+ FP S P+V+AP + + TW +E  KW   IP Y +   Q + G+  +
Sbjct  529   TRLTIVFLQSYLEQFPESHPVVIAPASLMLTWEEEFKKWNSNIPFYNM-SSQDFSGQENQ  587

Query  1805  QKMKLCPG---LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
               + L  G   L RN+D + ++    K+  W    S+L + Y  +  L   +      + 
Sbjct  588   AAVSLLKGNRHLRRNKDSVRMV----KLYSWRNKKSILGISYNLYEKLAG-NRCAGEVQE  642

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
               ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGT FQNNF E  N LCL
Sbjct  643   FRKMLLELPGLLVLDEGHTPRNHNSCIWKVLTEVKTEKRIILSGTPFQNNFKELSNVLCL  702

Query  1454  ARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNI  1275
              RP + D++   L    +   +G   RF  E                         G++ 
Sbjct  703   TRPAYADKISSRLQDLTRLSQEGKNGRFDEE------------------------VGISE  738

Query  1274  LKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELEL  1098
             LK +   F+ V++G    ++LPGL+   +M+     Q++IL ++   +  +     ELE 
Sbjct  739   LKDMIAPFVHVHKGNILRESLPGLRDCVVMLNPPFQQEKILKRIDHSQNTF-----ELEH  793

Query  1097  LITLGAIHPWLIRTTACSGQYfkeeel------ealekfkfdlkLGSKVKFVMSLIPRCL  936
              ++  ++HP L     C  Q  KE         + LE  + D K G+K +F++  I    
Sbjct  794   KLSAVSVHPSLY---MCCKQTNKERLTIGPVALKVLESLRLDSKEGAKTRFLIDFIRFSQ  850

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGP  756
                EKVL+F   I  + L  +     +GW +G E+L + G ++   R  +++ F      
Sbjct  851   TVNEKVLVFSQYIDTLELIRDQLNAVFGWTEGEEILYMHGQLKQTIRQHLINNFNRPDSK  910

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
             SKV+LAS   C+EGI L  ASRV+LLD  WNPS  +QAI+RA+R GQ +VVY Y L+  G
Sbjct  911   SKVLLASTGACSEGIHLVGASRVVLLDVVWNPSVERQAISRAYRIGQKRVVYTYHLMVKG  970

Query  575   TLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMK  399
             T E  KY + T K  +S M+FS    +D         ED++L E+V  ++   +F  ++ 
Sbjct  971   TTEWGKYCKQTKKHRISEMVFSPTNEKDKLIENEVVSEDKILDEMVRHEKLKDMFGKVLY  1030

Query  398   NEKASNM  378
              +K S+M
Sbjct  1031  RKKESDM  1037



>ref|NP_189077.1| chromatin remodeling 40 [Arabidopsis thaliana]
 sp|Q9LK10.1|CLSY4_ARATH RecName: Full=SNF2 domain-containing protein CLASSY 4; AltName: 
Full=Protein CHROMATIN REMODELING 40; Short=AtCHR40 [Arabidopsis 
thaliana]
 dbj|BAB02934.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76891.1| chromatin remodeling 40 [Arabidopsis thaliana]
Length=1132

 Score =   343 bits (880),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 233/724 (32%), Positives = 356/724 (49%), Gaps = 63/724 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LW++M +AL    +   T D N        M   KGT    HDF L++EIGL C  C 
Sbjct  458   DSLWEDMNVALTLEGMHSSTPDKNGD------MLCSKGT----HDFVLDDEIGLKCVHCA  507

Query  2342  VVSTEIKDVPPP---FMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
              V+ EIKD+ P    + PS   +     R  + +    + D +D   F  P+ +      
Sbjct  508   YVAVEIKDISPAMDKYRPSVNDNKKCSDRKGDPLPNRLEFDASDPSSFVAPLDN------  561

Query  2171  VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES-KKRGGCVISHSPG  1995
               +E   W  +P +++ L  HQ+  FEF+WKN+AG+    +++    K  GGC+ISH  G
Sbjct  562   --IEGTVWQYVPGIKDTLYPHQQEGFEFIWKNLAGTTKINELNSVGVKGSGGCIISHKAG  619

Query  1994  AGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE  1815
              GKT L + FL SYLK FP S P+V+AP T + TW  E+ KW + IP Y ++  Q    E
Sbjct  620   TGKTRLTVVFLQSYLKRFPNSHPMVIAPATLMRTWEDEVRKWNVNIPFYNMNSLQLSGYE  679

Query  1814  VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
                   +L  G   +  +  V     K+  W    S+L + Y  +  L    +T   + +
Sbjct  680   DAEAVSRL-EGNRHHNSIRMV-----KLVSWWKQKSILGISYPLYEKLAANKNTEGMQVF  733

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
               ++L + PG+L+LDEGH PR+  S + K L +V T  RI LSGTLFQNNF E  N LCL
Sbjct  734   -RRMLVELPGLLVLDEGHTPRNQSSLIWKVLTEVRTEKRIFLSGTLFQNNFKELSNVLCL  792

Query  1454  ARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNI  1275
             ARP   D +   +    K   +G   R + ENR                        +  
Sbjct  793   ARPADKDTISSRIHELSKCSQEGEHGRVNEENR------------------------IVD  828

Query  1274  LKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELEL  1098
             LK +   F+ V+EG    ++LPGL+   +++     Q++IL ++   +  +     E E 
Sbjct  829   LKAMIAHFVHVHEGTILQESLPGLRDCVVVLNPPFQQKKILDRIDTSQNTF-----EFEH  883

Query  1097  LITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
              ++  ++HP L      T           L  L++ +   + G K KF++  I      K
Sbjct  884   KLSAVSVHPSLYLCCNPTKKEDLVIGPATLGTLKRLRLKYEEGVKTKFLIDFIRISGTVK  943

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKVL++   I  + L +E       W +G ++L++ G +E  +R  ++D F +    SKV
Sbjct  944   EKVLVYSQYIDTLKLIMEQLIAECDWTEGEQILLMHGKVEQRDRQHMIDNFNKPDSGSKV  1003

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LAS   C+EGISL  ASRV++LD  WNPS   QAI+RAFR GQ + V++Y L+   T E
Sbjct  1004  LLASTKACSEGISLVGASRVVILDVVWNPSVESQAISRAFRIGQKRAVFIYHLMVKDTSE  1063

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMKNEK  390
               KY + + K  +S ++FS    +D         +D +L E+V  ++   +F  I+ + K
Sbjct  1064  WNKYCKQSEKHRISELVFSSTNEKDKPINNEVVSKDRILDEMVRHEKLKHIFEKILYHPK  1123

Query  389   ASNM  378
              S+M
Sbjct  1124  KSDM  1127



>ref|XP_008465909.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Cucumis 
melo]
Length=1214

 Score =   343 bits (880),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 372/725 (51%), Gaps = 39/725 (5%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCR  2352
             D LW E++ AL S  +     D N     +   +  +   +C    H   L+E+IGL CR
Sbjct  509   DKLWAELDFALRSSEI--GLVDCNTVEHEDAFPSKLEQVDLCLRGDHQLILDEQIGLKCR  566

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPE-EVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
              C  V  EI+++ P F  +    S K +    E V  +    DAD D      + +   S
Sbjct  567   CCSYVKLEIRNIAPSFDTNPHGKSKKRKSDSFEHVKYDGLEQDADCD------AHDGSDS  620

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES--KKRGGCVISHS  2001
                     W +IP +RN +  HQR  FEF+WKNIAG I   ++   +      GC++SH+
Sbjct  621   RSHFGQTVWDIIPGIRNSMYPHQREGFEFIWKNIAGGIYLDELRESNGLNNGSGCIVSHA  680

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I FL +Y+KL P  RP+++AP + L TW +E +KW + IP + ++      
Sbjct  681   PGTGKTRLTINFLQTYMKLNPTCRPMIIAPSSMLLTWEEEFLKWDVGIPFHNLNKRDFSF  740

Query  1820  GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSF--LTLTREDSTYA  1647
              E +     L    P  Q+V ++   L K+  W    S+L + Y  F  L   R DS   
Sbjct  741   EENMSALKFLMQASPSGQNVDNIR--LVKLFSWKKEKSILGISYRLFERLAGVRNDSKCD  798

Query  1646  HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFN  1467
                 +  VL + P +++ DEGH PR+  S +  AL K+ T  RI+LSGT FQNNF E+ N
Sbjct  799   K---VRNVLLELPDLVVFDEGHIPRNDDSLIWMALSKIKTERRIILSGTPFQNNFTEFSN  855

Query  1466  TLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkE  1287
             TL L RP F  E     D    KR      R   +N  R  +   IS    +S+    + 
Sbjct  856   TLRLVRPNFAKESNTVGDGCMDKR------RGRPKNITRGKWDLLISSIGRTSELESAE-  908

Query  1286  GLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
              L  ++ L   F+ VY+G    + LPGL+  T+++    LQ+  L ++Q ++  +     
Sbjct  909   -LKEIRALINPFVHVYKGSILQEKLPGLRKSTVILWPAELQKNFLERVQARKNSF-----  962

Query  1109  ELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
             E+E + +L ++HP LI     S +   E + + LE+ + +  LG K++F++ +I      
Sbjct  963   EVEYVESLISVHPSLILK---SDKGDCEFDKDMLERCRLNPDLGVKLQFLLEIIRLSEAL  1019

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSK  750
              EKVL+F   I P++   E  +  + W +GIE+  + G  E+ +R  +++ F +     +
Sbjct  1020  NEKVLVFSQYIEPLSFIEEHLKFHFKWTEGIELFHMDGKREIKKRQSLINTFNDPTSEVR  1079

Query  749   VMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTL  570
             V+LAS   C+EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ KVVYVY L+ +GT 
Sbjct  1080  VLLASTKACSEGINLVGASRVVLLDVVWNPSVERQAICRAYRLGQKKVVYVYHLITSGTR  1139

Query  569   EEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMKNE  393
             EEEKY R   K+ +S ++FS +   +     +  ++D +L  +++ ++   +F  I+   
Sbjct  1140  EEEKYSRQVEKDRLSQLVFSSEQNSNDVKVSSRDLDDRILEAVLQHEKFKKIFQKIIYQS  1199

Query  392   KASNM  378
             K S M
Sbjct  1200  KESCM  1204



>gb|EMT24776.1| DNA repair protein rhp54 [Aegilops tauschii]
Length=1314

 Score =   343 bits (881),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 223/685 (33%), Positives = 349/685 (51%), Gaps = 41/685 (6%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL--LDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             +MLW + + AL S  +    D E     +  +L + +K       H+F ++++IG+ C+ 
Sbjct  594   NMLWGDFDFALESENIGTYYDDEHQGESNVLDLGLPSKTPCSRGKHEFIIDDQIGIRCKY  653

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRP-------EEVVMEEKQGDDADLDHFAIPVSS  2190
             C +V+ EI+ V P  +     S+  E+ P       +E +M     + A         S 
Sbjct  654   CSLVNLEIRFVLPSMV-----SNYAEKTPWRNGSYLKEALMYHDLCEQAG--------SV  700

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGC  2016
             +  S +  +    W LIP +   +  HQR AFEF+W N+ G I   ++   +K    GGC
Sbjct  701   DGQSQDFHLYGTVWDLIPGVITSMYQHQREAFEFMWTNLVGDIRLDELKHGAKPDVVGGC  760

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             VI H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I  
Sbjct  761   VICHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWEEEFKKWDVNVP-FHIMN  819

Query  1835  GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED-  1659
                + G+  R   +L     R + +  ++    K+  W     +L + Y  ++ LT E  
Sbjct  820   TTDFSGKEDRDICRLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYMKLTSEKK  875

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S       +  +L + PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNNF 
Sbjct  876   SGCTEGNKVRTILLENPGLLVLDEGHTPRNERSIMWKTLGKVKTEKRIILSGTPFQNNFL  935

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             E +N LCL RPRF +  L E      K+V   +  +  + R  K           S    
Sbjct  936   ELYNILCLVRPRFGEMFLTE------KKV--GRRHYVSKKRQDKFSDKYEKGVWASLTSN  987

Query  1298  erkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
                +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G
Sbjct  988   VTDDNAEKVRSILKPFVHIHNGTILRTLPGLRESVIVLKPPPLQKSIIRKVEN---IGSG  1044

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
                E E +I+L + HP L+     S +     +   LE+ + +   G K +FV+ ++  C
Sbjct  1045  NNFEHEYVISLASTHPSLVTAINMSEEEASLIDKPMLERLRSNPYEGVKTRFVIEVVRLC  1104

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGG  759
                KEKVLIF   I P+ L  E   + +  R G E+L + G I+   R   ++ F     
Sbjct  1105  EALKEKVLIFSQFIQPLELIKEHLSKLFKSRVGKEILQMDGKIQPRYRQTSIEVFNNPDS  1164

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
              +KV+LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  
Sbjct  1165  DAKVLLASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITY  1224

Query  578   GTLEEEKYKRTTWKEWVSSMIFSED  504
             GT E +KY R   K+ +S ++FS++
Sbjct  1225  GTGEGDKYDRQAEKDHLSKLVFSQE  1249



>ref|XP_009408709.1| PREDICTED: LOW QUALITY PROTEIN: SNF2 domain-containing protein 
CLASSY 3-like [Musa acuminata subsp. malaccensis]
Length=1167

 Score =   342 bits (876),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 236/722 (33%), Positives = 364/722 (50%), Gaps = 62/722 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKG----TRVCH--HDFRLNEEIGL  2361
             D LW + E A+     L++    N     E     +      T  C   H F L+E+ G+
Sbjct  462   DELWADFEFAMG----LENIGTYNADKVXEEFNTQEPEYDPLTSCCEGKHCFILDEQTGI  517

Query  2360  VCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEK--QGDDADLDHFAIPVSS-  2190
              C+ C  V  EI+ + P    +    S           E K   G+   L HF     + 
Sbjct  518   KCKFCSFVQLEIRYIFPSLETNAWEKS-----------EWKCFSGESGQL-HFNYLCETL  565

Query  2189  ---NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--  2025
                N  +S   +    W LIP +   +  HQ+ AFEF+W+N+AG I   ++   S     
Sbjct  566   TKLNGQASHSHLCGTVWDLIPGVYTTMYEHQQEAFEFMWRNLAGGIHLDELKSGSGSDVL  625

Query  2024  GGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQ  1845
             GGCVISH+PG GKT L I F+ +Y+K+FP  RP+++AP   L TW +E  KW + IP++ 
Sbjct  626   GGCVISHAPGTGKTRLSIVFIQTYMKVFPECRPVIIAPSGMLLTWEEEARKWDVSIPIHN  685

Query  1844  IHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR  1665
             ++  + Y G+  ++ + L    P+  +++ ++    K+  W    S+L + Y  F  LT 
Sbjct  686   LNSLE-YNGKEDKEALSLAEKEPQRSNLIRLV----KLCSWGRGNSILGISYNLFKQLTS  740

Query  1664  EDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNN  1485
             + ST      ++++L + PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNN
Sbjct  741   KASTG-----LSKILLEKPGLLVLDEGHIPRNERSLIWKVLGKVKTEKRIILSGTPFQNN  795

Query  1484  FGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssk  1305
             F E +N LCL RP+F +++         K +K  + +    ++ + +   +   K   + 
Sbjct  796   FVELYNILCLVRPKFAEKI-------STKTLKSCRRQEIFLDKEQAILAGENGGKGIWAT  848

Query  1304  ererkEGLNI--LKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
                     N+  ++ +   F+ V+ G    NLPGL+   +++     Q+ I+ K+   + 
Sbjct  849   LTSDVTNDNVEEVRSILKPFVHVHNGSILKNLPGLRECLIVLDPLPQQKSIIEKI---KC  905

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
             I      E E  + L +IHP L+     S +     +   LEK K     G+K +FV+ +
Sbjct  906   IGSHGNFEREYKVCLASIHPSLVTHLNMSEEEESLVDTNLLEKLKLSPVEGAKTRFVIEV  965

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             +  C    EKVLIF   I P+ +  E     +GW +G EVL + G I    R   +D F 
Sbjct  966   VRLCDPLNEKVLIFSQYIQPLVMIKEQLINEFGWNEGKEVLQMDGKILTKNRQPSIDIFN  1025

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             +  G +KV+LAS   C EGISLT ASRVILLD  WNP+  +QAI+RA+R GQ K VY Y 
Sbjct  1026  DTKGKAKVLLASTKACCEGISLTGASRVILLDVVWNPAVGRQAISRAYRIGQKKFVYAYN  1085

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFSEDL--------VEDPSHWQAPKI--EDELLGEI  441
             L+  GT E EKY + + K+ +S ++FS ++        +        PKI  ED++L +I
Sbjct  1086  LITFGTGEREKYDKQSKKDLLSKLLFSPEIDFNNLRNSISQSEEGHFPKIISEDKILEQI  1145

Query  440   VE  435
             VE
Sbjct  1146  VE  1147



>gb|KGN60451.1| hypothetical protein Csa_3G912350 [Cucumis sativus]
Length=1220

 Score =   342 bits (877),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 239/728 (33%), Positives = 379/728 (52%), Gaps = 45/728 (6%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCR  2352
             D LW E++ A+ S  +     D N     +   +  +   +C    H   L+E+IGL CR
Sbjct  515   DKLWAELDFAIRSSEI--GLVDCNTVEHEDAFPSKLEQVDLCLRGDHQLILDEQIGLKCR  572

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGD----DADLDHFAIPVSSNK  2184
              C  V  EI+++ P F     +  GK ++ +  + E  + D    DAD D      + + 
Sbjct  573   CCSYVKLEIRNIAPSF---DTNPHGKSKKKKSDLFEHVKYDGLEQDADCD------AHDN  623

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI-DPESKKRG-GCVI  2010
             P S        W +IP +RN +  HQR  FEF+WKNIAG I   ++ + +    G GC++
Sbjct  624   PDSRSHFGQTVWDIIPGIRNSMYPHQREGFEFIWKNIAGGIYLDELREMDGLNNGSGCIV  683

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I FL +Y+KL P  RP+++AP + L TW +E +KW + IP + ++   
Sbjct  684   SHAPGTGKTRLTINFLQTYMKLNPTCRPMIIAPSSMLLTWEEEFLKWDVGIPFHNLNKRD  743

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSF--LTLTREDS  1656
                 E +     L    P  Q+V +V   + K+  W    S+L + Y  F  L   R DS
Sbjct  744   FSFEENMSALKFLMQASPSGQNVDNVR--VVKLFSWKKEKSILGISYRLFERLAGVRNDS  801

Query  1655  TYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGE  1476
                    +  VL + P +++ DEGH PR+  S +  AL K+ T  RI+LSGT FQNNF E
Sbjct  802   KCDK---VRNVLLELPDLVVFDEGHIPRNDDSLIWMALSKIKTERRIILSGTPFQNNFTE  858

Query  1475  YFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskere  1296
             + NTL L RP F  E     D    K+      R   +N  R  +   IS    +S+   
Sbjct  859   FSNTLRLVRPNFAKESNTVGDGCMDKK------RGRPKNITRGKWDLLISSIGRTSELES  912

Query  1295  rkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
              +  L  ++ L   F+ VY G    + LPGL+  T+++    LQ+  L ++Q ++  +  
Sbjct  913   AE--LKEIRALINPFVHVYRGSILQEKLPGLRKSTVILWPAELQKNFLERVQARKNSF--  968

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
                E+E + +L ++HP LI     S +   E + + LE+ + + +LG K++F++ +I   
Sbjct  969   ---EVEYVESLISVHPSLILK---SDKGDCEFDKDMLERCRLNPELGVKLQFLLEIIRLS  1022

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGG  759
                 EKVL+F   I P++   E  +  + W +GIE+  + G  E+ +R  +++ F ++  
Sbjct  1023  EALNEKVLVFSQYIEPLSFIEEHLKFHFKWTEGIELFHMDGKREIKKRQALINTFNDLTS  1082

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
               +V+LAS   C+EGI+L  ASRV+LLD  WNPS  ++AI RA+R GQ KVVYVY L+ +
Sbjct  1083  EVRVLLASTRACSEGINLVGASRVVLLDVVWNPSVERKAICRAYRLGQRKVVYVYHLITS  1142

Query  578   GTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIM  402
             GT EEEKY R   K+ +S ++FS +   +     +  ++D +L  +++ ++   +F  I+
Sbjct  1143  GTREEEKYSRQIVKDRLSQLVFSSEQNSNDVKVSSRDLDDRILEAVLQHEKFKKIFQKII  1202

Query  401   KNEKASNM  378
                K S M
Sbjct  1203  YQSKDSCM  1210



>emb|CDY66441.1| BnaCnng50860D [Brassica napus]
Length=1033

 Score =   337 bits (864),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 241/729 (33%), Positives = 367/729 (50%), Gaps = 69/729 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LW++M LAL+    L+    +    + ++  +  K      HDF L+EE+GL CR C 
Sbjct  355   DRLWEDMALALS----LEGVRSSAHSRSGDVSCSNGK------HDFVLDEEVGLKCRYCS  404

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEV--  2169
              VS EI+DV P       + + K+         +K+G+   LD      S      E   
Sbjct  405   YVSVEIRDVSPTMDKYRANINDKK------TCSDKKGNPL-LDSLDFEASDRSRDMESLK  457

Query  2168  EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-SKKRGGCVISHSPGA  1992
               +   W  IP ++N L  HQ+  FEF+W N+AG+    ++     K+ GGC+ISHSPG 
Sbjct  458   NTQGTVWEYIPGIKNTLYPHQQEGFEFMWNNLAGTTKLDELKSSVGKESGGCIISHSPGT  517

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEV  1812
             GKT L I FL SYL+ FP S P+V+AP + + TW +E  KW   IP Y +   Q + G+ 
Sbjct  518   GKTRLTIVFLQSYLEQFPESHPVVIAPASLMLTWEEEFKKWNSNIPFYNM-SSQDFSGQE  576

Query  1811  LRQKMKLCPG---LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHR  1641
              +  + L  G   L RN+D + ++    K+  W    S+L + Y  +  L   +      
Sbjct  577   NQSAVSLLKGNRHLRRNKDSVRMV----KLYSWRNKKSILGISYNLYEKLAG-NRCAGEV  631

Query  1640  KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTL  1461
             +   ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGT FQNNF E  N L
Sbjct  632   QEFRKMLLELPGLLVLDEGHTPRNHNSCIWKVLTEVKTEKRIILSGTPFQNNFKELSNVL  691

Query  1460  CLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGL  1281
             CL RP + D++   L    +   +G   RF  E                         G+
Sbjct  692   CLTRPAYADKISSRLQDLTRLSQEGKNGRFDEE------------------------VGI  727

Query  1280  NILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLEL  1104
             + LK +   F+ V++G    ++LPGL+   +M+     Q++IL ++   +  +     EL
Sbjct  728   SELKDMIAPFVHVHKGNILRESLPGLRDCVVMLNPPFQQEKILKRIDHSQNTF-----EL  782

Query  1103  ELLITLGAIHPWLIRTTACSGQYfkee------elealekfkfdlkLGSKVKFVMSLIPR  942
             E  ++  ++HP L     C  Q  KE+       L+ LE  + D K G+K +F++  I  
Sbjct  783   EHKLSAVSVHPSLY---MCCKQTNKEQLTIGPVALKVLESLRLDSKEGAKTRFLIDFIRF  839

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
                  EKVL+F   I  + L  +     +GW +G E+L + G ++   R  +++ F    
Sbjct  840   SQTVNEKVLVFSQYIDTLELIRDQLNAVFGWTEGEEILYMHGQLKQTIRQHLINNFNRPD  899

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               SKV+LAS   C+EGI L  ASRV+LLD  WNPS  +QAI+RA+R GQ +VVY Y L+ 
Sbjct  900   SKSKVLLASTGACSEGIHLVGASRVVLLDVVWNPSVERQAISRAYRIGQKRVVYTYHLMV  959

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMI  405
              GT E  KY + T K  +S M+FS    +D         ED++L E+V  ++   +F  +
Sbjct  960   KGTTEWGKYCKQTKKHRISEMVFSPTNEKDKLIENEVVSEDKILDEMVRHEKLKDMFGKV  1019

Query  404   MKNEKASNM  378
             +  +K S+M
Sbjct  1020  LYRKKESDM  1028



>ref|XP_002885641.1| hypothetical protein ARALYDRAFT_342596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61900.1| hypothetical protein ARALYDRAFT_342596 [Arabidopsis lyrata subsp. 
lyrata]
Length=1122

 Score =   337 bits (863),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 236/730 (32%), Positives = 359/730 (49%), Gaps = 75/730 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCH---HDFRLNEEIGLVCR  2352
             D LW++M +AL             + S+T      K G ++C    HDF L+EEIGL C 
Sbjct  448   DSLWEDMAVALTL---------EGMNSST----PAKNGDKLCSKGTHDFVLDEEIGLKCL  494

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFA--IPVSSNKPS  2178
              C  V+ EIK++ P  +         + RP   V + K+  D   D     +   ++ PS
Sbjct  495   HCSYVAVEIKNISPAMV---------KYRPS--VNDNKKCSDKKGDPLPNRLEFDASGPS  543

Query  2177  SE----VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES-KKRGGCV  2013
             S      + E   W  +P +++ L  HQ+  FEF+WKN+AG+    +++    K  GGC+
Sbjct  544   SHDTPLEKTEGTVWRYVPGIKDTLYPHQQEGFEFIWKNLAGTTKLNELNSVGVKGSGGCI  603

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH  G GKT L I FL SYL+ FP S P+V+AP + + TW +E  KW   IP Y ++  
Sbjct  604   ISHKAGTGKTRLTIVFLQSYLERFPDSHPMVIAPASLMRTWEEEFRKWNANIPFYNMNSP  663

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDST  1653
             Q + G    + +    G   +  +  V     K+  W    S+L + Y  +  L    + 
Sbjct  664   Q-FSGHEDVEAVSCLEGDRHHNSIRMV-----KLVSWWKQKSILGVSYPLYEKLATNKNA  717

Query  1652  YAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
                + +  ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGTLFQNNF E 
Sbjct  718   EGMQVF-RRMLVELPGLLVLDEGHTPRNQNSLIWKVLTEVRTEKRIILSGTLFQNNFKEL  776

Query  1472  FNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
              N LCLARP   D +   L    K   +G   R + ENR                     
Sbjct  777   SNVLCLARPACKDTISSRLHELIKCSQEGEHGRVNEENR---------------------  815

Query  1292  kEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGF  1116
                +  LK +   F+ V+EG    ++L GL+   L++     Q++IL ++   +  +   
Sbjct  816   ---IVDLKAVIAPFVHVHEGDILQESLLGLRDCVLVLNPPFQQKKILDRIDTSQSTF---  869

Query  1115  PLELELLITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIP  945
               E E  ++  ++HP L      T           LE L+K +   K G K KF++  I 
Sbjct  870   --EFEHKLSAVSVHPSLYLCCNPTKKENLVIGPATLETLKKLRLKYKEGVKTKFLIDFIR  927

Query  944   RCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEV  765
                  KEKVL++   I  + L +E     + W++G E+L + G +E  +R  ++D F + 
Sbjct  928   ISGTMKEKVLVYSQYIDTLKLIMEQLSLVFSWKEGEEILFMHGKVEQRDRQHLIDNFNKP  987

Query  764   GGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLL  585
                SKV+LAS   C+EGISL  ASRV++LD  WNPS   QAI+RAFR GQ + V++Y L+
Sbjct  988   DSGSKVLLASTKACSEGISLVGASRVVILDVVWNPSVESQAISRAFRLGQKRAVFIYHLM  1047

Query  584   ATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHM  408
                T E  KY + + K  +S ++FS    +D         ED +L E+V  ++   +F  
Sbjct  1048  VKDTSEWNKYCKQSEKHRISELVFSSTNEKDKPINNEVDSEDRILDEMVRHEKLKHIFEK  1107

Query  407   IMKNEKASNM  378
             I+ + K S+M
Sbjct  1108  ILYHPKESDM  1117



>gb|KHG04884.1| DNA repair and recombination protein RAD54-like protein [Gossypium 
arboreum]
Length=966

 Score =   333 bits (855),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 238/755 (32%), Positives = 384/755 (51%), Gaps = 74/755 (10%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCH---HDFRLNEEIGLVCRLC  2346
             LW EM+  LAS  +        ++ A  +    +    +C    H   L+EEIG+ C+ C
Sbjct  222   LWTEMQFCLASDGIASKPSLVEIEDAANVSEVKQDRAVLCRQGDHYLVLDEEIGIKCKFC  281

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGKEQRP--EEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
               +  EIK V  PFM       G++     +  + +  Q  D ++D      S+N     
Sbjct  282   SFLQLEIKYVASPFMKHPYGKFGRQYSGIVDSSMFDGLQDVDPNIDMPGCDSSAN-----  336

Query  2171  VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGA  1992
               VE   W +IP+++ KL  HQR  FEF+W NIAG I   +    S + GGC+ISH+PG 
Sbjct  337   --VEGTVWEIIPNIKEKLYPHQREGFEFIWNNIAGGIYRDKSKNSSSEGGGCIISHAPGT  394

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH-----GGQT  1827
             GK+LL I FL +YLK  P  RP+++AP + L TW  E  KWK+ IP + ++     G   
Sbjct  395   GKSLLTIVFLQTYLKENPSCRPVIVAPCSMLLTWEAEFSKWKVDIPFHNMNSPDFCGMGK  454

Query  1826  YKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYA  1647
               G  L +K+K+  G+P   D   ++  L K+  W     +L++ Y  F  L  +++   
Sbjct  455   TNGVALYEKLKV--GVP---DADRLVRPLVKLLSWKYDGGILVISYNLFTQLAGKETKRK  509

Query  1646  HR-----KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
              +     K ++++L   PG+LILDEGH PR+  + L KAL  + T+ RI+LSGT FQNNF
Sbjct  510   QKCKNLHKQISKILLDLPGLLILDEGHIPRNAATLLWKALSGIKTNRRIILSGTPFQNNF  569

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              E FNTLCL RP F + +      +Y  R K         N A++ F             
Sbjct  570   DELFNTLCLVRPTFAEGI------RYSTRYKHNSRLGCKGNEAKRNF------TSWIGSI  617

Query  1301  rerkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQ--------------  1167
             R    GL  ++ +   F+ VY+G      LPGL+   ++++ T LQ              
Sbjct  618   RNEIGGLREVRAVIKPFVHVYKGTILQTALPGLRHTLVVLRPTELQKKILERVEEILKHV  677

Query  1166  QEILVKLQDQRPIYKGF-------PLELELLITLGAIHPWLIRTTA--------CSGQYf  1032
             QEIL  +++ + ++K          L+ +  +++ +IHP L++            +    
Sbjct  678   QEILECVKEAKNLFKRKREKEKKNALDFDRYVSMISIHPSLLKQLLKQLPDLKDINEVVS  737

Query  1031  keeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYG  852
                  E +E+ +   + G K +F+M+L+      +E+V++F   + P+ L +E  E ++ 
Sbjct  738   SIVSTEEIERIRLKPEEGVKTRFLMNLLKLSEALEERVIVFSQYLGPLRLIMEQLEYYFK  797

Query  851   WRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDS  672
             W++G E+L + G  ++ +R   ++ F +    ++V+LASI  C+EGI+L   SRV+LLD 
Sbjct  798   WKEGEEILFMHGKCDIKQRQCSINVFNDPESKARVLLASIKACSEGINLIGGSRVVLLDM  857

Query  671   EWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVED  492
              WNPS  +QAI RA+R GQ KVVYVY+L+++  +E  K+ R   K+ VS ++FS D   +
Sbjct  858   TWNPSVERQAICRAYRLGQKKVVYVYRLISS-VIEGHKFNRQAGKDRVSELLFSSD---E  913

Query  491   PSHWQAPKIEDELLGEIVEEDR-ATLFHMIMKNEK  390
                     +ED++L E+++     ++F  I+   K
Sbjct  914   HQEQVCDIVEDKVLEEMLQHGTIKSMFEKIINEPK  948



>gb|KEH22457.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1439

 Score =   337 bits (865),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 238/726 (33%), Positives = 353/726 (49%), Gaps = 75/726 (10%)
 Frame = -3

Query  2519  MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC--HHDFRLNEEIGLVCRLC  2346
             ++W E+E AL         E   +     L      G+  C   H+  L+EEIG  C+ C
Sbjct  743   VIWDELETAL--------RESEAVSKIGNLETDEASGSPSCCSEHNIFLDEEIGEFCKSC  794

Query  2345  GVVSTEIKDVPPPFMPSTCS-SSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEV  2169
             GVV TEIK + P  +       SGK+   + V +       + +D   + VS N   +  
Sbjct  795   GVVITEIKYISPLVIDRFLGEGSGKKASFDGVNV-------SHVDGSQLNVSDNDSKTNF  847

Query  2168  E-VEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESK-KRGGCVISHSPG  1995
                E   W LIPDL+  L  HQ   FEF+WKN+AG     ++  +     GGC+ISH+PG
Sbjct  848   SRNEGTVWDLIPDLKQTLYPHQIEGFEFIWKNLAGHTELQKLKNDDLCSEGGCIISHAPG  907

Query  1994  AGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE  1815
              GKT L + FL +YLK FP   P+++AP + L TW  E  KW I +P + +   +   G+
Sbjct  908   TGKTRLTMVFLKAYLKAFPKCLPIIVAPASILLTWEDEFKKWDIGVPFHNLSNPE-LSGK  966

