BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c78549_g1_i1 len=1793 path=[1:0-1792]

Length=1793
                                                                      Score     E

ref|XP_011093925.1|  PREDICTED: cytochrome P450 703A2                   862   0.0      
dbj|BAA92894.1|  cytochrome P450                                        860   0.0      Petunia x hybrida [garden petunia]
ref|XP_002523334.1|  flavonoid 3-hydroxylase, putative                  851   0.0      Ricinus communis
gb|EYU32253.1|  hypothetical protein MIMGU_mgv1a004391mg                851   0.0      
ref|XP_006491291.1|  PREDICTED: cytochrome P450 71A1-like               849   0.0      
gb|KDO86497.1|  hypothetical protein CISIN_1g045756mg                   848   0.0      
ref|XP_009765717.1|  PREDICTED: cytochrome P450 703A2                   846   0.0      
ref|XP_009587545.1|  PREDICTED: cytochrome P450 703A2                   844   0.0      
ref|XP_006444827.1|  hypothetical protein CICLE_v10023470mg             843   0.0      
gb|KDP28480.1|  hypothetical protein JCGZ_14251                         842   0.0      
ref|XP_010100729.1|  Flavonoid 3'-monooxygenase                         840   0.0      
ref|XP_009336813.1|  PREDICTED: cytochrome P450 703A2                   838   0.0      
ref|XP_010556597.1|  PREDICTED: cytochrome P450 703A2                   835   0.0      
ref|XP_008233175.1|  PREDICTED: cytochrome P450 703A2                   835   0.0      
ref|XP_007133195.1|  hypothetical protein PHAVU_011G159600g             835   0.0      
ref|XP_002263965.2|  PREDICTED: cytochrome P450 703A2                   834   0.0      Vitis vinifera
ref|XP_003541057.1|  PREDICTED: cytochrome P450 71A1-like               831   0.0      
gb|KHN45798.1|  Flavonoid 3'-monooxygenase                              829   0.0      
ref|XP_007220171.1|  hypothetical protein PRUPE_ppa016810mg             827   0.0      
ref|XP_004308304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         833   0.0      
ref|XP_007051531.1|  Cytochrome P450, family 703, subfamily A, po...    825   0.0      
ref|XP_008356280.1|  PREDICTED: cytochrome P450 703A2                   839   0.0      
ref|XP_003624793.1|  Flavonoid 3'-monooxygenase                         824   0.0      
ref|XP_010275090.1|  PREDICTED: cytochrome P450 703A2                   823   0.0      
ref|XP_002302635.1|  cytochrome P450 family protein                     822   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011023171.1|  PREDICTED: cytochrome P450 703A2                   820   0.0      
emb|CAN79465.1|  hypothetical protein VITISV_035365                     819   0.0      Vitis vinifera
gb|EMS57417.1|  Flavonoid 3',5'-hydroxylase                             818   0.0      
ref|XP_006362136.1|  PREDICTED: cytochrome P450 71A1-like               816   0.0      
gb|EMT07267.1|  Flavonoid 3',5'-hydroxylase                             813   0.0      
ref|XP_004972929.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    813   0.0      
ref|XP_004972930.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    811   0.0      
ref|XP_004248085.1|  PREDICTED: cytochrome P450 703A2                   812   0.0      
ref|XP_010501277.1|  PREDICTED: cytochrome P450 703A2                   810   0.0      
ref|XP_006418407.1|  hypothetical protein EUTSA_v10007395mg             809   0.0      
ref|NP_001149251.1|  LOC100282873                                       807   0.0      Zea mays [maize]
gb|KFK42510.1|  hypothetical protein AALP_AA1G003300                    806   0.0      
ref|XP_004493277.1|  PREDICTED: cytochrome P450 71A1-like               806   0.0      
gb|ACN36201.1|  unknown                                                 806   0.0      Zea mays [maize]
ref|XP_010474719.1|  PREDICTED: cytochrome P450 703A2-like              805   0.0      
ref|XP_009119683.1|  PREDICTED: cytochrome P450 703A2                   805   0.0      
ref|XP_006306019.1|  hypothetical protein CARUB_v10011315mg             803   0.0      
ref|XP_010665532.1|  PREDICTED: cytochrome P450 703A2                   802   0.0      
dbj|BAK06020.1|  predicted protein                                      800   0.0      
ref|XP_002445004.1|  hypothetical protein SORBIDRAFT_07g002610          798   0.0      Sorghum bicolor [broomcorn]
ref|XP_004155249.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    798   0.0      
ref|XP_008437881.1|  PREDICTED: cytochrome P450 703A2 isoform X1        797   0.0      
ref|XP_004134300.1|  PREDICTED: flavonoid 3',5'-hydroxylase-like        797   0.0      
ref|XP_003571355.1|  PREDICTED: cytochrome P450 703A2                   794   0.0      
ref|XP_010054863.1|  PREDICTED: cytochrome P450 703A2                   792   0.0      
ref|XP_010941811.1|  PREDICTED: cytochrome P450 703A2                   782   0.0      
ref|XP_010457143.1|  PREDICTED: cytochrome P450 703A2-like              779   0.0      
ref|NP_171635.1|  cytochrome P450, family 703, subfamily A, polyp...    778   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892076.1|  CYP703A2                                           775   0.0      
ref|XP_009118885.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    775   0.0      
ref|XP_006659094.1|  PREDICTED: flavonoid 3'-monooxygenase-like         774   0.0      
ref|NP_001060927.1|  Os08g0131100                                       771   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADZ04640.1|  hypothetical protein                                    770   0.0      
gb|ADZ04644.1|  hypothetical protein                                    766   0.0      
ref|XP_006836296.1|  hypothetical protein AMTR_s00092p00018750          763   0.0      
emb|CDX90022.1|  BnaA10g00600D                                          757   0.0      
gb|EAZ05488.1|  hypothetical protein OsI_27705                          780   0.0      Oryza sativa Indica Group [Indian rice]
gb|EAZ41414.1|  hypothetical protein OsJ_25936                          780   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDY15188.1|  BnaC05g00670D                                          745   0.0      
gb|EPS61464.1|  hypothetical protein M569_13332                         725   0.0      
ref|XP_009414535.1|  PREDICTED: cytochrome P450 703A2                   706   0.0      
emb|CDY38002.1|  BnaCnng08630D                                          654   0.0      
gb|KGN56419.1|  hypothetical protein Csa_3G119520                       652   0.0      
gb|KCW78192.1|  hypothetical protein EUGRSUZ_D02382                     614   0.0      
ref|XP_008437883.1|  PREDICTED: cytochrome P450 703A2 isoform X2        538   0.0      
ref|XP_002967231.1|  hypothetical protein SELMODRAFT_168652             496   4e-167   
ref|XP_002967259.1|  hypothetical protein SELMODRAFT_144382             490   3e-164   
ref|XP_002960462.1|  hypothetical protein SELMODRAFT_74166              485   4e-162   
ref|XP_002960493.1|  lauric acid in-chain hydroxylase                   480   2e-160   
emb|CDO99831.1|  unnamed protein product                                455   8e-154   
ref|XP_001752061.1|  predicted protein                                  447   2e-147   
ref|XP_001756284.1|  predicted protein                                  439   3e-144   
ref|XP_002978011.1|  hypothetical protein SELMODRAFT_108395             438   3e-143   
ref|XP_002966737.1|  hypothetical protein SELMODRAFT_168443             436   3e-142   
ref|XP_001776045.1|  predicted protein                                  414   8e-135   
gb|ABR16821.1|  unknown                                                 401   4e-129   Picea sitchensis
ref|XP_002983090.1|  hypothetical protein SELMODRAFT_155508             397   2e-128   
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              396   2e-127   Osteospermum hybrid cultivar
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                395   7e-127   
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                393   3e-126   Echinops bannaticus
ref|XP_002965839.1|  hypothetical protein SELMODRAFT_230667             390   1e-125   
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              390   5e-125   
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               390   6e-125   
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                389   9e-125   Pilosella officinarum [mouse-ear hawkweed]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                388   4e-124   
ref|XP_011046010.1|  PREDICTED: flavonoid 3'-monooxygenase-like         387   1e-123   
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               386   2e-123   
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   385   4e-123   Callistephus chinensis [Chinese aster]
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          384   1e-122   Zea mays [maize]
ref|XP_001751225.1|  predicted protein                                  383   2e-122   
gb|EAZ09259.1|  hypothetical protein OsI_31532                          384   2e-122   Oryza sativa Indica Group [Indian rice]
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                383   2e-122   Tagetes erecta [big marigold]
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              383   3e-122   
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               382   4e-122   
ref|NP_001063285.1|  Os09g0441400                                       382   5e-122   Oryza sativa Japonica Group [Japonica rice]
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                382   8e-122   
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                382   8e-122   
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                381   1e-121   
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               380   5e-121   
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                379   8e-121   Rudbeckia hirta
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          379   8e-121   Sorghum bicolor [broomcorn]
ref|NP_001062713.1|  Os09g0264400                                       379   9e-121   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063284.1|  Os09g0441100                                       379   2e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               378   2e-120   
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         378   2e-120   
gb|AGT17103.1|  flavonoid 3-monooxygenase                               378   3e-120   
gb|AGI16386.1|  flavonoid 3' hydroxylase                                378   3e-120   
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                378   3e-120   
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                378   4e-120   Osteospermum hybrid cultivar
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          378   4e-120   Sorghum bicolor [broomcorn]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       377   8e-120   
ref|XP_011040453.1|  PREDICTED: cytochrome P450 71A1-like               376   1e-119   
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                376   1e-119   Centaurea cyanus [bachelor's-button]
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               376   2e-119   
ref|XP_006369135.1|  hypothetical protein POPTR_0001s16800g             375   3e-119   
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             375   3e-119   
ref|XP_002318091.2|  hypothetical protein POPTR_0012s09180g             375   3e-119   Populus trichocarpa [western balsam poplar]
ref|XP_007012628.1|  Cytochrome P450 superfamily protein isoform 1      375   4e-119   
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       375   5e-119   
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               375   5e-119   
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               374   8e-119   
ref|XP_007204134.1|  hypothetical protein PRUPE_ppa023335mg             374   8e-119   
ref|XP_011040452.1|  PREDICTED: cytochrome P450 71A1-like               374   9e-119   
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         374   1e-118   
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              374   1e-118   
ref|XP_002990094.1|  hypothetical protein SELMODRAFT_43356              372   1e-118   
gb|AGC29948.1|  CYP75B65                                                374   1e-118   
gb|ACO35755.1|  chalcone 3-hydroxylase                                  374   1e-118   
ref|XP_010099912.1|  Cytochrome P450 71A1                               373   1e-118   
ref|XP_002321645.1|  hypothetical protein POPTR_0015s09760g             373   1e-118   Populus trichocarpa [western balsam poplar]
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          373   1e-118   
ref|XP_007048087.1|  Cytochrome P450                                    374   1e-118   
gb|KDP40690.1|  hypothetical protein JCGZ_24689                         373   2e-118   
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          373   2e-118   
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                373   2e-118   Cichorium intybus [radicchio]
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    372   2e-118   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   2e-118   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   3e-118   
ref|XP_009413866.1|  PREDICTED: cytochrome P450 71A1-like               372   4e-118   
gb|AET01782.2|  cytochrome P450 family protein                          372   5e-118   
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       372   5e-118   
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   5e-118   
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   6e-118   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   7e-118   
emb|CDP19009.1|  unnamed protein product                                372   8e-118   
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                371   8e-118   
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              371   8e-118   
gb|AIB06740.1|  flavanone 3'-hydroxylase                                371   1e-117   
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             371   1e-117   
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                371   1e-117   
ref|XP_011005615.1|  PREDICTED: cytochrome P450 71A1-like               370   1e-117   
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         371   2e-117   
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             371   2e-117   
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   2e-117   
ref|XP_006381618.1|  hypothetical protein POPTR_0006s14370g             370   2e-117   
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             370   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               371   2e-117   
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                370   2e-117   Gerbera hybrid cultivar
gb|ADC34701.1|  flavonoid 3' hydroxylase                                370   3e-117   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               370   3e-117   Vitis vinifera
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          369   3e-117   
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   3e-117   
ref|XP_006388081.1|  hypothetical protein POPTR_0357s00220g             370   3e-117   
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             370   4e-117   
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                370   4e-117   
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                369   6e-117   
gb|ABK24537.1|  unknown                                                 369   6e-117   Picea sitchensis
ref|XP_011015794.1|  PREDICTED: flavonoid 3'-monooxygenase-like         369   6e-117   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               369   6e-117   Vitis vinifera
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         369   6e-117   
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    369   7e-117   
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      369   7e-117   Pelargonium x hortorum [bedding geranium]
emb|CDP19008.1|  unnamed protein product                                369   7e-117   
gb|AAL66194.1|AF386512_1  cytochrome P450                               369   8e-117   Pyrus communis
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    369   9e-117   
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  369   9e-117   Ricinus communis
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                369   9e-117   
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            369   1e-116   
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             368   1e-116   
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               369   1e-116   
ref|XP_006436412.1|  hypothetical protein CICLE_v10031266mg             369   1e-116   
ref|XP_002318090.2|  hypothetical protein POPTR_0012s09160g             368   1e-116   Populus trichocarpa [western balsam poplar]
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                368   1e-116   Ageratina adenophora
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               369   1e-116   
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               368   1e-116   Vitis vinifera
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               368   1e-116   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          368   2e-116   
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          368   2e-116   
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               368   2e-116   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               368   2e-116   Vitis vinifera
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             368   2e-116   
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                368   2e-116   
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              367   2e-116   
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               367   3e-116   
gb|KDO48981.1|  hypothetical protein CISIN_1g010365mg                   367   3e-116   
ref|XP_008678485.1|  PREDICTED: flavonoid 3'-monooxygenase-like         368   3e-116   
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        367   5e-116   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   366   5e-116   Vitis arizonica x Vitis rupestris
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              367   6e-116   
ref|XP_011035092.1|  PREDICTED: flavonoid 3'-monooxygenase-like         366   7e-116   
gb|AFW61881.1|  putative cytochrome P450 superfamily protein            368   7e-116   
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                366   8e-116   Cosmos sulphureus [orange cosmos]
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             365   8e-116   Populus trichocarpa [western balsam poplar]
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                366   1e-115   
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          366   1e-115   
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                366   1e-115   
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               366   1e-115   
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          366   1e-115   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         365   1e-115   
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         365   1e-115   
ref|XP_004510480.1|  PREDICTED: flavonoid 3'-monooxygenase-like         365   1e-115   
gb|ACN38268.1|  flavonoid 3' hydroxylase                                365   2e-115   Vitis amurensis
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               365   2e-115   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 365   2e-115   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               365   2e-115   
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          365   2e-115   
ref|XP_002516018.1|  flavonoid 3-hydroxylase, putative                  365   2e-115   Ricinus communis
ref|XP_002989844.1|  hypothetical protein SELMODRAFT_235879             364   2e-115   
gb|KHG15722.1|  Cytochrome P450                                         365   3e-115   
ref|XP_002324180.2|  hypothetical protein POPTR_0018s05370g             365   3e-115   Populus trichocarpa [western balsam poplar]
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            365   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         365   4e-115   
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           364   4e-115   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   364   4e-115   Vitis arizonica x Vitis rupestris
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             364   5e-115   
ref|XP_009626729.1|  PREDICTED: flavonoid 3'-monooxygenase-like         364   5e-115   
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             364   5e-115   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             363   5e-115   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          363   5e-115   
gb|KEH33357.1|  flavonoid hydroxylase                                   364   5e-115   
ref|XP_002310014.1|  cytochrome P450 family protein                     363   6e-115   Populus trichocarpa [western balsam poplar]
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          363   6e-115   
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                364   6e-115   Gossypium hirsutum [American cotton]
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                364   6e-115   
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              364   6e-115   
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             363   7e-115   
ref|XP_009337219.1|  PREDICTED: flavonoid 3'-monooxygenase-like         364   7e-115   
gb|KHF98582.1|  Flavonoid 3',5'-hydroxylase                             364   7e-115   
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               363   8e-115   
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               363   9e-115   Vitis vinifera
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             363   9e-115   
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      363   9e-115   Nicotiana tabacum [American tobacco]
ref|XP_007012629.1|  Cytochrome P450 superfamily protein isoform 2      364   1e-114   
gb|AEN71546.1|  flavanone 3'-hydroxylase                                363   1e-114   
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               363   1e-114   
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             363   1e-114   Solanum tuberosum [potatoes]
gb|EAZ09261.1|  hypothetical protein OsI_31534                          364   1e-114   Oryza sativa Indica Group [Indian rice]
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              363   1e-114   Vitis vinifera
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             363   1e-114   Populus trichocarpa [western balsam poplar]
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               363   1e-114   
ref|XP_008242245.1|  PREDICTED: flavonoid 3'-monooxygenase-like         363   1e-114   
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          363   1e-114   
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               363   1e-114   
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   363   1e-114   
ref|XP_007146137.1|  hypothetical protein PHAVU_006G015400g             363   2e-114   
gb|ABA01477.1|  cytochrome P450 DDWF1                                   362   2e-114   Gossypium hirsutum [American cotton]
ref|XP_008242319.1|  PREDICTED: flavonoid 3'-monooxygenase-like         363   2e-114   
gb|ABC69383.1|  CYP92A2v4                                               363   2e-114   Nicotiana tabacum [American tobacco]
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         363   2e-114   
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             362   2e-114   
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    362   2e-114   Solanum melongena [aubergine]
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               362   2e-114   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             362   3e-114   
ref|XP_007203042.1|  hypothetical protein PRUPE_ppa022777mg             362   3e-114   
dbj|BAD36163.1|  putative elicitor-inducible cytochrome P450            362   3e-114   Oryza sativa Japonica Group [Japonica rice]
gb|AJA79074.1|  flavonoid 3' hydroxylase                                362   3e-114   
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         362   3e-114   
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               362   4e-114   Vitis vinifera
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   4e-114   
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      362   4e-114   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    361   4e-114   
ref|XP_010086796.1|  Cytochrome P450 71A1                               362   4e-114   
ref|XP_006468115.1|  PREDICTED: flavonoid 3'-monooxygenase-like         362   5e-114   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   5e-114   
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                361   6e-114   
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      361   8e-114   
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           361   8e-114   
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               361   8e-114   
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               360   1e-113   
gb|EAZ07221.1|  hypothetical protein OsI_29466                          361   1e-113   
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           360   1e-113   
emb|CAN68303.1|  hypothetical protein VITISV_041731                     360   2e-113   
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        360   2e-113   
gb|ABC69381.1|  CYP92A2v2                                               360   2e-113   
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              360   2e-113   
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        360   2e-113   
emb|CDX69984.1|  BnaA10g23330D                                          360   2e-113   
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                360   2e-113   
gb|ABC69382.1|  CYP92A2v2                                               360   3e-113   
emb|CAN77776.1|  hypothetical protein VITISV_021888                     359   3e-113   
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      360   3e-113   
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             360   3e-113   
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              360   3e-113   
gb|AHA49900.1|  flavonoid 3' hydroxylase                                360   3e-113   
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                359   3e-113   
gb|ABG74350.1|  cytochrome P450                                         359   4e-113   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             359   4e-113   
ref|XP_002278462.1|  PREDICTED: flavonoid 3'-monooxygenase              359   4e-113   
ref|XP_007203722.1|  hypothetical protein PRUPE_ppa019048mg             359   4e-113   
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            359   4e-113   
gb|ACR14867.1|  flavonoid 3' hydroxylase                                359   5e-113   
gb|EMT12612.1|  Flavonoid 3'-monooxygenase                              359   5e-113   
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          359   6e-113   
ref|XP_002984650.1|  hypothetical protein SELMODRAFT_120910             359   6e-113   
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               359   6e-113   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   359   6e-113   
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                358   6e-113   
ref|XP_008354562.1|  PREDICTED: flavonoid 3'-monooxygenase-like         359   7e-113   
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                358   7e-113   
ref|XP_009591954.1|  PREDICTED: cytochrome P450 71A1-like               358   7e-113   
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         358   7e-113   
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                359   7e-113   
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               358   7e-113   
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               359   7e-113   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              372   8e-113   
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                358   9e-113   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             358   9e-113   
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      358   9e-113   
gb|KEH32010.1|  flavonoid hydroxylase                                   358   9e-113   
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             358   9e-113   
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         358   9e-113   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               358   9e-113   
ref|XP_002310007.2|  cytochrome P450 family protein                     358   9e-113   
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               358   9e-113   
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         358   9e-113   
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              358   9e-113   
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             358   1e-112   
ref|XP_002962369.1|  hypothetical protein SELMODRAFT_78844              358   1e-112   
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          358   1e-112   
gb|AES71399.2|  cytochrome P450 family 71 protein                       358   1e-112   
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             358   1e-112   
ref|XP_003581159.2|  PREDICTED: flavonoid 3'-monooxygenase-like         361   1e-112   
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                358   1e-112   
emb|CCP37679.1|  cytochrome P450                                        358   1e-112   
ref|XP_002962366.1|  hypothetical protein SELMODRAFT_78680              358   1e-112   
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            358   1e-112   
ref|XP_002980509.1|  hypothetical protein SELMODRAFT_113134             358   1e-112   
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         358   1e-112   
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                358   1e-112   
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              358   1e-112   
ref|XP_002445595.1|  hypothetical protein SORBIDRAFT_07g022320          358   1e-112   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             357   1e-112   
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         357   2e-112   
ref|XP_002310015.1|  cytochrome P450 family protein                     357   2e-112   
gb|AGI98132.1|  cytochrome P450                                         357   2e-112   
ref|XP_010929928.1|  PREDICTED: cytochrome P450 71A1-like               357   2e-112   
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             357   2e-112   
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             357   2e-112   
gb|EMT12610.1|  Flavonoid 3'-monooxygenase                              357   2e-112   
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               357   2e-112   
gb|AER39773.1|  CYP92A44-3                                              357   3e-112   
ref|XP_008242247.1|  PREDICTED: flavonoid 3'-monooxygenase-like         358   3e-112   
ref|XP_004165407.1|  PREDICTED: flavonoid 3'-monooxygenase-like         357   3e-112   
ref|XP_004501854.1|  PREDICTED: cytochrome P450 71A1-like               357   3e-112   
emb|CAN82000.1|  hypothetical protein VITISV_023195                     357   3e-112   
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               357   3e-112   
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      357   3e-112   
ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               357   3e-112   
ref|XP_011035728.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    357   3e-112   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          357   3e-112   
gb|AFK47419.1|  unknown                                                 357   3e-112   
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     357   4e-112   
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         357   4e-112   
ref|XP_003627307.1|  Flavonoid 3',5'-hydroxylase                        357   4e-112   
ref|NP_001061964.2|  Os08g0456200                                       357   4e-112   
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             357   4e-112   
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  357   4e-112   
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               357   4e-112   
ref|XP_009359731.1|  PREDICTED: flavonoid 3'-monooxygenase-like         357   4e-112   
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             356   5e-112   
ref|XP_008337887.1|  PREDICTED: flavonoid 3'-monooxygenase-like         356   6e-112   
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     356   6e-112   
gb|AER39774.1|  CYP92A44-4                                              357   6e-112   
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                357   6e-112   
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                355   6e-112   
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         357   6e-112   
ref|XP_009620580.1|  PREDICTED: cytochrome P450 71A9-like               356   6e-112   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          356   6e-112   
dbj|BAJ96250.1|  predicted protein                                      356   7e-112   
emb|CBI21489.3|  unnamed protein product                                358   7e-112   
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         356   7e-112   
ref|XP_007037775.1|  Cytochrome P450 71A1                               357   7e-112   
gb|EMT12959.1|  Flavonoid 3'-monooxygenase                              357   7e-112   
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          356   8e-112   
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      356   8e-112   
ref|XP_010102938.1|  Cytochrome P450 71A1                               356   9e-112   
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 356   9e-112   
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                355   9e-112   
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        356   9e-112   
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              356   9e-112   
ref|XP_006493371.1|  PREDICTED: cytochrome P450 71A1-like               357   1e-111   
ref|XP_002467824.1|  hypothetical protein SORBIDRAFT_01g034710          357   1e-111   
ref|XP_003528553.1|  PREDICTED: flavonoid 3'-monooxygenase              356   1e-111   
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             355   1e-111   
emb|CDP17539.1|  unnamed protein product                                356   1e-111   
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   1e-111   
ref|XP_011035730.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    355   1e-111   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    355   1e-111   
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             355   1e-111   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   2e-111   
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             355   2e-111   
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         355   2e-111   
gb|KHN29102.1|  Cytochrome P450 71A1                                    355   2e-111   
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                355   2e-111   
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              355   2e-111   
ref|XP_002962909.1|  hypothetical protein SELMODRAFT_78910              355   2e-111   
gb|EAZ09260.1|  hypothetical protein OsI_31533                          355   2e-111   
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           355   2e-111   
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               356   2e-111   
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                355   2e-111   
ref|XP_004956935.1|  PREDICTED: flavonoid 3'-monooxygenase-like         355   2e-111   
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                355   2e-111   
gb|KEH33153.1|  flavonoid hydroxylase                                   355   2e-111   
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               354   2e-111   
gb|KDO48980.1|  hypothetical protein CISIN_1g010365mg                   355   2e-111   
ref|XP_004299223.1|  PREDICTED: cytochrome P450 71A1-like               354   2e-111   
ref|XP_010239382.1|  PREDICTED: cytochrome P450 71A1-like               355   2e-111   
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       355   2e-111   
ref|XP_006426678.1|  hypothetical protein CICLE_v10025392mg             355   2e-111   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    354   3e-111   
ref|XP_002277926.2|  PREDICTED: flavonoid 3'-monooxygenase              354   3e-111   
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         355   3e-111   
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          355   3e-111   
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         355   3e-111   
ref|XP_011071980.1|  PREDICTED: cytochrome P450 71A6-like               354   4e-111   
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                354   4e-111   
ref|XP_010685305.1|  PREDICTED: cytochrome P450 71A1-like               354   4e-111   
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            354   4e-111   
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            354   4e-111   
dbj|BAH84782.1|  cytochrome P450                                        353   4e-111   
gb|AES69199.2|  flavonoid hydroxylase                                   354   5e-111   
gb|AEX07282.1|  F3'H                                                    354   5e-111   
ref|XP_010525432.1|  PREDICTED: cytochrome P450 98A3                    354   5e-111   
ref|XP_008793722.1|  PREDICTED: cytochrome P450 71A1-like               353   5e-111   
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         353   5e-111   
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            353   5e-111   
ref|XP_008798387.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      353   6e-111   
gb|AER39771.1|  CYP92A44-1                                              354   6e-111   
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          353   6e-111   
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                353   6e-111   
ref|XP_004288987.1|  PREDICTED: flavonoid 3'-monooxygenase-like         353   6e-111   
gb|AGI98131.1|  cytochrome P450 CYP92                                   353   6e-111   
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          353   6e-111   
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            353   7e-111   
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               353   7e-111   
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 353   7e-111   
emb|CDP20032.1|  unnamed protein product                                353   8e-111   
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            353   8e-111   
gb|ABR16655.1|  unknown                                                 353   8e-111   
gb|KHN32024.1|  Cytochrome P450 71A1                                    352   8e-111   
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             353   9e-111   
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             353   1e-110   
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               353   1e-110   
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    353   1e-110   
ref|XP_007037782.1|  Cytochrome P450 71A1                               353   1e-110   
gb|AER39772.1|  CYP92A44-2                                              353   1e-110   
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             353   1e-110   
gb|ABR18060.1|  unknown                                                 353   1e-110   
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            352   2e-110   
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            352   2e-110   
ref|XP_011039208.1|  PREDICTED: cytochrome P450 71A1-like               352   2e-110   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          352   2e-110   
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              353   2e-110   
ref|XP_010027084.1|  PREDICTED: cytochrome P450 71A1-like               352   2e-110   
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             352   2e-110   
gb|ABR18406.1|  unknown                                                 352   2e-110   
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    352   2e-110   
ref|XP_002962486.1|  hypothetical protein SELMODRAFT_78293              352   2e-110   
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               351   3e-110   
gb|EMS57898.1|  Flavonoid 3'-monooxygenase                              352   3e-110   
ref|XP_004237819.1|  PREDICTED: cytochrome P450 71A1-like               352   3e-110   
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                352   3e-110   
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               351   4e-110   
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                352   4e-110   
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            352   4e-110   
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             352   4e-110   
ref|XP_008239349.1|  PREDICTED: cytochrome P450 71A1-like               352   4e-110   
gb|ABR16345.1|  unknown                                                 351   5e-110   
ref|XP_006465907.1|  PREDICTED: cytochrome P450 71A1-like               351   5e-110   
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      351   5e-110   
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    351   5e-110   
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            351   6e-110   
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             350   6e-110   
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             351   7e-110   
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           351   8e-110   
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           351   8e-110   
ref|XP_002980809.1|  hypothetical protein SELMODRAFT_113310             350   8e-110   
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           353   8e-110   
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    350   8e-110   
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               350   9e-110   
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              351   1e-109   
ref|XP_002516270.1|  flavonoid 3-hydroxylase, putative                  351   1e-109   
ref|XP_008791650.1|  PREDICTED: cytochrome P450 84A1-like               351   1e-109   
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               350   1e-109   
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      350   1e-109   