Query  1814  VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
                  ++         DV      + K+  W    S+L + Y  F    ++   + + K 
Sbjct  967   EHPDAVETFDMSNTQHDVHETR--MAKLISWFKEASILGISYNLFGKKCQDKKKHENVKE  1024

Query  1634  ------MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEY  1473
                   M +VL   PG+++LDEGH PR+ +S + K   K+ T  RI+LSGT FQNNF E 
Sbjct  1025  REGNCDMRKVLLNSPGLIVLDEGHTPRNQRSHIWKVFSKLQTQKRIILSGTPFQNNFWEL  1084

Query  1472  FNTLCLARPRFVDEVLKEL-----DPKYKKRVKG-------AKTRFSLENRARKMFidki  1329
             ++TL L +P F + +  EL     +  YK   K         KTR   +++ +K      
Sbjct  1085  YSTLSLVKPSFPNTIPPELKSFCQNQGYKSSKKCNWEPVLLNKTRDPSDDQIKK------  1138

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGSSDN-LPGLQCYTLMMKSTTLQQEILV  1152
                                K L   F+ V++G   +N LPGL+   + +K+ +LQ EIL 
Sbjct  1139  ------------------FKLLMDPFVHVHKGAILENKLPGLRDSLVTLKAGSLQNEILK  1180

Query  1151  KLQ-DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGS  975
              ++  Q  I+       E  + L ++HP L    A S +     + + LEK + +   G 
Sbjct  1181  SIKRSQNTIFN-----FERKVALTSVHPSLFLECALSEEEKSALDKDQLEKIRLNPHEGV  1235

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             K KF+   +  C    EKVL+F    AP+ L  +     + W +G EVLV+ G+     +
Sbjct  1236  KTKFLFKFVRLCDAFHEKVLVFSQFHAPLQLIKDQLNSAFKWTEGKEVLVMSGEDPPKVK  1295

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
               V+  F +    +KV+LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ
Sbjct  1296  QSVIHSFNDENCQAKVLLASTKACSEGISLVGASRVVLLDVVWNPSVERQAISRAYRIGQ  1355

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLV---EDPSHWQAPKIEDELLGE  444
              KVVY Y LLA GT EEEKY +   K+ +S ++FS       +  S   A   ED +L E
Sbjct  1356  KKVVYTYHLLAEGTTEEEKYGKQAEKDRLSELVFSAKNAANNDGKSKSSAVNFEDRVLDE  1415

Query  443   IVEEDR  426
             + + ++
Sbjct  1416  MTKHEK  1421



>ref|XP_006648888.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Oryza 
brachyantha]
Length=1335

 Score =   335 bits (859),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 224/694 (32%), Positives = 352/694 (51%), Gaps = 50/694 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLD-DTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLC  2346
             D LW E + AL S  +   + E+       E+            H+  ++E+IG+ C+ C
Sbjct  634   DELWTEFDFALESINVCSHNCEEHEKNDEQEIPADKAASCSQGKHELFIDEQIGVRCKHC  693

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADL--DHFAIPVSSNKP---  2181
               V  EI+ V P  + S                E K+  D DL  D     V    P   
Sbjct  694   HYVDLEIRFVLPSMVKSYAE------------REMKKDHDLDLVFDDILTSVGYEGPRDF  741

Query  2180  --SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE-SKKRGGCVI  2010
                  V V    W L+P +R  +  HQR  FEF+W+ +AG I   Q+        GGCVI
Sbjct  742   GGDKTVLV----WDLVPGVREDMFPHQREGFEFMWRKLAGGISIEQLKHTVGTIEGGCVI  797

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I F+ SY + FP   P+++AP+  L TW +E  KWK+ +P + ++  +
Sbjct  798   SHAPGTGKTRLAITFVQSYFEFFPECCPVIIAPRGMLATWEQEFRKWKVKVPFHVLNSNE  857

Query  1829  TYKGE------VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT  1668
                 E      +     KL   L RN+        L K+  W    S++ + Y+ F  L 
Sbjct  858   INWNEDKTIKYLATMDEKLAQSLARNKLDQKFRRKL-KLASWRKGSSIIGVSYSLFRKLA  916

Query  1667  REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQN  1488
               D        +  +L + P +L+LDEGH PR+ KS + K L KV T  RI+LSGT FQN
Sbjct  917   NHDGIDGL--MVRNLLLEKPDLLVLDEGHTPRNKKSLIWKVLAKVRTEKRIILSGTPFQN  974

Query  1487  NFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskk----  1320
             NF E +N L L RP+F  +   +    +KK  KG  +R S   R+R+M + K  +     
Sbjct  975   NFLELYNILYLVRPKFARDFASK---SFKK--KGFASRTS---RSREMLLGKDDEGKDFW  1026

Query  1319  idsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQ  1143
                      +E ++ ++K+    + ++ G     +LPGL+   +++     Q+EI+  ++
Sbjct  1027  TSLKLNNITEENIDEIRKILDPIVHIHNGDILQKSLPGLRESVVVLNPLPHQKEIITAME  1086

Query  1142  DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKF  963
             +   +     L+ E  I+L +IHP+LI  T  S        +  L+  + +   G K +F
Sbjct  1087  NTVAMG---TLDSEYKISLASIHPFLITCTKLSENETSCVNVSLLKSLRPNPCEGVKTRF  1143

Query  962   VMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVM  783
             V+ ++  C   KE+VL+F   + P++L ++   + + W +G E+L++ G++ +  RG +M
Sbjct  1144  VLEIVRLCEAMKERVLVFSQYLEPLSLIVDQLSKMFSWTEGKEILLMSGNVLVKNRGALM  1203

Query  782   DKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVV  603
             + F ++   +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ+K+V
Sbjct  1204  EAFNDMKSDAKVMLASTKACCEGITLIGASRVVLLDVVWNPSVGRQAIGRAYRIGQEKIV  1263

Query  602   YVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDL  501
             Y Y L+  GT E++KY R   K+ +S ++FS++L
Sbjct  1264  YTYNLITEGTKEKDKYDRQGRKDQMSKLLFSKEL  1297



>gb|KEH22453.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1303

 Score =   332 bits (852),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 232/711 (33%), Positives = 355/711 (50%), Gaps = 68/711 (10%)
 Frame = -3

Query  2468  DTEDTNLKSATELHMATKKGTR-------VCHHDFRLNEEIGLVCRLCGVVSTEIKDVPP  2310
             D  DT L+ +    M    GT        +C HD   +++IG+ CR CGVV TEIK V  
Sbjct  600   DQMDTALRESEAESMIGNLGTNDMRNPSTLCEHDTCFDDQIGVYCRWCGVVVTEIKYVSQ  659

Query  2309  PFMPSTCSSSGKEQRPEEVVMEEKQGDDA-DLDHF---AIPVSSNKPSSEV-EVEDNAWA  2145
               M         ++ P E   +    DD+ ++ HF      VS  +P +     E   W 
Sbjct  660   LVM---------DRFPSEGSGKRASFDDSVNVSHFDGSQFNVSDGEPETNFSHNEGTVWD  710

Query  2144  LIPD-LRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR-GGCVISHSPGAGKTLLII  1971
             LIPD ++  L  HQ   FEF+WKN+ G I   ++   + +R GGC+ISH+PG GKT L I
Sbjct  711   LIPDDVKETLYPHQLEGFEFIWKNLTGHIDLHKLSKTNPRREGGCIISHAPGTGKTRLTI  770

Query  1970  AFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG----GQTYKGEVLRQ  1803
              FL+SYLK+FP   P+++AP + L TW  E  KW I +P + ++     G+ +   V   
Sbjct  771   MFLMSYLKVFPKCLPVIVAPASLLLTWEDEFKKWDIGVPFHNLNNLKLSGKEHDDAVDFV  830

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY----  1635
                       N+ +      + K+  W    S+L + Y  +  L  E  +   +K     
Sbjct  831   NWS-------NKRLSKDTTRMVKLISWYKEKSILGISYNLYEKLAGEGGSKRRKKRKHTN  883

Query  1634  ---------MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
                      M   L + PG+L+LDEGH PR+ +S + K L K+ T  RI+LSGT FQNNF
Sbjct  884   VEKRKQNGDMRNALLESPGLLVLDEGHIPRNERSLIWKVLSKIQTRKRIILSGTPFQNNF  943

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidki-skkidssk  1305
              E +N L L +P F + +  EL             +F L+   +K+  +        +S 
Sbjct  944   LELYNILSLVKPSFPNTIPHEL------------KKFCLKQEYKKVSEEWSWEADYGNST  991

Query  1304  ererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
                    +  LK L   F+ V++G      LPG++   L +K  +LQ++IL  +Q ++  
Sbjct  992   CNPSDHKIKQLKLLMDPFVHVHKGAILQKKLPGIRNCKLTLKPDSLQKQILDSIQSRQN-  1050

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
                  L  E  +T+ +IHP+L        +     + + LEK + +  +G K KF++  +
Sbjct  1051  ----ALIFERKLTMASIHPYLFLECDLLKEEESVVDKDQLEKLRLNPYVGVKTKFLVEFV  1106

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERF-YGWRKGIEVLVLQGDIELFERGRVMDKFE  771
               C   KEKVL+F   I P+ L ++        W  G E+L + G++ L +R  ++  F 
Sbjct  1107  RLCDAVKEKVLVFSQLIRPLCLIIDQLSHISLNWTVGKEILFMHGEVSLKDRQSLIHSFN  1166

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             +    +K++LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ KVVY Y 
Sbjct  1167  DANSQAKILLASTNACSEGISLVGASRVVLLDVVWNPSVDRQAISRAYRIGQKKVVYTYH  1226

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIFS-EDLVEDPSHWQAPKIEDELLGEI  441
             LL  GT E+ K+++   K  +S ++FS ++  +D S   A   ED +L ++
Sbjct  1227  LLTEGTAEKIKHRKQAEKHRLSELVFSAKNADKDKSKSCAVNFEDRILDQL  1277



>gb|EYU38298.1| hypothetical protein MIMGU_mgv1a000457mg [Erythranthe guttata]
Length=1138

 Score =   330 bits (846),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 231/726 (32%), Positives = 365/726 (50%), Gaps = 51/726 (7%)
 Frame = -3

Query  2504  MELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVVSTEI  2325
             + L++ + +L+  TE+ ++    E+  +     R   H   L +EIG+VC+ C  V  EI
Sbjct  437   INLSINTFFLIFKTENDDV---VEIDTSPAACCRRGEHQLILEDEIGIVCKYCAAVILEI  493

Query  2324  KDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWA  2145
             K V PPF  +      + +  EE     K          A   ++  P S +      W 
Sbjct  494   KYVLPPFYTAPSRKRDRREYSEEYSPNSKTDRQIQFQDAAYKEAA--PDS-IGTRGTVWD  550

Query  2144  LIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISHSPGAGKTLLII  1971
             LIP + N++  HQR  FEF+W+NIAG      +       GG  C+ISH+PG GKT L I
Sbjct  551   LIPGVENEMYPHQREGFEFIWRNIAGGTSLCNLQQPLTDTGGKGCIISHAPGTGKTRLTI  610

Query  1970  AFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKL  1791
              FL ++LKL+P  RP+++APK  L TW  E +KWK+ IP + ++  +  + E      K+
Sbjct  611   VFLATFLKLYPNCRPVIIAPKGMLLTWETEFVKWKVNIPFHNMNKEELSENEN-EFAAKI  669

Query  1790  CPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---------REDSTYAHRK  1638
             C  L     +        K+ KW+   S+L + Y  F  L           ++      +
Sbjct  670   CAQLGGGGGISKEHVRWVKLCKWMQGRSILGISYQLFEKLVGVKTQKGDKNKNKNENENE  729

Query  1637  YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLC  1458
              M + L + PG+L+LDEGH PR+ +S + KAL KV+T   I+LSGT FQNN  E +NTLC
Sbjct  730   KMREFLLEYPGLLVLDEGHTPRNQQSLIWKALTKVSTKRCIILSGTPFQNNLTELYNTLC  789

Query  1457  LARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLN  1278
             L  P   ++              G     S + R R        +K  ++  +   +GL 
Sbjct  790   LVNPSIANQ--------------GNWCGNSKKTRGRP--PKSADRKEWTNLGKNTDDGLK  833

Query  1277  ILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
              LK +   F+ V+ G    ++LPGL+   + +  T LQ+ +L     +R I+        
Sbjct  834   KLKMMLDPFVHVHRGTILEESLPGLRDTIVFLHPTELQKNLLETCAQERRIF-----HRT  888

Query  1100  LLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEK  921
              L+++ ++HP L        +     +   LE+ + D++ G K+KFVM LI       E+
Sbjct  889   NLVSMVSVHPSLFPEE----KRRSVAQKNVLEEIESDIEAGVKLKFVMKLIYLADALGER  944

Query  920   VLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVML  741
             VLIF   I P+    +  +  + W +G E+L + G ++  +R   +  F +    +KV+L
Sbjct  945   VLIFSQYIHPLVFIKKQIKSHFSWNEGREILYMDGQLDERQRQDSISSFNDERSEAKVLL  1004

Query  740   ASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEE  561
             AS+  C+EGI+L  ASRV+LLD+ WNPS  KQAI+RA+R GQ +VVYVY+L  +GT E  
Sbjct  1005  ASLRACSEGINLVGASRVVLLDTVWNPSVEKQAISRAYRIGQKRVVYVYRLFTSGT-EVR  1063

Query  560   KYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKI----EDELLGEIVE-EDRATLFHMIMKN  396
             +Y +  +KE +S +IF+ D+ +D    ++ K     ED++L  +   E    +F  I+  
Sbjct  1064  QYSQQAYKERISQLIFA-DVDDDGEICRSDKSKMVNEDKVLDAMAGIEGFGDIFEKIIHQ  1122

Query  395   EKASNM  378
              K S++
Sbjct  1123  PKESDL  1128



>ref|XP_011085870.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Sesamum 
indicum]
Length=1331

 Score =   332 bits (850),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 225/634 (35%), Positives = 332/634 (52%), Gaps = 38/634 (6%)
 Frame = -3

Query  2393  HDFRLNEEIGLVCRLCGVVSTEIKDVPPPF-MPSTCSSSGKE--QRPEEVVMEEKQGDDA  2223
             H   L+E+IGLVCR C  V  +IK V PPF  P +     K+    P  ++ + +  D A
Sbjct  674   HQPILDEQIGLVCRYCYAVILDIKHVLPPFYTPPSWRRDRKDFDDLPSSIISQIQFQDSA  733

Query  2222  DLDHFAIPVSSNKPSSEVEVEDNA-WALIPDLRNKLRAHQRRAFEFLWKNIAGSI-IPTQ  2049
                       S  P+S    +    W LI  +  ++  HQR  FEF+WKNIAG I I   
Sbjct  734   ----------SGSPNSIDRAKGGTVWDLIAGVEKEMYPHQREGFEFMWKNIAGDIRIEKL  783

Query  2048  IDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW  1869
               P      GC+ISH+PG GKT L I FL+++LKL+P  RP+++AP+  L TW  E IKW
Sbjct  784   KQPLPDGGRGCIISHAPGTGKTRLTIMFLLTFLKLYPTCRPVIIAPRGMLLTWESEFIKW  843

Query  1868  KIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGY  1689
              + IP + ++  +   GE       +   +     +      L K+  W+   S+L + Y
Sbjct  844   HVHIPFHNLNK-EELSGEENAIAANIIGQVGGGGGMSRDYIRLLKLYSWMKGRSILGVSY  902

Query  1688  TSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILL  1509
               F  L  E       + + +VLR+ PG+L+LDEGH PR+ +S + K L KV T  RI+L
Sbjct  903   KLFEKLAGEKGKKGQNEQIRKVLRELPGLLVLDEGHTPRNNQSLIWKTLTKVATQRRIIL  962

Query  1508  SGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidki  1329
             SGT FQNN  E +NTLCL  P+F + +  E +   +    G K  F      RK +I+  
Sbjct  963   SGTPFQNNLTELYNTLCLVNPKFDNHLGSEYNIS-RSETHGRKGNFD-----RKKWINLT  1016

Query  1328  skkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILV  1152
             S    +S +     GLN LK +   F+ V++G    ++L GL+   + +  T LQ+ +L 
Sbjct  1017  SSIGKNSGD-----GLNKLKAMLDPFVHVHKGTILQESLLGLRDTLVFLHPTELQKTLLE  1071

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSK  972
                  R I+         +++L ++HP L    A  G          LE+ + D++ G K
Sbjct  1072  NASKSRHIFHRI-----RMVSLISVHPSL----AAVGMGTFSAHKSKLEEIELDIEAGVK  1122

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
              KFV++LI       E+VL+F   I P+          + W +G EVL + G +++ +R 
Sbjct  1123  TKFVVNLIWLADALGERVLVFSQYIDPLVFIKNRITSHFSWSEGKEVLYMDGQLDVNQRQ  1182

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
               +  F +  G +KV+LAS   C+EGI+L  ASRV+LLD+ WNPS  KQAI+RA+R GQ 
Sbjct  1183  DSISSFNDDTGEAKVLLASERACSEGINLVGASRVVLLDTVWNPSIEKQAISRAYRLGQK  1242

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             KVVYVY+L  +GT E + Y +   K+ +S +IFS
Sbjct  1243  KVVYVYRLFTSGT-EVKIYAQQVQKQRMSQLIFS  1275



>ref|XP_011093983.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Sesamum 
indicum]
Length=1580

 Score =   333 bits (855),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 212/667 (32%), Positives = 344/667 (52%), Gaps = 46/667 (7%)
 Frame = -3

Query  2408  TRVCH--HDFRLNEEIGLVCRLCGVVSTEIKDVPPP-----FMPSTCSSSGKEQRPEEVV  2250
             T+ C   H    ++EIG++C+ C  +  E K V PP     +  +    +G +Q      
Sbjct  921   TQCCKGKHQLIEDDEIGVICKYCFHIELEAKHVIPPWAEKMYRGANRRFAGADQSYVLDG  980

Query  2249  MEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIA  2070
             ++ + G+D     FA   +  K +         W + P +R  +  HQR   EFLWKN+A
Sbjct  981   LDMEPGED-----FAGSCNPRKGT--------IWDIKPGIRETMYEHQREGLEFLWKNLA  1027

Query  2069  GSIIPTQID-PESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYT  1893
             G+    Q+   ES+   GC+ISH+PG GKT L + FL +YLKL+P SRPL++ P + L T
Sbjct  1028  GTTDLAQVKTAESRNLEGCIISHAPGTGKTRLTMVFLETYLKLYPDSRPLIITPASMLLT  1087

Query  1892  WYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAH  1713
             W +E  KW +  P + ++  +    E      +L  G P N   +  +    K+  W   
Sbjct  1088  WEEEFRKWDVQFPFHNLNNLEISGKENKMILQRLPEGRPLNNTTVRTV----KIYSWNKE  1143

Query  1712  PSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKV  1533
              S+L M Y  F +L  + S     + + ++L + PG+++LDEGH PRS KS +  AL+K+
Sbjct  1144  QSILGMSYDLFKSLAWKKS---ENEPVTRILLEKPGLVVLDEGHIPRSQKSNIWNALLKL  1200

Query  1532  NTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRA  1353
              T  RI+LSGT FQNNF E FN L + RP     + KE         +G  +R +  +  
Sbjct  1201  KTKKRIILSGTPFQNNFKELFNILRIVRPAVAGVLAKEKKFSEMISCRGRCSRKNYRDIE  1260

Query  1352  RKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKST  1176
                F   +               ++ LK     F+ V++G     +LPGL+   ++++  
Sbjct  1261  ESQFSVSVMDT-----------AIDDLKAAMAPFVHVHKGAILQQSLPGLRDCVILLRPP  1309

Query  1175  TLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfk  996
              LQ+ ++ +++  + ++K      +  + L ++HP+L      + +     +  ALE  K
Sbjct  1310  ELQKSLIQRIEGLKNMFK-----FDHKVALISVHPYLFTQCRLTEEEKSGVDQAALEASK  1364

Query  995   fdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQG  816
                  G K +F+M L+    +R EKVL+F   + P++L  +  + F+GW +G ++L ++G
Sbjct  1365  LIPFEGVKTRFMMELVRLSAVRNEKVLVFSQYLGPLDLIQDHLKGFFGWGEGKQILKMEG  1424

Query  815   DIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIA  636
              +   +R  +++ F +    +KV+LAS   C+EGI+L  ASRV+LLD  WNPS  +QAI 
Sbjct  1425  KMGQKDRQNLINAFNDPKSEAKVLLASTRCCSEGINLVGASRVVLLDVVWNPSVERQAIC  1484

Query  635   RAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPK-IED  459
             RA+R GQ K+VY Y L+ +GT E +KY R   KE +S ++F+    E      A   I+D
Sbjct  1485  RAYRLGQKKIVYTYHLMTSGTTEGDKYCRQAEKERLSELVFTSSSNEQCKSMNADTCIDD  1544

Query  458   ELLGEIV  438
              +L +IV
Sbjct  1545  GVLEDIV  1551



>ref|XP_010488536.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Camelina 
sativa]
Length=1114

 Score =   328 bits (840),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 238/725 (33%), Positives = 359/725 (50%), Gaps = 65/725 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCR  2352
             D LW++M +AL             + S+T      K G  +C    HDF L EEIGL+CR
Sbjct  440   DSLWEDMAVALTL---------EGMDSST----PAKVGDMLCSKERHDFVLEEEIGLICR  486

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDA-DLDHFAIPVSSNKPSS  2175
              C  V+ EIKD+ P       + +  ++  E      K+G+   D   F     S+ P+S
Sbjct  487   HCSHVAVEIKDISPAMDKYRANINDNKKSSE------KKGEPLFDRLEFDASDHSSYPAS  540

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES-KKRGGCVISHSP  1998
                 E   W  +P +R+ L  HQ+  FEF+WKN+AG+    + +    K  GGC+ISH  
Sbjct  541   LDNTEGTVWQYVPGIRDTLYPHQQEGFEFIWKNLAGTTKLDEFNSVGVKGSGGCIISHKA  600

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             G GKT L I FL SYL+ FP S P+V+AP T + TW +E  KW   IP + ++  Q + G
Sbjct  601   GTGKTRLTIVFLQSYLERFPDSHPVVIAPATLMRTWEEECRKWNADIPFFNMNSRQ-FSG  659

Query  1817  EVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRK  1638
                   +    G  ++  V  V     K+  W    S+L + Y  +  L   D      +
Sbjct  660   YEDASAVSRLNGNRQHNSVRMV-----KLYSWWNKKSILGVSYPLYEKLA-ADKNAGEMQ  713

Query  1637  YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLC  1458
                ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGTLFQNNF E  N LC
Sbjct  714   VFRRMLLELPGLLVLDEGHTPRNQNSLIWKVLTEVRTEKRIILSGTLFQNNFKELSNVLC  773

Query  1457  LARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLN  1278
             LARP   D +   L    K+  +G   R + E                         G+ 
Sbjct  774   LARPALKDTISSRLQELSKRSQEGEHGRVNEE------------------------IGIV  809

Query  1277  ILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
              LK +   F+ V+EG    ++LPGL+   +++     Q++IL ++   +  +     E E
Sbjct  810   DLKVMIAPFVHVHEGTILEESLPGLKDCVVVLNPPFQQKKILDRIDTSQNTF-----EFE  864

Query  1100  LLITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
               ++  ++HP L      T           L  L++ + D K G K KF+++ I      
Sbjct  865   HKLSAVSVHPSLYLCCNPTKKEDLVIGPATLGTLKRLRLDYKEGVKTKFLINFIRITEKV  924

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSK  750
             KEKVL++   I  + L ++     + W +G E+L++ G +E  ER ++++ F +    SK
Sbjct  925   KEKVLVYSQYIDTLKLIMDQLSAEFSWTEGEEILLMHGKVEQRERQQLINNFNKQDSKSK  984

Query  749   VMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTL  570
             V+LAS   C+EGISL  ASRV+ LD  WNPS   QAI+RA+R GQ + V+VY L+   T 
Sbjct  985   VLLASTKACSEGISLVGASRVVFLDVVWNPSVESQAISRAYRIGQKRAVFVYHLMVKDTS  1044

Query  569   EEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMKNE  393
             E +KY + + K  +S ++FS    +D         ED +L E+V  ++   +F  I+ N 
Sbjct  1045  EWDKYCKQSEKYRISELVFSSTNEKDKPINNEAVSEDRILDEMVRLNKLKDIFEKILYNP  1104

Query  392   KASNM  378
             K S+M
Sbjct  1105  KESDM  1109



>ref|XP_010513389.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Camelina 
sativa]
Length=1091

 Score =   327 bits (839),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 357/725 (49%), Gaps = 65/725 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCR  2352
             D LW++M +AL             + S+T      K G  +C    HDF L EEIGL+CR
Sbjct  417   DSLWEDMAVALTL---------EGMDSST----PAKVGDMLCSKERHDFVLEEEIGLICR  463

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDA-DLDHFAIPVSSNKPSS  2175
              C  V+ EIKD+ P       + S  ++        EK+GD   +   F     S+ P+S
Sbjct  464   HCSHVAVEIKDISPAMDKYRANISDNKK------CSEKKGDPLFNRLEFDASDHSSYPAS  517

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES-KKRGGCVISHSP  1998
                 E   W  +P +R+ L  HQ+  FEF+WKN+AG+    + +    K  GGC+ISH  
Sbjct  518   LDNTEGTVWQYVPGIRDTLYPHQQEGFEFIWKNLAGTTKLDEFNSVGVKGSGGCIISHKA  577

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             G GKT L I FL SYL+ FP S P+V+AP T + TW +E  KW   IP + ++  Q    
Sbjct  578   GTGKTRLTIVFLQSYLERFPDSHPVVIAPATLMRTWEEECRKWNADIPFFNMNSRQFSGY  637

Query  1817  EVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRK  1638
             E      +L      N +  H    + K+  W    S+L + Y  +  L   D      +
Sbjct  638   EDASAVARL------NGNRQHNSVRMVKLYSWWNKKSILGVSYPLYEKLA-ADKNAGEMQ  690

Query  1637  YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLC  1458
                ++L + PG+L+LDEGH PR+  S + K L +V T  RI+LSGTLFQNNF E  N LC
Sbjct  691   VFRRMLLELPGLLVLDEGHTPRNQNSLIWKVLTEVRTEKRIILSGTLFQNNFKELSNVLC  750

Query  1457  LARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLN  1278
             LARP   D +   L    K+  +G   R + E                         G+ 
Sbjct  751   LARPALKDTLSSMLQELSKRSQEGEHGRVNEE------------------------IGIV  786

Query  1277  ILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
              LK     F+ V+EG    ++LPGL+   +++     Q++IL ++   +  +     E E
Sbjct  787   DLKVKIAPFVHVHEGNILEESLPGLKDCVVVLNPPFQQKKILDRIDTSQNTF-----EFE  841

Query  1100  LLITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
               ++  ++HP L      T           L  L++ + D K G K KF+++ I      
Sbjct  842   HKLSAVSVHPSLYLCCNPTKKEDLVIGPATLGTLKRLRLDYKEGVKTKFLINFIRITEKV  901

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSK  750
             KEKVL++   I  + L +E     + W +G E+L++ G +E  ER ++++ F +    SK
Sbjct  902   KEKVLVYSQYIDTLKLIMEQLSAEFSWTEGEEILLMHGKVEQRERQQLINNFNKQDSKSK  961

Query  749   VMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTL  570
             V+LAS   C+EGISL  ASRV+ LD  WNPS   QAI+RA+R GQ + V+VY L+   T 
Sbjct  962   VLLASTKACSEGISLVGASRVVFLDVVWNPSVESQAISRAYRIGQKRAVFVYHLMVKDTS  1021

Query  569   EEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR-ATLFHMIMKNE  393
             E +KY + + K  +S ++FS    +D         ED +L E+V  ++   +F  I+ N 
Sbjct  1022  EWDKYCKQSEKYRISELVFSSTNEKDKPINNEAVSEDRILDEMVRLNKLKDIFEKILYNP  1081

Query  392   KASNM  378
             K S+M
Sbjct  1082  KESDM  1086



>gb|KEH22460.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1276

 Score =   329 bits (843),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 235/725 (32%), Positives = 366/725 (50%), Gaps = 71/725 (10%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             LW E++ +L     +  ++  N ++           +  C HD  L+E+IG+ C+LCGVV
Sbjct  574   LWDELDTSLREEDAV--SKIGNFRTNEATQETNGNPSSRCEHDTLLDEQIGIYCKLCGVV  631

Query  2336  STEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSS-NKPSSEVEVE  2160
              TEIKD+    +    S+ G  +R    V  +   + +  D     VS  +   +    E
Sbjct  632   ITEIKDISQ-LVYERASNEGSGRR----VSFDDSVNPSLFDGSQFNVSDGDSDDNYFHKE  686

Query  2159  DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR-GGCVISHSPGAGKT  1983
                W LIP ++ KL  HQ+  FEF+WKN+AG+    ++      R GGC+ISH+PG GKT
Sbjct  687   GTVWDLIPGVKQKLYPHQQEGFEFIWKNLAGNTNLRKLKKAVPCREGGCIISHAPGTGKT  746

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQ  1803
              L + FL++YLK+FP   P+++AP + L+TW +E  KW IP   +         G+V   
Sbjct  747   RLTVVFLMAYLKVFPKCLPVIVAPASLLHTWEEEFKKWDIP---FHNLNNPELSGKVHDD  803

Query  1802  KMKLCPGLPRNQDVMHVLDCLE--KMQKWLAHPSVLLMGYTSFLTLT-------------  1668
              + L        +  H +D +   K+  W    S+L + Y+ ++ L              
Sbjct  804   VVNLLNW----SNSQHSMDTMRMVKLISWYKEKSILGISYSLYMKLAGGGGESDDERGED  859

Query  1667  ---REDSTYAHRK-YMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGT  1500
                ++ S+ A RK  M  VLRQ PG+L+LDEGH PR+ KS + + L +V T  RI+LSGT
Sbjct  860   EKKKKQSSVAKRKEIMGNVLRQIPGLLVLDEGHTPRNKKSGIWQVLSEVQTRKRIILSGT  919

Query  1499  LFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskk  1320
              FQNNF E +NTL L +P F + +  EL                      KMF  K   K
Sbjct  920   PFQNNFMELYNTLSLVKPSFPNTMPHEL----------------------KMFCQKKDHK  957

Query  1319  idssk---ererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILV  1152
               S +   E   +E +  LK L   F+ V++G      LPGL+   L +   +  ++IL 
Sbjct  958   KASKEWIWEPVPEEKIKQLKLLMDPFVHVHKGAILQKMLPGLRKCVLRLMPDSFHKKILE  1017

Query  1151  KLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSK  972
              +Q  +       L  +   T  ++HP L+       +     + + LEK + +   G K
Sbjct  1018  GIQSSKNT-----LSFDFKETRASVHPSLLLERDLLEEEESVLDKDRLEKLRLNPYAGVK  1072

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLE-IFERFYGWRKGIEVLVLQGDIELFER  795
              KF++  +  C    EKVL+F   ++P+ L +E +      W    EVL + G+++  +R
Sbjct  1073  TKFLVEFVRLCAALNEKVLVFSQFLSPLRLIIEQLLNSSLKWTMEKEVLFIYGEVK--DR  1130

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
               ++D F +    +K++LA+  TC+EGISL  ASRV+LLD  WNPS  KQAI+RA+R GQ
Sbjct  1131  KSLIDTFNDENSQAKILLATTKTCSEGISLVGASRVVLLDVVWNPSVEKQAISRAYRIGQ  1190

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQ--APKIEDELLGEI  441
              KVVY Y LL  GT E +K+++   K+ +S ++FS    ++    +  A  IED +L E+
Sbjct  1191  KKVVYTYHLLTEGTRECDKFRKQAKKDRLSELVFSAKNDDNNEELRSCAANIEDRILDEM  1250

Query  440   VEEDR  426
             +  ++
Sbjct  1251  IRHEK  1255



>ref|XP_008678890.1| PREDICTED: uncharacterized protein LOC103653855 isoform X2 [Zea 
mays]
Length=1378

 Score =   330 bits (845),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 215/687 (31%), Positives = 354/687 (52%), Gaps = 56/687 (8%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             LW E  +A  S  +  +  + + K    + + +     +  H+F ++E+IG+ C+ C VV
Sbjct  660   LWMECGIAFQSMNIGSNGCEEDGKEIPPVKVTS---CNIGQHEFIIDEQIGVRCKHCHVV  716

Query  2336  STEIKDVPPPFMPSTCSSS-GKEQRPE------EVVMEEKQGDDADLDHFAIPVSSNKPS  2178
               EI+DV P      CS+  G    PE      E++   +Q D    +   +P +     
Sbjct  717   DLEIRDVLPTL--GKCSAERGSAINPEFDRMLKEMLNVFEQNDVLVSNGHELPCNFGDHK  774

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRGGCVISH  2004
             +      + W LIP ++  +  HQ+ AFEF+W  +AG     Q+    +S   GGCVISH
Sbjct  775   A-----GSVWNLIPGVKETMFPHQQDAFEFMWTKLAGGTTIEQLKHTIKSDAGGGCVISH  829

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ-T  1827
             +PG GKT L I F+ SYL++FP   P+++AP+  L TW KE  KWK+ +P + ++  +  
Sbjct  830   APGTGKTRLAITFVQSYLEVFPHCSPVIIAPRGMLATWEKEFRKWKVKLPFHVLNSTEIN  889

Query  1826  YKGEVLRQKMKLCPGLPRNQDVMHVLDC----LEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
             +  +   Q+     G    + +   +D     L K+  W+   S++ + Y+ F  L   +
Sbjct  890   WSEDKTLQEQAAKNGTFHRRLLTDKMDQNYRRLVKLGSWMNGTSIIGLSYSLFRKLANHE  949