>ref|XP_011093925.1| PREDICTED: cytochrome P450 703A2 [Sesamum indicum]
Length=526

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/519 (79%), Positives = 458/519 (88%), Gaps = 4/519 (1%)
 Frame = +3

Query  48    MIDY-ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHR  224
             ++DY  +    FL   ++ KII         E G + LPPGPP+WPI GNLLQLG+LPHR
Sbjct  9     ILDYAFSFLCIFLSSFIVVKIIGSCYSFKNSEEGALMLPPGPPKWPIFGNLLQLGQLPHR  68

Query  225   DFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGD  404
             DFAA C+KYGPLVY++LG++DAITTNDP IIREIL QQDDVFASRPRTLAA HLAYGCGD
Sbjct  69    DFAALCEKYGPLVYIQLGNIDAITTNDPDIIREILRQQDDVFASRPRTLAAEHLAYGCGD  128

Query  405   VALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREV  584
             VALAP+GPKWKR+RRICMEHLLTTKRLESF +HRA+EA+HLV+DVW +AE GE VNLREV
Sbjct  129   VALAPLGPKWKRLRRICMEHLLTTKRLESFGRHRADEAQHLVKDVWSVAERGEAVNLREV  188

Query  585   LGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWID  764
             LGAFSMNNVTRMLLGKQ+FGA ESSGP EAMEFM+ITHELF LLGLIYLGDY+P+WRWID
Sbjct  189   LGAFSMNNVTRMLLGKQYFGA-ESSGPHEAMEFMHITHELFWLLGLIYLGDYLPIWRWID  247

Query  765   PYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI--DGEMDFVDVLLSLPGENGKEHMEDV  938
             PYGCEK+MR+VEKRVDDFH KI+EEHR+  + I  +GEMDFVDVLLSLPGE+GKEHM+DV
Sbjct  248   PYGCEKRMRQVEKRVDDFHAKIIEEHRQRIQVIKDEGEMDFVDVLLSLPGEDGKEHMDDV  307

Query  939   EIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHL  1118
             EIKALIQDMIAAATDTSAVTNEWAMAEVIK P++LK IQQELD +VG DRMV E+DL HL
Sbjct  308   EIKALIQDMIAAATDTSAVTNEWAMAEVIKHPQVLKTIQQELDSIVGPDRMVQESDLAHL  367

Query  1119  NYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVD  1298
             NYLRCVVRETFR HPAGPFLIPH+STR+TTINGY+IP  TR+FINTHGLGRN  +WD+V+
Sbjct  368   NYLRCVVRETFRMHPAGPFLIPHQSTRSTTINGYYIPKNTRVFINTHGLGRNTKIWDNVE  427

Query  1299  DFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             +F+PERH P DG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH FDWSP
Sbjct  428   EFKPERHLPHDGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHCFDWSP  487

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             PEGLRPEDIDT+EVYGMTMPKA PL A+ RPRL  HLY 
Sbjct  488   PEGLRPEDIDTTEVYGMTMPKAQPLIAIPRPRLAAHLYN  526



>dbj|BAA92894.1| cytochrome P450 [Petunia x hybrida]
Length=539

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/529 (78%), Positives = 465/529 (88%), Gaps = 12/529 (2%)
 Frame = +3

Query  33    IKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGR  212
             + +  ++DY   A  F+C+ L+ K++    ++  K+    RLPPGP +WPIVGNL QLG+
Sbjct  14    VYIFYLVDY---APIFVCVYLVSKLVHFSFIERSKQKIN-RLPPGPKQWPIVGNLFQLGQ  69

Query  213   LPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAY  392
             LPHRD A+FCDKYGPLVYLRLG+VDAITTNDP IIREIL+QQDD+FASRPRTLAA+HLAY
Sbjct  70    LPHRDMASFCDKYGPLVYLRLGNVDAITTNDPEIIREILVQQDDIFASRPRTLAAIHLAY  129

Query  393   GCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVN  572
             GCGDVALAP+GPKWKRMRRICMEHLLTTKRLESF KHRA+EA+ LVEDVW   + GETVN
Sbjct  130   GCGDVALAPLGPKWKRMRRICMEHLLTTKRLESFGKHRADEAQSLVEDVWAKTQKGETVN  189

Query  573   LREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLW  752
             LR++LGAFSMNNVTRMLLGKQFFGA ES+GPQEAMEFM+ITHELF LLG+IYLGDY+PLW
Sbjct  190   LRDLLGAFSMNNVTRMLLGKQFFGA-ESAGPQEAMEFMHITHELFWLLGVIYLGDYLPLW  248

Query  753   RWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID-GEMDFVDVLLSLPGE-----N  914
             RWIDP+GCEKKMREVEKRVDDFHM+I+EEHRK+ K +D GEMDFVDVLLSLPGE     N
Sbjct  249   RWIDPHGCEKKMREVEKRVDDFHMRIIEEHRKNGKNVDEGEMDFVDVLLSLPGEDEGDGN  308

Query  915   GKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMV  1094
             GK+HM+D EIKALIQDMIAAATDTSAVTNEW MAEVIK P +LKKIQ+ELD VVGSDRMV
Sbjct  309   GKQHMDDTEIKALIQDMIAAATDTSAVTNEWPMAEVIKHPNVLKKIQEELDIVVGSDRMV  368

Query  1095  SENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRN  1274
             +E+DL+HL YLRCVVRETFR HPAGPFLIPHES R T INGY+IPAKTR+FINTHGLGRN
Sbjct  369   TESDLVHLKYLRCVVRETFRMHPAGPFLIPHESIRDTKINGYYIPAKTRVFINTHGLGRN  428

Query  1275  PSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALAR  1451
               +WD++D+FRPERH PAD   RVEISHGADFKILPFSAGKRKCPGAPLGV LVLMALAR
Sbjct  429   TKIWDNIDEFRPERHLPADELSRVEISHGADFKILPFSAGKRKCPGAPLGVKLVLMALAR  488

Query  1452  LFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             LFH F+WSPP+GLRPEDIDT EVYGMTMPKA PL A+ARPRL  HLY S
Sbjct  489   LFHCFEWSPPDGLRPEDIDTIEVYGMTMPKAKPLMAIARPRLPDHLYHS  537



>ref|XP_002523334.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF39050.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=515

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/522 (79%), Positives = 459/522 (88%), Gaps = 14/522 (3%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D++  +   L ++LI  ++Q  P++  K     RLPPGP RWPIVGNLLQLG LPHRD 
Sbjct  1     MDFLNFSLILLFVALITNLLQW-PMQKYK-----RLPPGPQRWPIVGNLLQLGHLPHRDL  54

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+ C+KYGPLVYLRLGSVDAITTNDP IIREILL+QDDVFASRPRTLAAVHLAYGCGDVA
Sbjct  55    ASLCNKYGPLVYLRLGSVDAITTNDPEIIREILLRQDDVFASRPRTLAAVHLAYGCGDVA  114

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAPVGP WKRMRRICME LLTTKRLESFAKHRAEEA+HL+ DVW  A  G+ VNLREVLG
Sbjct  115   LAPVGPNWKRMRRICMEQLLTTKRLESFAKHRAEEAQHLIRDVWTQARTGKAVNLREVLG  174

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FGA ES+GPQEA+EFM++THELF LLG+IYLGDY+P WRWIDPY
Sbjct  175   AFSMNNVTRMLLGKQYFGA-ESAGPQEALEFMHVTHELFRLLGVIYLGDYLPFWRWIDPY  233

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKKEI-------DGEMDFVDVLLSLPGENGKEHM  929
             GCEKKMREVEKRVDDFH  I+E+H+K++K         +GEMDFVDVLLSLPG +G+EHM
Sbjct  234   GCEKKMREVEKRVDDFHSTIIEQHKKARKMKGEKESVEEGEMDFVDVLLSLPGLDGQEHM  293

Query  930   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDL  1109
             +DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PR+L+KIQ+ELD V+G +RMV+E+DL
Sbjct  294   DDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLQKIQEELDSVIGPNRMVTESDL  353

Query  1110  LHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD  1289
             +HLNYLRCVVRETFR HPAGPFLIPHES  ATTINGY+IPAKTRIFINTHGLGRN  VW 
Sbjct  354   VHLNYLRCVVRETFRMHPAGPFLIPHESLHATTINGYYIPAKTRIFINTHGLGRNTKVWT  413

Query  1290  DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             DV++FRPERH+  DG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH+FD
Sbjct  414   DVEEFRPERHWLDDGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHAFD  473

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             WSPP+GLR EDIDT+EVYGMTMPKA PLFAVA PRL  H+Y 
Sbjct  474   WSPPDGLRYEDIDTNEVYGMTMPKAKPLFAVATPRLAPHMYN  515



>gb|EYU32253.1| hypothetical protein MIMGU_mgv1a004391mg [Erythranthe guttata]
 gb|EYU32254.1| hypothetical protein MIMGU_mgv1a004391mg [Erythranthe guttata]
Length=530

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/525 (78%), Positives = 455/525 (87%), Gaps = 10/525 (2%)
 Frame = +3

Query  42    LKMIDYIT--LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRL  215
             L +++Y+   L   F C  ++  I+     K  ++ G + LPPGPP+WPI GNLLQLG L
Sbjct  7     LLILNYVLSFLCILFTCYHILQIIVSCFSFKNSRQ-GTLTLPPGPPKWPIFGNLLQLGPL  65

Query  216   PHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYG  395
             PHRDFAA C+KYGPLVY+RLG VDAITTNDP IIREIL QQDDVFASRPRTLAA  LAYG
Sbjct  66    PHRDFAALCEKYGPLVYIRLGGVDAITTNDPDIIREILRQQDDVFASRPRTLAAERLAYG  125

Query  396   CGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNL  575
             CGDVALAP+GPKWKR+RRICMEHLLTTKRLESF  HRA+EA+HLV+DVW MA+ GE VNL
Sbjct  126   CGDVALAPLGPKWKRLRRICMEHLLTTKRLESFVSHRADEAQHLVKDVWAMAQKGEVVNL  185

Query  576   REVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWR  755
             REVLGAFSMNNVTRMLLGKQ+FG  ES+GPQEAMEFM+ITHELF LLGLIYLGDY+P+WR
Sbjct  186   REVLGAFSMNNVTRMLLGKQYFGT-ESAGPQEAMEFMHITHELFSLLGLIYLGDYLPVWR  244

Query  756   WIDPYGCEKKMREVEKRVDDFHMKILEEHRKSK--KEIDG----EMDFVDVLLSLPGENG  917
             W+DP+GCEK+M+EVEKRVDDFH KI+E+H+K +  +E+ G    EMDFVDVLLSLPGE+G
Sbjct  245   WVDPFGCEKRMKEVEKRVDDFHSKIIEQHKKRRENQEVGGGDDEEMDFVDVLLSLPGEDG  304

Query  918   KEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVS  1097
             KEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PR+LK++QQELD VVG +RMV 
Sbjct  305   KEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLKRVQQELDSVVGPNRMVQ  364

Query  1098  ENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNP  1277
             E DL+HLNYLRC+VRETFR HPAGPFLIPHESTR TTINGYHIP KTR+FINTH LGRN 
Sbjct  365   EPDLVHLNYLRCIVRETFRMHPAGPFLIPHESTRPTTINGYHIPNKTRVFINTHALGRNT  424

Query  1278  SVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLF  1457
              +WD VD+F PERH PADG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLF
Sbjct  425   KIWDSVDEFEPERHLPADGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLF  484

Query  1458  HSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             HSF+W PPEG+  EDIDT EVYGMTMPKA PL A+ARPRL  HLY
Sbjct  485   HSFEWGPPEGMGHEDIDTMEVYGMTMPKAQPLIAIARPRLAAHLY  529



>ref|XP_006491291.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=521

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/522 (79%), Positives = 460/522 (88%), Gaps = 10/522 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D+ T A   L  S+I  II+    +      K RLPPGPP+ PIVGNLLQL +LPHRD 
Sbjct  1     MDFATFALILLFSSIIADIIRRFQNQKFFHQTK-RLPPGPPKLPIVGNLLQLSQLPHRDL  59

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+ CDKYGPLVYLRLGSVDAITTNDP IIREILL+QD+VFASRPRTLAAVHLAYGCGDVA
Sbjct  60    ASLCDKYGPLVYLRLGSVDAITTNDPDIIREILLRQDEVFASRPRTLAAVHLAYGCGDVA  119

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICME+LLTTKRLESF +HRA+EA+HLV+DVWG A++G+ +NLR+VLG
Sbjct  120   LAPLGPHWKRMRRICMENLLTTKRLESFVRHRADEAKHLVQDVWGRAQSGKALNLRDVLG  179

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FG   S+GP+EAMEFM+ITHELF LLG+IYLGDY+P+WRW+DP+
Sbjct  180   AFSMNNVTRMLLGKQYFGGG-SAGPEEAMEFMHITHELFRLLGVIYLGDYLPIWRWVDPH  238

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKK-------EIDGE-MDFVDVLLSLPGENGKEH  926
             GCEKKMREVEKRVDDFH KI+EEHRK++K       E DGE MDFVDVLLSLPGENGKEH
Sbjct  239   GCEKKMREVEKRVDDFHTKIIEEHRKARKDKRNSVNEEDGEAMDFVDVLLSLPGENGKEH  298

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             M+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PRIL+KIQ+ELD VVG +RMV+E D
Sbjct  299   MDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRILRKIQEELDSVVGPNRMVNEQD  358

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L HLNYLRCVVRETFR HPAGPFLI HES RATTINGYHIPAKTR+FINTHGLGRN  +W
Sbjct  359   LPHLNYLRCVVRETFRMHPAGPFLILHESLRATTINGYHIPAKTRVFINTHGLGRNTRIW  418

Query  1287  DDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSF  1466
             +D++ FRPERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLG+TLVLMALARLFH F
Sbjct  419   NDIEQFRPERHWLADGSRVEISHGADFKILPFSAGKRKCPGAPLGITLVLMALARLFHCF  478

Query  1467  DWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             DW+PPEGLRPEDIDTSEVYGMTMPKA PL A+ RPRL  H+Y
Sbjct  479   DWTPPEGLRPEDIDTSEVYGMTMPKAQPLLALPRPRLADHMY  520



>gb|KDO86497.1| hypothetical protein CISIN_1g045756mg [Citrus sinensis]
Length=521

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/522 (79%), Positives = 459/522 (88%), Gaps = 10/522 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D+ T A   L  S+I  II+    +      K RLPPGPP+ PIVGNLLQL +LPHRD 
Sbjct  1     MDFATFALILLFSSIIADIIRRFQNQKFFHQTK-RLPPGPPKLPIVGNLLQLSQLPHRDL  59

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+ CDKYGPLVYLRLGSVDAITTNDP IIREILL+QD+VFASRPRTLAAVHLAYGCGDVA
Sbjct  60    ASLCDKYGPLVYLRLGSVDAITTNDPDIIREILLRQDEVFASRPRTLAAVHLAYGCGDVA  119

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICME+LLTTKRLESF  HRA+EA+HLV+DVWG A++G+ VNLR+VLG
Sbjct  120   LAPLGPHWKRMRRICMENLLTTKRLESFVTHRADEAKHLVQDVWGRAQSGKPVNLRDVLG  179

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FG   S+GP+EAMEFM+ITHELF LLG+IYLGDY+P+WRW+DP+
Sbjct  180   AFSMNNVTRMLLGKQYFGGG-SAGPEEAMEFMHITHELFRLLGVIYLGDYLPIWRWVDPH  238

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKK-------EIDGE-MDFVDVLLSLPGENGKEH  926
             GCEKKMREVEKRVDDFH KI+EEHRK++K       E DGE MDFVDVLLSLPGENGKEH
Sbjct  239   GCEKKMREVEKRVDDFHTKIIEEHRKARKDKRNSVNEEDGEAMDFVDVLLSLPGENGKEH  298

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             M+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PRIL+KIQ+ELD VVG +RMV+E D
Sbjct  299   MDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRILRKIQEELDSVVGPNRMVNEQD  358

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L HLNYLRCVVRETFR HPAGPFLI HES RATTINGYHIPAKTR+FINTHGLGRN  +W
Sbjct  359   LPHLNYLRCVVRETFRMHPAGPFLILHESLRATTINGYHIPAKTRVFINTHGLGRNTRIW  418

Query  1287  DDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSF  1466
             +D++ FRPERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLG+TLVLMALARLFH F
Sbjct  419   NDIEQFRPERHWLADGSRVEISHGADFKILPFSAGKRKCPGAPLGITLVLMALARLFHCF  478

Query  1467  DWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             DW+PPEGLRPEDIDTSEVYGMTMPKA PL A+ RPRL  H+Y
Sbjct  479   DWTPPEGLRPEDIDTSEVYGMTMPKAQPLLALPRPRLADHMY  520



>ref|XP_009765717.1| PREDICTED: cytochrome P450 703A2 [Nicotiana sylvestris]
Length=542

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/523 (79%), Positives = 454/523 (87%), Gaps = 10/523 (2%)
 Frame = +3

Query  48    MIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             + D I     FLC  LI K++    +   K+    RLPPGP +WPIVGNL QLG+LPHRD
Sbjct  16    LFDLINCVVAFLCAYLISKLVHFSLIDKSKQKIN-RLPPGPKQWPIVGNLFQLGQLPHRD  74

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A+FCDKYGPLVYLRLG+VDAITTNDP IIREIL+QQDDVFASRPRTLAAVHLAYGCGDV
Sbjct  75    MASFCDKYGPLVYLRLGNVDAITTNDPEIIREILVQQDDVFASRPRTLAAVHLAYGCGDV  134

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GPKWKRMRRICMEHLLTTKRLESF KHRA+EA+ LV+DVW   + GET+NLRE+L
Sbjct  135   ALAPLGPKWKRMRRICMEHLLTTKRLESFVKHRADEAQTLVQDVWTKTQKGETLNLREIL  194

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQ+FGA ES+GPQEA EFM+ITHELF LLG+IYLGDY+PLWRWIDP
Sbjct  195   GAFSMNNVTRMLLGKQYFGA-ESAGPQEAKEFMHITHELFWLLGVIYLGDYLPLWRWIDP  253

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKS-KKEID-GEMDFVDVLLSLPGE-----NGKEH  926
             + CEKKMREVEKR+DDFHM+I+EEHRK  K  ID GEMDFVDVLLSLPGE     NGK+H
Sbjct  254   HNCEKKMREVEKRIDDFHMRIIEEHRKKGKSNIDEGEMDFVDVLLSLPGEDEGDGNGKQH  313

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             M+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK P +LKKIQ+ELD VVGS RMV+E D
Sbjct  314   MDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPHVLKKIQEELDIVVGSGRMVTETD  373