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
                  +  + ++L + P +L+LDEGH PR+ KS + K L +V+T  RI+LSGTLFQNNF 
Sbjct  950   GMDGDK--VRKLLLEKPNLLVLDEGHTPRNKKSLIWKVLKRVHTEKRIILSGTLFQNNFE  1007

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             E +NTL L RP+  D +  E D       K   +   L +  +                 
Sbjct  1008  ELYNTLRLVRPKDADALHLETDES-----KDFWSSLRLNDITK-----------------  1045

Query  1298  erkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
                  +N ++K     + ++ G     +LPGL+   +++     Q+E++  +  ++ +  
Sbjct  1046  ---ANINEVRKKLDPIVHIHSGRFLQKSLPGLRESVVILNPLLYQKEVIASM--EKTVAM  1100

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
             G  L+ E  I+L +IHP L+ +   S +     +   LE  + +   G K +FV+ ++  
Sbjct  1101  G--LDAEYKISLASIHPSLLASAKLSMKEESILDKPKLESLRSNPSGGVKTRFVLEIVRL  1158

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
             C    E+VL+F   + P++L +E  +  + W +G E+L++ G + + +R  +M+ F  + 
Sbjct  1159  CEALNERVLVFSQYLEPLSLIMEQLKERFSWAEGEEILLMSGKVLVKKRQTMMEVFNNMK  1218

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ K+VY Y L+A
Sbjct  1219  SKAKVMLASTKACCEGITLVGASRVVLLDVVWNPSVGRQAIGRAYRIGQRKIVYTYNLIA  1278

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDL  501
              GT E+ KY R   KE +S ++FS +L
Sbjct  1279  EGTTEKRKYDRQAKKEHMSKLLFSNEL  1305



>ref|XP_008678889.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like isoform 
X1 [Zea mays]
Length=1360

 Score =   329 bits (844),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 215/687 (31%), Positives = 354/687 (52%), Gaps = 56/687 (8%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             LW E  +A  S  +  +  + + K    + + +     +  H+F ++E+IG+ C+ C VV
Sbjct  660   LWMECGIAFQSMNIGSNGCEEDGKEIPPVKVTS---CNIGQHEFIIDEQIGVRCKHCHVV  716

Query  2336  STEIKDVPPPFMPSTCSSS-GKEQRPE------EVVMEEKQGDDADLDHFAIPVSSNKPS  2178
               EI+DV P      CS+  G    PE      E++   +Q D    +   +P +     
Sbjct  717   DLEIRDVLPTL--GKCSAERGSAINPEFDRMLKEMLNVFEQNDVLVSNGHELPCNFGDHK  774

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRGGCVISH  2004
             +      + W LIP ++  +  HQ+ AFEF+W  +AG     Q+    +S   GGCVISH
Sbjct  775   A-----GSVWNLIPGVKETMFPHQQDAFEFMWTKLAGGTTIEQLKHTIKSDAGGGCVISH  829

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ-T  1827
             +PG GKT L I F+ SYL++FP   P+++AP+  L TW KE  KWK+ +P + ++  +  
Sbjct  830   APGTGKTRLAITFVQSYLEVFPHCSPVIIAPRGMLATWEKEFRKWKVKLPFHVLNSTEIN  889

Query  1826  YKGEVLRQKMKLCPGLPRNQDVMHVLDC----LEKMQKWLAHPSVLLMGYTSFLTLTRED  1659
             +  +   Q+     G    + +   +D     L K+  W+   S++ + Y+ F  L   +
Sbjct  890   WSEDKTLQEQAAKNGTFHRRLLTDKMDQNYRRLVKLGSWMNGTSIIGLSYSLFRKLANHE  949

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
                  +  + ++L + P +L+LDEGH PR+ KS + K L +V+T  RI+LSGTLFQNNF 
Sbjct  950   GMDGDK--VRKLLLEKPNLLVLDEGHTPRNKKSLIWKVLKRVHTEKRIILSGTLFQNNFE  1007

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             E +NTL L RP+  D +  E D       K   +   L +  +                 
Sbjct  1008  ELYNTLRLVRPKDADALHLETDES-----KDFWSSLRLNDITK-----------------  1045

Query  1298  erkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
                  +N ++K     + ++ G     +LPGL+   +++     Q+E++  +  ++ +  
Sbjct  1046  ---ANINEVRKKLDPIVHIHSGRFLQKSLPGLRESVVILNPLLYQKEVIASM--EKTVAM  1100

Query  1121  GFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPR  942
             G  L+ E  I+L +IHP L+ +   S +     +   LE  + +   G K +FV+ ++  
Sbjct  1101  G--LDAEYKISLASIHPSLLASAKLSMKEESILDKPKLESLRSNPSGGVKTRFVLEIVRL  1158

Query  941   CLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVG  762
             C    E+VL+F   + P++L +E  +  + W +G E+L++ G + + +R  +M+ F  + 
Sbjct  1159  CEALNERVLVFSQYLEPLSLIMEQLKERFSWAEGEEILLMSGKVLVKKRQTMMEVFNNMK  1218

Query  761   GPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLA  582
               +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ K+VY Y L+A
Sbjct  1219  SKAKVMLASTKACCEGITLVGASRVVLLDVVWNPSVGRQAIGRAYRIGQRKIVYTYNLIA  1278

Query  581   TGTLEEEKYKRTTWKEWVSSMIFSEDL  501
              GT E+ KY R   KE +S ++FS +L
Sbjct  1279  EGTTEKRKYDRQAKKEHMSKLLFSNEL  1305



>gb|EMS57735.1| DNA repair and recombination protein RAD54-like protein [Triticum 
urartu]
Length=847

 Score =   320 bits (819),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 219/697 (31%), Positives = 351/697 (50%), Gaps = 53/697 (8%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSAT-------ELHMATKKGTRVCH---HDFRLNE  2373
             D LW + +LAL       + E   + S T       + H     G   C    HD   ++
Sbjct  141   DDLWAQRDLALDL-----EAESNKVSSHTCHKDAESDEHEIPAHGGTFCKRGKHDLFHDD  195

Query  2372  EIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGD---DADLDHFAI  2202
             +IG+ CR C  +  EI+ V P        S  KE    E   E  + D   D  L     
Sbjct  196   QIGIRCRKCDYIEIEIRHVFP--------SMAKESTDREPAAEHDRLDMFVDDILKSVGY  247

Query  2201  PVSSNKP--SSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI--DPES  2034
               +SN    S +  V    W LIP +R  +  HQR  FEF+W+ +AG I   Q+     +
Sbjct  248   EGASNVALGSDKTGV---VWDLIPGVREDMFPHQREGFEFMWRKLAGGIDIEQLRHTMNT  304

Query  2033  KKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIP  1854
                 GCVISH+PG GKT L I F+ SYL+LFP  RP+++AP+  L T  +E  KW + +P
Sbjct  305   DTTSGCVISHAPGTGKTRLAITFVQSYLELFPHCRPVIIAPRGMLATLEQEFSKWNVKLP  364

Query  1853  VYQIHGGQTY--KGEVLRQKMKLCPGLPRN---QDVMHVLDCLEKMQKWLAHPSVLLMGY  1689
              + +   +    + + +++ +    GL +    + +      + K+  W    S++ + Y
Sbjct  365   FHVLSSSEIQWDQDKTIQKLVSKDHGLGQKLAMKKLSQKSKMMLKLASWYEGSSIIGLSY  424

Query  1688  TSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILL  1509
             + +  L + +      +    +L + PG+L+LDEGH PR+ KS + K L +V+T  RI+L
Sbjct  425   SLYRNLAKGEGKDG--EMQRNLLLEKPGLLVLDEGHTPRNKKSLIWKVLAEVSTEKRIIL  482

Query  1508  SGTLFQNNFGEYFNTLCLARPRFV-DEVLKELDPKYKKRVKGAKTRFSLENRARKMFidk  1332
             SGT FQNNF E +N LCL +P+F  D     L  K       ++    +E    K F   
Sbjct  483   SGTPFQNNFLELYNILCLVKPKFAKDFACTRLSKKGVASTSQSRAAPYVEEDEGKEFWSS  542

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL  1155
             +     + +       L  +++    F+ ++ G     +LPGL+   +++     Q+EI+
Sbjct  543   LRISNITDEH------LTEIREKLGPFVHIHNGDILQKSLPGLRESVVILNPLPRQKEII  596

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGS  975
               +++     KGF L+ E  I+L +IHP+L+ +T  S    +   ++ ++  + +   G 
Sbjct  597   AMMEESAG--KGF-LDAEYKISLASIHPFLVTSTKLSD--TEASVVDKMKSVRLNPCEGV  651

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             K  FV  +I  C   KE+VL+F   + P+ L ++       W +G E+L++ G++ + +R
Sbjct  652   KTWFVFEIIRLCEALKERVLVFSQYLEPLALIMDQLTTELDWTEGKEILLMSGNVRVKQR  711

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
               +M+ F ++   +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ
Sbjct  712   EALMEAFNDMNSEAKVMLASTKACCEGITLVGASRVVLLDVVWNPSVGRQAIGRAYRIGQ  771

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSED  504
             +K+VY Y L+A GT E+ KY R   K+  S ++FS +
Sbjct  772   EKIVYTYNLIAEGTKEKVKYDRQATKDHTSKLLFSNE  808



>ref|XP_004516267.1| PREDICTED: transcriptional regulator ATRX-like [Cicer arietinum]
Length=1224

 Score =   326 bits (835),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 228/683 (33%), Positives = 345/683 (51%), Gaps = 67/683 (10%)
 Frame = -3

Query  2399  CHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFM---PSTC----SSSGKEQRPEEVVMEE  2241
             C HD RL E+IG  C+LCG V TE+K + PP +   P+      +S G E  P   V + 
Sbjct  559   CKHDIRLEEDIGEYCKLCGWVVTEMKYISPPVIDRYPNEGYEKRASYGGENVP---VFDG  615

Query  2240  KQ----GDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNI  2073
              Q    GDD++  HF++    NK +         W LIP+ +  L  HQ+  FEF+WKN+
Sbjct  616   SQFNVYGDDSNT-HFSL----NKGT--------VWDLIPEEKQSLYPHQQEGFEFIWKNL  662

Query  2072  AGSI-IPTQIDPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLY  1896
             AGSI +   ++   +  GGC+ISH+PG GKT L I FL++YL++FP  RP+++AP + L 
Sbjct  663   AGSIDLRKLMNAGPRSEGGCIISHAPGTGKTRLTIVFLMAYLQVFPKCRPVIVAPASLLL  722

Query  1895  TWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLA  1716
             TW  E  KW   I  + ++  +    E         PG     DV+ ++    KM  W  
Sbjct  723   TWEDEFKKWGKGITFHNLNNPELSGKEHDDAVDLYNPG--NTVDVIRMV----KMISWFK  776

Query  1715  HPSVLLMGYTSFLTLTREDSTYAHRKY------MNQVLRQCPGILILDEGHNPRSTKSRL  1554
               S++ + Y  +  L     T   RK       M + L + PG+L+LDEGH PR+ +S +
Sbjct  777   EKSIIGISYNLYEILAGGGETKDRRKRKREHDDMKKYLVEVPGLLVLDEGHTPRNQRSGI  836

Query  1553  RKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKY--KKRVKGAK  1380
              K   ++ T  RI+LSGT FQNN  E +NTL LA+P F + +  +L  K+  K+  K A 
Sbjct  837   WKVFSEMQTPKRIILSGTPFQNNLTELYNTLSLAKPSFPNMLSPQL-KKFCLKQEHKAAS  895

Query  1379  TRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQ  1203
                S E    K        K            L  LK +T  F+ V++G      LPGL+
Sbjct  896   KELSWEPVYSKTTGSPSDDK------------LKQLKLITDSFVHVHKGSILQKKLPGLR  943

Query  1202  CYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkee  1023
                  +K  + Q++I+    D   I +  P + E  + L +IHP L     CS     +E
Sbjct  944   DCVQFLKPDSFQKQII----DNICIPQN-PFKFERKMALASIHPSLF--LECSHILESKE  996

Query  1022  elealekfkfdlkL---GSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYG  852
                  E+ +        G K +F++  +  C    EKVL+F   +  +NL ++     + 
Sbjct  997   SFIDKERLENLRLNPYGGVKTRFLVEFVRLCDAVNEKVLVFSQYLDTLNLIIDQLNSVFN  1056

Query  851   WRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDS  672
             W  G EVL + G  +  ++  ++  F +    +K++LAS   C+EGISL  ASRV+LLD 
Sbjct  1057  WSLGKEVLFMSGKDDKKDKQYLIHSFNDPSCQAKILLASTKACSEGISLVGASRVVLLDV  1116

Query  671   EWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIF-SEDLVE  495
              WNPS  +QAI+RA+R GQ +VVY Y L+  GT E +KY +   K+ +S  +F + +   
Sbjct  1117  VWNPSVERQAISRAYRLGQKRVVYTYHLITEGTSEWDKYCKQAKKDRLSEQVFAARNADN  1176

Query  494   DPSHWQAPKIEDELLGEIVEEDR  426
             D S   A   ED++L ++   ++
Sbjct  1177  DKSKSSAADFEDKVLDQMTRHEK  1199



>ref|XP_004301720.1| PREDICTED: uncharacterized protein LOC101294670 [Fragaria vesca 
subsp. vesca]
Length=1071

 Score =   323 bits (827),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 241/730 (33%), Positives = 365/730 (50%), Gaps = 62/730 (8%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL--LDDTE---DTNLKSATEL--HMATKKGTRVCHHDFRLNEEIG  2364
             D L++EME A+ S  +   D +E   + ++  A E+  HM   +G     H   L+EEIG
Sbjct  371   DRLFEEMEFAIRSAQIGSTDCSEVGTNDSVPPAKEVTQHMLCSQG----EHYLILDEEIG  426

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADL-DHFAIPVSSN  2187
             ++C+ C  V  EIK + P F P+    SGK    E         D+  L D      S +
Sbjct  427   MICKYCPHVHQEIKYIVPEFAPNPYGRSGKRFYEE---------DNWSLPDELQCHESGS  477

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CV  2013
                S   V+   W LIP +++ +  HQ   FEF+W +IAG I   ++   S   GG  C+
Sbjct  478   VFPSSAHVDGTVWDLIPGVKSSMYPHQCEGFEFIWSHIAGGIHLEKLQKTSSADGGGGCI  537

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGG  1833
             ISH+PG GKT L I FL +Y++  P  RPL++AP+T L TW +E  KW   +P + ++  
Sbjct  538   ISHAPGTGKTRLTIVFLQAYMRFNPKCRPLIIAPRTMLLTWEEEFKKWGFDVPFHNLNN-  596

Query  1832  QTYKGEVLRQKMKLCPGLPRNQDVMHV--LDCLE--KMQKWLAHPSVLLMGYTSFLTLTR  1665
             Q+  G+  +  + +   L +     HV  +D     K+  W    S+L + Y  F  L+ 
Sbjct  597   QSLSGKENKAALAI---LVQGGGQRHVKSVDGSRWLKLYSWNKERSILGISYRLFEKLST  653

Query  1664  EDSTYAHR----KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTL  1497
               ++   +    K M  +L   PGI++ DEGH PR+ KS + KA   + T  RI+LSGT 
Sbjct  654   AHNSGGKKADLAKKMRNILLDFPGIVVFDEGHTPRNDKSHMWKASSNIKTHRRIILSGTP  713

Query  1496  FQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskki  1317
             FQNNF E +NT+ LARP   D ++     +  KR      +  L N   K          
Sbjct  714   FQNNFDELYNTIGLARP---DWIMPTCSGRSLKRNVVKAQQMPLANDIAK--------GD  762

Query  1316  dsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQD  1140
                 +  +K G  I        + VY G    D LPGL+   ++++ + LQ+EI  ++Q+
Sbjct  763   GDKAKEAKKIGARIAP-----IVHVYRGSILRDTLPGLRNSVVVLQPSKLQKEISARIQE  817

Query  1139  QR--PIYKGFPLELELLITLGAIHP-WLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             +   P +K    E     TL ++HP  L+       +   + +LE L++ K   + G K 
Sbjct  818   KNDLPFFKDEHYE-----TLISVHPSALLNLEKEMRESLNQVDLERLKEKKSTPESGMKA  872

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             KFV+ LI       E+VL+F   I  +    E+ +  + W +G EVL + G  +  +R  
Sbjct  873   KFVIELIRLSDAMNERVLVFSQYINALTFLKELLKSQFQWTEGDEVLYMYGADDEKQRQS  932

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
              +  F +    +KV+LAS   C EGI+L  ASRV+LLD  WNPS  +QAI+RA+R GQ K
Sbjct  933   SVKAFNDPSSKAKVLLASTRGCNEGINLVGASRVVLLDVTWNPSVERQAISRAYRLGQKK  992

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEED  429
             +V++Y LL  G  EE K+ R   K  +S ++FS   +E      A   ED++L E+V+  
Sbjct  993   IVFIYHLLMAGAREEGKHSRQVEKHRLSELVFSCSDMEAAKKIPAVVAEDKILEEMVQHQ  1052

Query  428   RATLFHMIMK  399
             +  L HM  K
Sbjct  1053  K--LKHMFEK  1060



>ref|XP_006296863.1| hypothetical protein CARUB_v10012851mg [Capsella rubella]
 gb|EOA29761.1| hypothetical protein CARUB_v10012851mg [Capsella rubella]
Length=1135

 Score =   323 bits (829),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 247/771 (32%), Positives = 371/771 (48%), Gaps = 85/771 (11%)
 Frame = -3

Query  2648  ETLNKEQPPIIDQWKEFQNTKSCQREPIeksstnneeelseLDMLWKEMELALASCYLLD  2469
             + L KE PP+        N +    EP+    T  E+EL   D LW++M LAL       
Sbjct  431   DCLTKESPPV--------NLRFGCEEPVLIEKTEEEKEL---DSLWEDMTLAL-------  472

Query  2468  DTEDTNLKSATELHMAT--KKGTRVCH---HDFRLNEEIGLVCRLCGVVSTEIKDVPPP-  2307
                     +   +H +T  K G  +C    HDF L+EEIGL C  C  V+ EIKD+ P  
Sbjct  473   --------TLEGMHSSTPAKNGDMLCSKETHDFVLDEEIGLKCCHCSYVAVEIKDISPAM  524

Query  2306  --FMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPD  2133
               + P    ++    +  + +    + D +D   +  P+ +         E   W  +P 
Sbjct  525   EKYRPRVNDNTKCRDKKGDPLPNRLEFDASDPSRYVAPLDN--------TEGTVWQYVPG  576

Query  2132  LRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES-KKRGGCVISHSPGAGKTLLIIAFLVS  1956
             +++ L  HQ+  FEF+W+N+AG+    +++    K+ GGC+ISH  G GKTLL I FL+S
Sbjct  577   IKDTLYPHQQEGFEFIWRNLAGTTKLNELNTVGVKESGGCIISHKAGTGKTLLTIVFLLS  636

Query  1955  YLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLP  1776
             YLK FP S P+V+AP T + TW +E  KW   IP Y ++  Q  K E      +L     
Sbjct  637   YLKRFPDSHPVVIAPATLMRTWEEEFKKWNTNIPFYNMNSLQFSKYEDASAVSRL-----  691

Query  1775  RNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILI  1596
              N +  H    + K+  W    SVL + Y  +  L   +      +   ++L + PG+L+
Sbjct  692   -NGNRQHNSIRMVKLYSWWNQKSVLGVSYPLYEKLA-ANKNAGEMQVFRKMLLELPGLLV  749

Query  1595  LDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKEL  1416
             LDEGH PR+  S + K L +V T  RI+LSGTLFQNNF E  N LCLARP   D +   L
Sbjct  750   LDEGHTPRNQNSLIWKVLTEVRTEKRIILSGTLFQNNFKELSNVLCLARPSLKDTISSRL  809

Query  1415  DPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDVYE  1236
                 K   +G   R + E                         GL   K +   F+  +E
Sbjct  810   QELGKWSQEGEHGRVNEE------------------------IGLVDFKAVIAPFVHFHE  845

Query  1235  GGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWL--  1065
             G    ++LPGL+   +++     Q++IL ++   +  +     E E  ++  ++HP L  
Sbjct  846   GNILQESLPGLRDCVVVLNPPFQQKKILDRIDTFQNTF-----EFEHKLSAVSVHPSLYL  900

Query  1064  -IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPI  888
                 T           L  L++ + D K G K KF++  I      KEKVL++   I  +
Sbjct  901   CCNPTKKEDLVIGPAALGILKRIRLDYKEGVKTKFLIDFIYISQTVKEKVLVYSQYIDTL  960

Query  887   NLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGIS  708
              L +E     +GW +G E+L + G +E  +R  +++ F      SKV+LAS   C+EGIS
Sbjct  961   KLIMEQLSVVFGWTEGKEILFMHGKVEQRDRQHLINNFNNPDSESKVLLASTKACSEGIS  1020

Query  707   LTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWV  528
             L  ASRV+ LD  WNPS   QAI+RA+R GQ + V++Y L+   T E  KY R + K  +
Sbjct  1021  LVGASRVVFLDVVWNPSVESQAISRAYRIGQKRAVFIYHLMVKDTSEWNKYCRQSEKYRI  1080

Query  527   SSMIFSEDLVEDPSHWQAPKIEDELLGEIVE-EDRATLFHMIMKNEKASNM  378
             S ++FS    E+         ED +L E+V+ E    +F  I+   + S+M
Sbjct  1081  SELVFSS-TNENDKPINNKVSEDRILDEMVQLEKLKDIFEKILYYPRESDM  1130



>ref|XP_010319906.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Solanum 
lycopersicum]
Length=1268

 Score =   325 bits (832),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 244/720 (34%), Positives = 372/720 (52%), Gaps = 83/720 (12%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             L+ EM++    C L  D   TN +S + +      G  + +H   L+E+IGL+C++C  V
Sbjct  610   LFVEMDM----CILESDIGFTN-QSVSLMQDGDISGCEMGNHHLVLDEQIGLICKVCSHV  664

Query  2336  STEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVED  2157
               EIK + PPF   T   +G++   E   +        D+D F    SS    S V  E 
Sbjct  665   HLEIKYIFPPFADRTRGRNGRKYCRESPSL-------LDVDDFRFSDSSTVHDSPVYEEG  717

Query  2156  NAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIPTQI-DPESKKRGGCVISHSPGAGKT  1983
               W L+P + +  +  HQR  FEF+WKNIAG II  ++ +P S  +GGC+ISH PG GKT
Sbjct  718   TVWDLVPSNAKATMFPHQRGGFEFMWKNIAGDIILERLREPLSDGKGGCIISHPPGTGKT  777

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE----  1815
              L I FL S+LKLFP  RP+++AP   L  W  E  KW++ IP + ++       E    
Sbjct  778   RLTIVFLQSFLKLFPKCRPVIIAPSNLLLNWETEFHKWEVDIPFHNLNNKDFSFQEDEAT  837

Query  1814  -----VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
                   L Q  +  P L R          + K++ W    SVL + Y  F  LT  D   
Sbjct  838   ASVFHCLSQAGRKNPQLIR----------MVKLRSWAKSKSVLGISYDLFRILTGGDGD-  886

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
              + K + ++L + PG+LIL+EGH  R+ +S + KAL KV T  RILLSGT FQNN  E +
Sbjct  887   GYAKEIREILLKLPGLLILEEGHTARNEQSLVWKALKKVETEKRILLSGTPFQNNIKELY  946

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NTL +  P+F  ++ +          K A    S++  AR                    
Sbjct  947   NTLYVVSPKFASDLEQ----------KWASLSSSIDKNAR--------------------  976

Query  1289  EGLNILKKLTTGFID-VYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
               L  L+ + + F+    E     +LPG++   + +K T LQ+E+L ++    P   G  
Sbjct  977   -ALEELRDIISPFVHRCSENVKKVSLPGIRDTVIHLKPTDLQKELLKRI----PENPGSF  1031

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
              E + L++L ++HP L+   A   ++ +       ++ + D  +G K+KFV+ LI  C  
Sbjct  1032  YE-QNLVSLISVHPSLV---AKRKEFSESVSHLKEQRCRLDPDIGVKMKFVVELIKLCGG  1087

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
              KE+V+IF   + P+NL  E     +GW  G E+L + G +++ +R   ++   +     
Sbjct  1088  PKERVIIFSQLLDPLNLIKEQLNSLFGWTLGREILYMDGKLDVKQRQLSINSLNDPNSDV  1147

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV+LASI  C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ KVV+VY  + +  
Sbjct  1148  KVLLASIKACSEGISLIGASRVVLLDVLWNPSVQQQAISRAYRNGQTKVVHVYNPVIS-K  1206

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVE-DPSHWQAPKI-EDELLGEIVEEDRATLFHMIMK  399
              E +K ++ T K++ S ++ S + V+ DPS    P + ED++L  +V+ +   L H+  K
Sbjct  1207  WEVDKIEQQTRKKYHSDVLLSRNEVKMDPS----PSVSEDDILESMVKHE--GLRHIFEK  1260



>ref|XP_006404471.1| hypothetical protein EUTSA_v10010079mg [Eutrema salsugineum]
 gb|ESQ45924.1| hypothetical protein EUTSA_v10010079mg [Eutrema salsugineum]
Length=1122

 Score =   321 bits (822),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 212/668 (32%), Positives = 335/668 (50%), Gaps = 53/668 (8%)
 Frame = -3

Query  2444  SATELHMATKKGTRVC----HHDFRLNEEIGLVCRLCGVVSTEIKDVPPP-FMPSTCSSS  2280
             S  E  ++T +    C    +H+  L+ EIGL C  CG V  EI+ +    +     S  
Sbjct  429   SEIEKEISTDETPAACCKKGNHELCLDLEIGLKCMHCGFVEREIRSIDASEWGEKNTSGR  488

Query  2279  GKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDNAWALIPDLRNKLRAHQRR  2100
              K  R EE       G    LD F  P  +N     V  E   W  IP +++++  HQ+ 
Sbjct  489   RKVDRSEEDGTSSFIGT---LD-FEAPSKNNSNDGCVSTEGTVWDKIPGIKSQMYPHQQE  544

Query  2099  AFEFLWKNIAGSIIPTQIDP--ESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRP  1926
              FEF+W+N+AG+I+  ++     S + GGC++SH+PG GKT L I FL +YL+ FP  +P
Sbjct  545   GFEFIWRNLAGTIVLNELKKFENSDETGGCIMSHAPGTGKTRLTIIFLQAYLECFPNCKP  604

Query  1925  LVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE---VLRQKMKLCPGLPRNQDVMH  1755
             +++AP + L TW +E  KW I IP + +        E    LR  M+       N ++  
Sbjct  605   VIIAPASLLLTWAEEFKKWNISIPFHNLSSLDFTGKENPAALRLMMQKNSSARSNNEIRM  664

Query  1754  VLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMN---------QVLRQCPGI  1602
             V     K+  W+   S+L + Y  +  L          K M          ++L   PG+
Sbjct  665   V-----KIYSWIKSKSILGISYNLYEKLAGVKDEDKKTKTMRLDKELEDIREILMGMPGM  719

Query  1601  LILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLK  1422
             L+LDE H PR+ +S + K L KV T  RILLSGT FQNNF E  N L LARP++++ +  
Sbjct  720   LVLDEAHTPRNQRSCIWKTLSKVETQKRILLSGTPFQNNFQELCNVLGLARPKYLERLTS  779

Query  1421  ELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGFIDV  1242
              L           K+  ++  R ++   ++I+ +           G+  LK +   F+ V
Sbjct  780   TL----------KKSGMTVTKRGKRALGNEINNR-----------GIEELKTVMLPFVHV  818

Query  1241  YEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWL  1065
             ++G     +LPGL+   +++    LQ+ +L  ++           E E  ++L ++HP L
Sbjct  819   HKGSILQKSLPGLRECVVVLNPPELQKRVLESIEVTHNQKTKNVFETEHKLSLVSVHPSL  878

Query  1064  IRTTACSGQYfkeeelealekfkfdl---kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIA  894
             +     +G+     +   L + K          K +F+M  I  C +  EKVL+F   I 
Sbjct  879   VSCCKLTGKERLTIDEALLAQLKKVRFDPNQSVKTRFLMEFIKLCEVINEKVLVFSQYID  938

Query  893   PINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEG  714
             P+ L ++     + W +G EVL + G +E  +R  ++++F +    +KV+LAS   C+EG
Sbjct  939   PLKLIMKHLVSRFKWIEGEEVLYMHGKLEQKQRQTLINEFNDPKSKAKVLLASTKACSEG  998

Query  713   ISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKE  534
             I+L  ASRVILLD  WNP+  +QAI+RA+R GQ ++VY Y L+A GT E  KY +   K+
Sbjct  999   INLVGASRVILLDVVWNPAVERQAISRAYRIGQKRIVYTYHLVAKGTPEGPKYCKQAQKD  1058

Query  533   WVSSMIFS  510
              +S ++F+
Sbjct  1059  RISELVFA  1066



>ref|XP_010110541.1| hypothetical protein L484_023375 [Morus notabilis]
 gb|EXC26759.1| hypothetical protein L484_023375 [Morus notabilis]
Length=1229

 Score =   322 bits (824),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 237/738 (32%), Positives = 375/738 (51%), Gaps = 62/738 (8%)
 Frame = -3

Query  2522  DMLWKEMELA--------LASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEI  2367
             D LW EM+LA         A+  + D+    +     + ++  +   R   H  +L EEI
Sbjct  512   DELWAEMDLAGTYDGIGFCAANVVEDEDPLPSWTGIDKYNLCNEAPER--KHRPKLEEEI  569

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEV--VMEEKQGDDADLDHFAIPVS  2193
             GL+C  C  V  EIK + P F         +E+ P     + + ++ D +  D      S
Sbjct  570   GLICSYCSKVLVEIKYIVPSF---------EEKNPSGRLDIRDLRKSDCSFFDELGFHDS  620

Query  2192  SNKPSSEVEVEDNA---WALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRG  2022
               +  S   V D A   W LIP +++ +  HQR  FEF+WK+IAG I     +      G
Sbjct  621   DCESHSSNGVCDRAETVWDLIPGVKSSMYPHQREGFEFIWKHIAGGIHLENFESIENYAG  680

Query  2021  G--CVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVY  1848
             G  C+ISH+PG GK+ L I FL +++KL P   PL++AP++ L TW +E  KWK+ IP +
Sbjct  681   GEGCIISHAPGTGKSRLTIVFLQTFMKLHPKCLPLIIAPRSMLLTWEEEFRKWKVDIPFH  740

Query  1847  QIH-----GGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTS  1683
              ++     G +  K   L +K         ++D + ++    K+  W    S+L + YT 
Sbjct  741   NLNIDDLSGKEDKKALALLRKASCM-----DKDAIRIV----KLYSWKKGGSILAISYTL  791

Query  1682  FLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSG  1503
             F  L       A+ KY  ++L + PG+L+LDEGH PR+ +S + +AL  + T  RILLSG
Sbjct  792   FEKLV-SGQNKANDKYFRKILLELPGLLVLDEGHTPRNNQSLIWQALSNIKTHRRILLSG  850

Query  1502  TLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkisk  1323
             T FQNNF E FNT+C+ +  F + +     P           R S + + RK +      
Sbjct  851   TPFQNNFNELFNTMCIVKKDFSETIGAA--PSV-----SCGIRLSSKEKTRKQW---SDL  900

Query  1322  kidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKL  1146
                  K    +  L  LK +    + ++ G     +LPGL+   +++K   LQ+ +L ++
Sbjct  901   TKSIGKSAGSQMDLTRLKSIIDPLVHIHRGDVLEKSLPGLRESVIVLKPLELQRSLLQEI  960

Query  1145  QDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVK  966
             + +    K      E  ++L ++HP L+  +     +    ++  L++ + +   G K K
Sbjct  961   EAE----KSQQFVFENAVSLTSVHPSLLLESKSEASH---VKINELKRLRSNPDAGVKTK  1013

Query  965   FVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRV  786
             F+M LI       E+VL+F   ++ ++L  E     +GW +  EVL + G  ++ ER   
Sbjct  1014  FLMELIKLSTAMNERVLVFSEYLSSLSLMKEYLIAKFGWTEK-EVLYIDGKCDIKERQCA  1072

Query  785   MDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKV  606
             ++KF ++   +KV+LASI  C EGI+L  ASRV+LLD  WNPS  KQA  RA+R GQ KV
Sbjct  1073  INKFNDMTSEAKVVLASIKACGEGINLVGASRVVLLDVVWNPSLEKQATRRAYRLGQKKV  1132

Query  605   VYVYQLLATGTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSHWQAPKIEDELLGEIVE-E  432
             VYVY L+A+GT+EE+K+ R   K+ +S ++F S D V +     +   ED +L  +V+ E
Sbjct  1133  VYVYYLIASGTMEEDKHSRQAEKKRLSKLVFTSSDSVRNEQKSHSRVTEDTILELMVQHE  1192

Query  431   DRATLFHMIMKNEKASNM  378
                 +F  I   +K SN+
Sbjct  1193  SLKPIFERISFKQKESNL  1210



>ref|XP_010519701.1| PREDICTED: SNF2 domain-containing protein CLASSY 3 [Tarenaya 
hassleriana]
Length=1025

 Score =   318 bits (815),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 234/748 (31%), Positives = 379/748 (51%), Gaps = 75/748 (10%)
 Frame = -3