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L++L YLRCVVRETFR HPAGPFLIPHES R TTINGY+IPAKTR+FINTHGLGRN  +W
Sbjct  374   LVNLKYLRCVVRETFRMHPAGPFLIPHESIRDTTINGYYIPAKTRVFINTHGLGRNTKIW  433

Query  1287  DDVDDFRPERHFPADGG-RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             D++D+FRPERH P D   RVEISHGADFKILPFSAGKRKCPGAPLGV LVLMALARLFH 
Sbjct  434   DNIDEFRPERHSPKDESIRVEISHGADFKILPFSAGKRKCPGAPLGVKLVLMALARLFHC  493

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDWSPP GL+PEDIDTSEVYGMTMPKA PL AVAR RL  HLY
Sbjct  494   FDWSPPNGLKPEDIDTSEVYGMTMPKAKPLMAVARHRLPAHLY  536



>ref|XP_009587545.1| PREDICTED: cytochrome P450 703A2 [Nicotiana tomentosiformis]
Length=542

 Score =   844 bits (2180),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/523 (79%), Positives = 453/523 (87%), Gaps = 10/523 (2%)
 Frame = +3

Query  48    MIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             + D I     FLC  L+ K++    +   KE    RLPPGP +WPIVGNL QLG+LPHRD
Sbjct  16    LFDLINCVVAFLCAYLVSKLVHFSLIDKSKEKIN-RLPPGPKQWPIVGNLFQLGQLPHRD  74

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A+FCDKYGPLVYLRLG+VDAITTNDP IIREIL+QQDDVFASRPRTLAAVHLAYGCGDV
Sbjct  75    MASFCDKYGPLVYLRLGNVDAITTNDPEIIREILVQQDDVFASRPRTLAAVHLAYGCGDV  134

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GPKWKRMRRICMEHLLTTKRLESFAKHRA+EA+ LV+DVW   +  ETVNLRE+L
Sbjct  135   ALAPLGPKWKRMRRICMEHLLTTKRLESFAKHRADEAQTLVQDVWTKTQKEETVNLREIL  194

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQ+FGA ES+GPQEA EFM+ITHELF LLG+IYLGDY+PLWRWIDP
Sbjct  195   GAFSMNNVTRMLLGKQYFGA-ESAGPQEAKEFMHITHELFWLLGVIYLGDYLPLWRWIDP  253

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKS-KKEID-GEMDFVDVLLSLPGE-----NGKEH  926
             + CEKKMREVEKR+DDFHM+I+EEHRK  K  ID GEMDFVDVLLSLPGE     NGK+H
Sbjct  254   HSCEKKMREVEKRIDDFHMRIIEEHRKKGKSNIDEGEMDFVDVLLSLPGEDDGDGNGKQH  313

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             M+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK P +LKKIQ+ELD VVGS RMV+E+D
Sbjct  314   MDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPHVLKKIQEELDIVVGSGRMVTESD  373

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L++L YLRCVVRETFR HPAGPFLIPHES R T INGY IPAKTR+FINT+GLGRN  +W
Sbjct  374   LVNLKYLRCVVRETFRMHPAGPFLIPHESIRDTKINGYFIPAKTRVFINTYGLGRNTKIW  433

Query  1287  DDVDDFRPERHFPAD-GGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             D++D+FRPERH P D   RVEISHGADFKILPFSAGKRKCPGAPLGV LVLMALARLFH 
Sbjct  434   DNIDEFRPERHSPEDESSRVEISHGADFKILPFSAGKRKCPGAPLGVKLVLMALARLFHC  493

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDWSPP GL+PEDIDTSEVYGMTMPKA PL AVARPRL   LY
Sbjct  494   FDWSPPNGLKPEDIDTSEVYGMTMPKAKPLMAVARPRLPAQLY  536



>ref|XP_006444827.1| hypothetical protein CICLE_v10023470mg [Citrus clementina]
 gb|ESR58067.1| hypothetical protein CICLE_v10023470mg [Citrus clementina]
Length=521

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/521 (78%), Positives = 458/521 (88%), Gaps = 13/521 (2%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKM----RLPPGPPRWPIVGNLLQLGRLPHRDFA  233
             ++ FF     + +I+    V   ++  ++    RLPPGPP+ PIVGNLLQL +LPHRD A
Sbjct  1     MSEFFSTSITVCRILPSFTVSIFQQAKRIAKTKRLPPGPPKLPIVGNLLQLSQLPHRDLA  60

Query  234   AFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVAL  413
             + CDKYGPLVYLRLGSVDAITTNDP IIREILL+QD+VFASRPRTLAAVHLAYGCGDVAL
Sbjct  61    SLCDKYGPLVYLRLGSVDAITTNDPDIIREILLRQDEVFASRPRTLAAVHLAYGCGDVAL  120

Query  414   APVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGA  593
             AP+GP WKRMRRICME+LLTTKRLESF  HRA+EA+HLV+DVWG A++G+ VNLR+VLGA
Sbjct  121   APLGPHWKRMRRICMENLLTTKRLESFVTHRADEAKHLVQDVWGRAQSGKPVNLRDVLGA  180

Query  594   FSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
             FSMNNVTRMLLGKQ+FG   S+GP+EAMEFM+ITHELF LLG+IYLGDY+P+WRW+DP+G
Sbjct  181   FSMNNVTRMLLGKQYFGGG-SAGPEEAMEFMHITHELFRLLGVIYLGDYLPIWRWVDPHG  239

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSKK-------EIDGE-MDFVDVLLSLPGENGKEHM  929
             CEKKMREVEKRVDDFH KI+EEHRK++K       E DGE MDFVDVLLSLPGENGKEHM
Sbjct  240   CEKKMREVEKRVDDFHTKIIEEHRKARKDKRNSVNEEDGEAMDFVDVLLSLPGENGKEHM  299

Query  930   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDL  1109
             +DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PRIL+KIQ+ELD VVG +RMV+E DL
Sbjct  300   DDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRILRKIQEELDSVVGPNRMVNEQDL  359

Query  1110  LHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD  1289
              HLNYLRCVVRETFR HPAGPFLI HES RATTINGYHIPAKTR+FINTHGLGRN  +W+
Sbjct  360   PHLNYLRCVVRETFRMHPAGPFLILHESLRATTINGYHIPAKTRVFINTHGLGRNTRIWN  419

Query  1290  DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             D++ FRPERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLG+TLVLMALARLFH FD
Sbjct  420   DIEQFRPERHWLADGSRVEISHGADFKILPFSAGKRKCPGAPLGITLVLMALARLFHCFD  479

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             W+PPEGLRPEDIDTSEVYGMTMPKA PL A+ RPRL  H+Y
Sbjct  480   WTPPEGLRPEDIDTSEVYGMTMPKAQPLLALPRPRLADHMY  520



>gb|KDP28480.1| hypothetical protein JCGZ_14251 [Jatropha curcas]
Length=509

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/515 (78%), Positives = 452/515 (88%), Gaps = 8/515 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             ++++T++S  +C+++I  + +       +     RLPPGP R PI GNLLQLG LPHRD 
Sbjct  1     MEFLTVSSILICIAIIANLFRW------RNQKSKRLPPGPSRLPIFGNLLQLGPLPHRDL  54

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+ C+KYGPLVYLRLGSVDAITTNDP IIREILL+QDD+FASRPRTLAAVHLAY CGDVA
Sbjct  55    ASLCNKYGPLVYLRLGSVDAITTNDPEIIREILLRQDDIFASRPRTLAAVHLAYDCGDVA  114

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICMEHLLTTKRLESFAKHR +EA+HLV  VW  A+ G+ VNLREVLG
Sbjct  115   LAPLGPNWKRMRRICMEHLLTTKRLESFAKHRIDEAQHLVRYVWAQAQCGKAVNLREVLG  174

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FG  E++G QEAMEFM++THELF LLGLIYLGDY+P WR IDPY
Sbjct  175   AFSMNNVTRMLLGKQYFGV-ETAGRQEAMEFMHVTHELFRLLGLIYLGDYLPFWRLIDPY  233

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKKEI-DGEMDFVDVLLSLPGENGKEHMEDVEIK  947
             GCE KM+EVEKRVDDFH KI+EEH+K K ++ +GEMDFVDVLLSLPG++GKEHM+DVEIK
Sbjct  234   GCENKMKEVEKRVDDFHSKIIEEHKKVKNQVGEGEMDFVDVLLSLPGKDGKEHMDDVEIK  293

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             ALIQDMIAAATDTSAVTNEWAMAEVIK PR+L+KIQ+ELD VVG +RMV+E+DL HLNYL
Sbjct  294   ALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLRKIQEELDSVVGPNRMVTESDLAHLNYL  353

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             RCVVRETFR HPAGPFLIPHES RATTINGYHIPA TRIFINTHGLGRN  VW DVD+FR
Sbjct  354   RCVVRETFRMHPAGPFLIPHESLRATTINGYHIPAGTRIFINTHGLGRNTQVWTDVDEFR  413

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH+FDW+PP G
Sbjct  414   PERHWLADGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHAFDWAPPNG  473

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             LR EDIDT+EVYGMTMPKA PL A ARPRL  H+Y
Sbjct  474   LRYEDIDTTEVYGMTMPKAQPLIASARPRLADHMY  508



>ref|XP_010100729.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB83891.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=526

 Score =   840 bits (2170),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/526 (77%), Positives = 451/526 (86%), Gaps = 13/526 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D  T +   +  +++   I    + +   N   RLPPGP RWPIVGNLLQLG LPHRD 
Sbjct  1     MDLTTFSFTAILFAILLGRIIYQSLTSNSPNRTRRLPPGPRRWPIVGNLLQLGPLPHRDL  60

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A  CDKYGPLVYLRLGSVDAITT+DP +IREILL+QD+VFASRPRTLAAVHLAYGC DVA
Sbjct  61    AHLCDKYGPLVYLRLGSVDAITTDDPDVIREILLRQDEVFASRPRTLAAVHLAYGCNDVA  120

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP+WKRMRRICMEHLLTTKRL+SFA  RA EA+HLV DVW  A+NG+ +++REVLG
Sbjct  121   LAPLGPQWKRMRRICMEHLLTTKRLDSFAMQRANEAQHLVRDVWARAQNGKAIDMREVLG  180

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
              FSMNNVTRMLLGKQFFG   S+GPQEAMEFM+ITHELF LLGLIYLGDY+P+WRW+DPY
Sbjct  181   GFSMNNVTRMLLGKQFFGTG-SAGPQEAMEFMHITHELFRLLGLIYLGDYLPIWRWVDPY  239

Query  771   GCEKKMREVEKRVDDFHMKILEEHRK------SKKEIDGE------MDFVDVLLSLPGEN  914
             GCEKKMREVEKRVDDFH+KI+EEHRK       KKE  GE      MDFVDVLLSLPGE+
Sbjct  240   GCEKKMREVEKRVDDFHIKIIEEHRKRKASGGKKKENGGEDDDGEEMDFVDVLLSLPGED  299

Query  915   GKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMV  1094
             GK HM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PR+L KIQ+ELD V+G DRMV
Sbjct  300   GKAHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLHKIQEELDSVIGRDRMV  359

Query  1095  SENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRN  1274
              E+DL HLNYLRCVVRETFR HPAGPFLIPHES R TTINGYHIPAKTRIFINTHGLGRN
Sbjct  360   CESDLAHLNYLRCVVRETFRMHPAGPFLIPHESLRDTTINGYHIPAKTRIFINTHGLGRN  419

Query  1275  PSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
              ++W D+++FRPERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL
Sbjct  420   TNIWTDIEEFRPERHWQADGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  479

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             F SFDW+PPEG+RPEDI+T+EVYGMTMPKA PL AVARPRL  HLY
Sbjct  480   FQSFDWAPPEGMRPEDINTNEVYGMTMPKAQPLMAVARPRLPDHLY  525



>ref|XP_009336813.1| PREDICTED: cytochrome P450 703A2 [Pyrus x bretschneideri]
Length=519

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/515 (79%), Positives = 450/515 (87%), Gaps = 12/515 (2%)
 Frame = +3

Query  78    FLCLSLIFKII-QLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
             F+  S+   II Q L  +   +   + LPPGPPRWPI+GNLLQLG LPHRD A+ C+KYG
Sbjct  6     FIFASIFTSIIYQWLKCRFAPKTKNL-LPPGPPRWPILGNLLQLGALPHRDLASLCNKYG  64

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PLVYL+LGS+DAITTNDP IIREILL+QD+VFASRPRTLAAVHLAYGCGDVALAP+GP+W
Sbjct  65    PLVYLKLGSIDAITTNDPDIIREILLKQDEVFASRPRTLAAVHLAYGCGDVALAPLGPQW  124

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             KRMRRICMEHLLTTKRLESFAKHRAEEA+HLV DV   ++ G+ VNLREVLG FSMNNVT
Sbjct  125   KRMRRICMEHLLTTKRLESFAKHRAEEAQHLVRDVSAASQTGKAVNLREVLGGFSMNNVT  184

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             RMLLGKQ+FGA  S+GPQEA+EFM+ITHELF LLG+IYLGDY+P+WRW+DPYGCEKKMRE
Sbjct  185   RMLLGKQYFGAG-SAGPQEALEFMHITHELFRLLGVIYLGDYLPIWRWVDPYGCEKKMRE  243

Query  795   VEKRVDDFHMKILEEHRKSKKEIDG---------EMDFVDVLLSLPGENGKEHMEDVEIK  947
             VEKRVDDFH KI+EEHR+  KE +G         EMDFVDVLLSLPGE+GK+HM DVEIK
Sbjct  244   VEKRVDDFHTKIIEEHRRRAKEENGRGNGEQDGGEMDFVDVLLSLPGEDGKQHMNDVEIK  303

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             ALIQDMIAAATDTSAVTNEWAMAEVIK PR+L+KIQ+ELD VVG +RMV+E+DL HLNYL
Sbjct  304   ALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLRKIQEELDSVVGQNRMVNESDLPHLNYL  363

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             RCVVRETFR HPAGPFLIPHES RAT INGY+IPAKTR+FINTHGLGRN  +WD+V +FR
Sbjct  364   RCVVRETFRMHPAGPFLIPHESLRATWINGYYIPAKTRVFINTHGLGRNTKIWDNVGEFR  423

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PERH  ADG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH FDWSPPEG
Sbjct  424   PERHCLADGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHCFDWSPPEG  483

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             LRP DIDT EVYGMTMPKA PL A+A PRL  H+Y
Sbjct  484   LRPGDIDTQEVYGMTMPKACPLMAIATPRLPSHMY  518



>ref|XP_010556597.1| PREDICTED: cytochrome P450 703A2 [Tarenaya hassleriana]
Length=521

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/518 (77%), Positives = 445/518 (86%), Gaps = 8/518 (2%)
 Frame = +3

Query  48    MIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             +I  +   + F     +++ ++ L  K        RLPPGPPRWPIVGNLLQLG LPHRD
Sbjct  8     IIGIVVANAMFAANVFLWRWLKALACKA------QRLPPGPPRWPIVGNLLQLGPLPHRD  61

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A  CDKYGPLVYLRLGSVDAITTNDP  IREILL+QD+VFASRP+TLAAVHLAYGCGDV
Sbjct  62    LAQLCDKYGPLVYLRLGSVDAITTNDPDTIREILLRQDNVFASRPKTLAAVHLAYGCGDV  121

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GP+WKRMRRICMEHLLTTKRLESFA  RAEEAR+LV DV   AE G+ +NLREVL
Sbjct  122   ALAPMGPQWKRMRRICMEHLLTTKRLESFASQRAEEARYLVRDVLERAETGKPINLREVL  181

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQFFG     GP+EA EFM+ITH LF LLG+IYLGDY+P WRW+DP
Sbjct  182   GAFSMNNVTRMLLGKQFFGPGSVVGPKEAQEFMHITHRLFWLLGVIYLGDYLPFWRWVDP  241

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG--EMDFVDVLLSLPGENGKEHMEDVE  941
             YGCEK MREVEKRVDDFH KI+EEHR+++ E     EMDFVD+LLSLPGENG EHM+D+E
Sbjct  242   YGCEKSMREVEKRVDDFHTKIIEEHRRARLENHNKKEMDFVDILLSLPGENGNEHMDDME  301

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             IKALIQDMIAAATDTSAVTNEWAMAEVIK P +L+KIQQELD+VVGSDRMV+E+DL HLN
Sbjct  302   IKALIQDMIAAATDTSAVTNEWAMAEVIKHPSVLRKIQQELDKVVGSDRMVNESDLTHLN  361

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             YLRCVVRETFR HPAGPFLIPHES R TTINGY+IPAKTR+FINTHGLGRN  +W DVD+
Sbjct  362   YLRCVVRETFRMHPAGPFLIPHESVRPTTINGYYIPAKTRVFINTHGLGRNAKIWSDVDE  421

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PERH+P +GGRVEISHG DF+ILPFSAGKRKCPGAPLGVT+VLM LARLFH FDWSPP
Sbjct  422   FMPERHWPEEGGRVEISHGPDFRILPFSAGKRKCPGAPLGVTMVLMGLARLFHCFDWSPP  481

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             EG  PEDIDT+EVYGMTMPKA PL+AVA+PRLQ HLYG
Sbjct  482   EGFSPEDIDTNEVYGMTMPKAQPLWAVAKPRLQAHLYG  519



>ref|XP_008233175.1| PREDICTED: cytochrome P450 703A2 [Prunus mume]
Length=522

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/489 (81%), Positives = 443/489 (91%), Gaps = 10/489 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             +LPPGPPRWPI+GNLLQLG LPHRD A+ CDKYGPLVYL+LGSVDAITTNDP IIREILL
Sbjct  34    KLPPGPPRWPILGNLLQLGPLPHRDLASLCDKYGPLVYLKLGSVDAITTNDPDIIREILL  93

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
             +QD+VFASRPRTLAAVHLAYGCGDVALAP GP+WKRMRRICMEHLLTTKRL+SFA+HRAE
Sbjct  94    KQDEVFASRPRTLAAVHLAYGCGDVALAPFGPRWKRMRRICMEHLLTTKRLDSFARHRAE  153

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             EA+HLV DVW MA+ G+ VNLR+VLG FSMNNVTRMLLGKQ+FGA  S+GPQEAMEFM+I
Sbjct  154   EAQHLVLDVWAMAQTGKAVNLRDVLGGFSMNNVTRMLLGKQYFGAG-SAGPQEAMEFMHI  212

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILE---------EHR  845
             THELF LLGLIYLGDY+P+WRW+DPYGCEKKMREVEKRVDDFH  I+E         + +
Sbjct  213   THELFWLLGLIYLGDYLPIWRWVDPYGCEKKMREVEKRVDDFHTNIIEEHRRRAREEKGK  272

Query  846   KSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
             K++ E  GEMDFVDVLLSLPGE+GKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVI
Sbjct  273   KTRGEDGGEMDFVDVLLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  332

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             K PR+L+KIQ+ELD VVG +RMV+E+DL HLNYLRCVVRETFR HPAGPFLIPHES RAT
Sbjct  333   KHPRVLRKIQEELDSVVGPNRMVNESDLAHLNYLRCVVRETFRMHPAGPFLIPHESLRAT  392

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              INGY+IPAKTR+FINTHGLGRN  +WD+V++FRPERH+ ADG RVEISHGADFKILPFS
Sbjct  393   WINGYYIPAKTRVFINTHGLGRNTKIWDNVEEFRPERHWLADGSRVEISHGADFKILPFS  452

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             AGKRKCPGAPLGVTLVLMALARLFH FDW+PP+GLRP+DIDT EVYGMTMPK  PL A+A
Sbjct  453   AGKRKCPGAPLGVTLVLMALARLFHGFDWAPPDGLRPQDIDTKEVYGMTMPKGQPLMAIA  512

Query  1566  RPRLQRHLY  1592
             +PRL  H+Y
Sbjct  513   KPRLPNHMY  521



>ref|XP_007133195.1| hypothetical protein PHAVU_011G159600g [Phaseolus vulgaris]
 gb|ESW05189.1| hypothetical protein PHAVU_011G159600g [Phaseolus vulgaris]
Length=534

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/520 (78%), Positives = 454/520 (87%), Gaps = 9/520 (2%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKMR-LPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             T  S     +L  KII+   V+      K + LPPGPP+WPIVGNLLQLG+LPHRD A+ 
Sbjct  5     TFISAMFLAALASKIIRHWLVRKSLFGHKNKGLPPGPPKWPIVGNLLQLGQLPHRDLASL  64

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
             C+KYGPLVYL+LG++DAITTNDP+II EIL+ QDDVFASRP TLAAVHLAYGCGDVALAP
Sbjct  65    CEKYGPLVYLKLGNIDAITTNDPNIIHEILVSQDDVFASRPNTLAAVHLAYGCGDVALAP  124

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
             +GP WKRMRRICMEHLLTTKRLESF+KHR EEA+HLV+DV G AE    +NLREVLGAFS
Sbjct  125   LGPHWKRMRRICMEHLLTTKRLESFSKHRLEEAQHLVKDVLGRAEYERPINLREVLGAFS  184

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             MNNVTRMLLGKQ+FG+ +SSGP+EAMEFM+ITHELF LLG+IYLGDY+P+WRW+DPYGCE
Sbjct  185   MNNVTRMLLGKQYFGS-KSSGPEEAMEFMHITHELFWLLGVIYLGDYLPMWRWVDPYGCE  243

Query  780   KKMREVEKRVDDFHMKILEEHRK-------SKKEIDGEMDFVDVLLSLPGENGKEHMEDV  938
             KKMREVEKRVDDFH KI+EEHR+        ++E DG+MDFVDVLLSLPGE+GKEHM+DV
Sbjct  244   KKMREVEKRVDDFHSKIIEEHRRVRECKKMRREEGDGDMDFVDVLLSLPGEDGKEHMDDV  303

Query  939   EIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHL  1118
             EIKALIQDMIAAATDTSAVTNEWAMAEVIK P IL+K+QQELD VVG +RMV E+DL HL
Sbjct  304   EIKALIQDMIAAATDTSAVTNEWAMAEVIKHPNILQKVQQELDSVVGPNRMVLESDLPHL  363

Query  1119  NYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVD  1298
             NYLRCVVRETFR HPAGPFLIPHES RATTINGYHIPAKTR+FINTHGLGRN  +WD+V 
Sbjct  364   NYLRCVVRETFRMHPAGPFLIPHESLRATTINGYHIPAKTRVFINTHGLGRNTEIWDNVG  423

Query  1299  DFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             +FRPERH+P++GGRVEISHG DFKILPFSAGKRKCPGAPLG+ LVLMALA LFH F W+P
Sbjct  424   EFRPERHWPSNGGRVEISHGVDFKILPFSAGKRKCPGAPLGLNLVLMALATLFHCFQWTP  483

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             P+GL P+DIDT+EVYGMTMPKA PLFAVA PRL +HLY S
Sbjct  484   PKGLNPQDIDTTEVYGMTMPKANPLFAVAVPRLPKHLYDS  523



>ref|XP_002263965.2| PREDICTED: cytochrome P450 703A2 [Vitis vinifera]
 emb|CBI40562.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/526 (77%), Positives = 452/526 (86%), Gaps = 13/526 (2%)
 Frame = +3

Query  48    MIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             ++D  T  S    L+L+  II+   +       ++ LPPGPPRWPIVGNL QLG+LPHRD
Sbjct  3     IMDLSTFVSTLFSLALVALIIRQWLIGVSMRRSRI-LPPGPPRWPIVGNLFQLGQLPHRD  61

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A+FC+KYGPLVYLRLG+VDAITTNDP IIREIL+++DD+FASRPRTLAA+HLAYGCGDV
Sbjct  62    LASFCNKYGPLVYLRLGTVDAITTNDPDIIREILVRKDDIFASRPRTLAAIHLAYGCGDV  121

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GP WKRMRRICMEHLLTTKRLESF  HRA EA++LV+DVW  A     +NLREVL
Sbjct  122   ALAPLGPHWKRMRRICMEHLLTTKRLESFVNHRAHEAQYLVQDVWTRARTRNPINLREVL  181

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQ+FG  ES+GPQEA EFM+ITHELF LLG IYLGDY+P+WRW+D 
Sbjct  182   GAFSMNNVTRMLLGKQYFGV-ESAGPQEAHEFMHITHELFWLLGFIYLGDYLPIWRWVDL  240

Query  768   -YGCEKKMREVEKRVDDFHMKILEEHRKSKKEID----------GEMDFVDVLLSLPGEN  914
              YGCEKKMREVEKRVD+FHMKI+EEHR+ ++E            GEMDFVDVLLSLPGEN
Sbjct  241   FYGCEKKMREVEKRVDEFHMKIIEEHRRMREEKKKNGVGGNEDGGEMDFVDVLLSLPGEN  300

Query  915   GKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMV  1094
             GK HM+DVEIKAL+QDMIAAATDTSAVTNEWAMAEVIK PR+L+KIQ ELD VVG  RMV
Sbjct  301   GKRHMDDVEIKALMQDMIAAATDTSAVTNEWAMAEVIKHPRVLRKIQDELDSVVGPHRMV  360

Query  1095  SENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRN  1274
             SE+DL HLNYLRCVVRETFR HPAGPFLIPHESTRATTINGY+IPAKTR+FINTHGLGRN
Sbjct  361   SESDLPHLNYLRCVVRETFRMHPAGPFLIPHESTRATTINGYYIPAKTRVFINTHGLGRN  420

Query  1275  PSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
              S+W DV++FRPERH+PADG RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL
Sbjct  421   TSLWPDVEEFRPERHWPADGSRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  480

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              H FDW+PP+GLRPEDIDT EVYGMTMPKA PL A+A PRL  H+Y
Sbjct  481   LHCFDWAPPDGLRPEDIDTREVYGMTMPKAQPLMAIASPRLAAHMY  526



>ref|XP_003541057.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=523

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/523 (76%), Positives = 451/523 (86%), Gaps = 10/523 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D  T  S     +L  +II+   +     + K +LPPGPPRWPIVGNLLQLG+LPHRD 
Sbjct  1     MDLTTFISTLFLGTLASRIIRHWLIGRSLSSHKNKLPPGPPRWPIVGNLLQLGQLPHRDL  60

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+ CDKYGPLVYL+LG +DAITTNDP IIREILL QDDVFASRP T AAVHLAYGCGDVA
Sbjct  61    ASLCDKYGPLVYLKLGKIDAITTNDPDIIREILLSQDDVFASRPHTFAAVHLAYGCGDVA  120

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICMEHLLTTKRLESF+ HR +EA+HLV+DV   A++ + +NLREVLG
Sbjct  121   LAPLGPHWKRMRRICMEHLLTTKRLESFSNHRLDEAQHLVKDVMAWAQDKKPINLREVLG  180

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FG+ ESSGPQEAMEFM+ITHELF LLG+IYLGDY+P+WRW+DPY
Sbjct  181   AFSMNNVTRMLLGKQYFGS-ESSGPQEAMEFMHITHELFWLLGVIYLGDYLPIWRWVDPY  239

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKS-------KKEIDGEMDFVDVLLSLPGENGKEHM  929
             GCEKKMREVEKRVDDFH  I+EEHRK+       +KE DG+MDFVDVLLSLPGE+GKEHM
Sbjct  240   GCEKKMREVEKRVDDFHSNIIEEHRKARKDRKGKRKEGDGDMDFVDVLLSLPGEDGKEHM  299

Query  930   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDL  1109
             +DVEIKALIQDMIAAATDTSAVTNEWAMAEV+K P +L KIQ+ELD +VG +RMV E+DL
Sbjct  300   DDVEIKALIQDMIAAATDTSAVTNEWAMAEVMKHPHVLHKIQEELDTIVGPNRMVLESDL  359

Query  1110  LHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD  1289
              HLNYLRCVVRETFR HPAGPFLIPHES RATTINGYHIPAKTR+FINTHGLGRN  +WD
Sbjct  360   PHLNYLRCVVRETFRMHPAGPFLIPHESLRATTINGYHIPAKTRVFINTHGLGRNTKIWD  419

Query  1290  DVDDFRPERHFPADGG--RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             +VD+FRPERH+P++G   RVEISHG DFKILPFSAGKRKCPGAPLGVTLVLMALARLFH 
Sbjct  420   NVDEFRPERHWPSNGNGTRVEISHGVDFKILPFSAGKRKCPGAPLGVTLVLMALARLFHC  479

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDW PP+GL   D+DT EVYGMTMPKA PL A+A+PRL +HLY
Sbjct  480   FDWEPPKGLSCGDVDTREVYGMTMPKAEPLIAIAKPRLAKHLY  522



>gb|KHN45798.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=523

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/523 (76%), Positives = 450/523 (86%), Gaps = 10/523 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D  T  S     +L  +II+   +     + K +LPPGPPRWPIVGNLLQLG+LPHRD 
Sbjct  1     MDLTTFISTLFLGTLASRIIRHWLIGRSLSSHKNKLPPGPPRWPIVGNLLQLGQLPHRDL  60

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+ CDKYGPLVYL+LG +DAITTNDP IIREILL QDDVFASRP T AAVHLAYGCGDVA
Sbjct  61    ASLCDKYGPLVYLKLGKIDAITTNDPDIIREILLSQDDVFASRPHTFAAVHLAYGCGDVA  120

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICMEHLLTTKRLESF+ HR +EA+HLV+DV   A++ + +NLREVLG
Sbjct  121   LAPLGPHWKRMRRICMEHLLTTKRLESFSNHRLDEAQHLVKDVMAWAQDKKPINLREVLG  180

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FG+ ESSGPQEAMEFM+ITHELF LLG+IYLGDY+P+WRW+DPY
Sbjct  181   AFSMNNVTRMLLGKQYFGS-ESSGPQEAMEFMHITHELFWLLGVIYLGDYLPIWRWVDPY  239

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKS-------KKEIDGEMDFVDVLLSLPGENGKEHM  929
             GCEKKMREVEKRVDDFH  I+EEHRK+       +KE DG+MDFVDVLLSLPGE+GKEHM
Sbjct  240   GCEKKMREVEKRVDDFHSNIIEEHRKARKDRKGKRKEGDGDMDFVDVLLSLPGEDGKEHM  299

Query  930   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDL  1109
             +DVEIKALIQDMIAAATDTSAVTNEWAMAEV+K P +L KIQ+ELD +VG +RMV E+DL
Sbjct  300   DDVEIKALIQDMIAAATDTSAVTNEWAMAEVMKHPHVLHKIQEELDTIVGPNRMVLESDL  359

Query  1110  LHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD  1289
              HLNYLRCVVRETFR HPAGPFLIPHES RATTINGYHI AKTR+FINTHGLGRN  +WD
Sbjct  360   PHLNYLRCVVRETFRMHPAGPFLIPHESLRATTINGYHITAKTRVFINTHGLGRNTKIWD  419

Query  1290  DVDDFRPERHFPADGG--RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             +VD+FRPERH+P++G   RVEISHG DFKILPFSAGKRKCPGAPLGVTLVLMALARLFH 
Sbjct  420   NVDEFRPERHWPSNGNGTRVEISHGVDFKILPFSAGKRKCPGAPLGVTLVLMALARLFHC  479

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDW PP+GL   D+DT EVYGMTMPKA PL A+A+PRL +HLY
Sbjct  480   FDWEPPKGLSCGDVDTREVYGMTMPKAEPLIAIAKPRLAKHLY  522



>ref|XP_007220171.1| hypothetical protein PRUPE_ppa016810mg, partial [Prunus persica]
 gb|EMJ21370.1| hypothetical protein PRUPE_ppa016810mg, partial [Prunus persica]
Length=495

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/489 (81%), Positives = 440/489 (90%), Gaps = 10/489 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             +LPPGPPRWPI+GNLLQLG LPHRD A+ CDKYGPLVYL+LGSVDAITTNDP IIREILL
Sbjct  7     KLPPGPPRWPILGNLLQLGPLPHRDLASLCDKYGPLVYLKLGSVDAITTNDPEIIREILL  66