Query  2516  LWKEMELALASCYL-LDDTEDTNLKSATELH--MATKKGTRVCHHDFRLNEEIGLVCRLC  2346
             L+ E  L L S    +D + D   +SA + H     +KG    +H+  L+ EIGL C  C
Sbjct  309   LFDEFALLLKSGETEIDISSDITKESAVDEHPLARCEKG----NHELELDLEIGLKCIHC  364

Query  2345  GVVSTEIK--DVPP---PFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKP  2181
             G + TEI+  DV         S   S+G  +R ++   E+             PV +   
Sbjct  365   GFIETEIRHMDVSEWRGDIFNSRRRSAGGTEREDKTFFEK----------LGFPVLTKNS  414

Query  2180  SSEV--EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESK---KRGGC  2016
             S+E   E +   W +IP  +++L  HQ+  FEF+W+NIAG+I   ++D   K   +  GC
Sbjct  415   STECGGESDGTVWDVIPGTKSQLYPHQQEGFEFIWRNIAGTIHRDKLDDYEKSDDENRGC  474

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             +ISH+PG GKT L I FL SY++L    RP+++AP + L TW +E  KW + +P + ++ 
Sbjct  475   IISHAPGTGKTRLTIVFLQSYMELHNNCRPMIIAPASLLLTWEEEFKKWNMDVPFHNLNN  534

Query  1835  GQTYKGEVLRQKM----KLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT  1668
                + G      M    K   G   + DV  V     K+  W    S+L + Y  F  L 
Sbjct  535   -VDFSGNESSVAMDIFEKRGQGSRSHNDVRMV-----KLFSWSTEKSILGISYNLFEKLA  588

Query  1667  REDSTYA------------HRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTS  1524
              +D                 R+ + ++L + PG+L+LDE H PRS +S + K L KV T 
Sbjct  589   GDDVEKRKKKKKSEAILDKEREDIRKILLEIPGLLVLDEAHTPRSQRSCIWKTLTKVTTQ  648

Query  1523  LRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKM  1344
              RILLSGT FQN+F E  N LC+ARP ++         K+   +K +K       R +  
Sbjct  649   KRILLSGTPFQNSFLELCNVLCVARPAYLS--------KFSSMLKKSKMTVLRRRRRKD-  699

Query  1343  FidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQ  1167
                    +  +S      +G++ LK L   F+ V++G     +L GL+   +++    LQ
Sbjct  700   ------GRDSASAVHINNDGIDELKSLMDPFVHVHKGSILQKSLLGLRDCVVVLNPPALQ  753

Query  1166  QEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQ---Yfkeeelealekfk  996
             + IL  + + + ++     E++   ++ +IHP LI     S +      E  L+ L++ +
Sbjct  754   KRILESIPNSKNVF-----EVDHKRSVVSIHPSLISCCTLSKEELLVLDETLLDQLKRSR  808

Query  995   fdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQG  816
              +     K +F+M  I  C    E+VL+F   I P++L +E     + W +G EVL L G
Sbjct  809   LEPNESVKTRFLMEFIGLCNAVNERVLVFSQYIDPLSLIMEQLGCVFNWLEGKEVLYLHG  868

Query  815   DIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIA  636
              +E  +R  +++KF +    ++V+LASI  C+EGI+L  ASRV+LLD  WNP+  +QAI+
Sbjct  869   KLEQNQRQLLINKFNDPKSEARVILASIKACSEGINLVGASRVVLLDVVWNPAVERQAIS  928

Query  635   RAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKI-ED  459
             RA+R GQ +VVY Y L+  G+LE +KY +   K  +S ++FS    +  S   +  + ED
Sbjct  929   RAYRIGQKRVVYTYHLVMKGSLECQKYCQQAEKHRISELMFSSRHEKAKSKSCSEAVLED  988

Query  458   ELLGEIVEEDR-ATLFHMIMKNEKASNM  378
             ++L ++V+  +   +F  ++   K +++
Sbjct  989   KVLDQMVQHAKLGEMFEKLIYQPKEADL  1016



>emb|CDY47279.1| BnaA10g03670D [Brassica napus]
Length=1337

 Score =   320 bits (821),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 219/694 (32%), Positives = 354/694 (51%), Gaps = 61/694 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGT--RVCHHDFRLNEEIGLVCRL  2349
             D +W+E+       Y   +  D  L S  ++      G   R  +H+  L+ EIGL C  
Sbjct  626   DTMWEEVAF-----YTNANEVDLQLHSEAKISADDSPGAACRQGNHELCLDLEIGLKCIH  680

Query  2348  CGVVSTEIKDVP-PPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
             C  V  EI+ +    +     S   K  R EE   EE      +L+  A   ++ K  SE
Sbjct  681   CCFVLREIRGLDVSEWGERNTSGRRKNDRSEE---EENSNFIGNLEFEANSNNNLKEGSE  737

Query  2171  VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRGGCVISHSP  1998
                +   W  IP +++++  HQ+  FEF+W+N+AG+I+  ++     S++ GGC++SH+P
Sbjct  738   -STQGTVWDKIPGVKSQMYPHQQEGFEFIWRNLAGTIMLNELQDFENSEETGGCIMSHAP  796

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG------  1836
             G GKT L I FL SYL+ FP  +P+++AP + L TW +E  KW I IP + +        
Sbjct  797   GTGKTRLTIIFLQSYLECFPNCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLEFTGR  856

Query  1835  GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---R  1665
               +   ++L QK         N ++  V     K+  W+   S+L + Y  +  L     
Sbjct  857   ENSAASKLLMQKNS---SARSNNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGVKD  908

Query  1664  EDSTYAHR-----KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGT  1500
             ED     +     + + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLSGT
Sbjct  909   EDRKTKGKPDKELEDIREILMDVPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLSGT  968

Query  1499  LFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskk  1320
              FQNNF E  N L LARP++++ ++  L           K+  ++  R +K   DKI+ +
Sbjct  969   PFQNNFLELGNVLGLARPKYLERLMSTL----------KKSGMTVTKRGKKALGDKINNR  1018

Query  1319  idsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQ  1143
                        G+  LK +   F+ V++G     +LPGL+   +++    LQ+++L  ++
Sbjct  1019  -----------GIEELKAVMLPFVHVHKGSILQKSLPGLRECVVVLNPPDLQRKVLESIE  1067

Query  1142  DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---kLGSK  972
                        E E  ++L ++HP L+     +G+         L + K          K
Sbjct  1068  VTHNQKTKNVFETEHKLSLVSVHPSLVSHCKLTGKESLTINEALLAQLKKVRLDPNQSVK  1127

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
              +F+M  I  C++ KEKVL+F   I P+ L ++    ++ W +G EVL + G +E  +R 
Sbjct  1128  TRFLMEFIKLCVVIKEKVLVFSQYIDPLKLIMKHLVNWFKWTEGEEVLYMHGKLEQKQRQ  1187

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
              ++++F +    +KV+LAS   C+EGI+L  ASRVILLD  WNP+  +QAI+RA+R GQ 
Sbjct  1188  TLINEFNDPKSKAKVLLASTKACSEGINLVGASRVILLDVVWNPAVERQAISRAYRIGQK  1247

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             ++VY Y L+A GT E  KY +   K+ +S ++F+
Sbjct  1248  RIVYTYHLVAKGTPEGTKYCKQAQKDRISELVFA  1281



>gb|EAY97928.1| hypothetical protein OsI_19844 [Oryza sativa Indica Group]
Length=1367

 Score =   321 bits (822),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 200/565 (35%), Positives = 298/565 (53%), Gaps = 20/565 (4%)
 Frame = -3

Query  2111  HQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGCVISHSPGAGKTLLIIAFLVSYLKLFP  1938
             HQR AFEF+W N+ G I   +I   +K    GGCVI H+PG GKT L I F+ +Y+K+FP
Sbjct  781   HQREAFEFMWTNLVGDIRLNEIKHGAKPDVVGGCVICHAPGTGKTRLAIVFIQTYMKVFP  840

Query  1937  GSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVM  1758
               RP+++AP+  L+ W +E  KW + +P + I     Y G+  R   +L     R + + 
Sbjct  841   DCRPVIIAPRGMLFAWEQEFKKWNVNVP-FHIMNTTDYSGKEDRDICRLIKKEHRTEKLT  899

Query  1757  HVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHN  1578
              ++    K+  W     VL + Y  ++ LT E         +  +L + PG+L+LDEGH 
Sbjct  900   RLV----KLFSWNRGHGVLGISYGLYMKLTSEKVGCTGENKVRTILLENPGLLVLDEGHT  955

Query  1577  PRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKK  1398
             PR+ +S + K L KV T  RI+LSGT FQNNF E +N LCL RPRF +  L       K 
Sbjct  956   PRNERSVIWKTLGKVKTEKRIILSGTPFQNNFLELYNILCLVRPRFGEMFLT------KT  1009

Query  1397  RVKGAKTRFSLENRARKMFidkiskki-dsskererkEGLNILKKLTTGFIDVYEGGSSD  1221
             RV     R  +  + R  F DK  K +  S       +    ++ +   F+ ++ G    
Sbjct  1010  RVG---RRHCVSKKQRDKFSDKYEKGVWASLTSNVTDDNAEKVRSILKPFVHIHNGTILR  1066

Query  1220  NLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSG  1041
              LPGL+   +++K   LQ+ I+ K+++   +  G   E E +I+L + HP L+     + 
Sbjct  1067  TLPGLRECVIVLKPLPLQKSIIRKVEN---VGSGNNFEHEYVISLASTHPSLVNAINMTE  1123

Query  1040  QYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFER  861
             +     +   LE+ + +   G K +FVM ++  C   KEKVLIF   I P+ L  E   +
Sbjct  1124  EEASLIDKPMLERLRSNPYEGVKTRFVMEVVRLCEALKEKVLIFSQFIQPLELIKEHLRK  1183

Query  860   FYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVIL  681
              + WR+G E+L + G I    R   ++ F      ++V+LAS   C EGISLT ASRV+L
Sbjct  1184  IFKWREGKEILQMDGKILPRYRQNSIEVFNNPDSDARVLLASTRACCEGISLTGASRVVL  1243

Query  680   LDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDL  501
             LD  WNP+  +QAI+RAFR GQ K VY Y L+  GT E +KY R   K+ +S ++FS + 
Sbjct  1244  LDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITYGTGEGDKYDRQAEKDHLSKLVFSTED  1303

Query  500   VEDPSHWQAPKIEDELLGEIVEEDR  426
                       K E E   +++ ED+
Sbjct  1304  EFSNVRNMLSKAEMEHCSKLISEDK  1328



>ref|XP_004229291.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Solanum 
lycopersicum]
Length=1058

 Score =   317 bits (812),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 219/688 (32%), Positives = 342/688 (50%), Gaps = 85/688 (12%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             L+ EM++    C L  D   TN  S +          ++ +H   L+E+IGL+C++C  V
Sbjct  387   LFAEMQM----CILESDIGFTN-PSVSATQSGNLNDCQMGNHQLVLDEQIGLICKVCSYV  441

Query  2336  STEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVED  2157
               EIK + P F   T     ++   +  +         D+  F    SS    S +  E 
Sbjct  442   HLEIKYIFPSFAQRTRGRYERKHLGQSPLF-------LDVAGFRFSDSSAVEDSLINEEG  494

Query  2156  NAWALIPD-LRNKLRAHQRRAFEFLWKNIAGSIIPTQI-DPESKKRGGCVISHSPGAGKT  1983
               W L+P   ++ +  HQR  FEF+WKN+AG     ++  P S  +GGC+ISH PG GKT
Sbjct  495   TVWDLVPQRAKSTMYPHQRGGFEFMWKNVAGDTNLERLRQPLSDSKGGCIISHPPGTGKT  554

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQ  1803
              L I FL SYLKLFP SRP+++AP + L  W  E  KW++  P + ++            
Sbjct  555   RLTIVFLQSYLKLFPKSRPVIVAPSSLLLNWEAEFQKWEVDNPFHNLNSKDF--------  606

Query  1802  KMKLCPGLPRNQDVMHVLDCLE-------------KMQKWLAHPSVLLMGYTSFLTLTRE  1662
                    L  ++  + V  CL              K+  W+   SVL + Y  F  LT +
Sbjct  607   ------SLQEDEATVSVFRCLSHAGKRNPHLIRMVKLGSWVKGNSVLGISYDLFRILTAD  660

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             D    + K + ++L + PG+L+L+EGH  R+ +S + KAL KV T  RI+LSGT FQNN 
Sbjct  661   DGD-GYAKPIREILLKYPGLLVLEEGHTARNEQSLVWKALKKVETDKRIVLSGTPFQNNI  719

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              E +NTLC+  P+F      +L+ K+      A    S++  AR                
Sbjct  720   KELYNTLCVVSPKFA----ADLEQKW------ASLSSSIDKNAR----------------  753

Query  1301  rerkEGLNILKKLTTGFID-VYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKL-QDQRPI  1128
                   L  L+ + +  +    E     +LPG++   + +K T LQ+E+L ++ ++    
Sbjct  754   -----ALEELRDIISPLVHKCSENVKKVSLPGIRDTVIHLKPTDLQKELLRRIPENPSSF  808

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
             Y+      + L++L ++HP L+   A   ++   E        + +   G K+KFV+ LI
Sbjct  809   YE------QNLVSLISVHPSLV---ANRKEFSDLESQLKERGCRLNPDTGVKMKFVVELI  859

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
               C  RKE+V+IF   + P+NL  E     + W  G E+L + G +++ +R   ++   +
Sbjct  860   RLCGGRKERVIIFSQLLDPLNLIKEQLNSLFDWTLGREILYMDGKLDVKQRQISINSVND  919

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
                  KV+LASI  C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ K V+VY  
Sbjct  920   PKSDVKVLLASIKACSEGISLIGASRVVLLDVLWNPSVEQQAISRAYRNGQTKFVHVY-C  978

Query  587   LATGTLEEEKYKRTTWKEWVSSMIFSED  504
               T   E +K ++ T K++ S ++ S++
Sbjct  979   PVTSKWEVDKIEQQTRKKYHSDVLLSKN  1006



>ref|XP_004246174.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Solanum 
lycopersicum]
Length=884

 Score =   313 bits (803),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 227/687 (33%), Positives = 338/687 (49%), Gaps = 83/687 (12%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             L+ EM +    C L  +   TN  S + +        ++ +H  +L+E+IGL+C +C  V
Sbjct  212   LFSEMNM----CILESNIGFTN-PSVSVMQSGELSECQMGNHKLKLDEQIGLLCSVCSYV  266

Query  2336  STEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVED  2157
               E+K + P F   T      + R E     E      D+D F +P SS    S V  E 
Sbjct  267   HLEMKYIFPDFARRT------QGRYERKCFGE-SSSILDVDGFKVPDSSAAEESPVFGEG  319

Query  2156  NAWALIPD-LRNKLRAHQRRAFEFLWKNIAGSI-IPTQIDPESKKRGGCVISHSPGAGKT  1983
               W L+P   ++ +  HQR  FEF+W NIAG   I    +P  + +GGC+ISH PG GKT
Sbjct  320   TVWDLVPKGSKDTMYPHQRGGFEFMWNNIAGDTKIERFREPLLESKGGCIISHPPGTGKT  379

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQ  1803
              L I FL SYLKLFP  RP+V+AP   L  W  E  KW + IP + ++            
Sbjct  380   RLAIVFLQSYLKLFPKCRPVVIAPSNLLLNWEAEFQKWAMDIPFHNLNSKNF--------  431

Query  1802  KMKLCPGLPRNQDVMHVLDCLE-------------KMQKWLAHPSVLLMGYTSFLTLTRE  1662
                    L  ++  + V  CL              K++ W    SVL + Y  F  LT E
Sbjct  432   ------SLKEDEGTVGVFHCLSGAAKKNPHLIRMVKLKSWAKSKSVLGISYDLFKILTGE  485

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
             D   ++ K + ++L + P +L+L+EGH  R+  S + KAL KV T  RILLSGT FQNN 
Sbjct  486   DGE-SYNKELREILLKFPSLLVLEEGHTARNEHSLVWKALKKVETEKRILLSGTPFQNNI  544

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              E +NTLC+  P+F      +L+ K+      A    S++  AR                
Sbjct  545   KELYNTLCVVSPKFA----ADLEQKW------ASLSSSIDKNAR----------------  578

Query  1301  rerkEGLNILKKLTTGFID-VYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIY  1125
                   L  L+ + +  +    E      LPG++   + +K T LQ+E+L ++    P  
Sbjct  579   -----ALEELRDILSPLVHKCSENVKKVGLPGIRDTVIHLKPTELQKELLKRV----PEN  629

Query  1124  KGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIP  945
              G   E + L++L ++HP L+   A   ++ + E      + + D  +G K+KFV+ LI 
Sbjct  630   PGSFYE-QNLMSLISVHPSLV---ANRKEFSELESQLKERRCRLDPDIGVKMKFVIELIR  685

Query  944   RCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEV  765
              C   KE+V+IF   + P+NL  E     + W  G E+L + G +++ +R   ++   + 
Sbjct  686   LCGGLKERVIIFSQLLDPLNLIKEQLNSLFSWTLGREILYMDGKLDVNQRQISINSLNDP  745

Query  764   GGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLL  585
                 KV+LAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ K V+VY   
Sbjct  746   KSDVKVLLASTKACSEGISLIGASRVVLLDVLWNPSVEQQAISRAYRTGQKKFVHVY-CP  804

Query  584   ATGTLEEEKYKRTTWKEWVSSMIFSED  504
              T   E +K ++ T K + S +I S +
Sbjct  805   VTSKWEVDKIEQQTRKRYHSDVILSRN  831



>emb|CDP13434.1| unnamed protein product [Coffea canephora]
Length=713

 Score =   309 bits (791),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 228/724 (31%), Positives = 348/724 (48%), Gaps = 78/724 (11%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDD---TEDTNLK--SATELHMATKKGTRVCHHDFRLNEEIGLV  2358
             D L+ EME+    C  L D   TE +N K     EL ++ K       H   L E IG+V
Sbjct  48    DNLFTEMEI----CLTLPDSDFTESSNSKVMCQAELCLSGK-------HQLILEEPIGIV  96

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
             CR C +V  E+KD+ P   P         +R + V +   +       H   P S N  +
Sbjct  97    CRSCQIVHKEMKDIFPTLTP---------RRRDWVDLRRSECFGIHELHLDDPGSGNYYT  147

Query  2177  SEVEVEDNAWALIPD-LRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRG-GCVISH  2004
             S V+ E +   LIPD +R  + +HQ   F FLWKNI G     ++  E    G G +ISH
Sbjct  148   S-VDAEGSVLDLIPDHIRMSMYSHQLDGFVFLWKNIVGETCIEKLKTEIFDDGRGAIISH  206

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKT L I F++S LK++P  RP+++AP + L TW  E  KW   IP +  +  +  
Sbjct  207   APGTGKTCLTIVFILSLLKMYPMCRPVIIAPTSMLLTWENEFRKWGYRIPFHNFNS-KDL  265

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              G  L+   +          +  V   + K+  W    SVL + Y  F  +         
Sbjct  266   SGNELKTDAEF---------LRRVGSRMTKLYSWTKEKSVLGISYKLFEQIASGQKGKGS  316

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
              + + ++  Q PG+++LDEGH PR+ +S + K L  V T  +I+LSGT FQNNF E +NT
Sbjct  317   DEKLKEIFLQLPGLVVLDEGHTPRNQQSLVWKVLTGVKTKRKIILSGTPFQNNFEELYNT  376

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG  1284
             LCL            ++PK    +   K   SL N   K                     
Sbjct  377   LCL------------VNPKLSGSMNSEKRWVSLTNAIDK----------------NSGNA  408

Query  1283  LNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
             +  LK +   F+ V++G    ++LPGL+   ++++ T  Q+ IL  + D    +    L 
Sbjct  409   VEELKAMIDPFVHVHKGSILEESLPGLKDTLVILRPTDEQKGILQLISDDWSRFDQVHL-  467

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
                 ++L ++HP L    A S ++  +++   + +       G K KF + LI  C    
Sbjct  468   ----VSLISVHPSL---AAFSKRFSGDKDRLRVLECSPYA--GVKTKFAIELIRLCDASH  518

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             EKV++F   I P+   ++       WR+GIEVL + G  +   R   +    +  G  KV
Sbjct  519   EKVIVFSEFIHPLRFIMQQLIDQLKWREGIEVLYMDGKRDEKNRQSSISSLNDPSGKVKV  578

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             + AS   C+EGI+L+ ASRV+LLD  WNP+  +QAI+RA+R GQ K VYVY L+ +GTLE
Sbjct  579   LFASTKACSEGINLSGASRVVLLDVVWNPAVERQAISRAYRLGQKKFVYVYHLITSGTLE  638

Query  566   EEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRAT-LFHMIMKNEK  390
              EKY +   K+ +S ++FS    +      +   ED++L  +V+      +F  ++   K
Sbjct  639   VEKYAQQANKDRLSELVFSSRDRQRIKSRISSVFEDKILEGMVDNKMLNDIFKNVIHQPK  698

Query  389   ASNM  378
              SN+
Sbjct  699   ESNV  702



>gb|KEH31042.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1218

 Score =   318 bits (816),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 228/685 (33%), Positives = 334/685 (49%), Gaps = 89/685 (13%)
 Frame = -3

Query  2399  CHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPS-TCSSSGKEQRPEEVVMEEKQGDDA  2223
             C HD  L+EEIGL C+LC  V TEIK + PP +       SGK+   + V +       +
Sbjct  578   CEHDSFLDEEIGLFCKLCHEVVTEIKYISPPVIDRFPGEGSGKKASFDGVNV-------S  630

Query  2222  DLDHFAIPVSSNKPSSEVE-VEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI  2046
              +D   + VS N   +     E   W LIP ++ KL  HQ+  FEF+WKN+AG     ++
Sbjct  631   HVDGSQLNVSDNDSETNFSRNEGTVWDLIPGVKQKLYPHQQEGFEFIWKNMAGHTELQKL  690

Query  2045  ---DPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEII  1875
                DP S+  GGC+ISH+PG GKT L I FL +YLK FP   P+++AP + L TW  E  
Sbjct  691   KNADPSSE--GGCIISHAPGTGKTRLTIVFLKAYLKAFPKCLPIIVAPASILLTWEDEFK  748

Query  1874  KWKIPIPVYQIHG----GQTYKGEVLRQKMKLCPGLPRNQDVMHVLD--CLEKMQKWLAH  1713
             K  I +P + ++     G+ +   V    M          +  H +    + K+  W   
Sbjct  749   KLDIGVPFHNLNNPELSGKEHPDAVETFDM---------SNARHNIHETRMAKLISWFKE  799

Query  1712  PSVLLMGYTSFLTLTREDSTYAHRKY------MNQVLRQCPGILILDEGHNPRSTKSRLR  1551
             PS+L + Y  F    ++   + +         M +VL   PG+L+LDEGH PR+ +S + 
Sbjct  800   PSILGISYNLFGKKCQDKRKHENVNEREGNCDMRKVLLNSPGLLVLDEGHTPRNQRSHIW  859

Query  1550  KALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRF  1371
             K  +K+ T  RI+LSGT FQNNF E ++TL L +P F + +  EL               
Sbjct  860   KVFLKLQTQKRIILSGTPFQNNFWELYSTLSLVKPSFPNTIPPEL---------------  904

Query  1370  SLENRARKMFidkiskkidsskererkEGLNILKKLT--TGFIDVYEGGSSDNLPGLQCY  1197
                    K F               + +GL   KK       ++     S D    ++ +
Sbjct  905   -------KSF--------------CQNQGLKSSKKWNWEPALLNKTRDPSDDQ---IKKF  940

Query  1196  TLMMK----STTLQQEILVKLQ-DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYf  1032
              L+M     + +L  EIL  ++  Q  I+       E  + L ++HP L    A S +  
Sbjct  941   KLLMDPFVHAGSLHNEILKSIKRSQNTIFN-----FERKVALTSVHPSLFLECALSEEEK  995

Query  1031  keeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYG  852
                + + LEKF+ +   G K KF+   +  C    EKVL+F    AP+ L  +     + 
Sbjct  996   SALDKDHLEKFRLNPHEGVKTKFLFEFVRLCDAFHEKVLVFSQFHAPLQLIKDQLNSAFK  1055

Query  851   WRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDS  672
             W +G EVLV+ G+     +  V+  F      +KV+LAS   C+EGISL  ASRV+LLD 
Sbjct  1056  WSEGKEVLVMSGEDPPKVKQSVIHSFNVENCQAKVLLASTKACSEGISLVGASRVVLLDV  1115

Query  671   EWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE-  495
              WNPS  +QAI+RA+R GQ +VVY Y LLA GT EEEKY +   K+ +S ++FS      
Sbjct  1116  VWNPSVERQAISRAYRIGQKRVVYTYHLLAEGTTEEEKYGKQAEKDRLSELVFSAKNAAN  1175

Query  494   --DPSHWQAPKIEDELLGEIVEEDR  426
               D S   A   ED +L E+ + ++
Sbjct  1176  NGDKSKSSAVNFEDRVLDEMTKHEK  1200



>ref|XP_009119150.1| PREDICTED: SNF2 domain-containing protein CLASSY 3 [Brassica 
rapa]
Length=1591

 Score =   321 bits (822),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 220/696 (32%), Positives = 354/696 (51%), Gaps = 63/696 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKK----GTRVCHHDFRLNEEIGLVC  2355
             D +W+E+       Y   +  D  L S  E  ++         R  +H+  L+ EIGL C
Sbjct  878   DTMWEEVAF-----YTNANEVDLQLHSEIEKEISADDSPGAACRQGNHELCLDLEIGLKC  932

Query  2354  RLCGVVSTEIKDVP-PPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
               C  V  EI+ +    +     S   K  R EE   EE      +LD  A   ++ K  
Sbjct  933   IHCCFVLREIRGLDVSEWGERNTSGRRKNDRSEE---EENSNFIGNLDFEANSNNNLKEG  989

Query  2177  SEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRGGCVISH  2004
             SE   +   W  IP +++++  HQ+  FEF+W+N+AG+I+  ++     S++ GGC++SH
Sbjct  990   SE-STQGTVWDKIPGVKSQMYPHQQEGFEFIWRNLAGTIMLNELQDFENSEETGGCIMSH  1048

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG----  1836
             +PG GKT L I FL SYL+ FP  +P+++AP + L TW +E  KW I IP + +      
Sbjct  1049  APGTGKTRLTIIFLQSYLECFPNCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLEFT  1108

Query  1835  --GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT--  1668
                 +   ++L QK         N ++  V     K+  W+   S+L + Y  +  L   
Sbjct  1109  GRENSAASKLLMQKNSSARS---NNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGV  1160

Query  1667  -REDSTYAHR-----KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
               ED     +     + + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLS
Sbjct  1161  KDEDRKTKGKPDKELEDIREILMDVPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLS  1220

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E  N L LARP++++ ++  L           K+  ++  R +K   DKI+
Sbjct  1221  GTPFQNNFLELGNVLGLARPKYLERLMSTL----------KKSGMTVTKRGKKALGDKIN  1270

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVK  1149
              +           G+  LK +   F+ V++G     +LPGL+   +++    LQ+++L  
Sbjct  1271  NR-----------GIEELKAVMLPFVHVHKGSILQKSLPGLRECVVVLNPPNLQRKVLES  1319

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---kLG  978
             ++           E E  ++L ++HP L+     +G+         L + K         
Sbjct  1320  IEVTHNQKTKNVFETEHKLSLVSVHPSLVSHCKLTGKESLTINEALLAQLKKVRLDPNQS  1379

Query  977   SKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFE  798
              K +F+M  I  C++ KEKVL+F   I P+ L ++    ++ W +G EVL + G +E  +
Sbjct  1380  VKTRFLMEFIKLCVVIKEKVLVFSQYIDPLKLIMKHLVNWFKWTEGEEVLYMHGKLEQKQ  1439

Query  797   RGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPG  618
             R  ++++F +    +KV+LAS   C+EGI+L  ASRVILLD  WNP+  +QAI+RA+R G
Sbjct  1440  RQTLINEFNDPKSKAKVLLASTKACSEGINLVGASRVILLDVVWNPAVERQAISRAYRIG  1499

Query  617   QDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             Q ++VY Y L+A GT E  KY +   K+ +S ++F+
Sbjct  1500  QKRIVYTYHLVAKGTPEGTKYCKQAQKDRISELVFA  1535



>ref|XP_010235775.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Brachypodium 
distachyon]
Length=848

 Score =   311 bits (797),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 230/700 (33%), Positives = 338/700 (48%), Gaps = 78/700 (11%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCH--HDFRLNEEIGLVCRL  2349
             D LW EM+  + S  +   + +   KS         K T      HD   +E+IG+ CR 
Sbjct  163   DELWAEMDFCMESTNVCPQSCEEGEKSNNGQEKPGDKATLCSQGKHDLVTDEQIGVWCRR  222

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEE------KQGDDADLDHFAIPVSSN  2187
             C  +  EI+ V       +     +  R  ++ +         +G    +DH A  V   
Sbjct  223   CNFIQLEIRHVVADMGKVSTERELRADRQLDLSINNLLTSMGYEGTCKIVDHKAGSV---  279

Query  2186  KPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGS--IIPTQIDPESKKRGGCV  2013
                         W LIP ++  L  +Q  A EF+WKN+AG   I   + +  S    GC 
Sbjct  280   ------------WDLIPGVKEGLFTYQAAAVEFMWKNLAGGTKIQDVKNNINSDDLRGCW  327

Query  2012  ISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKW--KIPIPVYQI-  1842
             ISH+PG GKT   IAFL SY  LFP S  L++APK  L TW  EI KW  K+PI VY   
Sbjct  328   ISHAPGTGKTRSTIAFLQSYRVLFPRSCVLIIAPKAMLATWQDEIGKWNAKVPIHVYSSC  387

Query  1841  ----HGGQTYK-----GEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGY  1689
                  G +T K      E   Q++ +    P+ + V+       K++ W    SVL M Y
Sbjct  388   DINWGGDETIKRIVDNDEDFAQRLSVNKFGPKVRKVL-------KVRSWCEGSSVLGMSY  440

Query  1688  TSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILL  1509
               F  L +++S   + + M ++L +   +LILDEGH PR+ KS + K L +V T  RI+L
Sbjct  441   EMFSKLAKQNS---NDETMRKLLLEKTDLLILDEGHKPRNKKSIIWKVLAEVRTKKRIIL  497

Query  1508  SGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKY--KKRVKGAKTRFSLENRARKMFid  1335
             SGT FQNNF E +N LCL +         + D K   K   KG  T  S++N   +    
Sbjct  498   SGTPFQNNFEELYNVLCLLQGTC------DADSKLLGKDEDKGFWTSMSVDNITDER---  548

Query  1334  kiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEI  1158
                              +N ++     F+ +Y G     +LPGL+   +++     Q++I
Sbjct  549   -----------------VNEIRDKLKPFLHIYNGEFLQKSLPGLRESVVILNPFPHQKKI  591

Query  1157  LVKLQDQRPIY-KGFPLELELLITLGAIHPWLIRTTA-CSGQYfkeeelealekfkfdlk  984
             +  L+D R        L+ E  I+L ++HP LI +T     Q     +   LE  + +  
Sbjct  592   IKMLEDSRTKSGTNGHLDFEYKISLASVHPSLITSTQKLPYQLTSVMDKPLLESLRLNPC  651

Query  983   LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIEL  804
              G K KFV  ++  C   KE+VL+F   + P++L ++     + W K  E+L + GD + 
Sbjct  652   EGVKTKFVFEIVRLCQPLKERVLVFSQYLQPLDLIMQQLRSEFLWTKDKEILSMSGDDDA  711

Query  803   FERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFR  624
               R ++M+ F  +   +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RAFR
Sbjct  712   ETRQKLMNDFNNMESEAKVMLASTKACGEGITLIGASRVVLLDVVWNPSVGRQAIGRAFR  771

Query  623   PGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSED  504
              GQ K+V+ Y L+A GT E+ KY R   K+ +S ++FS +
Sbjct  772   IGQKKIVHTYNLIAEGTQEKSKYDRQAQKDHMSKLLFSNE  811



>gb|EAZ24021.1| hypothetical protein OsJ_07744 [Oryza sativa Japonica Group]
Length=1360

 Score =   318 bits (815),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 211/684 (31%), Positives = 347/684 (51%), Gaps = 50/684 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRV-CHHDFRLNEEIGLVCRLC  2346
             D LWKE + AL S  +     +   K   +   A K  + +   H+  ++E+IGL C+ C
Sbjct  677   DELWKEFDFALESINVCSHNCEEGEKEDEQEIPADKAASCIQGKHELIIDEQIGLRCKHC  736

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVE  2166
               V  EI+ V P  M  +C+         E  M +    D   D          P     
Sbjct  737   NFVDLEIRFVLPS-MVKSCT---------ERDMRKDHELDLFFDDILTSAGYEGPRDFGG  786

Query  2165  VEDN-AWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK-RGGCVISHSPGA  1992
              +    W L+P +R  +  HQ+  FEF+W+ +AG     Q+   +    GGCVISH+PG 
Sbjct  787   KKTGLVWDLVPGVREDMFPHQQEGFEFMWRKLAGGTSIEQLRNNANTIEGGCVISHAPGT  846

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY--KG  1818
             GKT L I F+ SY   FP   P+++AP+  L TW +E  KWK+ +P + ++  +    + 
Sbjct  847   GKTRLAITFVQSYFAFFPECCPVIIAPRGMLATWEQEFRKWKVKVPFHVLNSKEINWKED  906

Query  1817  EVLRQ----KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
               ++Q       L   L RN+ + H      K+  W    S++ + YT F  L  + S  
Sbjct  907   RTIKQLAIMDENLAQSLARNK-LDHKFRRKLKLASWRKGSSIIGVSYTLFRKLANQSSMD  965

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
              +   +  +L + P +L+LDEGH PR+ KS + K L +V T  RI+LSGT FQN+F E  
Sbjct  966   GN--MVRNLLLEMPDLLVLDEGHTPRNKKSLIWKVLEEVRTKKRIILSGTPFQNSFLELS  1023

Query  1469  NTLCLARPRFVDEVLKELDPKYKK-RVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             N L L RP+F      +    +KK  ++   T  +L N   K                  
Sbjct  1024  NVLYLIRPKFARHFASK---SFKKIGLEDYWTSLTLNNITEKK-----------------  1063

Query  1292  kEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGF  1116
                ++ ++++    + ++ G     +LPGL+   +++     Q+EI+  +++   +  G 
Sbjct  1064  ---IDEIRQILDPIVHIHNGDILQKSLPGLRESVVILNPLPHQKEIITAMENT--VTMG-  1117

Query  1115  PLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCL  936
              L+ E  I+L +IHP+L+     S +     ++  L+  + +  +G K KFV+ ++  C 
Sbjct  1118  TLDAEYKISLASIHPFLVTCAKLSEKETSSVDVSLLKSLRPNPCVGVKTKFVLEIVRLCE  1177

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGP  756
               KE+VL+F   + P++L ++   + + W +G E+L++ G++ +  R  +M+ F ++   
Sbjct  1178  AMKERVLVFSQYLEPLSLIMDQLSKMFNWIEGEEILLMSGNVLVQNREALMEAFNDMKSN  1237

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
             +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ+K+VY Y L+  G
Sbjct  1238  AKVMLASTKACCEGITLIGASRVVLLDVVWNPSVGRQAIGRAYRIGQEKIVYTYNLITEG  1297

Query  575   TLEEEKYKRTTWKEWVSSMIFSED  504
             T E++KY R   K+ +S ++FS++
Sbjct  1298  TKEKDKYDRQAKKDHMSKLLFSKE  1321



>emb|CDY10115.1| BnaC05g03580D [Brassica napus]
Length=1379

 Score =   318 bits (815),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 217/695 (31%), Positives = 354/695 (51%), Gaps = 61/695 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGT--RVCHHDFRLNEEIGLVCRL  2349
             D +W+E+       Y   +  D  L+S  ++      G   R  +H+  L+ EIGL C  
Sbjct  666   DKMWEEVAF-----YTNANEVDLQLQSEAKISADDSPGAACRQGNHELCLDLEIGLKCIH  720

Query  2348  CGVVSTEIKDVP-PPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
             C  V  EI+ +    +     S   K  R EE   EE   +      F    ++N     
Sbjct  721   CCFVLREIRGLDVSEWGERNTSGRRKNDRSEE---EENSNNIIGSLEFEANGNNNNLKEG  777

Query  2171  VE-VEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRGGCVISHS  2001
              E  +   W  IP +++++  HQ+  FEF+W+N+AG+I+  +++    S++ GGC++SH+
Sbjct  778   CESTQGTVWDKIPGVKSQMYPHQQEGFEFIWRNLAGTIMLNELEDFENSEETGGCIMSHA  837

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG-----  1836
             PG GKT L I FL SYL+ FP  +P+++AP + L TW +E  KW I IP + +       
Sbjct  838   PGTGKTRLTIIFLQSYLECFPNCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLEFTG  897

Query  1835  -GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---  1668
                +   ++L QK         N ++  V     K+  W+   S+L + Y  +  L    
Sbjct  898   RENSAASKLLMQKNS---SARSNNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGVK  949

Query  1667  REDSTYAHR-----KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSG  1503
              ED     +     + + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLSG
Sbjct  950   DEDKKTKGKPDKELEDIREILMDVPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLSG  1009

Query  1502  TLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkisk  1323
             T FQNNF E  N L LARP++++ ++  L           K+  ++  R +K   DKI+ 
Sbjct  1010  TPFQNNFLELGNVLGLARPKYLERLMSTL----------KKSGMTVTKRGKKALGDKINN  1059

Query  1322  kidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKL  1146
             +           G+  LK +   F+ V++G     +LPGL+   +++    LQ+++L  +
Sbjct  1060  R-----------GIEELKAVMLPFVHVHKGSILQKSLPGLRECVVVLNPPDLQRKVLESI  1108

Query  1145  QDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---kLGS  975
             +           E E  ++L ++HP L+     +G+     +   L + K          
Sbjct  1109  EVTHNQKTKNVFETEHKLSLVSVHPSLVSHCKLTGKESLTIDEALLAQLKKVRLDPNQSV  1168

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             K +F+M  I  C++ KEKVL+F   I P+ L ++    ++ W +G EVL + G +E  +R
Sbjct  1169  KTRFLMEFIKLCVVIKEKVLVFSQYIDPLKLIMKHLVNWFKWTEGEEVLYMHGKLEQKQR  1228

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
               ++++F +    +KV+LAS   C+EGI+L  ASRVILLD  WNP+  +QAI+RA+R GQ
Sbjct  1229  QTLINEFNDPKSKAKVLLASTKACSEGINLVGASRVILLDVVWNPAVERQAISRAYRIGQ  1288

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
              ++VY Y L+A GT E  KY +   K+ +S ++F+
Sbjct  1289  KRIVYTYHLVAKGTPEGTKYCKQAQKDRISELVFA  1323



>ref|XP_006477564.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Citrus 
sinensis]
Length=935

 Score =   312 bits (799),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 227/712 (32%), Positives = 353/712 (50%), Gaps = 68/712 (10%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTE---DTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLC  2346
             LW EM+ A     L        +    S+ E+  A  +  R   HD  LNEE GL C +C
Sbjct  240   LWAEMDFARKVSELHSTNSPIAENEAASSNEVETAKTRCQR-GDHDLILNEEYGLYCTVC  298

Query  2345  GVVSTEIKDVPPPFM--PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
               + + IKD+ PPF   PS  +   +    +   +++    D+  D      S       
Sbjct  299   SYMKS-IKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFD------SQTGCDPF  351

Query  2171  VEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISHS  2001
                +   W L+P D+R K+  HQR  FEF+WKNIAG I   ++   +   GG  C+ISH+
Sbjct  352   THAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHA  411

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH----GG  1833
             PG GKT L + FL +Y+KL P  RP+++AP++ L TW +E  KW I IP Y ++     G
Sbjct  412   PGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSG  471

Query  1832  QTYKGEVL----RQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTR  1665
             +   G V     R++ +   GL R            K+  W     +L + Y  F  L  
Sbjct  472   KENNGAVALMDNRKRGRGKVGLIR----------YVKLYSWKMGTGILGLSYRLFEKLVS  521

Query  1664  EDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNN  1485
              D        ++ +L   PG+ + DEGH PR+  + + KAL ++ T  RI+LSGT FQNN
Sbjct  522   GDE-------LSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNN  574

Query  1484  FGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssk  1305
             F E  NTL L R  F  EVL+ +  K  + +  AK    + +  R               
Sbjct  575   FQELENTLSLVRQEF-GEVLRTVR-KSGREISKAKHASLISSIGR-------------CA  619

Query  1304  ererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPI  1128
                  E L  LK+    F++V++G    ++LPGL+   ++++    Q+ +   ++     
Sbjct  620   NHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEG----  675

Query  1127  YKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLI  948
              K F +EL   ++L ++HP L+           + +   L + K D + G K +F++ L+
Sbjct  676   VKSF-VELNYCVSLLSVHPSLLPQQFFES---FDVDSAKLARLKLDPEAGIKTRFLLILL  731

Query  947   PRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEE  768
                L   EKVL+F   I P+ L +E     + WR+G EVL + G  ++ +R   ++   +
Sbjct  732   E--LSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLND  789

Query  767   VGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQL  588
                 +++MLAS   C EGI+L  ASRV+LLD  WNP   +QAI+RA+R GQ +VV+VY L
Sbjct  790   PSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHL  849

Query  587   LATGTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSHWQAPKIEDELLGEIVE  435
             + + TLE +K +R   K W S+M+F S D   +     +  +ED++L E+ +
Sbjct  850   ITSETLEWDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQ  901



>ref|XP_009619119.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009619120.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009619121.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009619122.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 isoform X2 
[Nicotiana tomentosiformis]
 ref|XP_009619123.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 isoform X2 
[Nicotiana tomentosiformis]
Length=1155

 Score =   315 bits (806),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 217/677 (32%), Positives = 344/677 (51%), Gaps = 63/677 (9%)
 Frame = -3

Query  2411  GTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQG  2232
             G ++  H   L+E+IGL+C++C  V  E K + P F   T    G+ +R        +  
Sbjct  511   GCQMGSHHLILDEQIGLICKVCSHVHLESKYIYPAFAERT---RGRHER----TYFGESS  563

Query  2231  DDADLDHFAIPVSSNKPSSEVEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIP  2055
                D+D F     S    S + VE   W L+P   +  +  HQR  FEF+WKNIAG I  
Sbjct  564   PFFDVDGFRFDDPSAVHDSAIYVEGTVWDLVPLHAKATMYPHQREGFEFMWKNIAGDIYL  623

Query  2054  TQI-DPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEI  1878
              ++ +P S  RGGC+ISH PG GKT L I FL ++LK FP  RP+++AP   L  W  E 
Sbjct  624   EKLSEPLSASRGGCIISHPPGTGKTRLTIVFLQAFLKQFPKCRPVIIAPPKLLSNWEVEF  683

Query  1877  IKWKIPIPVYQIHGGQ-TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVL  1701
              KW+  IP + ++    + + + +   +  C      ++  H+   + K++ W    SVL
Sbjct  684   QKWEADIPFHNLNNNDFSCQEDEVTVGLYHCLSRAGRKNKHHIR--MVKLKSWAKSKSVL  741

Query  1700  LMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSL  1521
              + Y  F  LT E     + K + ++L   PG+++L+EGH PR+ +S L KA+ KV T  
Sbjct  742   GISYDLFEKLTGEYGD-GYAKEIREILLTLPGLVVLEEGHTPRNEQSLLYKAMTKVETQR  800

Query  1520  RILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMF  1341
             RILLSGT+FQNNF E +NTL +  P+F  E             K A    S++  +R   
Sbjct  801   RILLSGTVFQNNFKELYNTLRVVSPKFAAE----------SEQKWASLSNSIDTNSR---  847

Query  1340  idkiskkidsskererkEGLNILKKLTTGFIDV-YEGGSSDNLPGLQCYTLMMKSTTLQQ  1164
                                L  L+ +    I +  E     +LPG++   + +K T LQ+
Sbjct  848   ------------------ALEELRDMIAPLIHICSENVKMKSLPGIRDTLVYLKPTDLQK  889

Query  1163  EILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlk  984
             ++L  +    P Y G   +   +++L ++HP L+   A    +   E      + + D  
Sbjct  890   KLLNMI----PEYPG-SFDFRNMVSLISVHPSLV---ANKKVFSDLESQLNERECRLDPN  941

Query  983   LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIEL  804
              G K KFV+ LI  C   +E+V++F   + P+ L  E     + W  G E+L + G++++
Sbjct  942   TGVKTKFVVELIRLCDGMRERVIVFSQLLDPLRLIKEQLNSLFHWTLGREILYMDGELDV  1001

Query  803   FERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFR  624
              +R + +    +    +KV+LASIT C+EGI+L  ASRV+LLD  WNPS  +QA++RA+R
Sbjct  1002  KQRQKSISSLNDPKSDAKVLLASITACSEGINLIGASRVVLLDVHWNPSVEQQAVSRAYR  1061

Query  623   PGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE----DPSHWQAPKIEDE  456
              GQ K V+VY  +A+   E  K ++ T K++ S ++ S + V     +PS      +ED 
Sbjct  1062  NGQTKFVHVYCPVAS-KWEVNKIEQQTRKKYHSGVLLSRNEVNTCKTNPS---CSVLEDN  1117

Query  455   LLGEIVEEDRATLFHMI  405
             +L  +V+ +  +L H+ 
Sbjct  1118  ILESMVQNE--SLRHIF  1132



>ref|XP_010532826.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 [Tarenaya 
hassleriana]
Length=1074

 Score =   313 bits (803),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 237/755 (31%), Positives = 372/755 (49%), Gaps = 114/755 (15%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC--------HHDFRLNEEI  2367
             D LWKEM  AL         E T ++SA  +      GT+           H+F ++EE+
Sbjct  344   DALWKEMAFAL---------ESTGIESADPVKNENVSGTQATPSVHCSCGKHEFVIDEEV  394

Query  2366  GLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQG---DDADLDHFAIPV  2196
             GL C  C  V+ EI++V P          G + +      + K G   +  +LD     +
Sbjct  395   GLKCYYCSYVAVEIRNVSPAMEKYRRGGGGVDYKR---YTDRKDGSLFNSLELDDQGDSI  451

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID---------  2043
             S    +S    +   W  IP +R+ L  HQ+  FEF+WKN+ G+     ++         
Sbjct  452   SM---ASLKNTKGTVWDFIPGIRDTLYPHQQEGFEFIWKNLIGTTSQEDLNNWGVSEKNK  508

Query  2042  ------PESKKR--------GGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKT  1905
                   P S+K         GGC+ISHSPG GKT L I FL ++LK FP S P+++AP +
Sbjct  509   CIISHSPGSRKTPLGAVAGCGGCIISHSPGTGKTRLTIVFLQAFLKRFPDSHPVIVAPAS  568

Query  1904  TLYTWYKEIIKWKIPIPVYQIH-----GGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCL  1740
              L TW +E  KW + +P + ++     G ++       +K+    G  R+ D  ++    
Sbjct  569   MLLTWEEEFKKWNVKVPFHNVNSLDFSGKESKWAHTFLEKI----GYHRH-DKNYIRKV-  622

Query  1739  EKMQKWLAHPSVLLMGYTSFLTLTRE--------------DSTYAHRKYMNQVLRQCPGI  1602
              K+  W    S+L + Y  F+ LT +              DS    R  + + L + P +
Sbjct  623   -KLFSWCRRKSILGVSYHLFVKLTGKKCNKKPGKRTGLELDSEMEER--IQKYLLEWPEL  679

Query  1601  LILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEV--  1428
             LILDEGH PR+ KS + KAL  V T  RI+LSGT FQNNF E  N LCL RP + + +  
Sbjct  680   LILDEGHTPRNRKSLIWKALEGVQTKNRIILSGTPFQNNFQELSNVLCLTRPAYAEAISS  739

Query  1427  -LKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKLTTGF  1251
              LKEL             ++S+E R +K             KE E+  G+  L+ L + F
Sbjct  740   KLKEL------------GKWSME-RGQK------------GKEYEQAGGIKGLRALLSPF  774

Query  1250  IDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIH  1074
             + V++G    ++LPGL+   +++K   LQ++IL ++   +  +     ELE  ++  ++H
Sbjct  775   VHVHKGSILRESLPGLRESVVVLKPQDLQKKILDRIDRCQNTF-----ELEHKLSSVSVH  829

Query  1073  PWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCH  903
             P L   ++ T        +   + LE+ K +L  G+K +F++  +       EKVL+F  
Sbjct  830   PSLFLGLKGTKKEEIIIGKSIKQKLERNKLNLTEGAKARFLVDFVRLSTSIDEKVLVFSQ  889

Query  902   NIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTC  723
              +  ++L +E+    +GW +  EV  + G +EL ER R+++ F +    +KV+LAS   C
Sbjct  890   YLDILSLIMELLTTLFGWTEEREVSSMHGKLELKERQRLINNFNDPDSEAKVLLASTKAC  949

Query  722   AEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTT  543
             +EGI+L  ASRVILLD  WNPS  ++AI+RA+R GQ + VY Y L+   T E +KY +  
Sbjct  950   SEGINLVGASRVILLDVVWNPSVERKAISRAYRLGQKRTVYTYHLVMKDTPECDKYCKQA  1009

Query  542   WKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIV  438
              K  +S ++F+     D         ED++L E++
Sbjct  1010  EKHRISELVFTSKDERDKLENSRVVKEDKILEEMI  1044



>gb|EEC73701.1| hypothetical protein OsI_08293 [Oryza sativa Indica Group]
Length=1363

 Score =   317 bits (811),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 211/684 (31%), Positives = 346/684 (51%), Gaps = 50/684 (7%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRV-CHHDFRLNEEIGLVCRLC  2346
             D LWKE + AL S  +     +   K   +   A K  + +   H+  ++E+IGL C+ C
Sbjct  680   DELWKEFDFALESINVCSHNCEEGEKEDEQEIPADKAASCIQGKHELIIDEQIGLRCKHC  739

Query  2345  GVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVE  2166
               V  EI+ V P  M  +C+         E  M +    D   D          P     
Sbjct  740   NFVDLEIRFVLPS-MVKSCT---------ERDMRKDHELDLFFDDILTSAGYEGPRDFGG  789

Query  2165  VEDN-AWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK-RGGCVISHSPGA  1992
              +    W L+P +R  +  HQ+  FEF+W+ +AG     Q+   +    GGCVISH+PG 
Sbjct  790   QKTGLVWDLVPGVREDMFPHQQEGFEFMWRKLAGGTSIEQLRNNANTIEGGCVISHAPGT  849

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY--KG  1818
             GKT L I F+ SY   FP   P+++AP+  L TW +E  KWK+ +P + ++  +    + 
Sbjct  850   GKTRLAITFVQSYFAFFPECCPVIIAPRGMLATWEQEFRKWKVKVPFHVLNSKEINWKED  909

Query  1817  EVLRQ----KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
               ++Q       L   L RN+ + H      K+  W    S++ + YT F  L  + S  
Sbjct  910   RTIKQLAIMDENLAQSLARNK-LDHKFRRKLKLASWRKGSSIIGVSYTLFRKLANQSSMD  968

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
              +   +  +L + P +L+LDEGH PR+ KS + K L +V T  RI+LSGT FQN+F E  
Sbjct  969   GN--MVRNLLLEKPDLLVLDEGHTPRNKKSLIWKVLEEVRTKKRIILSGTPFQNSFLELS  1026

Query  1469  NTLCLARPRFVDEVLKELDPKYKK-RVKGAKTRFSLENRARKMFidkiskkidsskerer  1293
             N L L RP+F      +    +KK  ++   T  +L N   K                  
Sbjct  1027  NVLYLIRPKFARHFASK---SFKKIGLEDYWTSLTLNNITEKK-----------------  1066

Query  1292  kEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGF  1116
                ++ ++++    + ++ G     +LPGL+   +++     Q+EI+  +++   +  G 
Sbjct  1067  ---IDEIRQILDPIVHIHNGDILQKSLPGLRESVVILNPLPHQKEIITAMENT--VTMG-  1120

Query  1115  PLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCL  936
              L+ E  I+L +IHP+L+     S +     ++  L+  + +  +G K KFV+ ++  C 
Sbjct  1121  TLDAEYKISLASIHPFLVTCAKLSEKETSSVDVSLLKSLRPNPCVGVKTKFVLEIVRLCE  1180

Query  935   LRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGP  756
               KE+VL+F   + P++L ++   + + W +G E+L++ G++ +  R  +M+ F  +   
Sbjct  1181  AMKERVLVFSQYLEPLSLIMDQLSKMFNWTEGEEILLMSGNVLVQNREALMEAFNNMKSN  1240

Query  755   SKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATG  576
             +KVMLAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ+K+VY Y L+  G
Sbjct  1241  AKVMLASTKACCEGITLIGASRVVLLDVVWNPSVGRQAIGRAYRIGQEKIVYTYNLITEG  1300

Query  575   TLEEEKYKRTTWKEWVSSMIFSED  504
             T E++KY R   K+ +S ++FS++
Sbjct  1301  TKEKDKYDRQAKKDHMSKLLFSKE  1324



>ref|XP_009619118.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 isoform X1 
[Nicotiana tomentosiformis]
Length=1273

 Score =   315 bits (806),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 215/669 (32%), Positives = 340/669 (51%), Gaps = 61/669 (9%)
 Frame = -3

Query  2411  GTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQG  2232
             G ++  H   L+E+IGL+C++C  V  E K + P F   T    G+ +R        +  
Sbjct  629   GCQMGSHHLILDEQIGLICKVCSHVHLESKYIYPAFAERT---RGRHER----TYFGESS  681

Query  2231  DDADLDHFAIPVSSNKPSSEVEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIP  2055
                D+D F     S    S + VE   W L+P   +  +  HQR  FEF+WKNIAG I  
Sbjct  682   PFFDVDGFRFDDPSAVHDSAIYVEGTVWDLVPLHAKATMYPHQREGFEFMWKNIAGDIYL  741

Query  2054  TQI-DPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEI  1878
              ++ +P S  RGGC+ISH PG GKT L I FL ++LK FP  RP+++AP   L  W  E 
Sbjct  742   EKLSEPLSASRGGCIISHPPGTGKTRLTIVFLQAFLKQFPKCRPVIIAPPKLLSNWEVEF  801

Query  1877  IKWKIPIPVYQIHGGQ-TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVL  1701
              KW+  IP + ++    + + + +   +  C      ++  H+   + K++ W    SVL
Sbjct  802   QKWEADIPFHNLNNNDFSCQEDEVTVGLYHCLSRAGRKNKHHIR--MVKLKSWAKSKSVL  859

Query  1700  LMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSL  1521
              + Y  F  LT E     + K + ++L   PG+++L+EGH PR+ +S L KA+ KV T  
Sbjct  860   GISYDLFEKLTGEYGD-GYAKEIREILLTLPGLVVLEEGHTPRNEQSLLYKAMTKVETQR  918

Query  1520  RILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMF  1341
             RILLSGT+FQNNF E +NTL +  P+F  E             K A    S++  +R   
Sbjct  919   RILLSGTVFQNNFKELYNTLRVVSPKFAAE----------SEQKWASLSNSIDTNSR---  965

Query  1340  idkiskkidsskererkEGLNILKKLTTGFIDV-YEGGSSDNLPGLQCYTLMMKSTTLQQ  1164
                                L  L+ +    I +  E     +LPG++   + +K T LQ+
Sbjct  966   ------------------ALEELRDMIAPLIHICSENVKMKSLPGIRDTLVYLKPTDLQK  1007

Query  1163  EILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlk  984
             ++L  +    P Y G   +   +++L ++HP L+   A    +   E      + + D  
Sbjct  1008  KLLNMI----PEYPG-SFDFRNMVSLISVHPSLV---ANKKVFSDLESQLNERECRLDPN  1059

Query  983   LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIEL  804
              G K KFV+ LI  C   +E+V++F   + P+ L  E     + W  G E+L + G++++
Sbjct  1060  TGVKTKFVVELIRLCDGMRERVIVFSQLLDPLRLIKEQLNSLFHWTLGREILYMDGELDV  1119

Query  803   FERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFR  624
              +R + +    +    +KV+LASIT C+EGI+L  ASRV+LLD  WNPS  +QA++RA+R
Sbjct  1120  KQRQKSISSLNDPKSDAKVLLASITACSEGINLIGASRVVLLDVHWNPSVEQQAVSRAYR  1179

Query  623   PGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVE----DPSHWQAPKIEDE  456
              GQ K V+VY  +A+   E  K ++ T K++ S ++ S + V     +PS      +ED 
Sbjct  1180  NGQTKFVHVYCPVAS-KWEVNKIEQQTRKKYHSGVLLSRNEVNTCKTNPS---CSVLEDN  1235

Query  455   LLGEIVEED  429
             +L  +V+ +
Sbjct  1236  ILESMVQNE  1244



>ref|XP_009786652.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 [Nicotiana 
sylvestris]
 ref|XP_009786653.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 [Nicotiana 
sylvestris]
 ref|XP_009786654.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 [Nicotiana 
sylvestris]
 ref|XP_009786655.1| PREDICTED: SNF2 domain-containing protein CLASSY 4 [Nicotiana 
sylvestris]
Length=1173

 Score =   313 bits (803),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 207/643 (32%), Positives = 331/643 (51%), Gaps = 60/643 (9%)
 Frame = -3

Query  2411  GTRVCHHDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQG  2232
             G ++ +H   L+E+IGL+C++C  V  E K + P F      + G+ +R       +  G
Sbjct  529   GCQMGNHHLILDEQIGLICKVCSHVHLESKYIYPAFAER---NRGRHER-------KYFG  578

Query  2231  DDA---DLDHFAIPVSSNKPSSEVEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGS  2064
             + +   D+D F     S    S + VE   W L+P   +  +  HQR  FEF+WK IAG 
Sbjct  579   ESSPFLDVDGFRFDDPSAVHDSAIYVEGTVWDLVPLHAKATMYPHQREGFEFMWKTIAGD  638

Query  2063  IIPTQI-DPESKKRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWY  1887
             I   ++ +P S  RGGC+ISH PG GKT L I FL ++LK FP  RP+++AP   L  W 
Sbjct  639   IYLEKLSEPLSASRGGCIISHPPGTGKTRLTIVFLQAFLKHFPKCRPVIIAPPKLLSNWE  698

Query  1886  KEIIKWKIPIPVYQIHGGQ-TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHP  1710
              E  KW+  IP + ++    + + + +   +  C      ++  H+   + K++ W    
Sbjct  699   AEFQKWEADIPFHNLNNNDFSCQEDEVTVGLYHCLSHAGRKNKHHIR--MVKLKSWAKSK  756

Query  1709  SVLLMGYTSFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVN  1530
             S+L + Y  F  LT E+    + K + ++L   PG+++L+EGH PR+ +S L KA+ KV 
Sbjct  757   SILGISYDLFEKLTGENGD-GYAKEIREILLTLPGLVVLEEGHTPRNEQSLLYKAMTKVE  815

Query  1529  TSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRAR  1350
             T  RILLSGT+FQNNF E +NTL +  P+F  E             K A    S++  AR
Sbjct  816   TQRRILLSGTVFQNNFKELYNTLRVVSPKFAAE----------SEQKWASLSNSIDTNAR  865

Query  1349  KMFidkiskkidsskererkEGLNILKKLTTGFIDV-YEGGSSDNLPGLQCYTLMMKSTT  1173
                                   L  L+ +    I +  E     +LPG++   + +K T 
Sbjct  866   ---------------------ALEELRDMIAPLIHICSENVKMKSLPGIRDTLVYLKPTD  904

Query  1172  LQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkf  993
             LQ+++L  +    P Y G   +   +++L ++HP L+   A    +   E      + + 
Sbjct  905   LQKKLLNMI----PEYPG-SFDFRNMVSLISVHPSLV---ANKKVFSDLESQLNERECRL  956

Query  992   dlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGD  813
             D   G K KFV+ LI  C   +E+V++F   + P+ L  E     + W  G E+L + G+
Sbjct  957   DPNTGVKTKFVVELIRLCDGMRERVIVFSQLLDPLRLIKEQLNSLFHWTLGREILYMDGE  1016

Query  812   IELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIAR  633
             +++ +R + +    +    +KV+LASIT C+EGI+L  ASRV+LLD  WNPS  +QA++R
Sbjct  1017  LDVKQRQKSISSLNDPKSDAKVLLASITACSEGINLIGASRVVLLDVHWNPSVEQQAVSR  1076

Query  632   AFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSED  504
             A+R GQ K V+VY  +A+   E  K ++ T K++ S ++ S +
Sbjct  1077  AYRNGQTKFVHVYCPVAS-KWEVNKIEQQTRKKYHSGVLLSRN  1118



>gb|KDO68851.1| hypothetical protein CISIN_1g018545mg [Citrus sinensis]
Length=354

 Score =   293 bits (750),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 159/307 (52%), Positives = 208/307 (68%), Gaps = 10/307 (3%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             +RR ++Q++HPFD +PFEAF + SW+ VE IRI++GT  MH+ D     EE    SN+RI
Sbjct  3     RRRHLYQSKHPFDDHPFEAFFDDSWRTVELIRIEDGTMTMHLKDNQCYTEERRPFSNLRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR ATSSDC CFLRPG+D+ V S    +E SDEEN        EP W+DAKI SIERKP
Sbjct  63    RSRKATSSDCTCFLRPGIDVCVLSASQDAESSDEENE-------EPVWVDAKISSIERKP  115

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             H   C CQ ++  Y+  GP    +  LSKE K+V ++QI ILQK+ +  CED+YYRW+ S
Sbjct  116   HEGQCSCQLYVKFYINPGPLGSERGALSKETKLVGIDQITILQKLGRDACEDQYYRWNFS  175

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSE  3486
             +DCS+LQK KL  GKF SDLS++LVAS  KQ  FD++SV  +IVY++L  ++D  +P+S 
Sbjct  176   EDCSSLQKTKLLLGKFSSDLSFLLVASVLKQTAFDIRSVQKKIVYQVLGSDDDNSSPDSI  235

Query  3485  YHSYAVSFKLENEVSTPIIIQF-NPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
              H  A++FK+E+ VST  + QF  PD  E    G   E G L +YD   LRRSKRR VQP
Sbjct  236   NHLNAINFKVEDGVSTSHLFQFIPPDTKEVSTAGGTEEVGLLPIYDVMNLRRSKRRNVQP  295

Query  3314  ERYLGCD  3294
             +R++GCD
Sbjct  296   DRFIGCD  302



>gb|EYU44858.1| hypothetical protein MIMGU_mgv1a024033mg, partial [Erythranthe 
guttata]
Length=871

 Score =   308 bits (789),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 214/666 (32%), Positives = 348/666 (52%), Gaps = 62/666 (9%)
 Frame = -3

Query  2393  HDFRLNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD  2214
             HD  L+E+IG++C  C  +  EIK V PPF+    S       P  + +           
Sbjct  228   HDAFLDEQIGIICSYCSSLLLEIKHVLPPFVSIINS-------PHNIYI-----------  269

Query  2213  HFAIPVSSNKPSSEVEVEDNAWALIPDL-RNKLRAHQRRAFEFLWKNIAGSIIPTQIDPE  2037
             H     SS+  S+ ++       LIPD  + +L  HQ +  EFLW+NIAG I    +   
Sbjct  270   HCGSNSSSSSSSTVMD-------LIPDADKKQLYPHQLQGLEFLWRNIAGDIHINNMATL  322

Query  2036  SKKRG-GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIP  1860
                 G GC+ISH+PG GKT L I FL +++KL+P   P+++AP+  L TW +E  KW + 
Sbjct  323   PANGGRGCIISHAPGTGKTRLTIVFLQTFMKLYPNCLPVIIAPRGMLLTWEQEFAKWNVD  382

Query  1859  IPVYQIHGGQ--TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYT  1686
             I  + ++  +  T + E+         G  +N +         K+  W+   SVL +GY 
Sbjct  383   IKFHNLNETKLSTQEMEIASTLTDHQSGHEKNNNNNKDYIRFVKLFAWMKGGSVLGVGYR  442

Query  1685  SFLTLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
              F  L  E     + K+  ++L + PG+L+LDEGH PR+ +S + KAL + +T  RI+LS
Sbjct  443   LFEELAGEKHDKNNNKF-KKILLESPGLLVLDEGHTPRNNQSLMWKALTRTSTHRRIILS  501

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGA-KTRFS-LENRARKMFidk  1332
             GT FQNNF E +NTLCL  P F  ++ K  +   K++V  A K  ++ L N   K     
Sbjct  502   GTPFQNNFTELYNTLCLVNPTFSQQITKATNRGRKQKVANAVKDEWACLTNSISK-----  556

Query  1331  iskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL  1155
                        +  E +  L+ +   F+ +++G      LPG++   ++++ T +Q+++ 
Sbjct  557   -----------KNDERVKELRSMIEPFVHIHKGDILEKTLPGMRDCMIVLRPTDVQKKLA  605

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGS  975
              K+ DQ  + K   LE + L +L ++HP L+     + +    ++   L+  + D   G 
Sbjct  606   DKI-DQVLVDKF--LEHDYLASLISVHPSLV-----ADRPEFSDQKRKLKSLELDPLAGV  657

Query  974   KVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFER  795
             K +F++ LI   +  +EKVL+F   I P+    ++ + ++ W +G EV+ + G++E  +R
Sbjct  658   KTRFLVKLIELSIRVQEKVLVFSEYIDPLQQIKKLIKDYFCWHEGREVIYMDGNLESKQR  717

Query  794   GRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQ  615
               V++ F +    +KV+LAS   C+EGI+L  ASR++LLD  WNPS  +QAI RA+R GQ
Sbjct  718   QVVINSFNDKKSEAKVLLASQRACSEGINLVGASRLVLLDVAWNPSVERQAICRAYRIGQ  777

Query  614   DKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVE  435
             +K+VYVY LL    +E  KY R   K+ +S +IF        +   +   ED+LL  +V 
Sbjct  778   EKMVYVYHLLT--LMEVNKYVRQAEKDRISQLIFGHQGGGGGNELVS---EDKLLEAMVR  832

Query  434   EDRATL  417
              +  ++
Sbjct  833   HEEKSV  838



>emb|CDP14473.1| unnamed protein product [Coffea canephora]
Length=1136

 Score =   312 bits (800),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 221/726 (30%), Positives = 345/726 (48%), Gaps = 72/726 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTE--DTNLKSATELHMATKKGTRVCH---HDFRLNEEIGLV  2358
             D L+ EME+    C  L D++  ++++     +    K    +C    H   L E IG+V
Sbjct  467   DNLFTEMEM----CLTLPDSDFTESSMDGTHHVTATAKSQAELCQLGEHQLILEEPIGIV  522