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
             +QD+VFASRPRTLAAVHLAYGCGDVALAP GP+WKRMRRICMEHLLTTKRL+SF +HRAE
Sbjct  67    KQDEVFASRPRTLAAVHLAYGCGDVALAPFGPRWKRMRRICMEHLLTTKRLDSFTRHRAE  126

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             EA+HLV DVW MA+ G+ VNLR+VLG FSMNNVTRMLLGKQ+FGA  S+GPQEAMEFM+I
Sbjct  127   EAQHLVRDVWAMAQTGKAVNLRDVLGGFSMNNVTRMLLGKQYFGAG-SAGPQEAMEFMHI  185

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILE---------EHR  845
             THELF LLGLIYLGDY+P+WRW+DPYGCEKKMREVEKRVDDFH  I+E         + +
Sbjct  186   THELFWLLGLIYLGDYLPIWRWVDPYGCEKKMREVEKRVDDFHTNIIEEHRRRAREEKGK  245

Query  846   KSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
             K++ +  GEMDFVDVLLSLPGE+GK HM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVI
Sbjct  246   KTRGQEGGEMDFVDVLLSLPGEDGKGHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  305

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             K P +L+KIQ+ELD VVG  RMV+E+DL HLNYLRCVVRETFR HPAGPFLIPHES RAT
Sbjct  306   KHPHVLRKIQEELDSVVGPKRMVNESDLAHLNYLRCVVRETFRMHPAGPFLIPHESLRAT  365

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              I+GYHIPAKTR+FINTHGLGRN  +WD+V++FRPERH+ ADG RVEISHGADFKILPFS
Sbjct  366   WIDGYHIPAKTRVFINTHGLGRNTKIWDNVEEFRPERHWLADGSRVEISHGADFKILPFS  425

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             AGKRKCPGAPLGVTLVLMALARLFH FDW+PP+GLRP+DI+T EVYGMTMPKA PL A+A
Sbjct  426   AGKRKCPGAPLGVTLVLMALARLFHGFDWAPPDGLRPQDIETKEVYGMTMPKAQPLMAIA  485

Query  1566  RPRLQRHLY  1592
             +PRL  H+Y
Sbjct  486   KPRLPNHMY  494



>ref|XP_004308304.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=675

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/518 (79%), Positives = 454/518 (88%), Gaps = 11/518 (2%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             SF +  ++   I QL+  + G +  K+  PPGP R P++GNLLQLG LPHRD A  CDKY
Sbjct  152   SFIIAATIASIIYQLVKRRLGSKTEKV-FPPGPVRLPVLGNLLQLGPLPHRDLALLCDKY  210

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GPLVYLRLGS+DAITTNDP IIREILL+QDD+FASRPRTLAAVHLAY CGDVALAP+GP+
Sbjct  211   GPLVYLRLGSIDAITTNDPDIIREILLRQDDIFASRPRTLAAVHLAYDCGDVALAPLGPQ  270

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             WKRMRRICMEHLLTTKRLESFAKHRA+EA+HLV DV  MA+ G+ VNLREVLG +SMNNV
Sbjct  271   WKRMRRICMEHLLTTKRLESFAKHRADEAQHLVRDVCAMAQTGKAVNLREVLGGWSMNNV  330

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
             TRMLLGKQ+FGA  S+GPQEAMEFM+ITHELF LLGLIYLGDY+P+WRW+DPYGCEKKMR
Sbjct  331   TRMLLGKQYFGAG-SAGPQEAMEFMHITHELFWLLGLIYLGDYLPIWRWVDPYGCEKKMR  389

Query  792   EVEKRVDDFHMKILEEHR-----KSK----KEIDGEMDFVDVLLSLPGENGKEHMEDVEI  944
             EVEKRVDDFH KILEEHR     KSK    +E   EMDFVDVLLSLPGE+GK+HMEDVEI
Sbjct  390   EVEKRVDDFHSKILEEHRRVRVEKSKPIVGEEDGAEMDFVDVLLSLPGEDGKKHMEDVEI  449

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KALIQDMIAAATDTSAVTNEWAMAEVIK PR+L+KIQ+ELD VVG DRMV+E+DL HLNY
Sbjct  450   KALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLRKIQEELDTVVGQDRMVNESDLPHLNY  509

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             LRCVVRETFR HPAGPFLIPHES RAT INGY+IPAKTR+FINTHGLGRN  +WD+V++F
Sbjct  510   LRCVVRETFRMHPAGPFLIPHESLRATWINGYYIPAKTRVFINTHGLGRNTKLWDNVEEF  569

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
             RPERH+  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH FDW+PPE
Sbjct  570   RPERHWLDDGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHCFDWTPPE  629

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             GLRPEDIDT EVYGMTMPK  PL AVARPRL  ++Y S
Sbjct  630   GLRPEDIDTEEVYGMTMPKVQPLMAVARPRLTNNIYVS  667



>ref|XP_007051531.1| Cytochrome P450, family 703, subfamily A, polypeptide 2 [Theobroma 
cacao]
 gb|EOX95688.1| Cytochrome P450, family 703, subfamily A, polypeptide 2 [Theobroma 
cacao]
Length=524

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/488 (81%), Positives = 443/488 (91%), Gaps = 10/488 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP +WP+VGNLLQL  LPHRD A+ CDKYGPLVYLRLGSVDAITTNDP IIREILL+
Sbjct  37    LPPGPKKWPVVGNLLQLSPLPHRDLASLCDKYGPLVYLRLGSVDAITTNDPDIIREILLR  96

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             QDDVFASRPRTLAAVHLAY CGDVALAP+GP WKRMRRICMEHLLTTKRLESFAKHRA+E
Sbjct  97    QDDVFASRPRTLAAVHLAYECGDVALAPLGPHWKRMRRICMEHLLTTKRLESFAKHRADE  156

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
             A+HLV+DV   A+ G+ VNLREVLGAF+MNNVTRMLLG+Q+FGA ES+GPQEA+EFM++T
Sbjct  157   AQHLVKDVSARAKTGKLVNLREVLGAFAMNNVTRMLLGRQYFGA-ESAGPQEALEFMHVT  215

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSK-------  854
             HELF LLG+IYLGDY+P+WRW+DPYGCEKKMREVEKRVDDFH +I+EEHR+++       
Sbjct  216   HELFWLLGVIYLGDYLPIWRWVDPYGCEKKMREVEKRVDDFHKRIIEEHRRAREGKKREF  275

Query  855   -KEIDGE-MDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
              +E DGE MDFVDVLLSLPGE+GK HM+D +IKALIQDMIAAATDTSAVTNEWAMAEVIK
Sbjct  276   GREDDGEEMDFVDVLLSLPGEDGKAHMDDTDIKALIQDMIAAATDTSAVTNEWAMAEVIK  335

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              PR+L+KIQ+ELD VVG +RMV+E+DL HLNY+RCVVRETFR HPAGPFLIPHES RATT
Sbjct  336   HPRVLRKIQEELDTVVGPNRMVNESDLPHLNYIRCVVRETFRMHPAGPFLIPHESLRATT  395

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSA  1388
             INGY+IPAKTR+FINTHGLGRN  +WDDV+ FRPERH+ A+G RVEISHGADFKILPFSA
Sbjct  396   INGYYIPAKTRVFINTHGLGRNTKIWDDVEVFRPERHWLANGTRVEISHGADFKILPFSA  455

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             GKRKCPGAPLGVTLVLMALARLFH FDW+PPEGLRPEDI+T+EVYGMTMPKA PL A+AR
Sbjct  456   GKRKCPGAPLGVTLVLMALARLFHCFDWAPPEGLRPEDINTTEVYGMTMPKAEPLMAIAR  515

Query  1569  PRLQRHLY  1592
             PRL   +Y
Sbjct  516   PRLADQMY  523



>ref|XP_008356280.1| PREDICTED: cytochrome P450 703A2 [Malus domestica]
Length=908

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/483 (82%), Positives = 434/483 (90%), Gaps = 10/483 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGPPRWPI+GNLLQLG LPHRD A+ C+KYGPLVYL+LGS+DAITTNDP IIREILL+
Sbjct  32    LPPGPPRWPILGNLLQLGALPHRDLASLCNKYGPLVYLKLGSIDAITTNDPDIIREILLK  91

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             QD+VFASRPRTLAAVHLAYGCGDVALAP+GP+WKRMRRICMEHLLTTKRLESFAKHRAEE
Sbjct  92    QDEVFASRPRTLAAVHLAYGCGDVALAPLGPQWKRMRRICMEHLLTTKRLESFAKHRAEE  151

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
             A+HLV DV   +  G+ VNLREVLG FSMNNVTRMLLGKQ+FGA  S+GPQEA+EFM+IT
Sbjct  152   AQHLVRDVLVASRTGKAVNLREVLGGFSMNNVTRMLLGKQYFGAG-SAGPQEALEFMHIT  210

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG--  869
             HELF LLG+IYLGDY+P+WRW+DPYGCEKKMREVEKRVDDFH KI+EEHR+   E +G  
Sbjct  211   HELFWLLGVIYLGDYLPIWRWVDPYGCEKKMREVEKRVDDFHTKIIEEHRRRANEENGRG  270

Query  870   -------EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
                    EMDFVDVLLSLPGE+GK+HM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK
Sbjct  271   SGEQDGGEMDFVDVLLSLPGEDGKQHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  330

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              PR+L+KIQ+ELD VVG +RMV+E+DL HLNYLRCVVRETFR HPAGPFLIPHES RAT 
Sbjct  331   HPRVLRKIQEELDSVVGQNRMVNESDLPHLNYLRCVVRETFRMHPAGPFLIPHESLRATW  390

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSA  1388
             INGY+IPAKTR+F NTHGLGRN  +WD+VD+FRPERH   DG RVEISHGADFKILPFSA
Sbjct  391   INGYYIPAKTRVFXNTHGLGRNTKIWDNVDEFRPERHCLXDGSRVEISHGADFKILPFSA  450

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             GKRKCPGAPLGVTLVLMALARLFH FDWSPPEGLRP DIDT EVYGMTMPKA PL A+A 
Sbjct  451   GKRKCPGAPLGVTLVLMALARLFHCFDWSPPEGLRPGDIDTQEVYGMTMPKACPLMAIAT  510

Query  1569  PRL  1577
             PRL
Sbjct  511   PRL  513



>ref|XP_003624793.1| Flavonoid 3'-monooxygenase [Medicago truncatula]
 gb|AES81011.1| cytochrome P450 family protein [Medicago truncatula]
Length=521

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/495 (79%), Positives = 441/495 (89%), Gaps = 7/495 (1%)
 Frame = +3

Query  126   KTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTND  305
             K+   + K  LPPGPPRWPIVGNLLQLG+LPHRD A+ CDKYGPLVYL+LG++DAITTND
Sbjct  27    KSPSLDKKNNLPPGPPRWPIVGNLLQLGQLPHRDLASLCDKYGPLVYLKLGNIDAITTND  86

Query  306   PSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRL  485
             P IIREILL QDDVFASRPRTLAA+HLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRL
Sbjct  87    PDIIREILLSQDDVFASRPRTLAAIHLAYGCGDVALAPLGPHWKRMRRICMEHLLTTKRL  146

Query  486   ESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGP  665
             ESF+KHR EEA+HLV+DV+  A++   +NLRE+LGAFSMNNVTRMLLGKQ+FG+ +S+GP
Sbjct  147   ESFSKHRQEEAQHLVKDVFARAKSENPINLREILGAFSMNNVTRMLLGKQYFGS-KSAGP  205

Query  666   QEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR  845
             QEAMEFM+ITHELF LLG+IYLGDY+P+WRWIDP+GCEKKMREVEKRVDDFH KILEEHR
Sbjct  206   QEAMEFMHITHELFWLLGVIYLGDYLPMWRWIDPHGCEKKMREVEKRVDDFHSKILEEHR  265

Query  846   KSKKEIDG------EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEW  1007
             K++K+  G      E+DFVD+LLSLPGE+GKEHM+DVEIKALIQDMIAAATDTSAVTNEW
Sbjct  266   KARKDKKGIGKSDEELDFVDILLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEW  325

Query  1008  AMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPH  1187
             AM EVIK P +L KIQ+ELD VVG +RMV E+DL +LNYLRCVVRETFR HPAGPFLIPH
Sbjct  326   AMTEVIKHPHVLHKIQEELDVVVGPNRMVIESDLPNLNYLRCVVRETFRMHPAGPFLIPH  385

Query  1188  ESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADF  1367
             ES R TTINGY+IP+KTR+FINTHGLGRN  +W++VD+FRPERHF   G RVEISHGADF
Sbjct  386   ESLRPTTINGYYIPSKTRVFINTHGLGRNTKIWENVDEFRPERHFSTSGSRVEISHGADF  445

Query  1368  KILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKAT  1547
             KILPFSAGKRKCPGAPLGVTLVLMALARLFH FDW+PP+GL  +DIDT EVYGMTMPK  
Sbjct  446   KILPFSAGKRKCPGAPLGVTLVLMALARLFHCFDWNPPKGLNHQDIDTQEVYGMTMPKVH  505

Query  1548  PLFAVARPRLQRHLY  1592
             PL AVA+PRL  H+Y
Sbjct  506   PLIAVAKPRLASHMY  520



>ref|XP_010275090.1| PREDICTED: cytochrome P450 703A2 [Nelumbo nucifera]
Length=522

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/522 (76%), Positives = 448/522 (86%), Gaps = 9/522 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D  TLAS  +   L   I+ L          K RLPPGPPRWPI GNLLQLG LPHRDF
Sbjct  1     MDLGTLASTLVYAFLFGTIVCLRLWLMKSLQSKGRLPPGPPRWPIFGNLLQLGPLPHRDF  60

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A+FC+KYGPLVYLRLGSVDAITTNDP IIREILL+QD+VFASRPRTLAAVHLAYGCGDVA
Sbjct  61    ASFCEKYGPLVYLRLGSVDAITTNDPEIIREILLRQDEVFASRPRTLAAVHLAYGCGDVA  120

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP+WKRMRRICMEHLL+ KRLESFA HRA EA HLV+DV+  ++ G+ VNLR+VLG
Sbjct  121   LAPLGPQWKRMRRICMEHLLSIKRLESFADHRAREAHHLVQDVYDRSQTGKPVNLRQVLG  180

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
             AFSMNNVTRMLLGKQ+FG  ES+GPQEAMEFM+ITHELF LLGLIYLGDY+P+WRW+DP+
Sbjct  181   AFSMNNVTRMLLGKQYFGI-ESAGPQEAMEFMHITHELFWLLGLIYLGDYLPIWRWLDPF  239

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKK--------EIDGEMDFVDVLLSLPGENGKEH  926
             GCEKKMREVEKRVD+FHMKI+EEHRK ++        + D EMDFVD+LLSLPGE GKEH
Sbjct  240   GCEKKMREVEKRVDEFHMKIIEEHRKGRERKKEKKGEDDDREMDFVDILLSLPGEQGKEH  299

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             +ED EIKALIQDMIAAATDTS+VTNEWAMAEVIK P +L K+Q+ELD VVG +RMVSE+D
Sbjct  300   LEDAEIKALIQDMIAAATDTSSVTNEWAMAEVIKHPEVLGKVQEELDSVVGPNRMVSESD  359

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L HLNYLRC+VRETFR HPAGPFLIPHES R T INGY IPAKTR+FINTH LGRN  +W
Sbjct  360   LAHLNYLRCIVRETFRMHPAGPFLIPHESIRPTKINGYDIPAKTRVFINTHALGRNTRIW  419

Query  1287  DDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSF  1466
             +D+D+FRPERH PADG RVEISHG DFKILPFSAGKRKCPGAPLG+T VLM+LARLFH F
Sbjct  420   NDIDEFRPERHLPADGSRVEISHGTDFKILPFSAGKRKCPGAPLGLTFVLMSLARLFHCF  479

Query  1467  DWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             DW PPEGL+PEDIDT+EVYGMTMPKA PL A+A PRL + +Y
Sbjct  480   DWIPPEGLKPEDIDTTEVYGMTMPKAKPLMAIASPRLAKEMY  521



>ref|XP_002302635.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE81908.1| cytochrome P450 family protein [Populus trichocarpa]
Length=521