Query  2357  CRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD--HFAIPVSSNK  2184
             C+ C +V  E+KD+ P           KE        +  +GD + +   HF    S N 
Sbjct  523   CKYCQIVYMEMKDIFPVLK--------KETSHRRDWFDLCRGDCSGIHELHFGELASRNY  574

Query  2183  PSSEVEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRG-GCVI  2010
              +S ++ E +   LIP D+R  + +HQ   F FLWKNI G     ++  E    G G +I
Sbjct  575   YTS-IDAEGSVLDLIPNDIRMSMYSHQLDGFVFLWKNIVGETCIEKLKTELSDDGRGAII  633

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I F++S LK++P  RP+++AP++ L TW  E  KW   IP +  +  +
Sbjct  634   SHAPGTGKTCLTIVFILSLLKMYPMCRPVIIAPRSMLLTWENEFRKWGSRIPFHNFNS-K  692

Query  1829  TYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTY  1650
                G  L+   +          +  V   + K+  W    SVL + Y  F  +       
Sbjct  693   DLSGNELKTDAEF---------LRRVGSRMTKLYSWTKDKSVLGISYKLFEQIASGRKGK  743

Query  1649  AHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYF  1470
                + + ++  Q PG+++LDEGH PR+ +S + K L  V T  +I+LSGT FQNNF E +
Sbjct  744   GSDERLGEIFLQLPGLVVLDEGHTPRNQQSLVWKVLTGVKTKRKIILSGTPFQNNFDELY  803

Query  1469  NTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererk  1290
             NT CL  P+F   +  E            K   SL N   K   +               
Sbjct  804   NTFCLVNPKFSGSITSE------------KRWISLTNAIHKKSDNV--------------  837

Query  1289  EGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFP  1113
               +  LK +   F+ V+ G    +NLPGL+   ++++ T  Q++IL  + D    +    
Sbjct  838   --VEELKAMIDPFVHVHRGSILEENLPGLKDTLVILRPTDEQKDILRLISDDWSRFDQVH  895

Query  1112  LELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLL  933
             L     ++L ++HP L   +            + L   +     G K KF + LI  C  
Sbjct  896   L-----VSLISVHPSLAAFSK-----RLSAHKDRLGVLRCSPYAGVKTKFAIELIRLCDA  945

Query  932   RKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPS  753
               EKVL+F   I P+   ++       WR+GIE+L + G  +   R   +    +     
Sbjct  946   SHEKVLVFSEFIHPLRFIMQQLMDQLKWREGIEMLYMDGKRDEKNRQSSISSLNDPSSKV  1005

Query  752   KVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGT  573
             KV+ AS   C+EGI+L+ ASRV+LLD  WNPS  +QAI+RA+R GQ K+VYVY L+ +GT
Sbjct  1006  KVLFASTKACSEGINLSGASRVVLLDVVWNPSVERQAISRAYRLGQKKLVYVYHLITSGT  1065

Query  572   LEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDRAT-LFHMIMKN  396
             LE EKY +   K+ +S ++FS    +      +   ED++L  +++      +F  ++  
Sbjct  1066  LEVEKYAQQANKDRLSELVFSSRDRQSNKSRISSVFEDKILEGMLDNKMLNDIFENVIHQ  1125

Query  395   EKASNM  378
              K SN+
Sbjct  1126  PKESNV  1131



>dbj|BAD26561.1| SNF2 domain-containing protein-like [Oryza sativa Japonica Group]
Length=602

 Score =   301 bits (770),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 182/560 (33%), Positives = 301/560 (54%), Gaps = 40/560 (7%)
 Frame = -3

Query  2153  AWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKK-RGGCVISHSPGAGKTLL  1977
              W L+P +R  +  HQ+  FEF+W+ +AG     Q+   +    GGCVISH+PG GKT L
Sbjct  34    VWDLVPGVREDMFPHQQEGFEFMWRKLAGGTSIEQLRNNANTIEGGCVISHAPGTGKTRL  93

Query  1976  IIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE--VLRQ  1803
              I F+ SY   FP   P+++AP+  L TW +E  KWK+ +P + ++  +    E   ++Q
Sbjct  94    AITFVQSYFAFFPECCPVIIAPRGMLATWEQEFRKWKVKVPFHVLNSKEINWKEDRTIKQ  153

Query  1802  ----KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
                    L   L RN+ + H      K+  W    S++ + YT F  L  + S   +   
Sbjct  154   LAIMDENLAQSLARNK-LDHKFRRKLKLASWRKGSSIIGVSYTLFRKLANQSSMDGN--M  210

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
             +  +L + P +L+LDEGH PR+ KS + K L +V T  RI+LSGT FQN+F E  N L L
Sbjct  211   VRNLLLEMPDLLVLDEGHTPRNKKSLIWKVLEEVRTKKRIILSGTPFQNSFLELSNVLYL  270

Query  1454  ARPRFVDEVLKELDPKYKKRV--KGAKTRFSLENRARKMFidkiskkidsskererkEGL  1281
              RP+F     +    K  K++  +   T  +L N   K                     +
Sbjct  271   IRPKFA----RHFASKSFKKIGLEDYWTSLTLNNITEK--------------------KI  306

Query  1280  NILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLEL  1104
             + ++++    + ++ G     +LPGL+   +++     Q+EI+  +++   +  G  L+ 
Sbjct  307   DEIRQILDPIVHIHNGDILQKSLPGLRESVVILNPLPHQKEIITAMENT--VTMG-TLDA  363

Query  1103  ELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKE  924
             E  I+L +IHP+L+     S +     ++  L+  + +  +G K KFV+ ++  C   KE
Sbjct  364   EYKISLASIHPFLVTCAKLSEKETSSVDVSLLKSLRPNPCVGVKTKFVLEIVRLCEAMKE  423

Query  923   KVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVM  744
             +VL+F   + P++L ++   + + W +G E+L++ G++ +  R  +M+ F ++   +KVM
Sbjct  424   RVLVFSQYLEPLSLIMDQLSKMFNWIEGEEILLMSGNVLVQNREALMEAFNDMKSNAKVM  483

Query  743   LASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEE  564
             LAS   C EGI+L  ASRV+LLD  WNPS  +QAI RA+R GQ+K+VY Y L+  GT E+
Sbjct  484   LASTKACCEGITLIGASRVVLLDVVWNPSVGRQAIGRAYRIGQEKIVYTYNLITEGTKEK  543

Query  563   EKYKRTTWKEWVSSMIFSED  504
             +KY R   K+ +S ++FS++
Sbjct  544   DKYDRQAKKDHMSKLLFSKE  563



>ref|XP_010485015.1| PREDICTED: SNF2 domain-containing protein CLASSY 3 [Camelina 
sativa]
Length=716

 Score =   304 bits (778),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 217/699 (31%), Positives = 340/699 (49%), Gaps = 68/699 (10%)
 Frame = -3

Query  2519  MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCRL  2349
             MLW+E    LA C   +D  +  L S  E  +  +     C   +H+  L+ E+GL C  
Sbjct  1     MLWEE----LAFCSKSNDVSN-ELPSNMEEILIDETPAAKCKKGNHNLILDLEVGLKCMN  55

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLD-----HFAIPVSSNK  2184
             CG V  EI+        S   S   E+   E    ++  ++ + +      F  P +++ 
Sbjct  56    CGFVQREIR--------SMDESEWGEKITRERRRFDRFDEEENSNILGKLGFEAPNTNSL  107

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID--PESKKRGGCVI  2010
                 V  E   W  IP +++++  HQ+  FEF+W+N+AG+I+  ++     S++ GGC++
Sbjct  108   HEDCVSSEGTVWDKIPGVKSQMYPHQQEGFEFIWRNLAGTIMLNELKDFENSEETGGCIM  167

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I FL SYL  FP  +P+++AP + L TW +E  KW I IP + +   +
Sbjct  168   SHAPGTGKTRLTIIFLQSYLACFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLE  227

Query  1829  TYKGE---VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---  1668
                 E    L   M+       N ++  V     K+  W+   S+L + Y  +  L    
Sbjct  228   FTGKESSAALGLLMQKNATARTNNEIRMV-----KIYSWIKAKSILGISYNLYEKLAGVK  282

Query  1667  ---------REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRI  1515
                      RE         + ++L   PG+L+LDE H PR+ +S + K L KV T  RI
Sbjct  283   DEDKKTKMVREVKPDKELNDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRI  342

Query  1514  LLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFid  1335
             LLSGT FQNNF E  N L LARP++++++   L        K  K     E   R     
Sbjct  343   LLSGTPFQNNFQELCNVLGLARPKYLEKLTSTLKKSGMTVTKRGKRALGNEINNR-----  397

Query  1334  kiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEI  1158
                             G+  LK +   F+ V++G     +LPGL+   +++    LQ+ +
Sbjct  398   ----------------GIEELKAVMLPFVHVHKGSILQRSLPGLRECVVVLNPPELQKRV  441

Query  1157  LVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---  987
             L  ++           E E  ++L ++HP L+     S +     +   L + K      
Sbjct  442   LESIEVTHNRKTKNVFETEHKLSLVSVHPSLVSRCKLSEKERLSIDEALLAQLKKVRLDP  501

Query  986   kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIE  807
             K   K +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL + G +E
Sbjct  502   KQSVKTRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFNWNPGEEVLYMHGKLE  561

Query  806   LFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAF  627
               +R  ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +QAI+RA+
Sbjct  562   QKQRQTLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQAISRAY  621

Query  626   RPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             R GQ ++VY Y L+A GT E  KY +   K+ +S ++F+
Sbjct  622   RIGQQRIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFA  660



>ref|XP_006303135.1| hypothetical protein CARUB_v10008086mg [Capsella rubella]
 gb|EOA36033.1| hypothetical protein CARUB_v10008086mg [Capsella rubella]
Length=1524

 Score =   315 bits (808),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 216/699 (31%), Positives = 349/699 (50%), Gaps = 73/699 (10%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGVV  2337
             LW+E+     S   +D + +  ++ +T+   A +   R  +HD  L+ EIGL C  CG V
Sbjct  813   LWEELAFYNKS---IDVSNEVEIEISTDETPAAQ--CRKGNHDLCLDLEIGLKCVNCGFV  867

Query  2336  STEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFA---------IPVSSNK  2184
               EI+            S  + +  E++  E ++ D  D + F+          P  ++ 
Sbjct  868   QREIR------------SMDESEWGEKITRERRKSDRYDEEEFSNLIGKLGIEAPNMNSL  915

Query  2183  PSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID--PESKKRGGCVI  2010
                 V  E   W  IP +++++  HQ+  FEF+W N+AG+I   ++     S + GGC++
Sbjct  916   DGGCVSSEGTVWDKIPGVKSQMYPHQQEGFEFIWTNLAGTIFLNKLKDFENSDETGGCIM  975

Query  2009  SHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQ  1830
             SH+PG GKT L I FL +YL  FP  +P+++AP + L TW +E  KW I IP + +   +
Sbjct  976   SHAPGTGKTRLTIIFLQAYLACFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLE  1035

Query  1829  TYKGE---VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT---  1668
                 E    L   M+       N ++  V     K+  W+   S+L + Y  +  L    
Sbjct  1036  FTGKENAAALGLLMQKNATARSNNEIRMV-----KIYSWIKAKSILGISYNLYEKLAGVK  1090

Query  1667  ---------REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRI  1515
                      RE       + + ++L   PG+L+LDE H PR+ +S + K L KV T  RI
Sbjct  1091  DEDKKTKTVREVKPDKESEDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRI  1150

Query  1514  LLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFid  1335
             LLSGT FQNNF E  N L LARP++++++   L           K+  ++  R +K   +
Sbjct  1151  LLSGTPFQNNFQELCNVLGLARPKYLEKLTATL----------KKSGMTVTKRGKKALGN  1200

Query  1334  kiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEI  1158
             +I+ +           G+  LK +   F+ V++G     +LPGL+   +++    LQ+ +
Sbjct  1201  EINNR-----------GIEELKTVMLPFVHVHKGSILQRSLPGLRECVVVLNPPELQKRV  1249

Query  1157  LVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---  987
             L  ++      K    E E  ++L ++HP L+     S +     +   L + K      
Sbjct  1250  LESIEVTHNRKKINVFETEHKLSLVSVHPSLVSRCKLSAKESLTIDEALLAQLKKVRLDP  1309

Query  986   kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIE  807
             K   K +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL + G +E
Sbjct  1310  KQSVKTRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFKWNPGEEVLYMHGKLE  1369

Query  806   LFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAF  627
               +R  ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +QAI+RA+
Sbjct  1370  QKQRQTLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQAISRAY  1429

Query  626   RPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             R GQ ++VY Y L+A GT E  KY +   K+ +S ++F+
Sbjct  1430  RIGQQRIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFA  1468



>ref|XP_006440142.1| hypothetical protein CICLE_v10023697mg [Citrus clementina]
 gb|ESR53382.1| hypothetical protein CICLE_v10023697mg [Citrus clementina]
Length=939

 Score =   308 bits (789),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 226/713 (32%), Positives = 353/713 (50%), Gaps = 69/713 (10%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTE----DTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             LW EM+ A     L         +    S+ E+  A  +  R   HD  LNEE GL C +
Sbjct  243   LWAEMDFARKVSELHSTNSSILAENEAASSNEVETAKTRCQR-GDHDLILNEEYGLYCTV  301

Query  2348  CGVVSTEIKDVPPPFM--PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
             C  + + IKD+ PPF   PS  +   +    +   +++    D+  D      S +    
Sbjct  302   CSYMKS-IKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFD------SQSGCDP  354

Query  2174  EVEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISH  2004
                 +   W L+P D+R K+  HQ   FEF+WKNIAG I   ++   +   GG  C+ISH
Sbjct  355   FTHAQGTVWELVPRDVRKKMFPHQHEGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISH  414

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIH----G  1836
             +PG GKT L + FL +Y+KL P  RP+++AP++ L TW +E  KW I IP Y ++     
Sbjct  415   APGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELS  474

Query  1835  GQTYKGEVL----RQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT  1668
             G+   G V     R++ +   GL R            K+  W     +L + Y  F  L 
Sbjct  475   GKENNGAVALMDNRKRGRGKVGLIR----------YVKLYSWKMGTGILGLSYRLFEKLV  524

Query  1667  REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQN  1488
               D        ++ +L   PG+ + DEGH PR+  + + KAL ++ T  RI+LSGT FQN
Sbjct  525   SGDE-------LSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQN  577

Query  1487  NFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidss  1308
             NF E  NTL L R  F  EVL+ +     ++ K AK    + +  R              
Sbjct  578   NFQELENTLSLVRQEF-GEVLRTVRKSGHEKSK-AKHASLISSIGR-------------C  622

Query  1307  kererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRP  1131
                   E L  LK+    F++V++G    ++LPGL+   ++++    Q+ +   ++    
Sbjct  623   ANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEG---  679

Query  1130  IYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
               K F +EL   ++L ++HP L+           + +   L + K D + G K +F++ L
Sbjct  680   -VKSF-VELNYCVSLISVHPSLLPQQFFES---FDVDSAKLARLKLDPEAGIKTRFLLIL  734

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             +   L   EKVL+F   I P+ L +E     + WR+G EVL + G  ++ +R   ++   
Sbjct  735   LE--LSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLN  792

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
             +    +++MLAS   C EGI+L  ASRV+LLD  WNP   +QAI+RA+R GQ +VV+VY 
Sbjct  793   DPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYH  852

Query  590   LLATGTLEEEKYKRTTWKEWVSSMIF-SEDLVEDPSHWQAPKIEDELLGEIVE  435
             L+ + TLE +K +R   K W S+M+F S D   +     +  +ED++L E+ +
Sbjct  853   LITSETLEWDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQ  905



>ref|NP_172040.2| chromatin remodeling 31 [Arabidopsis thaliana]
 sp|F4I8S3.1|CLSY3_ARATH RecName: Full=SNF2 domain-containing protein CLASSY 3; AltName: 
Full=Protein CHROMATIN REMODELING 31; Short=AtCHR31 [Arabidopsis 
thaliana]
 gb|AEE27845.1| chromatin remodeling 31 [Arabidopsis thaliana]
Length=1410

 Score =   311 bits (796),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 228/745 (31%), Positives = 369/745 (50%), Gaps = 66/745 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLK---SATELHMAT-KKGTRVCHHDFRLNEEIGLVC  2355
             D LW+E+     S  +  +   +N++   SA E   A  KKG     HD  ++ E+GL C
Sbjct  693   DRLWEELAFFTKSNDIGGNELFSNVEKNISANETPAAQCKKG----KHDLCIDLEVGLKC  748

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
               CG V  EI+ +    +      + +E+R  +   EE+         F  P +S     
Sbjct  749   MHCGFVEREIRSMD---VSEWGEKTTRERRKFDRFEEEEGSSFIGKLGFDAPNNSLNEGC  805

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID--PESKKRGGCVISHS  2001
              V  E   W  IP +++++  HQ+  FEF+WKN+AG+I+  ++     S + GGC++SH+
Sbjct  806   -VSSEGTVWDKIPGVKSQMYPHQQEGFEFIWKNLAGTIMLNELKDFENSDETGGCIMSHA  864

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I FL +YL+ FP  +P+++AP + L TW +E  KW I IP + +       
Sbjct  865   PGTGKTRLTIIFLQAYLQCFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLDFTG  924

Query  1820  GE---VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT------  1668
              E    L   M+       N ++  V     K+  W+   S+L + Y  +  L       
Sbjct  925   KENSAALGLLMQKNATARSNNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGVKDED  979

Query  1667  ------REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
                   RE         + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLS
Sbjct  980   KKTKMVREVKPDKELDDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLS  1039

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E  N L LARP++++ +   L           K+  ++  R +K   ++I+
Sbjct  1040  GTPFQNNFLELCNVLGLARPKYLERLTSTL----------KKSGMTVTKRGKKNLGNEIN  1089

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL--  1155
              +           G+  LK +   F+ V++G     +LPGL+   +++    LQ+ +L  
Sbjct  1090  NR-----------GIEELKAVMLPFVHVHKGSILQSSLPGLRECVVVLNPPELQRRVLES  1138

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---k  984
             +++   R     F  E E  ++L ++HP L+     S +     +   L + K       
Sbjct  1139  IEVTHNRKTKNVF--ETEHKLSLVSVHPSLVSRCKISEKERLSIDEALLAQLKKVRLDPN  1196

Query  983   LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIEL  804
                K +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL + G +E 
Sbjct  1197  QSVKTRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFKWNPGEEVLYMHGKLEQ  1256

Query  803   FERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFR  624
              +R  ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +QAI+RA+R
Sbjct  1257  KQRQTLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQAISRAYR  1316

Query  623   PGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPK--IEDELL  450
              GQ ++VY Y L+A GT E  KY +   K+ +S ++F+     D    +  +   ED++L
Sbjct  1317  IGQKRIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFACSSRHDKGKEKIAEAVTEDKVL  1376

Query  449   GEIVEEDR-ATLFHMIMKNEKASNM  378
               +VE  +   +F  ++   K +++
Sbjct  1377  DTMVEHSKLGDMFDNLIVQPKEADL  1401



>gb|AAF79734.1|AC005106_15 T25N20.14 [Arabidopsis thaliana]
Length=1465

 Score =   311 bits (798),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 228/745 (31%), Positives = 369/745 (50%), Gaps = 66/745 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLK---SATELHMAT-KKGTRVCHHDFRLNEEIGLVC  2355
             D LW+E+     S  +  +   +N++   SA E   A  KKG     HD  ++ E+GL C
Sbjct  748   DRLWEELAFFTKSNDIGGNELFSNVEKNISANETPAAQCKKG----KHDLCIDLEVGLKC  803

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
               CG V  EI+ +    +      + +E+R  +   EE+         F  P +S     
Sbjct  804   MHCGFVEREIRSMD---VSEWGEKTTRERRKFDRFEEEEGSSFIGKLGFDAPNNSLNEGC  860

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID--PESKKRGGCVISHS  2001
              V  E   W  IP +++++  HQ+  FEF+WKN+AG+I+  ++     S + GGC++SH+
Sbjct  861   -VSSEGTVWDKIPGVKSQMYPHQQEGFEFIWKNLAGTIMLNELKDFENSDETGGCIMSHA  919

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I FL +YL+ FP  +P+++AP + L TW +E  KW I IP + +       
Sbjct  920   PGTGKTRLTIIFLQAYLQCFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLDFTG  979

Query  1820  GE---VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT------  1668
              E    L   M+       N ++  V     K+  W+   S+L + Y  +  L       
Sbjct  980   KENSAALGLLMQKNATARSNNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGVKDED  1034

Query  1667  ------REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
                   RE         + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLS
Sbjct  1035  KKTKMVREVKPDKELDDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLS  1094

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E  N L LARP++++ +   L           K+  ++  R +K   ++I+
Sbjct  1095  GTPFQNNFLELCNVLGLARPKYLERLTSTL----------KKSGMTVTKRGKKNLGNEIN  1144

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL--  1155
              +           G+  LK +   F+ V++G     +LPGL+   +++    LQ+ +L  
Sbjct  1145  NR-----------GIEELKAVMLPFVHVHKGSILQSSLPGLRECVVVLNPPELQRRVLES  1193

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---k  984
             +++   R     F  E E  ++L ++HP L+     S +     +   L + K       
Sbjct  1194  IEVTHNRKTKNVF--ETEHKLSLVSVHPSLVSRCKISEKERLSIDEALLAQLKKVRLDPN  1251

Query  983   LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIEL  804
                K +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL + G +E 
Sbjct  1252  QSVKTRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFKWNPGEEVLYMHGKLEQ  1311

Query  803   FERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFR  624
              +R  ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +QAI+RA+R
Sbjct  1312  KQRQTLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQAISRAYR  1371

Query  623   PGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPK--IEDELL  450
              GQ ++VY Y L+A GT E  KY +   K+ +S ++F+     D    +  +   ED++L
Sbjct  1372  IGQKRIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFACSSRHDKGKEKIAEAVTEDKVL  1431

Query  449   GEIVEEDR-ATLFHMIMKNEKASNM  378
               +VE  +   +F  ++   K +++
Sbjct  1432  DTMVEHSKLGDMFDNLIVQPKEADL  1456



>dbj|BAE98499.1| hypothetical protein [Arabidopsis thaliana]
Length=1410

 Score =   311 bits (796),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 228/745 (31%), Positives = 369/745 (50%), Gaps = 66/745 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLK---SATELHMAT-KKGTRVCHHDFRLNEEIGLVC  2355
             D LW+E+     S  +  +   +N++   SA E   A  KKG     HD  ++ E+GL C
Sbjct  693   DRLWEELAFFTKSNDIGGNELFSNVEKNISANETPAAQCKKG----KHDLCIDLEVGLKC  748

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSS  2175
               CG V  EI+ +    +      + +E+R  +   EE+         F  P +S     
Sbjct  749   MHCGFVEREIRSMD---VSEWGEKTTRERRKFDRFEEEEGSSFIGKLGFDAPNNSLNEGC  805

Query  2174  EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID--PESKKRGGCVISHS  2001
              V  E   W  IP +++++  HQ+  FEF+WKN+AG+I+  ++     S + GGC++SH+
Sbjct  806   -VSSEGTVWDKIPGVKSQMYPHQQEGFEFIWKNLAGTIMLNELKDFENSDETGGCIMSHA  864

Query  2000  PGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYK  1821
             PG GKT L I FL +YL+ FP  +P+++AP + L TW +E  KW I IP + +       
Sbjct  865   PGTGKTRLTIIFLQAYLQCFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLDFTG  924

Query  1820  GE---VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT------  1668
              E    L   M+       N ++  V     K+  W+   S+L + Y  +  L       
Sbjct  925   KENSAALGLLMQKNATARSNNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGVKDED  979

Query  1667  ------REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLS  1506
                   RE         + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLS
Sbjct  980   KKTKMVREVKPDKELDDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLS  1039

Query  1505  GTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkis  1326
             GT FQNNF E  N L LARP++++ +   L           K+  ++  R +K   ++I+
Sbjct  1040  GTPFQNNFLELCNVLGLARPKYLERLTSTL----------KKSGMTVTKRGKKNLGNEIN  1089

Query  1325  kkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL--  1155
              +           G+  LK +   F+ V++G     +LPGL+   +++    LQ+ +L  
Sbjct  1090  NR-----------GIEELKAVMLPFVHVHKGSILQSSLPGLRECVVVLNPPELQRRVLES  1138

Query  1154  VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---k  984
             +++   R     F  E E  ++L ++HP L+     S +     +   L + K       
Sbjct  1139  IEVTHNRKTKNVF--ETEHKLSLVSVHPSLVSRCKISEKERLSIDEALLAQLKKVRLDPN  1196

Query  983   LGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIEL  804
                K +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL + G +E 
Sbjct  1197  QSVKTRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFKWNPGEEVLYMHGKLEQ  1256

Query  803   FERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFR  624
              +R  ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +QAI+RA+R
Sbjct  1257  KQRQTLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQAISRAYR  1316

Query  623   PGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPK--IEDELL  450
              GQ ++VY Y L+A GT E  KY +   K+ +S ++F+     D    +  +   ED++L
Sbjct  1317  IGQKRIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFACSSRHDKGKEKIAEAVTEDKVL  1376

Query  449   GEIVEEDR-ATLFHMIMKNEKASNM  378
               +VE  +   +F  ++   K +++
Sbjct  1377  DTMVEHSKLGDMFDNLIVQPKEADL  1401



>ref|XP_010695461.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Beta 
vulgaris subsp. vulgaris]
Length=1082

 Score =   306 bits (785),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 225/740 (30%), Positives = 362/740 (49%), Gaps = 89/740 (12%)
 Frame = -3

Query  2522  DMLWKEMELAL---------ASCYLLDDTEDTNLKSATELHMATK----KGTRVCHHDFR  2382
             D L+K+ E A+         +S    D+  D+   + +   ++ K    KG     HD  
Sbjct  399   DKLFKDFEFAIQASNIGSDDSSLIQHDNRSDSENINPSNGALSQKDLCAKGKHYLVHD--  456

Query  2381  LNEEIGLVCRLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAI  2202
               +EIG+VC+ C  V+ EIK V P F        G+  R +       +G     D F  
Sbjct  457   --DEIGIVCKFCSYVNLEIKHVMPDFNKDPF---GRGDRRDYYCRFLYEGS-MTYDRFQF  510

Query  2201  PVSSNKPSSEV----EVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPES  2034
               SS     +     +++   W LIP ++  L  HQR  FEF+W+NIAG I   ++   +
Sbjct  511   LESSYDGRGDFSPSDDIQGTVWDLIPGVKKTLYPHQRDGFEFIWRNIAGGIRMDELGKPT  570

Query  2033  K-KRGGCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPI  1857
             K   GGC+I H+PG GKT L I FL S++K +  ++P+++AP   L TW +E  +W + I
Sbjct  571   KFGLGGCIICHAPGTGKTRLAIVFLQSFMKHYQNAKPVIVAPFPMLRTWEEEFGRWNVNI  630

Query  1856  PVYQIHGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFL  1677
             P + ++  +    E  +    +      ++ +      L K+  W +   VL + Y    
Sbjct  631   PFFNLNDNELSGKEDPKILGYVAKSSKDDKTIR-----LVKLHTWASGNGVLCISYGLLQ  685

Query  1676  TLTREDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTL  1497
              L  +      +  + QVL +  GIL+LDEGH PR+ KS + K L  ++T  R++LSGT 
Sbjct  686   RLAGDKEGTDEK--VRQVLLEQSGILVLDEGHTPRNEKSNIWKVLSNISTKRRVILSGTP  743

Query  1496  FQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskki  1317
             FQNNF E  NT+ L R  F   V      KY++                           
Sbjct  744   FQNNFEELHNTISLVRQEFGTPVFPGFYSKYER---------------------------  776

Query  1316  dsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQ---EILVK  1149
                        +  L+K    F+ V++G    + L GL    L++K + LQ    E LV+
Sbjct  777   -----------IEELRKKIKPFVHVHKGEILKETLKGLIHRLLILKPSPLQTRCFEQLVR  825

Query  1148  LQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKV  969
             ++++         + + L+++ ++HP +         +  E+    L+K + DL  G K 
Sbjct  826   IKNR--------FKFDNLVSIISVHPSIFCGRESKPAFVDEKFESLLKKHRMDLDAGVKT  877

Query  968   KFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGR  789
             +F++ LI   L + E+VL+F   I P+N   ++ +  +GW  G E+L + G  ++ ER  
Sbjct  878   RFLVELIK--LSKGERVLVFGQYIPPLNFIADLLKSVFGWSMGSELLYMHGKQDVKERQS  935

Query  788   VMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDK  609
              +  F +    ++V+LAS   C EGI L  ASRV+LLD  WNPS  +QAI+RA+R GQ K
Sbjct  936   SIRLFNDPRSKARVLLASTKACCEGIHLVGASRVVLLDVVWNPSVERQAISRAYRLGQLK  995

Query  608   VVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS--EDLVEDPSHWQAPKIEDELLGEIVE  435
              V+VY L+ +GTLEEEKY+R   KE +S ++FS  E+  E+ S  ++   ED +L E+ +
Sbjct  996   DVFVYHLITSGTLEEEKYQRQATKERLSELVFSSAEENTENKS-TRSRISEDRILKEMTD  1054

Query  434   EDRAT-LFHMIMKNEKASNM  378
              ++   +F  ++   KA N+
Sbjct  1055  HEKMKHMFKRVIYQPKADNL  1074



>ref|XP_010475242.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Camelina 
sativa]
 ref|XP_010475243.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Camelina 
sativa]
 ref|XP_010475244.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Camelina 
sativa]
Length=1555

 Score =   310 bits (795),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 216/705 (31%), Positives = 355/705 (50%), Gaps = 80/705 (11%)
 Frame = -3

Query  2519  MLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVC---HHDFRLNEEIGLVCRL  2349
             MLW+E    LA C   +D  +  L S  E  +  +     C   +H+  L+ E+GL C  
Sbjct  840   MLWEE----LAFCSKSNDVSN-ELPSNMEEILIDETPAAQCKKGNHNLFLDLEVGLKCMN  894

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDH---------FAIPV  2196
             CG V  EI+            S  + +  E++  E ++ D  D +          F  P 
Sbjct  895   CGFVEREIR------------SMDESEWGEKITRERRRCDRFDEEENSNILGRLGFEGPN  942

Query  2195  SSNKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDP--ESKKRG  2022
             +++     V  E   W  IP +++++  HQ+  FEF+W+N+AG+I+  ++     S++ G
Sbjct  943   TNSLHEDCVSSEGTVWDKIPGVKSQMYPHQQEGFEFIWRNLAGTIMLNELKEFENSEETG  1002

Query  2021  GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQI  1842
             GC++SH+PG GKT L I FL +YL  FP  +P+++AP + L TW +E  KW I IP + +
Sbjct  1003  GCIMSHAPGTGKTRLTIIFLQAYLACFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNL  1062

Query  1841  HGGQTYKGEVLRQKMKLC---PGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTL  1671
                + + G+     + L        R ++ + ++    K+  W+   S+L + Y  +  L
Sbjct  1063  SSLE-FTGKENSAALGLLMKKNATARTKNEIRMV----KIYSWIKAKSILGISYNLYEKL  1117

Query  1670  T------------REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNT  1527
                          RE         + ++L   PG+L+LDE H PR+ +S + K L KV T
Sbjct  1118  AGVKDEDKKTKMVREVKPDKELDDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVET  1177

Query  1526  SLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARK  1347
               RILLSGT FQNNF E  N L LARP++++++   L           K+  ++  R ++
Sbjct  1178  QKRILLSGTPFQNNFQELCNVLGLARPKYLEKLTSTL----------KKSGMTVTKRGKR  1227

Query  1346  MFidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTL  1170
                ++I+ +           G+  LK +   F+ V++G     +LPGL+   +++    L
Sbjct  1228  ALGNEINNR-----------GIEELKAVMLPFVHVHKGSILQRSLPGLRECVVVLNPPEL  1276

Query  1169  QQEIL--VKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfk  996
             Q+ +L  +++   R     F  E E  ++L ++HP L+     S +     +   L + K
Sbjct  1277  QKRVLESIEVTHNRKTKNVF--ETEHKLSLVSVHPSLVSRCKLSEKERLSIDETLLAQLK  1334

Query  995   fdl---kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLV  825
                   K   K +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL 
Sbjct  1335  KVRLDPKQSVKTRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFNWNPGEEVLY  1394

Query  824   LQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQ  645
             + G +E  +R  ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +Q
Sbjct  1395  MHGKLEQKQRQTLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQ  1454

Query  644   AIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             AI+RA+R GQ ++VY Y L+A GT E  KY +   K+ +S ++F+
Sbjct  1455  AISRAYRIGQQRIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFA  1499



>ref|XP_010695456.1| PREDICTED: SNF2 domain-containing protein CLASSY 4-like [Beta 
vulgaris subsp. vulgaris]
Length=1133

 Score =   306 bits (785),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 218/699 (31%), Positives = 336/699 (48%), Gaps = 90/699 (13%)
 Frame = -3

Query  2516  LWKEMELALA--------SCYLLDDTEDTNL-KSATELHMATKKGTRVCHHDFRLNEEIG  2364
             L++E+   L         SC   ++ ED  L  SA        +G     HD    EEIG
Sbjct  439   LFQELNFGLGVIDIGSETSCLDHNEKEDAVLCDSAIMQEKLCSQGKHYLIHD----EEIG  494

Query  2363  LVCRLCGVVSTEIKDVPPPFMPSTCSSSGKE---QRPEEVVMEEKQGDDADLDHFAIPVS  2193
             + C+ C  V  EI+DV P F  +   SS      + P +         +   D F +P S
Sbjct  495   IRCKFCLFVELEIRDVTPDFNKNLFGSSTHRYCGKFPNDT--------NVSSDRFELPGS  546

Query  2192  SNKPSS--EVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESK-KRG  2022
             +N  ++  E +     W LIP  ++ L  HQ++ FEF+W N+AG I    ++  SK   G
Sbjct  547   NNDFAADHENDTRGTVWDLIPGTKDNLYEHQQKGFEFMWTNVAGGIKLENLNNNSKYGLG  606

Query  2021  GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQI  1842
             GC+I H+PG GKT L I FL S++K +  S+P+++AP + L TW +E  +W + +P   +
Sbjct  607   GCIICHAPGTGKTRLAIVFLQSFIKQYSMSKPIIIAPSSMLLTWEEEFARWNVDVPFLNL  666

Query  1841  HGGQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT--  1668
             +  +  + E+  + +     L   + V     C+     W     +L + YT F  L   
Sbjct  667   NNAELSRKEI--EALAYVDNLKNCKAVRETKLCI-----WAMGKGILGISYTLFEQLAGE  719

Query  1667  RED----------STYAHRKY--MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTS  1524
             RED           +Y   +Y  + + L +  G+LILDEGH PR+  S++ K L +V T 
Sbjct  720   REDKEKKETHNKKDSYKKERYEIVKKALLEQTGVLILDEGHTPRNETSKIWKVLSEVKTK  779

Query  1523  LRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKM  1344
              RI+LSGT FQNNF E +NT+ L R  F D   + +  K   +++  K    L NR +  
Sbjct  780   RRIILSGTPFQNNFEELYNTISLVREEFGDPFNRGVYLKGGPKIRTDKKIEDLRNRMKH-  838

Query  1343  FidkiskkidsskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQ  1167
                                           F+ V++G      L GL    L++  + LQ
Sbjct  839   ------------------------------FVHVHKGEILRTTLLGLFHSVLILNPSELQ  868

Query  1166  QEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl  987
                   L + R       L+ + L+++ ++HPWL+ T+     +    + + L K K DL
Sbjct  869   TTYFKHLANVRN-----GLKSDHLVSIASVHPWLLCTSEPLPDF---VDEKTLNKHKTDL  920

Query  986   kLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIE  807
               G K +F+  LI   L + EKVL+F   + P+    ++ +    W +G E L ++G   
Sbjct  921   AAGVKTQFLFELIK--LSKGEKVLVFSQFLHPLTFIGDLLKLHMNWSEGTEFLFMEGKQR  978

Query  806   LFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAF  627
                R  ++  F + G  ++V+LAS   C EGI L  ASRV+LLD  WNPS  +QAI+RA+
Sbjct  979   PKLRQSLIKLFNDPGSEARVLLASTKACCEGIHLVGASRVVLLDVVWNPSVERQAISRAY  1038

Query  626   RPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             R GQ K V+VY L+  GTLE +KY R   K+ +S  +F+
Sbjct  1039  RLGQTKDVFVYHLITAGTLEGDKYYRQVEKDRLSEKVFT  1077



>gb|KEH22456.1| SNF2 family amino-terminal protein [Medicago truncatula]
Length=1351

 Score =   308 bits (790),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 233/749 (31%), Positives = 361/749 (48%), Gaps = 102/749 (14%)
 Frame = -3

Query  2522  DMLWKEMELAL----ASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVC  2355
             ++LW E+E  L    A C +       NL    E   A+   +  C H+  L+EEIG  C
Sbjct  632   EVLWDELETTLRELEAVCKI------GNL----ETDEASGSPSSCCEHNIFLDEEIGEYC  681

Query  2354  RLCGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDAD----LDHFAIPVSSN  2187
             + CGVV TE K + P  +         ++ P E   +    DD+      D     VS  
Sbjct  682   KSCGVVITETKYISPLVI---------DRFPHEGYRKRASFDDSVNASLFDGSKFNVSDG  732

Query  2186  KPSSEV-EVEDNAWALIPD-LRNKLRAHQRRAFEFLWKNIAGSIIP---TQIDPESKKRG  2022
             +  +     E   W LIPD ++     HQ+  FEF+WKN+ G+I     ++ DP  ++ G
Sbjct  733   ESETNFSHNEGTVWDLIPDDVKETSYPHQKEGFEFIWKNLTGNIDLHKLSKTDP--RREG  790

Query  2021  GCVISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQI  1842
             GC+ISH+PG GKT L I FL+SYLK+FP   P+++AP + L TW  E  KW + +P + +
Sbjct  791   GCIISHAPGTGKTRLTIMFLMSYLKVFPKCLPVIVAPASLLLTWEDEFKKWDVGVPFHNL  850

Query  1841  HG----GQTYKGEV-LRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFL  1677
             +     G+ +   V L       P    ++D   ++    K+  W    S+L + Y+ + 
Sbjct  851   NNLELSGKEHGDAVNLHNWSNARP----SKDTTRMV----KLISWYKESSILGISYSLYE  902

Query  1676  TLT-------RED---------------------STYAHRKYMNQVLRQCPGILILDEGH  1581
              L         ED                     ST     YM +VL + PG+L+ DEGH
Sbjct  903   KLAGGGGECDDEDEKKRKQARGVRSKNKREKKYASTEKRNGYMRKVLLEAPGLLVFDEGH  962

Query  1580  NPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPRFVDEVLKELDPKYK  1401
              PRS KS L   L+++ T+ RI+LSGT FQNNF E +NTL L +P F + +         
Sbjct  963   TPRSEKSLLWNMLLEIQTNKRIILSGTPFQNNFMELYNTLSLMKPSFPNTI---------  1013

Query  1400  KRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNI--LKKLTTGFIDVYEGGS  1227
                        L+N  +K    K SKK              I  LK L   F+ V++G  
Sbjct  1014  --------SLKLKNFCQKPKRKKTSKKSSWELVSGNSSDNEIKQLKLLMDPFVHVHKGAI  1065

Query  1226  -SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITLGAIHPWLIRTTA  1050
                 LPGL+   L +K  + Q++ L  ++    I+   P      +T+ ++HP L+    
Sbjct  1066  LQKKLPGLRNCILTLKPDSFQKQTLESIKSSHNIFISEPK-----VTMASVHPSLLLECK  1120

Query  1049  CSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEI  870
                +     + + LEK + +   G K KF++  +  C    EKVL+F   + P+ L  + 
Sbjct  1121  LLEEEESVLDKDRLEKLRLNPNGGVKTKFLVEFVRLCDAVNEKVLVFSELLGPLRLIKDQ  1180

Query  869   FERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITTCAEGISLTAASR  690
                   W    E+L + G + L E+  ++  F +    +K++LAS   C+EGISL  ASR
Sbjct  1181  LSSSLNWTDK-EILYMDGVVRLKEKQELIHSFNDANCQAKILLASTRACSEGISLVGASR  1239

Query  689   VILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFS  510
             V+LLD  WNPS  +QA++RA+R GQ +VVY Y LL  GT E  KY + + K+ +S ++FS
Sbjct  1240  VVLLDVVWNPSVERQAVSRAYRIGQKRVVYTYHLLTEGTTEHLKYFKQSEKDRLSELVFS  1299

Query  509   EDLVE-DPSHWQAPKIEDELLGEIVEEDR  426
             +  ++ D S   A   +D++L  +++ ++
Sbjct  1300  DKHIDNDESKSCAVDFDDKVLDLMLQHEK  1328



>ref|XP_002892292.1| hypothetical protein ARALYDRAFT_470549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68551.1| hypothetical protein ARALYDRAFT_470549 [Arabidopsis lyrata subsp. 
lyrata]
Length=1406

 Score =   306 bits (785),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 219/738 (30%), Positives = 360/738 (49%), Gaps = 65/738 (9%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             + LW+E+     S  +  +   +N++             +  +H+  L+ E+GL C  CG
Sbjct  689   ETLWEELAFFSKSNEIGGNELPSNVEKDILTKETPAAQCKKGNHELCLDLEVGLKCMHCG  748

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
              V  EI+ +    +        +E+R  +   EE+         F  P +S      +  
Sbjct  749   FVEREIRSMD---VSEWGEKITRERRKIDRFEEEEGSSFIGKLGFEPPNNSLNEGC-ISS  804

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQID--PESKKRGGCVISHSPGAG  1989
             E   W  IP +++++  HQ+  FEF+WKN+AG+I+  ++     S + GGC++SH+PG G
Sbjct  805   EGTVWDKIPGVKSQMYPHQQEGFEFIWKNLAGTILLNELKDFENSDETGGCIMSHAPGTG  864

Query  1988  KTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE--  1815
             KT L I FL +YL+ FP  +P+++AP + L TW +E  KW I IP + +        E  
Sbjct  865   KTRLTIIFLQAYLQCFPDCKPVIIAPASLLLTWAEEFKKWNISIPFHNLSSLDFTGKESS  924

Query  1814  -VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT----------  1668
               L   M+       N ++  V     K+  W+   S+L + Y  +  L           
Sbjct  925   AALGLLMQKNATARSNNEIRMV-----KIYSWIKSKSILGISYNLYEKLAGVKDEDKKTK  979

Query  1667  --REDSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLF  1494
               RE         + ++L   PG+L+LDE H PR+ +S + K L KV T  RILLSGT F
Sbjct  980   TVREVKPDKELDDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLSGTPF  1039

Query  1493  QNNFGEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkid  1314
             QNNF E  N L LARP++++ +   L           K+  ++  R +K   ++I+ +  
Sbjct  1040  QNNFQELCNVLGLARPKYLERLTSTL----------KKSGMTVTKRGKKALGNEINNR--  1087

Query  1313  sskererkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEIL--VKLQ  1143
                      G+  LK +   F+ V++G     +LPGL+   +++    LQ+ +L  +++ 
Sbjct  1088  ---------GIEELKAVMLPFVHVHKGSILQSSLPGLRECVVVLNPPELQRRVLESIEVT  1138

Query  1142  DQRPIYKGFPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdl---kLGSK  972
               R     F  E E  ++L ++HP L+     S +     +   L + K          K
Sbjct  1139  HNRKTKNVF--ETEHKLSLVSVHPSLVSRCKLSEKERLSIDEALLAQLKKVRLDPNQSVK  1196

Query  971   VKFVMSLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERG  792
              +F+M  +  C + KEKVL+F   I P+ L ++     + W  G EVL + G +E  +R 
Sbjct  1197  TRFLMEFVELCEVIKEKVLVFSQYIDPLKLIMKHLVSRFKWNPGQEVLYMHGKLEQKQRQ  1256

Query  791   RVMDKFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQD  612
              ++++F +    +KV LAS   C+EGISL  ASRVILLD  WNP+  +QAI+RA+R GQ 
Sbjct  1257  TLINEFNDPKSKAKVFLASTKACSEGISLVGASRVILLDVVWNPAVERQAISRAYRIGQQ  1316

Query  611   KVVYVYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEE  432
             ++VY Y L+A GT E  KY +   K+ +S ++F+     D           E + E+V E
Sbjct  1317  RIVYTYHLVAKGTPEGPKYCKQAQKDRISELVFACSSRHDKGK--------EKIAEVVTE  1368

Query  431   DRATLFHMIMKNEKASNM  378
             D+  +   ++++ K  +M
Sbjct  1369  DK--VLDTMVQHSKLGDM  1384



>ref|XP_004245838.2| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Solanum 
lycopersicum]
Length=1084

 Score =   303 bits (775),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 224/682 (33%), Positives = 349/682 (51%), Gaps = 65/682 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D L+ EM++    C L      TN  S + +      G ++ +H   L+E+IGL+C++C 
Sbjct  404   DDLFVEMDM----CILESRIGFTN-PSDSPIQSEKTSGCQMGNHQLFLDEQIGLICKVCS  458

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDA---DLDHFAIPVSSNKPSSE  2172
              V  E K + PPF   T    G+ +R       +  G+     D+D F    SS    + 
Sbjct  459   HVHLESKYIFPPFAERT---RGRHER-------KYFGESPSLWDVDGFKFYDSSAVHDAA  508

Query  2171  VEVEDNAWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIPTQI-DPESKKRGGCVISHSP  1998
             +  E   W L+P   +  +  HQR  FEF+WKNI G +   ++ +P S  RGGC+ISH P
Sbjct  509   IYGEGTVWDLVPLSAKTTMYPHQREGFEFMWKNIVGDMYLEKLKEPISGNRGGCIISHPP  568

Query  1997  GAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKG  1818
             G GKT L I FL ++LK FP  RP+++AP   L  W  E  KW++ IP + ++  + +  
Sbjct  569   GTGKTRLTIVFLQAFLKQFPKCRPVIIAPSNLLLNWEAEFQKWEVDIPFHNLN-SKDFSS  627

Query  1817  EVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDS-TYAHR  1641
             +     + +   L R       L  + K++ W    SVL + Y  F  LT ED  +YA  
Sbjct  628   QEDEATVSVFHCLSRAGKNNPHLIRMVKLRSWAKSKSVLGISYDLFRILTGEDGDSYATE  687

Query  1640  KYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTL  1461
               + ++L + PG+L+L+EGH  R+ +S + KAL K+ T  RILLSGT FQNN  E +NTL
Sbjct  688   --IKEILLKLPGLLVLEEGHTARNDQSLVWKALNKIETEKRILLSGTPFQNNIKELYNTL  745

Query  1460  CLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGL  1281
             C+  P+F      +L+ K+      A    S++   R                      L
Sbjct  746   CVVSPKFA----ADLEHKW------AYLSSSIDKNVR---------------------AL  774

Query  1280  NILKKLTTGFID-VYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLEL  1104
               L+ +    +    E     +LPG++   + +K T LQ+E+L ++    P + G   E 
Sbjct  775   EELRDMIAPLVHKCSENVKKVSLPGIRDIVIHLKPTHLQKELLKRI----PEFPGSFYE-  829

Query  1103  ELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKE  924
             + +++L ++HP L+ T     ++   E        + D   G K+KFV+ LI  C   KE
Sbjct  830   QNMVSLISVHPSLVATRK---EFADLESQLKERGCRLDPDNGVKMKFVVELIRLCGGLKE  886

Query  923   KVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVM  744
             +V+IF   + P+NL  E     +GW  G E+L + G +++ +R   ++   +     KV+
Sbjct  887   RVIIFSQLLDPLNLIKEQLHSLFGWTLGREILYMDGKLDVKQRQISINSLNDPKSDVKVL  946

Query  743   LASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEE  564
             LASI  C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ K V+VY  +++   E 
Sbjct  947   LASIKACSEGISLIGASRVVLLDVLWNPSVEQQAISRAYRNGQTKFVHVYCPVSS-KWEV  1005

Query  563   EKYKRTTWKEWVSSMIFSEDLV  498
             +K ++ T K++ S +I S + V
Sbjct  1006  DKIEQQTKKKYHSDVIMSRNKV  1027



>gb|KDO36323.1| hypothetical protein CISIN_1g047478mg [Citrus sinensis]
Length=343

 Score =   283 bits (723),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/302 (50%), Positives = 202/302 (67%), Gaps = 10/302 (3%)
 Frame = -3

Query  4205  KRRSIHQNEHPFDVYPFEAFRNGSWQPVERIRIQNGTFGMHVLDEGDLIEEEISISNVRI  4026
             +RR ++Q++ PFD +PFEAF + SW+ VE IRI++GT  MH+ D     E+    SN+RI
Sbjct  3     RRRHLYQSKQPFDDHPFEAFFHDSWRTVELIRIKDGTMTMHLKDNQCYTEKRRPFSNLRI  62

Query  4025  RSRNATSSDCACFLRPGLDISVFSTPHQsedsdeennedEKMEPEPAWIDAKIRSIERKP  3846
             RSR ATSSDC CFLRPG+D+ V S    +E  DEEN        EP W+DAKI SIERKP
Sbjct  63    RSRKATSSDCTCFLRPGIDVCVLSASQDAECLDEENE-------EPVWVDAKISSIERKP  115

Query  3845  HGFGCVCQFHISVYVTQGPPPIVKKTLSKEIKVVQLNQIAILQKIEQKPCEDKYYRWSLS  3666
             H   C C+F++  YV  GP  + +  LSKE K+V ++QI ILQK+ +  CED+YYRW+ S
Sbjct  116   HEGQCSCRFYVEFYVNPGPLGLERGALSKETKLVGIDQITILQKLGRDACEDQYYRWNFS  175

Query  3665  DDCSTLQKFKLFTGKFCSDLSWMLVASAHKQVGFDVKSVHNRIVYEILKDENDIDAPNSE  3486
             +DCS+LQK K+  GKF SDLS+++VAS  KQ  FD++SV  +IVY+IL  ++D  + NS 
Sbjct  176   EDCSSLQKTKMLLGKFSSDLSFLIVASVLKQTAFDIRSVQKKIVYQILGSDDDNSSLNSI  235

Query  3485  YHSYAVSFKLENEVSTPIIIQF-NPDIPERGPEGDVYEAGPLVVYD--ELRRSKRRFVQP  3315
              +  A++FK+E+ VS+  + QF  PD  E    G   E G L +YD   L+RSKRR VQP
Sbjct  236   NNLNAINFKVEDGVSSSHLFQFIPPDTKEVSIAGGTEEVGLLPIYDVMNLQRSKRRNVQP  295

Query  3314  ER  3309
             +R
Sbjct  296   DR  297



>emb|CDP18763.1| unnamed protein product [Coffea canephora]
Length=1179

 Score =   303 bits (775),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 214/680 (31%), Positives = 327/680 (48%), Gaps = 72/680 (11%)
 Frame = -3

Query  2522  DMLWKEMELAL---ASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCR  2352
             D L+ EME+ L   AS +     + T+  +AT    A  +  R   H   L E IG++C+
Sbjct  492   DDLFTEMEMCLTLPASDFTESSKDGTHHVTATAKCQA--ELCRSGKHQLILEEPIGIICK  549

Query  2351  LCGVVSTEIKDVPPPFMPSTCSSSG--KEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPS  2178
              C +V  E+K++ P     T         +R +   M E   DD+   ++          
Sbjct  550   CCQIVHKEMKEIFPTLKMETPRRRDWVDLRRGDCFGMHELHFDDSSFGNYY---------  600

Query  2177  SEVEVEDNAWALIPD-LRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRG-GCVISH  2004
             + ++ E +   LIP+ +R  + +HQ   F FLWKNI G     ++  E    G G +ISH
Sbjct  601   TSIDAEGSVLDLIPEHIRMSMYSHQLDGFVFLWKNIVGETWIEKLKTELSDDGRGAIISH  660

Query  2003  SPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTY  1824
             +PG GKT L I F++S LK++P  RP+++AP + L TW  E  KW   IP +  +  +  
Sbjct  661   APGTGKTCLTIVFILSLLKMYPMCRPVIIAPTSMLLTWENEFRKWGHRIPFHNFNS-KDL  719

Query  1823  KGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
              G  L+   +          +  V   + K+  W    SVL + Y  F  +         
Sbjct  720   SGNELKTDAEF---------LRRVGSRMTKLYSWTKEKSVLGISYKLFEQIASGRKGKGS  770

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
              + + ++  Q PG ++LDEGH PR+ +S + K L  V T  +I+LSGT FQNNF E +NT
Sbjct  771   GERLGEIFLQLPGFVVLDEGHTPRNQQSLVWKVLTGVKTKRKIILSGTPFQNNFDELYNT  830

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGAKTRF-SLENRARKMFidkiskkidsskererkE  1287
             LCL  P+                + G+K R+ SL N   K                    
Sbjct  831   LCLVNPK----------------LSGSKERWVSLTNAIDK----------------NSDN  858

Query  1286  GLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPL  1110
              +  LK +   F+ V++G    ++LPGL+   ++++ T  Q+EIL  + D    +    L
Sbjct  859   AVEELKAMIDPFVHVHKGSILEESLPGLKDTLVILRPTDEQKEILQLILDDWSRFDQVHL  918

Query  1109  ELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLR  930
                  ++L ++HP L    A S ++   ++   +         G K KF + LI  C   
Sbjct  919   -----VSLISVHPSL---AAFSKRFSAHKDRLGVLGCSPYA--GVKTKFAIELIRLCDAS  968

Query  929   KEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSK  750
              EKVL+F   I P+   ++       WR+GIEVL + G  +   R   +    +     K
Sbjct  969   HEKVLVFSEFIHPLRFIMQQLMDQLKWREGIEVLYMDGKCDEKNRQSSISSLNDASSKVK  1028

Query  749   VMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTL  570
             V+ AS   C+EGI+L  ASRV+LLD  WNPS  +QAI+RA+R GQ K VYVY L+ +GTL
Sbjct  1029  VLFASTKACSEGINLIGASRVVLLDVVWNPSVERQAISRAYRLGQKKFVYVYHLITSGTL  1088

Query  569   EEEKYKRTTWKEWVSSMIFS  510
             E EKY +   K+ +S ++FS
Sbjct  1089  EVEKYAQQANKDRLSELVFS  1108



>gb|EMS64562.1| DNA repair and recombination protein RAD54-like protein [Triticum 
urartu]
Length=1229

 Score =   302 bits (774),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 211/685 (31%), Positives = 329/685 (48%), Gaps = 84/685 (12%)
 Frame = -3

Query  2522  DMLWKEMELALASCYL--LDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRL  2349
             +MLW + + AL S  +    D E     +  +L + +K       H+F ++++IG+ C+ 
Sbjct  552   NMLWGDFDFALESENIGTYYDDEHQGESNVLDLGLPSKTPCSRGKHEFIIDDQIGIRCKY  611

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRP-------EEVVMEEKQGDDADLDHFAIPVSS  2190
             C +V+ EI+ V P  +     S+  E+ P       +E +M     + A         S 
Sbjct  612   CSLVNLEIRFVLPSMV-----SNYAEKTPWRNGSCLKEALMYHDLCEQAG--------SV  658

Query  2189  NKPSSEVEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKR--GGC  2016
             +  S +  +    W LIP +   +  HQR AFEF+W N+ G I   ++   +K    GGC
Sbjct  659   DGQSQDFHLYGTVWDLIPGVITSMYQHQREAFEFMWTNLVGDIRLDELKHGAKPDVVGGC  718

Query  2015  VISHSPGAGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHG  1836
             VI H+PG GKT L I F+ +Y+K+FP  RP+++AP+  L+ W +E  KW + +P + I  
Sbjct  719   VICHAPGTGKTRLAIVFIQTYMKVFPDCRPVIIAPRGMLFAWEEEFKKWDVNVP-FHIMN  777

Query  1835  GQTYKGEVLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTRED-  1659
                + G+  R   +L     R + +  ++    K+  W     +L + Y  ++ LT E  
Sbjct  778   TTDFSGKEDRDICRLIKKEHRTEKLTRLV----KLLSWNKGHGILGISYGLYMKLTSEKK  833

Query  1658  STYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFG  1479
             S       +  +L + PG+L+LDEGH PR+ +S + K L KV T  RI+LSGT FQNNF 
Sbjct  834   SGCTEGNKVRTILLENPGLLVLDEGHTPRNERSIMWKTLGKVKTEKRIILSGTPFQNNFL  893

Query  1478  EYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidssker  1299
             E +N LCL RPRF +  L E      K+V   +  +  + R  K           S    
Sbjct  894   ELYNILCLVRPRFGEMFLTE------KKV--GRRHYVSKKRQDKFSDKYEKGVWASLTSN  945

Query  1298  erkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKG  1119
                +    ++ +   F+ ++ G     LPGL+   +++K   LQ+ I+ K+++   I  G
Sbjct  946   VTDDNAEKVRSILKPFVHIHNGTILRTLPGLRESVIVLKPPPLQKSIIRKVEN---IGSG  1002

Query  1118  FPLELELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRC  939
                E E +I+L + HP L+     S +     +   LE+ + +   G K +FV+ ++  C
Sbjct  1003  NNFEHEYVISLASTHPSLVTAINMSEEEASLIDKPMLERLRSNPYEGVKTRFVIEVVRLC  1062

Query  938   LLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGG  759
                KEK                           IEV                  F     
Sbjct  1063  EALKEKT-------------------------SIEV------------------FNNPDS  1079

Query  758   PSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLAT  579
              +KV+LAS   C EGISLT ASRV+LLD  WNP+  +QAI+RAFR GQ K VY Y L+  
Sbjct  1080  DAKVLLASTRACCEGISLTGASRVVLLDVVWNPAVGRQAISRAFRIGQKKFVYTYNLITY  1139

Query  578   GTLEEEKYKRTTWKEWVSSMIFSED  504
             GT E +KY R   K+ +S ++FS++
Sbjct  1140  GTGEGDKYDRQAEKDHLSKLVFSQE  1164



>ref|XP_004510995.1| PREDICTED: transcriptional regulator ATRX homolog [Cicer arietinum]
Length=870

 Score =   295 bits (755),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 205/676 (30%), Positives = 339/676 (50%), Gaps = 80/676 (12%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D +W+EM +A+         E +   S        ++    C H F L +++G VCR+CG
Sbjct  228   DDIWREMSMAI---------ETSKDVSDDPPPEEEEEEDADCDHSFVLKDDLGYVCRVCG  278

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
             V+   I+ +             K +R     + +       +D F + ++ +     +  
Sbjct  279   VIDRGIETI--------FEFQYKVKRSTRTYVSDSSNGKEKVDVFGVKIADD---DLIVT  327

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
             E +A    P   N+++ HQ   F FL +N+AG       +P     GGC+++H+PG+GKT
Sbjct  328   EISAH---PRHANQMKPHQIEGFNFLVRNLAGD------NP-----GGCILAHAPGSGKT  373

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLR  1806
              +II+F+ S+L  +P +RPLV+ PK  L TW KE   W++  IP+Y  +   T K +   
Sbjct  374   FMIISFMQSFLGKYPSARPLVVLPKGILSTWKKEFQTWQVEDIPLYDFY---TVKADNRY  430

Query  1805  QKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQ  1626
             Q+                   LE +++W+A+ S+L +GY  F ++  ++S         +
Sbjct  431   QQ-------------------LEVLKQWVANKSILFLGYKQFSSIVCDNSNNNASISCQE  471

Query  1625  VLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARP  1446
             +L + P ILILDEGH PR+  + + ++L KV T  +++LSGTL+QN+  E FN L L RP
Sbjct  472   ILLKVPSILILDEGHTPRNENTDMVQSLAKVQTPRKVVLSGTLYQNHVKEVFNVLNLVRP  531

Query  1445  RFVD-EVLKELDPKYKKR--VKGAKTRFS--LENRARKMFidkiskkidsskererkEGL  1281
             +F+  E  K +  + K R  ++G K  FS  +EN  +K               + +   +
Sbjct  532   KFLQMETSKPIVRRIKSRIYIQGVKA-FSELVENTLQK-----------DPDFKRKVAVI  579

Query  1280  NILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELE  1101
             + L+++T+  +  Y+G   D LPGL  +T+++K T  Q+  + K+   + I + F  ++ 
Sbjct  580   HDLREMTSKVLHYYKGDFLDELPGLVDFTVILKLTPRQKHEVEKV---KRISRKF--KMS  634

Query  1100  LLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEK  921
              + T   +HP L        +    + +        D++ G K KF  +++  C    EK
Sbjct  635   SVGTAVYLHPKLKPVAEKCDEKSISDHVMDDLIENIDVRDGVKSKFFRNMLNLCESAGEK  694

Query  920   VLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVML  741
             +L+F   + P+     I  ++ GW  G E+ V+ G+    +R   M+KF      +++  
Sbjct  695   LLVFSQYLLPLKYMERITMKWKGWSLGKEIFVISGETSSEDRELSMEKFNN-SPDARIFF  753

Query  740   ASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEE  561
              SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A  + EEE
Sbjct  754   GSIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQTKKVFVYRLIAADSPEEE  813

Query  560   KYKRTTWKEWVSSMIF  513
              +     KE +S M F
Sbjct  814   DHNTCFKKELISKMWF  829



>dbj|BAC84084.1| putative SNF2 domain/helicase domain-containing protein [Oryza 
sativa Japonica Group]
Length=872

 Score =   294 bits (753),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 213/687 (31%), Positives = 332/687 (48%), Gaps = 76/687 (11%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-TNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             LWK+  LA A C  LD  ED +N K   + +         C+HD R++E++G VCR+CG+
Sbjct  217   LWKDFSLA-AECTKLDTNEDMSNEKDVDDENEMDDD----CNHDIRIHEDLGHVCRICGM  271

Query  2339  VSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVE  2160
             +  + + +             K  R      E +  D  D+D  A+ VS +   S++   
Sbjct  272   IVRKAETI-------IDYQWKKASRTRTNYYESRSKDADDIDTGAVKVSEDFIVSDI---  321

Query  2159  DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTL  1980
                 A+ P    ++R HQ   F FL KN+ G            K GGC+++H+PG+GKT 
Sbjct  322   ----AIHPRHAKQMRPHQLEGFSFLVKNLVGD-----------KPGGCILAHAPGSGKTF  366

Query  1979  LIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLRQ  1803
             ++I+F+ S+L  +P +RPLV+ PK  L TW +E  +W++  IP+Y  +  +  K      
Sbjct  367   MLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKR-----  421

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQV  1623
                               + LE ++ W A  S+L +GY  F  +   D            
Sbjct  422   -----------------TEQLEVLKSWEARMSILFLGYKQFSRIICGDGDGNIAAACRDR  464

Query  1622  LRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPR  1443
             L   P +LILDEGH PR+ ++ +  +L +V T  +++LSGTLFQN+  E FN L L RP+
Sbjct  465   LLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRPK  524

Query  1442  FVD-EVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG-LNILK  1269
             F+  E  + +  +   +V  +  R SL+      F + +   + +     RK   +  L+
Sbjct  525   FLKMESSRPIARRIMSQVAISGIR-SLKGVHDSAFTESVEDTLLNDDNFTRKSHVIRSLR  583

Query  1268  KLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLIT  1089
             +LT   +  Y+G   D LPGL  +++ +K +T Q+EI+ K++     Y+ F  +   + T
Sbjct  584   ELTKDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIE----AYEKF--KRSAVGT  637

Query  1088  LGAIHPWLIRTT---ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKV  918
                IHP L   +   A        +           +K G K KF  +++       EK+
Sbjct  638   ALYIHPCLSEISEGDAADRATNLTDATVDSLIESIIIKDGVKAKFFFNILSLANSAGEKL  697

Query  917   LIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLA  738
             L F   I P+     +  +  GW  G E+ ++ GD    +R   MD+F      +KV+  
Sbjct  698   LAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNN-SADAKVLFG  756

Query  737   SITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE---  567
             SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A  + E   
Sbjct  757   SIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAADSPEVKF  816

Query  566   -EEKYKRTT----WKEWVSSMIFSEDL  501
              E  +K+      W EW S +  +ED 
Sbjct  817   HETAFKKEVIPKLWFEW-SELCTTEDF  842



>gb|KCW73204.1| hypothetical protein EUGRSUZ_E01664, partial [Eucalyptus grandis]
Length=596

 Score =   287 bits (734),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 202/598 (34%), Positives = 310/598 (52%), Gaps = 59/598 (10%)
 Frame = -3

Query  2144  LIPDLRNKLRAHQRRAFEFLWKNIAGSI-IPTQIDPESKKRGGCVISHSPGAGKTLLIIA  1968
             LIP   +K+  HQ   FEF+WKNIAGS  +    + E    GGC+ISH+PG GKT + I 
Sbjct  7     LIPCDSSKMYPHQLEGFEFMWKNIAGSTDLKDLSNSEPNDVGGCIISHAPGTGKTCMTIL  66

Query  1967  FLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWK----IPIPVYQIHGGQTYKGEVLRQK  1800
             FL +YL+LFP SRP+V+AP + L TW +E  KW       I  + ++  + + G    + 
Sbjct  67    FLHTYLRLFPNSRPVVIAPASLLLTWEEEFKKWNKKWDTSILFHNLNNPE-FSGAENPEA  125

Query  1799  MKLCPG---LPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLT-----------RE  1662
             +++      L R  DVM V+    K+  W  + S+L + Y  +  L            ++
Sbjct  126   VRMVEANSHLKRCSDVMRVI----KVYSWSKNSSILGISYNLYEKLAVHNRKGTKDPVKK  181

Query  1661  DSTYAHRKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNF  1482
                    + M ++L   PG+++LDEGH PR+ +S + K L+K+ T  RI+LSGT FQNNF
Sbjct  182   AKIEKKDEEMRKILLDLPGVVVLDEGHTPRNQRSSIWKLLLKLRTEKRIILSGTPFQNNF  241

Query  1481  GEYFNTLCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              E +NTLCL RP   +E+   L             +F    + ++   D I+  +    +
Sbjct  242   LELYNTLCLVRPTMANELPLSL------------KKFCQTTQWKRAKTDDINSLVQPHDK  289

Query  1301  rerkEGLNILKKLTTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIY  1125
                   +N L+ +   F+ V++G    +NLPG++   +++     Q++I+  +Q  +  +
Sbjct  290   VADDAIVN-LRSIMAPFVHVHKGSILKENLPGIKECIVVLNPGDRQKKIVENIQRSQCTF  348

Query  1124  KGFPLELELLITLGAIHPWLIRTTACSGQYfke----eelealekfkfdlkLGSKVKFVM  957
                  E E  ++L  IHP LI   +C+    ++     E + LE  K     G K +F++
Sbjct  349   -----EYEFKLSLACIHPSLI--LSCNAYANEKPLICHERQKLEDLKTHTDAGIKTRFLV  401