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/477 (82%), Positives = 430/477 (90%), Gaps = 8/477 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             + GNLLQLG+ PHRD A+ CDKYGPLVYLRLGSVDAITTNDP IIREIL++QD+VFASRP
Sbjct  45    VFGNLLQLGQQPHRDLASLCDKYGPLVYLRLGSVDAITTNDPEIIREILVRQDEVFASRP  104

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
             RTLAAVHLAYGCGDVALAP+GP WKRMRRICME LLTT+RLESFA HRA+EA+HLV DVW
Sbjct  105   RTLAAVHLAYGCGDVALAPLGPHWKRMRRICMEQLLTTRRLESFANHRADEAQHLVMDVW  164

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
                + G+ ++LREVLGAFSMNNVTRMLLGKQ+FGA ES+GPQEAMEFM+ITHELF LLG+
Sbjct  165   SRTQTGKPLSLREVLGAFSMNNVTRMLLGKQYFGA-ESAGPQEAMEFMHITHELFRLLGV  223

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK-------EIDGEMDF  881
             IYLGDY+P WRWIDP+GCEKKMREVEKRVDDFH KI+EEHRK++K       E D +MDF
Sbjct  224   IYLGDYLPFWRWIDPHGCEKKMREVEKRVDDFHNKIIEEHRKTRKTKRKETGEEDKDMDF  283

Query  882   VDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             VDVLLSLPGENGKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PR+L KIQQE
Sbjct  284   VDVLLSLPGENGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLSKIQQE  343

Query  1062  LDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTR  1241
             LD VVG +RMV+E+DL HLNYLRCVVRETFR HPAGP LIPHES RATTINGYHIP KTR
Sbjct  344   LDSVVGPNRMVTESDLAHLNYLRCVVRETFRMHPAGPLLIPHESLRATTINGYHIPDKTR  403

Query  1242  IFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLG  1421
             +FINTHGLGRN  +W DV++FRPERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLG
Sbjct  404   VFINTHGLGRNTKLWADVEEFRPERHWLADGSRVEISHGADFKILPFSAGKRKCPGAPLG  463

Query  1422  VTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             VTLVLMALARLFH FDW+PPEGL PEDIDT+EVYGMTMPKA PL A+ARPRL  H+Y
Sbjct  464   VTLVLMALARLFHCFDWTPPEGLSPEDIDTTEVYGMTMPKAKPLLAMARPRLAEHMY  520



>ref|XP_011023171.1| PREDICTED: cytochrome P450 703A2 [Populus euphratica]
Length=521

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/477 (82%), Positives = 429/477 (90%), Gaps = 8/477 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             + GNLLQLG+ PHRD A+ CDKYGPLVYLRLGSVDAITTNDP IIREILL+QD+VFASRP
Sbjct  45    VFGNLLQLGQQPHRDLASLCDKYGPLVYLRLGSVDAITTNDPEIIREILLRQDEVFASRP  104

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
             RTLAAVHLAYGCGDVALAP+GP WKRMRRICME LLTT+RLESFA HRA+EA+HLV DVW
Sbjct  105   RTLAAVHLAYGCGDVALAPLGPHWKRMRRICMEQLLTTRRLESFANHRADEAQHLVMDVW  164

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
                + G+ +NLREVLGAFSMNNVTRMLLGKQ+FGA ES+GPQEA+EFM+ITHELF LLG+
Sbjct  165   SGTQTGKPLNLREVLGAFSMNNVTRMLLGKQYFGA-ESAGPQEAIEFMHITHELFRLLGV  223

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK-------EIDGEMDF  881
             IYLGDY+P WRWIDP+GCEKKMREVEKRVDDFH KI+EEHRK++K       E D +MDF
Sbjct  224   IYLGDYLPFWRWIDPHGCEKKMREVEKRVDDFHTKIIEEHRKTRKTKRKETGEEDKDMDF  283

Query  882   VDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             VDVLLSLPGENGKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK PR+L KIQQE
Sbjct  284   VDVLLSLPGENGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLSKIQQE  343

Query  1062  LDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTR  1241
             LD VVG +RMV E+DL HLNYLRCVVRETFR HPAGP LIPHES RATTINGYHIP KTR
Sbjct  344   LDAVVGPNRMVMESDLAHLNYLRCVVRETFRMHPAGPLLIPHESLRATTINGYHIPDKTR  403

Query  1242  IFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLG  1421
             +FINTHGLGRN  +W DV++FRPERH+ ADG RVEISHGADFKILPFSAGKRKCPGAPLG
Sbjct  404   VFINTHGLGRNTKLWADVEEFRPERHWLADGSRVEISHGADFKILPFSAGKRKCPGAPLG  463

Query  1422  VTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             VTLVLMALARLFH FDW+PPEGL PEDIDT+EVYGMTMPKA PL A+ARPRL  H+Y
Sbjct  464   VTLVLMALARLFHCFDWTPPEGLSPEDIDTTEVYGMTMPKAKPLLAMARPRLAEHMY  520



>emb|CAN79465.1| hypothetical protein VITISV_035365 [Vitis vinifera]
Length=513

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/490 (80%), Positives = 433/490 (88%), Gaps = 12/490 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGPPRWPIVGNL QLG+LPHRD A+FC+KYGPLVYLRLG+VDAITTNDP IIREIL++
Sbjct  24    LPPGPPRWPIVGNLFQLGQLPHRDLASFCNKYGPLVYLRLGTVDAITTNDPDIIREILVR  83

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             +DD+FASRPRTLAA+HLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF  HRA E
Sbjct  84    KDDIFASRPRTLAAIHLAYGCGDVALAPLGPHWKRMRRICMEHLLTTKRLESFVNHRAHE  143

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
             A++LV+DVW  A     +NLREVLGAFSMNNVTRMLLGKQ+FG  ES+GPQEA EFM+IT
Sbjct  144   AQYLVQDVWTRARTRNPINLREVLGAFSMNNVTRMLLGKQYFGV-ESAGPQEAHEFMHIT  202

Query  696   HELFHLLGLIYLGDYVPLWRWIDP-YGCEKKMREVEKRVDDFHMKILEEHRKSKKEID--  866
             HELF LLG IYLGDY+P+WRW+D  YGCEKKMREVEKRVD+FHMKI+EEHR+ ++E    
Sbjct  203   HELFWLLGFIYLGDYLPIWRWVDLFYGCEKKMREVEKRVDEFHMKIIEEHRRMREEKKKN  262

Query  867   --------GEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
                     GEMDFVDVLLSLPGENGK HM+DVEIKAL+QDMIAAATDTSAVTNEWAMAEV
Sbjct  263   GVGGNEDGGEMDFVDVLLSLPGENGKRHMDDVEIKALMQDMIAAATDTSAVTNEWAMAEV  322

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             IK PR+L+KIQ ELD VVG  RMVSE+DL HLNYLRCVVRETFR HPAGPFLIPHESTRA
Sbjct  323   IKHPRVLRKIQDELDSVVGPHRMVSESDLPHLNYLRCVVRETFRMHPAGPFLIPHESTRA  382

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
             TTINGY+IPAKTR+FINTHGLGRN S+W DV++FRPERH+PADG RVEISHGADF ILPF
Sbjct  383   TTINGYYIPAKTRVFINTHGLGRNTSLWADVEEFRPERHWPADGSRVEISHGADFXILPF  442

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
             SAGKRKCPGAPLGVTLVLMALARL H FDW+PP GLRP DI T EVYGMTMPKA PL A+
Sbjct  443   SAGKRKCPGAPLGVTLVLMALARLLHCFDWAPPXGLRPXDIXTREVYGMTMPKAQPLMAI  502

Query  1563  ARPRLQRHLY  1592
             A PRL  H+Y
Sbjct  503   ASPRLAAHMY  512



>gb|EMS57417.1| Flavonoid 3',5'-hydroxylase [Triticum urartu]
Length=531

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 446/525 (85%), Gaps = 21/525 (4%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENG-KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             L S  LC S IF       V   K NG ++RLPPGPPRWPI GNLLQL  LPH+DFA FC
Sbjct  5     LLSIILC-SCIFAA-----VSWKKLNGMRLRLPPGPPRWPIFGNLLQLSPLPHKDFARFC  58

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGPLVYLRLG++DAITT+DP +IREIL++QD+VFASRPRTLAAVHLAYGCGDVALAP+
Sbjct  59    TKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPL  118

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             GP WKRMRR+CMEHLLTT+RLESFA HRAEEA HL E VW  +++G+ VNLREVLGAFSM
Sbjct  119   GPNWKRMRRVCMEHLLTTRRLESFAAHRAEEAEHLCEFVWAKSQSGKPVNLREVLGAFSM  178

Query  603   NNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
             NNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF LLGLIYLGDY+P WRW+DPYGCEK
Sbjct  179   NNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFFLLGLIYLGDYLPAWRWLDPYGCEK  237

Query  783   KMREVEKRVDDFHMKILEEHRKSKK--------EIDGE-----MDFVDVLLSLPGENGKE  923
             KMREVEK+VDDFH KI++EHRK++         + DG+     MDFVDVLLSLPGENG E
Sbjct  238   KMREVEKKVDDFHQKIIDEHRKARDVRKSGASLDDDGDDSKEGMDFVDVLLSLPGENGNE  297

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
             HM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L+KIQ+ELD VVG+ RMV E 
Sbjct  298   HMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDAVVGTSRMVVEA  357

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             DL HL YLRCVVRE+FR HPAGPFLIPHES +ATTI GY IPA+TRIFINTH LGRNP +
Sbjct  358   DLPHLTYLRCVVRESFRMHPAGPFLIPHESLKATTIMGYDIPAQTRIFINTHALGRNPRI  417

Query  1284  WDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             WDDVD+FRPERH PADGGRVEISH  DFKILPFSAGKRKCPGAPLGV LVLMALARLFH 
Sbjct  418   WDDVDEFRPERHLPADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHC  477

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             FDWSPP+GLRPEDIDT EVYGMTMPKA PL A A+PRL   +YGS
Sbjct  478   FDWSPPDGLRPEDIDTDEVYGMTMPKAKPLIAAAQPRLPPQMYGS  522



>ref|XP_006362136.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=551

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/548 (73%), Positives = 458/548 (84%), Gaps = 25/548 (5%)
 Frame = +3

Query  21    LSDLIKVLKMIDYITLASFFLCLSLIFKIIQLLPVK-TGKENGKM-RLPPGPPRWPIVGN  194
             L+  + VL     + L ++ + L   + I +LL      K N ++ +LPPGP +WPIVGN
Sbjct  4     LTSFVIVLLCTYLLNLINYSIVLFGAYLISKLLHFSFVDKSNREINQLPPGPKQWPIVGN  63

Query  195   LLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLA  374
             L QLG+LPHRD A+FC+KYGPLVYLRLG+VDAITTNDP IIREIL+QQDDVFASRPRTLA
Sbjct  64    LFQLGQLPHRDMASFCEKYGPLVYLRLGNVDAITTNDPEIIREILVQQDDVFASRPRTLA  123

Query  375   AVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAE  554
             A+HLAYGCGDVALAP+GPKWKRMRRICMEHLLTTKRLESFAKHRA+EA+ LV+D+W  A+
Sbjct  124   AIHLAYGCGDVALAPLGPKWKRMRRICMEHLLTTKRLESFAKHRADEAQSLVKDIWTKAQ  183

Query  555   NGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLG  734
              G+ VNLREVLG FSMNNVTRMLLGKQ+FGA ES+GPQEAMEFM++THELF LLG+IYLG
Sbjct  184   KGQIVNLREVLGGFSMNNVTRMLLGKQYFGA-ESAGPQEAMEFMHVTHELFWLLGVIYLG  242

Query  735   DYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI------DGEMDFVDVLL  896
             DY+P WRWIDPYGCEKKMR+VEKR+DDFHM+I+EEHRK K         D EMDFVDVLL
Sbjct  243   DYLPFWRWIDPYGCEKKMRDVEKRIDDFHMRIIEEHRKKKGNKNNNNIDDDEMDFVDVLL  302

Query  897   SLPGE-----NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             SLPGE     NGK++M+DVEIKALIQDMIAAATDTSAVTNEWAMAEVI+ P +LKKIQ+E
Sbjct  303   SLPGEDEGDGNGKQNMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIRHPHVLKKIQEE  362

Query  1062  LDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTR  1241
             LD VVGS RMV+E+DL+HL YLRCVVRETFR HPAGPFLIPHES R T INGY+IPAKTR
Sbjct  363   LDIVVGSGRMVTESDLIHLKYLRCVVRETFRMHPAGPFLIPHESIRDTMINGYYIPAKTR  422

Query  1242  IFINTHGLGRNPSVWDDVDDFRPERHFPAD-----------GGRVEISHGADFKILPFSA  1388
             +FINTHGLGRN  +WD++D+FRPERH P +             RVEISHG DFKILPFSA
Sbjct  423   VFINTHGLGRNTKIWDNIDEFRPERHLPPNDDEKNMIMTTSSSRVEISHGPDFKILPFSA  482

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             GKRKCPGAPLGV LVLMALARLFH +DWSPP G++ +DIDT+EVYGMTMPKA PL A+A+
Sbjct  483   GKRKCPGAPLGVKLVLMALARLFHCYDWSPPNGVKHQDIDTNEVYGMTMPKAKPLMAIAK  542

Query  1569  PRLQRHLY  1592
             PRL  HLY
Sbjct  543   PRLPAHLY  550



>gb|EMT07267.1| Flavonoid 3',5'-hydroxylase [Aegilops tauschii]
Length=532

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/519 (76%), Positives = 440/519 (85%), Gaps = 16/519 (3%)
 Frame = +3

Query  87    LSLIFKIIQLLPVKTGKENG-KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLV  263
             LS+I        V   K NG ++RLPPGPPRWPI GNLLQL  LPH+DFA FC KYGPLV
Sbjct  6     LSMILCSCIFAAVSWKKLNGMRLRLPPGPPRWPIFGNLLQLSPLPHKDFARFCTKYGPLV  65

Query  264   YLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRM  443
             YLRLG++DAITT+DP +IREIL++QD+VFASRPRTLAAVHLAYGCGDVALAP+GP WKRM
Sbjct  66    YLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRM  125

Query  444   RRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRML  623
             RR+CMEHLLTT+RLESFA HRAEE  HL E VW  +++G+ VNLREVLGAFSMNNVTRML
Sbjct  126   RRVCMEHLLTTRRLESFAAHRAEETEHLCEFVWAKSQSGKPVNLREVLGAFSMNNVTRML  185

Query  624   LGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEK  803
             LGKQ+FG  +S+GP EAMEFM+ITHELF LLGLIYLGDY+P WRW+DPYGCEKKMREVEK
Sbjct  186   LGKQYFGL-QSAGPGEAMEFMHITHELFFLLGLIYLGDYLPAWRWLDPYGCEKKMREVEK  244

Query  804   RVDDFHMKILEEHRKSKK--------------EIDGEMDFVDVLLSLPGENGKEHMEDVE  941
             +VDDFH KI++EHRK++               +   +MDFVDVLLSLPGENG EHM+DVE
Sbjct  245   KVDDFHQKIIDEHRKARDVRKSGASLDDDGDDDSKEDMDFVDVLLSLPGENGNEHMDDVE  304

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             IKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L+KIQ+ELD VVG+ RMV E+DL HL 
Sbjct  305   IKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRKIQEELDTVVGTSRMVVESDLPHLT  364

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             YLRCVVRE+FR HPAGPFLIPHES +ATTI GY IPA+TRIFINTH LGRNP +WDDVD+
Sbjct  365   YLRCVVRESFRMHPAGPFLIPHESLKATTIMGYDIPAQTRIFINTHALGRNPRIWDDVDE  424

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             FRPERH PADGGRVEISH  DFKILPFSAGKRKCPGAPLGV LVLMALARLFH F+WSPP
Sbjct  425   FRPERHLPADGGRVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHCFNWSPP  484

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             +GLRPEDIDT EVYGMTMPKA PL A A PRL   +YGS
Sbjct  485   DGLRPEDIDTDEVYGMTMPKAKPLIAAAHPRLPPQMYGS  523