Query  956   SLIPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGW-RKGIEVLVLQGDIELFERGRVMD  780
              LI       EKVL+F     P++   +     + W  +G E+L + G + L ER R++ 
Sbjct  402   ELIRLSEALGEKVLVFSQYKEPLSFISDQLRLTFQWSSQGKELLHMHGSLNLRERQRLIG  461

Query  779   KFEEVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVY  600
             KF      ++VMLAS   C+EGISL  ASRV+LLD  WNPS  +QAI+RAFR GQ+KVVY
Sbjct  462   KFNNPQSQARVMLASTKACSEGISLVGASRVVLLDVVWNPSVERQAISRAFRIGQEKVVY  521

Query  599   VYQLLATGTLEEEKYKRTTWKEWVSSMIFSEDLVEDPSHWQAPKIEDELLGEIVEEDR  426
              Y L+  GT E  K+ +   KE +S + FS      P+     +I D  +  +V EDR
Sbjct  522   TYHLIMKGTSECNKFNQQMEKERLSKLFFS------PAD---KEIGDGTMSSLVAEDR  570



>gb|KDO57017.1| hypothetical protein CISIN_1g006698mg [Citrus sinensis]
Length=635

 Score =   288 bits (736),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 207/660 (31%), Positives = 333/660 (50%), Gaps = 50/660 (8%)
 Frame = -3

Query  2327  IKDVPPPFM--PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVEDN  2154
             IKD+ PPF   PS  +   +    +   +++    D+  D      S          +  
Sbjct  4     IKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFD------SQTGCDPFTHAQGT  57

Query  2153  AWALIP-DLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGG--CVISHSPGAGKT  1983
              W L+P D+R K+  HQR  FEF+WKNIAG I   ++   +   GG  C+ISH+PG GKT
Sbjct  58    VWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKT  117

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGEVLRQ  1803
              L + FL +Y+KL P  RP+++AP++ L TW +E  KW I IP Y ++  +   G+    
Sbjct  118   GLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPE-LSGKENNG  176

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQV  1623
              + L     R +  + ++  + K+  W     +L + Y  F  L   D        ++ +
Sbjct  177   AVALMDNRKRGRGKVGLIRYV-KLYSWKMGTGILGLSYRLFEKLVSGDE-------LSGI  228

Query  1622  LRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPR  1443
             L   PG+ + DEGH PR+  + + KAL ++ T  RI+LSGT FQNNF E  NTL L R  
Sbjct  229   LLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQE  288

Query  1442  FVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEGLNILKKL  1263
             F  EVL+ +  K  + +  AK    + +  R                    E L  LK+ 
Sbjct  289   F-GEVLRTVR-KSGREISKAKHASLISSIGR-------------CANHRDDEKLKELKEK  333

Query  1262  TTGFIDVYEGGS-SDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLITL  1086
                F++V++G    ++LPGL+   ++++    Q+ +   ++      K F +EL   ++L
Sbjct  334   IAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEG----VKSF-VELNYCVSL  388

Query  1085  GAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKVLIFC  906
              ++HP L+           + +   L + K D + G K +F++ L+   L   EKVL+F 
Sbjct  389   LSVHPSLLPQQFFES---FDVDSAKLARLKLDPEAGIKTRFLLILLE--LSTNEKVLVFS  443

Query  905   HNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLASITT  726
               I P+ L +E     + WR+G EVL + G  ++ +R   ++   +    +++MLAS   
Sbjct  444   QYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKA  503

Query  725   CAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEEKYKRT  546
             C EGI+L  ASRV+LLD  WNP   +QAI+RA+R GQ +VV+VY L+ + TLE +K +R 
Sbjct  504   CCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQ  563

Query  545   TWKEWVSSMIF-SEDLVEDPSHWQAPKIEDELLGEIVE---EDRATLFHMIMKNEKASNM  378
               K W S+M+F S D   +     +  +ED++L E+ +       TL + I+   K + +
Sbjct  564   ARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETEL  623



>gb|EEE65467.1| hypothetical protein OsJ_20857 [Oryza sativa Japonica Group]
Length=949

 Score =   294 bits (752),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 219/722 (30%), Positives = 347/722 (48%), Gaps = 79/722 (11%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-TNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             LWK+  LA A C  LD  ED +N K   + +         C+HD R++E++G VCR+CG+
Sbjct  291   LWKDFSLA-AECTKLDTNEDMSNEKDVDDENEMDDD----CNHDIRIHEDLGHVCRICGM  345

Query  2339  VSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVE  2160
             +  + + +             K  R      E +  D  ++D  A+ VS +   S++   
Sbjct  346   IVRKAETI-------IDYQWKKASRTRTNYYESRSKDADEIDTGAVKVSEDFIVSDI---  395

Query  2159  DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTL  1980
                 A+ P    ++R HQ   F FL KN+ G            K GGC+++H+PG+GKT 
Sbjct  396   ----AIHPRHAKQMRPHQLEGFSFLVKNLVGD-----------KPGGCILAHAPGSGKTF  440

Query  1979  LIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLRQ  1803
             ++I+F+ S+L  +P +RPLV+ PK  L TW +E  +W++  IP+Y  +  +  K      
Sbjct  441   MLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKR-----  495

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQV  1623
                              ++ LE ++ W A  S+L +GY  F  +   D            
Sbjct  496   -----------------VEQLEVLKSWEAQMSILFLGYKQFSRIICGDGDGNIAAACRDR  538

Query  1622  LRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPR  1443
             L   P +LILDEGH PR+ ++ +  +L +V T  +++LSGTLFQN+  E FN L L RP+
Sbjct  539   LLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRPK  598

Query  1442  FVD-EVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG-LNILK  1269
             F+  E  + +  +   +V  +  R SL+      F + +   + +     RK   +  L+
Sbjct  599   FLKMESSRPIARRIMSQVAISGIR-SLKGVHDSAFTESVEDTLLNDDNFTRKAHVIRSLR  657

Query  1268  KLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLIT  1089
             +LT   +  Y+G   D LPGL  +++ +K +T Q+EI+ K++     Y+ F  +   + T
Sbjct  658   ELTKDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIE----AYEKF--KRSAVGT  711

Query  1088  LGAIHPWLIRTT---ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKV  918
                IHP L   +   A        +           +K G K KF  +++       EK+
Sbjct  712   ALYIHPCLSEISEGDAADRASNLTDATVDSLIESIIIKDGVKAKFFFNILSLANSAGEKL  771

Query  917   LIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLA  738
             L F   I P+     +  +  GW  G E+ ++ GD    +R   MD+F      +KV+  
Sbjct  772   LAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNN-SADAKVLFG  830

Query  737   SITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE---  567
             SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A  + E   
Sbjct  831   SIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAADSPEVKF  890

Query  566   -EEKYKRTT----WKEWVSSMIFSEDLVEDPSHWQAPKIEDELL-GEIVEEDRATLFHMI  405
              E  +K+      W EW S +  +ED     +       EDELL    + +D   L+  +
Sbjct  891   HETAFKKEVIPKLWFEW-SELCTTEDF--KLNQVDIDDSEDELLEANAIRQDIKALYRRM  947

Query  404   MK  399
             ++
Sbjct  948   LQ  949



>gb|EEC80340.1| hypothetical protein OsI_22411 [Oryza sativa Indica Group]
Length=949

 Score =   293 bits (751),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 219/722 (30%), Positives = 347/722 (48%), Gaps = 79/722 (11%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-TNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             LWK+  LA A C  LD  ED +N K   + +         C+HD R++E++G VCR+CG+
Sbjct  291   LWKDFSLA-AECTKLDTNEDMSNEKDVDDENEMDDD----CNHDIRIHEDLGHVCRICGM  345

Query  2339  VSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVE  2160
             +  + + +             K  R      E +  D  ++D  A+ VS +   S++   
Sbjct  346   IVRKAETI-------IDYQWKKASRTRTNYYESRSKDADEIDTGAVKVSEDFIVSDI---  395

Query  2159  DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTL  1980
                 A+ P    ++R HQ   F FL KN+ G            K GGC+++H+PG+GKT 
Sbjct  396   ----AIHPRHAKQMRPHQLEGFSFLVKNLVGD-----------KPGGCILAHAPGSGKTF  440

Query  1979  LIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLRQ  1803
             ++I+F+ S+L  +P +RPLV+ PK  L TW +E  +W++  IP+Y  +  +  K      
Sbjct  441   MLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKR-----  495

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQV  1623
                              ++ LE ++ W A  S+L +GY  F  +   D            
Sbjct  496   -----------------VEQLEVLKSWEAQMSILFLGYKQFSRIICGDGDGNIAAACRDR  538

Query  1622  LRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPR  1443
             L   P +LILDEGH PR+ ++ +  +L +V T  +++LSGTLFQN+  E FN L L RP+
Sbjct  539   LLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRPK  598

Query  1442  FVD-EVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG-LNILK  1269
             F+  E  + +  +   +V  +  R SL+      F + +   + +     RK   +  L+
Sbjct  599   FLKMESSRPIARRIMSQVAISGIR-SLKGVHDSAFTESVEDTLLNDDNFTRKAHVIRSLR  657

Query  1268  KLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLIT  1089
             +LT   +  Y+G   D LPGL  +++ +K +T Q+EI+ K++     Y+ F  +   + T
Sbjct  658   ELTKDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIE----AYEKF--KRSAVGT  711

Query  1088  LGAIHPWLIRTT---ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKV  918
                IHP L   +   A        +           +K G K KF  +++       EK+
Sbjct  712   ALYIHPCLSEISEGDAADRASNLTDATVDSLIESIIIKDGVKAKFFFNILSLANSAGEKL  771

Query  917   LIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLA  738
             L F   I P+     +  +  GW  G E+ ++ GD    +R   MD+F      +KV+  
Sbjct  772   LAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNN-SADAKVLFG  830

Query  737   SITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE---  567
             SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A  + E   
Sbjct  831   SIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAADSPEVKF  890

Query  566   -EEKYKRTT----WKEWVSSMIFSEDLVEDPSHWQAPKIEDELL-GEIVEEDRATLFHMI  405
              E  +K+      W EW S +  +ED     +       EDELL    + +D   L+  +
Sbjct  891   HETAFKKEVIPKLWFEW-SELCTTEDF--KLNQVDIDDSEDELLEANAIRQDIKALYRRM  947

Query  404   MK  399
             ++
Sbjct  948   LQ  949



>gb|EEE67065.1| hypothetical protein OsJ_24029 [Oryza sativa Japonica Group]
Length=969

 Score =   294 bits (752),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 220/720 (31%), Positives = 344/720 (48%), Gaps = 79/720 (11%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-TNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             LWK+  LA A C  LD  ED +N K   + +         C+HD R++E++G VCR+CG+
Sbjct  311   LWKDFSLA-AECTKLDTNEDMSNEKDVDDENEMDDD----CNHDIRIHEDLGHVCRICGM  365

Query  2339  VSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVE  2160
             +  + + +             K  R      E +  D  D+D  A+ VS +   S++   
Sbjct  366   IVRKAETI-------IDYQWKKASRTRTNYYESRSKDADDIDTGAVKVSEDFIVSDI---  415

Query  2159  DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTL  1980
                 A+ P    ++R HQ   F FL KN+ G            K GGC+++H+PG+GKT 
Sbjct  416   ----AIHPRHAKQMRPHQLEGFSFLVKNLVGD-----------KPGGCILAHAPGSGKTF  460

Query  1979  LIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLRQ  1803
             ++I+F+ S+L  +P +RPLV+ PK  L TW +E  +W++  IP+Y  +  +  K      
Sbjct  461   MLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKR-----  515

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQV  1623
                               + LE ++ W A  S+L +GY  F  +   D            
Sbjct  516   -----------------TEQLEVLKSWEARMSILFLGYKQFSRIICGDGDGNIAAACRDR  558

Query  1622  LRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPR  1443
             L   P +LILDEGH PR+ ++ +  +L +V T  +++LSGTLFQN+  E FN L L RP+
Sbjct  559   LLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRPK  618

Query  1442  FVD-EVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG-LNILK  1269
             F+  E  + +  +   +V  +  R SL+      F + +   + +     RK   +  L+
Sbjct  619   FLKMESSRPIARRIMSQVAISGIR-SLKGVHDSAFTESVEDTLLNDDNFTRKSHVIRSLR  677

Query  1268  KLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLIT  1089
             +LT   +  Y+G   D LPGL  +++ +K +T Q+EI+ K++     Y+ F  +   + T
Sbjct  678   ELTKDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIE----AYEKF--KRSAVGT  731

Query  1088  LGAIHPWLIRTT---ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKV  918
                IHP L   +   A        +           +K G K KF  +++       EK+
Sbjct  732   ALYIHPCLSEISEGDAADRATNLTDATVDSLIESIIIKDGVKAKFFFNILSLANSAGEKL  791

Query  917   LIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLA  738
             L F   I P+     +  +  GW  G E+ ++ GD    +R   MD+F      +KV+  
Sbjct  792   LAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNN-SADAKVLFG  850

Query  737   SITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE---  567
             SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A  + E   
Sbjct  851   SIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAADSPEVKF  910

Query  566   -EEKYKRTT----WKEWVSSMIFSEDLVEDPSHWQAPKIEDELL-GEIVEEDRATLFHMI  405
              E  +K+      W EW S +  +ED     +       EDELL    + +D   L+  +
Sbjct  911   HETAFKKEVIPKLWFEW-SELCTTEDF--KLNQVDIDDSEDELLEANAIRQDIKALYRRV  967



>ref|NP_001057310.1| Os06g0255700 [Oryza sativa Japonica Group]
 dbj|BAD45245.1| putative DNA repair protein [Oryza sativa Japonica Group]
 dbj|BAD46298.1| putative DNA repair protein [Oryza sativa Japonica Group]
 dbj|BAF19224.1| Os06g0255700 [Oryza sativa Japonica Group]
Length=946

 Score =   293 bits (750),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 212/687 (31%), Positives = 333/687 (48%), Gaps = 76/687 (11%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-TNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCGV  2340
             LWK+  LA A C  LD  ED +N K   + +         C+HD R++E++G VCR+CG+
Sbjct  291   LWKDFSLA-AECTKLDTNEDMSNEKDVDDENEMDDD----CNHDIRIHEDLGHVCRICGM  345

Query  2339  VSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEVE  2160
             +  + + +             K  R      E +  D  ++D  A+ VS +   S++   
Sbjct  346   IVRKAETI-------IDYQWKKASRTRTNYYESRSKDADEIDTGAVKVSEDFIVSDI---  395

Query  2159  DNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKTL  1980
                 A+ P    ++R HQ   F FL KN+ G            K GGC+++H+PG+GKT 
Sbjct  396   ----AIHPRHAKQMRPHQLEGFSFLVKNLVGD-----------KPGGCILAHAPGSGKTF  440

Query  1979  LIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLRQ  1803
             ++I+F+ S+L  +P +RPLV+ PK  L TW +E  +W++  IP+Y  +  +  K      
Sbjct  441   MLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKR-----  495

Query  1802  KMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQV  1623
                              ++ LE ++ W A  S+L +GY  F  +   D            
Sbjct  496   -----------------VEQLEVLKSWEAQMSILFLGYKQFSRIICGDGDGNIAAACRDR  538

Query  1622  LRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARPR  1443
             L   P +LILDEGH PR+ ++ +  +L +V T  +++LSGTLFQN+  E FN L L RP+
Sbjct  539   LLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRPK  598

Query  1442  FVD-EVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG-LNILK  1269
             F+  E  + +  +   +V  +  R SL+      F + +   + +     RK   +  L+
Sbjct  599   FLKMESSRPIARRIMSQVAISGIR-SLKGVHDSAFTESVEDTLLNDDNFTRKAHVIRSLR  657

Query  1268  KLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLIT  1089
             +LT   +  Y+G   D LPGL  +++ +K +T Q+EI+ K++     Y+ F  +   + T
Sbjct  658   ELTKDVLHYYKGDILDELPGLVDFSVFLKLSTKQKEIVHKIE----AYEKF--KRSAVGT  711

Query  1088  LGAIHPWLIRTT---ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEKV  918
                IHP L   +   A        +           +K G K KF  +++       EK+
Sbjct  712   ALYIHPCLSEISEGDAADRASNLTDATVDSLIESIIIKDGVKAKFFFNILSLANSAGEKL  771

Query  917   LIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVMLA  738
             L F   I P+     +  +  GW  G E+ ++ GD    +R   MD+F      +KV+  
Sbjct  772   LAFSQYILPMKFLERLLVKRLGWHVGKEIFMISGDTSADDREVAMDQFNN-SADAKVLFG  830

Query  737   SITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE---  567
             SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A  + E   
Sbjct  831   SIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAADSPEVKF  890

Query  566   -EEKYKRTT----WKEWVSSMIFSEDL  501
              E  +K+      W EW S +  +ED 
Sbjct  891   HETAFKKEVIPKLWFEW-SELCTTEDF  916



>ref|XP_006358634.1| PREDICTED: SNF2 domain-containing protein CLASSY 3-like [Solanum 
tuberosum]
Length=1048

 Score =   295 bits (754),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 225/688 (33%), Positives = 348/688 (51%), Gaps = 70/688 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKK--GTRVCHHDFRLNEEIGLVCRL  2349
             D L+ EM +    C L    E   L ++  L M ++K    ++ +H  +L+E+IG +C +
Sbjct  263   DNLFAEMHM----CML---EERIRLTNSPVLQMQSEKVSDCQMGNHKLKLDEQIGHICSV  315

Query  2348  CGVVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEV  2169
             C  V  E+K + P F         ++   E   +        D++ F    SS      +
Sbjct  316   CSHVILEMKYIFPDFARRPRRRHRRKYLRESPSL-------LDVESFRASDSSADQDCAI  368

Query  2168  EVEDNAWALI-PDLRNKLRAHQRRAFEFLWKNIAGSIIPTQI-DPESKKRGGCVISHSPG  1995
               E   W L+ P+++  +  HQR  FEF+W++IAG+I   ++ +P SK RGGC+ISH PG
Sbjct  369   YEEGTVWDLVSPNVKVAMYPHQRGGFEFMWEHIAGAITLERLREPLSKSRGGCIISHPPG  428

Query  1994  AGKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKIPIPVYQIHGGQTYKGE  1815
              GKT L I FL SYLK+FP SRP+++AP + L  W  E  KWK+ IP Y ++       E
Sbjct  429   TGKTRLTIVFLQSYLKMFPKSRPVIIAPSSLLLNWEAEFQKWKVDIPFYNLNSKDFSSQE  488

Query  1814  ---VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAH  1644
                 +R    L     +N  ++ ++    K++ W    SVL + Y     LT ED    +
Sbjct  489   EEATVRVVGCLSDAGRKNTQLIRLV----KLKSWAESKSVLGISYDLLRNLTGEDGD-GN  543

Query  1643  RKYMNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNT  1464
              K + ++L + PG+L+L+EGH  R+  S + KAL KV T  RILLSGT FQNN  E++NT
Sbjct  544   AKGIREMLLKLPGLLVLEEGHTARNEHSLVWKALKKVETEKRILLSGTPFQNNIKEFYNT  603

Query  1463  LCLARPRFVDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG  1284
             L +  P+F  +             K A    S++   R                      
Sbjct  604   LSIVCPKFAAD----------SEQKWASLSSSIDTNPR---------------------A  632

Query  1283  LNILKKLTTGFIDV-YEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLE  1107
             L  L+ +    +    E     +LPGL+   + +K T LQ+E+L ++ +        P  
Sbjct  633   LEELRDIIAPLVHTCSEDVKKVSLPGLKSTVIHLKPTDLQKELLKRIPEN-------PGS  685

Query  1106  LELLITLGAIHPWLIRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRK  927
             L  L +L + HP L+   A   ++   E   +  +++ D  +G K KFV+ LI  C  +K
Sbjct  686   LSNLSSLISAHPSLV---ANRKEFSDLESQLSERRYRLDPDIGVKTKFVVELIKLCDGQK  742

Query  926   EKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKV  747
             E+V+IF   + P+ L  E     +GW    E+L + G +++ +R   ++   +     KV
Sbjct  743   ERVIIFSQLLGPLKLIKEQLSSLFGWTLDREILYMDGQLDVKQRQVSINSLNDPKSEVKV  802

Query  746   MLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLE  567
             +LASI  C+EGISL  ASRV+LLD  WNPS  +QAI+RA+R GQ K V+VY  + T   E
Sbjct  803   LLASIKACSEGISLIGASRVVLLDVLWNPSVEQQAISRAYRKGQTKFVHVYYPV-TSKWE  861

Query  566   EEKYKRTTWKEWVSSMIFSEDLVE-DPS  486
              +K ++ T K + S ++ S + V+ DPS
Sbjct  862   VDKIEQQTRKSYQSDVLLSRNEVKMDPS  889



>ref|XP_006659282.1| PREDICTED: transcriptional regulator ATRX homolog isoform X1 
[Oryza brachyantha]
Length=948

 Score =   293 bits (750),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 206/671 (31%), Positives = 331/671 (49%), Gaps = 66/671 (10%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D LWK+  LA A C  LD  ED + ++  +     K+    C+HD R++E++G VCR+CG
Sbjct  291   DDLWKDFSLA-AECTKLDTHEDMSNENEVD---DEKEMDDDCNHDIRIHEDLGHVCRICG  346

Query  2342  VVSTEIKDVPPPFMPSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSEVEV  2163
             ++  + + +             K  R      E +  D  ++D  A+  S +   S++  
Sbjct  347   MIVRKAETI-------IDYQWKKASRTRTNYYESRSKDADEIDTGAVKFSEDFIVSDI--  397

Query  2162  EDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGAGKT  1983
                  A+ P    ++R HQ   F FL KN+ G            K GGC+++H+PG+GKT
Sbjct  398   -----AIHPRHAKQMRPHQLEGFNFLVKNLVGD-----------KPGGCILAHAPGSGKT  441

Query  1982  LLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGEVLR  1806
              ++I+F+ S+L  +P +RPLV+ PK  L TW +E  +W++  IP+Y  +  +  K     
Sbjct  442   FMLISFIQSFLAKYPSARPLVVLPKGILGTWKREFQRWQVEDIPLYDFYSVKADKR----  497

Query  1805  QKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKYMNQ  1626
                                + LE ++ W A  S+L +GY  F  +   D+          
Sbjct  498   ------------------TEQLEVLKSWEAQMSILFLGYKQFSRIICGDAGGNIAAACRD  539

Query  1625  VLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCLARP  1446
              L   P +LILDEGH PR+ ++ +  +L +V T  +++LSGTLFQN+  E FN L L RP
Sbjct  540   RLLMVPNLLILDEGHTPRNRETDVLASLKRVQTPRKVVLSGTLFQNHVSEVFNILDLVRP  599

Query  1445  RFVD-EVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsskererkEG-LNIL  1272
             +F+  E  + +  +   +V  +  R SL+      F + +   + +     RK   +  L
Sbjct  600   KFLKMESSRPIARRIMSQVAISGGR-SLKGVPDSAFTEIVENTLLNDDNFTRKANVIRSL  658

Query  1271  KKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYKGFPLELELLI  1092
             + LT   +  Y+G   D LPGL  +++ +K T  Q++I+ K++     Y+ F  +   + 
Sbjct  659   RDLTKDVLHYYKGDILDELPGLVDFSVFLKLTPKQKDIVHKIE----AYEKF--KRSAVG  712

Query  1091  TLGAIHPWLIRTT---ACSGQYfkeeelealekfkfdlkLGSKVKFVMSLIPRCLLRKEK  921
             T   IHP L   +   A        +          +++ G K +F M+++       EK
Sbjct  713   TALYIHPCLSEISEGAAADRAINLTDATVDGLIESINIRDGVKARFFMNILSLANSAGEK  772

Query  920   VLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFEEVGGPSKVML  741
             +L F   I P+     +  +  GW  G E+ ++ GD    +R   M++F      +KV+ 
Sbjct  773   LLAFSQYILPMKFLERLLVKMLGWHVGKEIFMISGDTNPEDRELAMEQFNN-SPDAKVLF  831

Query  740   ASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQLLATGTLEEE  561
              SI  C EGISL  ASRVI+LD   NPS ++QAI RAFRPGQ K V+VY+L+A G+  EE
Sbjct  832   GSIKACGEGISLVGASRVIILDVHLNPSVTRQAIGRAFRPGQQKKVFVYRLVAAGS-PEE  890

Query  560   KYKRTTWKEWV  528
             K+  T +K+ V
Sbjct  891   KFHETAFKKEV  901



>gb|EMS50774.1| DNA repair protein rhp54 [Triticum urartu]
Length=1014

 Score =   294 bits (753),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 223/765 (29%), Positives = 356/765 (47%), Gaps = 99/765 (13%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D  W E  LAL S  L     DT  ++ +E  +  K+    C HD R++E++G VCR+CG
Sbjct  283   DGFWNEYSLALESSKL-----DTPEEADSEKEVGEKEVDNGCSHDIRIHEDLGHVCRVCG  337

Query  2342  VVSTEIKDVPPPFM---PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
             ++     D+   +    PS   S   E R        K  DD       I +   + + E
Sbjct  338   MI-VRRADMIFDYQWKKPSRSRSYFSETR-------SKDSDD-------IVIGDVRVTEE  382

Query  2171  VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGA  1992
             +   D   A+ P    ++RAHQ   F FL KN+            S+K GGC+++H+PG+
Sbjct  383   LMALD--VAIHPRHAKQMRAHQLAGFHFLVKNLV-----------SEKPGGCILAHAPGS  429

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGE  1815
             GKT ++I+F+ S+L  +P SRPLV+ PK  L TW +E  +W++  IP+Y  +   + K E
Sbjct  430   GKTFMLISFIQSFLAKYPSSRPLVILPKGILGTWKREFQRWQVEDIPLYDFY---SVKAE  486

Query  1814  VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
                ++                   LE ++ W A  S+L +GY  F  +   D        
Sbjct  487   KRAEQ-------------------LEILKSWQAKLSILFLGYKQFSQIVCSDGGGNVAAA  527

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
                +L + P +LI+DEGH PR+ ++ + ++L +V T  +++LSGTLFQN+  E FN L L
Sbjct  528   CRDMLLKVPSLLIMDEGHTPRNRETDVLESLSRVLTPRKVVLSGTLFQNHVSEVFNILNL  587

Query  1454  ARPRF---------VDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              RP+F         V  ++ ++     +  KGA      E+    +  D    +      
Sbjct  588   VRPKFLKSDSSRPIVKRIMSQVAISGGRISKGAADNAFTESIEETLLHDDNFTRKAHV--  645

Query  1301  rerkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
                   +  L++LT   +  Y+G   D LPGL  +++ +K +  Q+EI+ KL+     Y+
Sbjct  646   ------IRSLRELTKDVLHYYKGDILDELPGLLDFSVFLKLSPKQKEIVHKLES----YE  695

Query  1121  GFPLELELLITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              F  +   + T   +HP L       A        +          ++  G K +F  ++
Sbjct  696   KF--KRSAVGTAVYMHPCLSGMSEVDAADRAINLTDASIDSLVESINVTDGVKARFFTNI  753

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             +       EKVL F   I P+     +  +  GW  G E+ V+ GD    ER   MD+F 
Sbjct  754   LALANSAGEKVLAFGQYILPMKFLERLLVKTRGWNVGKEIFVINGDTSQEERELAMDQFN  813

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
                  +KV+  SI  C EGISL  ASRV++LD   NPS ++QAI RAFRPGQ K V+VY+
Sbjct  814   N-SADAKVLFGSIRACGEGISLVGASRVVILDVHLNPSVTRQAIGRAFRPGQQKKVFVYR  872

Query  590   LLATGTLEEEKYKRTT---------WKEWVSSMIFSEDLVEDPSHWQAPKIEDELL-GEI  441
             L+A  + +EE + +T          W EW      S+D   +         EDELL  + 
Sbjct  873   LVAADS-QEESFHQTAFKKEVIPKLWFEWSEQHCTSDDFRLN--KVDIDDCEDELLDNKA  929

Query  440   VEEDRATLFHMIMKNEKASNMGRLQV*RRQSYPEVAVMIKNHILP  306
             + +D   L+  +++  +     + +V  +Q +    V+   ++ P
Sbjct  930   MRQDIKVLYKRVLQLLRRGGNAKPRVCCQQGFSAACVIAPTYVYP  974



>gb|EMT12758.1| DNA repair protein rhp54 [Aegilops tauschii]
Length=1032

 Score =   293 bits (751),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 212/699 (30%), Positives = 329/699 (47%), Gaps = 96/699 (14%)
 Frame = -3

Query  2522  DMLWKEMELALASCYLLDDTEDTNLKSATELHMATKKGTRVCHHDFRLNEEIGLVCRLCG  2343
             D  W E  LAL S  L     DT  ++ +E  +  K+    C HD R++E++G VCR+CG
Sbjct  309   DGFWNEYSLALESSKL-----DTPEEADSEKEVGEKEVDNGCSHDIRIHEDLGHVCRVCG  363

Query  2342  VVSTEIKDVPPPFM---PSTCSSSGKEQRPEEVVMEEKQGDDADLDHFAIPVSSNKPSSE  2172
             ++     D+   +    PS   S   E R        K  DD       I +   + + E
Sbjct  364   MI-VRRADMIFDYQWKKPSRSRSYFSETR-------SKDSDD-------IVIGDVRVTEE  408

Query  2171  VEVEDNAWALIPDLRNKLRAHQRRAFEFLWKNIAGSIIPTQIDPESKKRGGCVISHSPGA  1992
             +   D   A+ P    ++RAHQ   F FL KN+            S K GGC+++H+PG+
Sbjct  409   LMALD--VAIHPRHAKQMRAHQLAGFHFLVKNLV-----------SDKPGGCILAHAPGS  455

Query  1991  GKTLLIIAFLVSYLKLFPGSRPLVLAPKTTLYTWYKEIIKWKI-PIPVYQIHGGQTYKGE  1815
             GKT ++I+F+ S+L  +P SRPLV+ PK  L TW +E  +W++  IP+Y  +   + K E
Sbjct  456   GKTFMLISFIQSFLAKYPSSRPLVILPKGILGTWKREFQRWQVEDIPLYDFY---SVKAE  512

Query  1814  VLRQKMKLCPGLPRNQDVMHVLDCLEKMQKWLAHPSVLLMGYTSFLTLTREDSTYAHRKY  1635
                ++                   LE ++ W A  S+L +GY  F  +   D        
Sbjct  513   KRAEQ-------------------LEILKSWQAKMSILFLGYKQFSQIVCSDGGGNVAAA  553

Query  1634  MNQVLRQCPGILILDEGHNPRSTKSRLRKALMKVNTSLRILLSGTLFQNNFGEYFNTLCL  1455
                +L + PG+LI+DEGH PR+ ++ + ++L +V T  +++LSGTLFQN+  E FN L L
Sbjct  554   CRDMLLKVPGLLIMDEGHTPRNRETDVLESLSRVLTPRKVVLSGTLFQNHVSEVFNILNL  613

Query  1454  ARPRF---------VDEVLKELDPKYKKRVKGAKTRFSLENRARKMFidkiskkidsske  1302
              RP+F         V  ++ ++     +  KGA      E+    +  D    +      
Sbjct  614   VRPKFLKSDSSRPIVKRIMSQVAISGGRISKGAADNAFTESIEETLLHDDNFTRKAHV--  671

Query  1301  rerkEGLNILKKLTTGFIDVYEGGSSDNLPGLQCYTLMMKSTTLQQEILVKLQDQRPIYK  1122
                   +  L++LT   +  Y+G   D LPGL  +++ +K +  Q+EI+ KL+     Y+
Sbjct  672   ------IRSLRELTKDVLHYYKGDILDELPGLIDFSVFLKLSPKQKEIVHKLES----YE  721

Query  1121  GFPLELELLITLGAIHPWL---IRTTACSGQYfkeeelealekfkfdlkLGSKVKFVMSL  951
              F  +   + T   +HP L       A        +          ++  G K +F  ++
Sbjct  722   KF--KRSAVGTAVYMHPCLSGMSEVDAADRAINLTDASIDSLVESINVTDGVKARFFTNI  779

Query  950   IPRCLLRKEKVLIFCHNIAPINLFLEIFERFYGWRKGIEVLVLQGDIELFERGRVMDKFE  771
             +       EKVL F   I P+     +  +  GW  G E+ V+ GD    ER   MD+F 
Sbjct  780   LALANSAGEKVLAFGQYILPMKFLERLLVKTRGWNVGKEIFVINGDTSQEERELAMDQFN  839

Query  770   EVGGPSKVMLASITTCAEGISLTAASRVILLDSEWNPSKSKQAIARAFRPGQDKVVYVYQ  591
                  +KV+  SI  C EGISL  ASR+++LD   NPS ++QAI RAFRPGQ K V+VY+
Sbjct  840   N-SADAKVLFGSIRACGEGISLVGASRIVILDVHLNPSVTRQAIGRAFRPGQQKKVFVYR  898

Query  590   LLATGTLEEEKYKRTT---------WKEWVSSMIFSEDL  501
             L+A  + +EE + +T          W EW      S+D 
Sbjct  899   LVAADS-QEESFHQTAFKKEVIPKLWFEWSEQHCTSDDF  936



>gb|EEC81934.1| hypothetical protein OsI_25800 [Oryza sativa Indica Group]
Length=969

 Score =   292 bits (747),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 220/720 (31%), Positives = 344/720 (48%), Gaps = 79/720 (11%)
 Frame = -3

Query  2516  LWKEMELALASCYLLDDTED-TNLKSATELHMATKKGTRVCHH