>ref|XP_004972929.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Setaria 
italica]
Length=524

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/525 (75%), Positives = 443/525 (84%), Gaps = 19/525 (4%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
              L S  LCL  IF ++        + + + RLPPGPP WPI GNLLQL  LPH+DFA FC
Sbjct  4     VLLSILLCL-WIFIVVYW----RRRNSMRQRLPPGPPTWPIFGNLLQLSPLPHKDFARFC  58

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGPLVYLRLG++DAITT+DP +IREIL++QD+VFASRPRTLAAVHLAYGCGDVALAP+
Sbjct  59    TKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPL  118

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             GP WKRMRR+CMEHLLTTKRLESFA HRA+EA HL + VW  A++G+ VNLREVLGAFSM
Sbjct  119   GPNWKRMRRVCMEHLLTTKRLESFAAHRAQEAEHLCQFVWAKAQSGKPVNLREVLGAFSM  178

Query  603   NNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
             NNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF LLGLIYLGDY+P WRW+DPYGCEK
Sbjct  179   NNVTRMLLGKQYFGI-QSAGPGEAMEFMHITHELFFLLGLIYLGDYLPAWRWVDPYGCEK  237

Query  783   KMREVEKRVDDFHMKILEEHRKS------------KKEIDGEMDFVDVLLSLPGENGKEH  926
             KMREVEK+VDDFH KI++EHRK+              +   EMDFVDVLLSLPGENGKEH
Sbjct  238   KMREVEKKVDDFHQKIIDEHRKAWEAKKSAAASLDDDDTKEEMDFVDVLLSLPGENGKEH  297

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             M+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L++IQ+ELD V+G DRMV E+D
Sbjct  298   MDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRRIQEELDAVIGRDRMVVESD  357

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L HL YLRCVVRE+FR HPAGPFLIPHES + TTI GYH+PA+TR+FINTH LGRNP VW
Sbjct  358   LAHLPYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYHVPARTRVFINTHALGRNPRVW  417

Query  1287  DDVDDFRPERHFP-ADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             D VD+FRPERH P A+GGRVEISH  DFKILPFSAGKRKCPGAPLGV LVLMALARLFH 
Sbjct  418   DAVDEFRPERHLPTAEGGRVEISHLPDFKILPFSAGKRKCPGAPLGVALVLMALARLFHC  477

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             FDWSPP+GLRPED+DT EVYGMTMPKATPL AVA PRL  H+Y S
Sbjct  478   FDWSPPDGLRPEDVDTREVYGMTMPKATPLVAVATPRLPPHMYAS  522



>ref|XP_004972930.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Setaria 
italica]
Length=499

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/497 (78%), Positives = 432/497 (87%), Gaps = 14/497 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             + RLPPGPP WPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREI
Sbjct  2     RQRLPPGPPTWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREI  61

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L++QD+VFASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HR
Sbjct  62    LIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHR  121

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
             A+EA HL + VW  A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM
Sbjct  122   AQEAEHLCQFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGI-QSAGPGEAMEFM  180

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKS-----  851
             +ITHELF LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK+     
Sbjct  181   HITHELFFLLGLIYLGDYLPAWRWVDPYGCEKKMREVEKKVDDFHQKIIDEHRKAWEAKK  240

Query  852   -------KKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWA  1010
                      +   EMDFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW 
Sbjct  241   SAAASLDDDDTKEEMDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWV  300

Query  1011  MAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHE  1190
             MAEVIK PR+L++IQ+ELD V+G DRMV E+DL HL YLRCVVRE+FR HPAGPFLIPHE
Sbjct  301   MAEVIKNPRVLRRIQEELDAVIGRDRMVVESDLAHLPYLRCVVRESFRMHPAGPFLIPHE  360

Query  1191  STRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP-ADGGRVEISHGADF  1367
             S + TTI GYH+PA+TR+FINTH LGRNP VWD VD+FRPERH P A+GGRVEISH  DF
Sbjct  361   SLKPTTIMGYHVPARTRVFINTHALGRNPRVWDAVDEFRPERHLPTAEGGRVEISHLPDF  420

Query  1368  KILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKAT  1547
             KILPFSAGKRKCPGAPLGV LVLMALARLFH FDWSPP+GLRPED+DT EVYGMTMPKAT
Sbjct  421   KILPFSAGKRKCPGAPLGVALVLMALARLFHCFDWSPPDGLRPEDVDTREVYGMTMPKAT  480

Query  1548  PLFAVARPRLQRHLYGS  1598
             PL AVA PRL  H+Y S
Sbjct  481   PLVAVATPRLPPHMYAS  497



>ref|XP_004248085.1| PREDICTED: cytochrome P450 703A2 [Solanum lycopersicum]
Length=556

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/542 (73%), Positives = 451/542 (83%), Gaps = 29/542 (5%)
 Frame = +3

Query  48    MIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             +++ I  + F     LI K++    V   K     RLPPGP +WPIVGNL QLG+LPHRD
Sbjct  16    LLNLINYSIFLFGAYLISKLLHFSFVDKSKREIN-RLPPGPKQWPIVGNLFQLGQLPHRD  74

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A+FC+KYGPLVYLRLG+VDAITTNDP IIREIL+QQDDVFASRPRTLAA+HLAYGCGDV
Sbjct  75    MASFCEKYGPLVYLRLGNVDAITTNDPEIIREILVQQDDVFASRPRTLAAIHLAYGCGDV  134

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GPKWKRMRRICMEHLLTTKRLESFAKHRA+EA+ LV+D+W  A+ G+ V+LREVL
Sbjct  135   ALAPLGPKWKRMRRICMEHLLTTKRLESFAKHRADEAQSLVKDIWTKAQKGQIVDLREVL  194

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             G FSMNNVTRMLLGKQ+FGA ES+GPQEAMEFM++THELF LLG+IYLGDY+P WRWIDP
Sbjct  195   GGFSMNNVTRMLLGKQYFGA-ESAGPQEAMEFMHVTHELFWLLGVIYLGDYLPFWRWIDP  253

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEI--------DGEMDFVDVLLSLPGE----  911
             +GCEKKMR+VEKR+DDFH +I+EEHRK K           D EMDFVDVLLSLPGE    
Sbjct  254   HGCEKKMRDVEKRIDDFHRRIIEEHRKKKGSKNNNNNNIDDDEMDFVDVLLSLPGEDEGD  313

Query  912   -NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDR  1088
              NGK+HM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVI+ P +LKKIQ+ELD VVGS R
Sbjct  314   GNGKQHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIRHPHVLKKIQEELDIVVGSGR  373

Query  1089  MVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLG  1268
             MV+E+DL++L YLRCVVRETFR HPAGPFLIPHES R T INGY+IPAKTR+FINTHGLG
Sbjct  374   MVTESDLINLKYLRCVVRETFRMHPAGPFLIPHESIRDTKINGYYIPAKTRVFINTHGLG  433

Query  1269  RNPSVWDDVDDFRPERHFPADG--------------GRVEISHGADFKILPFSAGKRKCP  1406
             RN  +WD++D+FRPERH P +G               RVEISHG DFKILPFSAGKRKCP
Sbjct  434   RNTKIWDNIDEFRPERHLPPNGDEKNMILTSSSSSSNRVEISHGPDFKILPFSAGKRKCP  493

Query  1407  GAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRH  1586
             GAPLGV LVLMALARLFH +DW+PP G++ +DIDT+EVYGMTMPKA PL A+A+PRL  H
Sbjct  494   GAPLGVKLVLMALARLFHCYDWNPPNGVKHQDIDTNEVYGMTMPKAKPLMAIAKPRLPPH  553

Query  1587  LY  1592
             LY
Sbjct  554   LY  555



>ref|XP_010501277.1| PREDICTED: cytochrome P450 703A2 [Camelina sativa]
Length=510

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/484 (80%), Positives = 432/484 (89%), Gaps = 9/484 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGPPRWPI+GNLLQLG LPHRD AA CDKYGPLVYLRLG++DAITTNDP  IREILL
Sbjct  31    RLPPGPPRWPILGNLLQLGPLPHRDLAALCDKYGPLVYLRLGNIDAITTNDPDTIREILL  90

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
             +QDDVFASRP+TLAAVHLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF   RAE
Sbjct  91    RQDDVFASRPKTLAAVHLAYGCGDVALAPMGPHWKRMRRICMEHLLTTKRLESFTSQRAE  150

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             EAR+L+ DV+  A+ G+ +NLREVLGAFSMNNVTRMLLGKQFFG      P+EA EFM+I
Sbjct  151   EARYLIRDVFERAKFGKPINLREVLGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFMHI  210

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID--  866
             TH+LF LLG+IYLGDY+P WRW+DP GCEK+MR+VEKRVD FH KI++EHR++K+E D  
Sbjct  211   THKLFWLLGVIYLGDYLPFWRWVDPSGCEKEMRDVEKRVDKFHTKIIDEHRRAKRENDDN  270

Query  867   -GEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
              GEMDFVDVLLSLPGENGKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK+PR++
Sbjct  271   NGEMDFVDVLLSLPGENGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKQPRVM  330

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD +VGS+RMV E+DL+HLNYLRCVVRETFR HPAGPFLIPHES R TTINGY+
Sbjct  331   RKIQEELDTIVGSNRMVDESDLVHLNYLRCVVRETFRMHPAGPFLIPHESVRPTTINGYY  390

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRK  1400
             IPAKTR+FINTHGLGRN  +WDDV+DFRPERH+P DG GRVEISHG DFKILPFSAGKRK
Sbjct  391   IPAKTRVFINTHGLGRNTKLWDDVEDFRPERHWPVDGSGRVEISHGPDFKILPFSAGKRK  450

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPGAPLGVT+VLMALARLFH FDWS PE      IDT EVYGMTMPKA PL+A+A+PRL 
Sbjct  451   CPGAPLGVTMVLMALARLFHCFDWSSPEC-----IDTVEVYGMTMPKAKPLWAIAKPRLA  505

Query  1581  RHLY  1592
              HLY
Sbjct  506   PHLY  509



>ref|XP_006418407.1| hypothetical protein EUTSA_v10007395mg [Eutrema salsugineum]
 gb|ESQ36760.1| hypothetical protein EUTSA_v10007395mg [Eutrema salsugineum]
Length=510

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/515 (76%), Positives = 443/515 (86%), Gaps = 12/515 (2%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             + LA  F+ L L   + + L     K     +LPPGPPRWP++GNLLQLG LPHRD AA 
Sbjct  3     LVLAFLFVILFLNVLLWRWLKASACKAQ---KLPPGPPRWPVLGNLLQLGPLPHRDLAAL  59

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
             CDKYGPLVYLRLG++DAITTNDP  IREIL +QDDVFASRP+TLAAVHLAYGCGDVALAP
Sbjct  60    CDKYGPLVYLRLGNIDAITTNDPETIREILFRQDDVFASRPKTLAAVHLAYGCGDVALAP  119

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
             +GP WKRMRRICMEHLLTTKRLESF   RAEEAR+L+ DV+  AE G+ +N+REVLGAFS
Sbjct  120   MGPHWKRMRRICMEHLLTTKRLESFTVQRAEEARYLIRDVFQKAEFGKPINVREVLGAFS  179

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             MNNVTRMLLGKQFFG     G +EA EFM+ITH+LF LLG+IYLGDY+P WRW+DPYGCE
Sbjct  180   MNNVTRMLLGKQFFGPGSVVGAKEAQEFMHITHKLFWLLGVIYLGDYLPFWRWVDPYGCE  239

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEID---GEMDFVDVLLSLPGENGKEHMEDVEIKA  950
             K+MR+VEKRVD FH KI+EEHR++K+E +   G+MDFVDVLLSLPG+NGKEHM+DVEIKA
Sbjct  240   KEMRDVEKRVDKFHTKIIEEHRRAKREKEDNKGDMDFVDVLLSLPGDNGKEHMDDVEIKA  299

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
             LIQDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD VVGS+RMV E+DL++LNYLR
Sbjct  300   LIQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDNVVGSNRMVDESDLINLNYLR  359

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
             CVVRETFR HPAGPFLIPHES RATTINGY+IPAKTR+FINTHGLGRN  +WDDV+DFRP
Sbjct  360   CVVRETFRMHPAGPFLIPHESVRATTINGYYIPAKTRVFINTHGLGRNTKIWDDVEDFRP  419

Query  1311  ERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             ERH+P DG GRVEISHG DFKILPFSAGKRKCPGAPLGVT+VLMALARLFH FDWS    
Sbjct  420   ERHWPVDGSGRVEISHGPDFKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWS----  475

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
               P +IDT EVYGMTMPKA PL+A+ARPRL  H Y
Sbjct  476   -SPVNIDTVEVYGMTMPKAKPLWAIARPRLAAHSY  509



>ref|NP_001149251.1| LOC100282873 [Zea mays]
 gb|ACG34718.1| flavonoid 3-monooxygenase [Zea mays]
 gb|AFW57463.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=530

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/522 (75%), Positives = 447/522 (86%), Gaps = 20/522 (4%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             S  LC S IF ++    + + +    +RLPPGPP WPI GNLLQL  LPH+DFA FC KY
Sbjct  7     SILLCSS-IFVVVYWRRLNSMR----LRLPPGPPTWPIFGNLLQLSPLPHKDFAQFCTKY  61

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GPLVYLRLG++DAITT+DP +IREIL++QD+VFASRPRTLAAVHLAYGCGDVALAP+GP 
Sbjct  62    GPLVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPN  121

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             WKRMRR+CMEHLLTT+RLESFA HRA+EA HL + VW  +++G+ VNLREVLGAFSMNNV
Sbjct  122   WKRMRRVCMEHLLTTRRLESFAAHRAQEAEHLCQFVWAKSQSGKPVNLREVLGAFSMNNV  181

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
             TRMLLGKQ+FG  +S+GP EAMEFM+ITHELF LLGLIYLGDY+P WRW+DPYGCEK+MR
Sbjct  182   TRMLLGKQYFGI-QSAGPGEAMEFMHITHELFFLLGLIYLGDYLPAWRWVDPYGCEKRMR  240

Query  792   EVEKRVDDFHMKILEEHRKSKK--------EIDG-----EMDFVDVLLSLPGENGKEHME  932
             EVEK+VDDFH KI++EHR++++        E DG     EMDFVDVLLSLPGENGKEHM+
Sbjct  241   EVEKKVDDFHQKIIDEHRRAREARKSRSSVEEDGGNGKDEMDFVDVLLSLPGENGKEHMD  300

Query  933   DVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLL  1112
             D+EIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L+++Q+ELD VVG DRMV+E+DL 
Sbjct  301   DMEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRRVQEELDAVVGRDRMVAESDLA  360

Query  1113  HLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDD  1292
             HL YLRCVVRE+FR HPAGPFLIPHES +ATTI GYH+PA+TR+FINTH LGRNP VWD 
Sbjct  361   HLPYLRCVVRESFRMHPAGPFLIPHESLKATTIMGYHVPARTRVFINTHALGRNPRVWDS  420

Query  1293  VDDFRPERHFPA-DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             V +FRPERH PA +G RVEISH  DFKILPFSAGKRKCPGAPLGV LVLMALARLFH FD
Sbjct  421   VGEFRPERHLPAEEGARVEISHLPDFKILPFSAGKRKCPGAPLGVALVLMALARLFHCFD  480

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             WSPP+GLRPED+DT EVYGMTMPKATPL AVA PRL  HLYG
Sbjct  481   WSPPDGLRPEDVDTREVYGMTMPKATPLVAVATPRLPPHLYG  522



>gb|KFK42510.1| hypothetical protein AALP_AA1G003300 [Arabis alpina]
Length=510

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/515 (76%), Positives = 442/515 (86%), Gaps = 10/515 (2%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             + L S FL   LI  ++    +K      + RLPPGPPRWPI+GNLLQLG LPHRD AA 
Sbjct  1     MILVSAFLFAVLILNVLLWRWLKASASKSQ-RLPPGPPRWPILGNLLQLGPLPHRDLAAL  59

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
             C KYGPLVYLRLG++DAITTNDP  IREILL+QDDVFASRP+TLAAVHLAYGCGDVALAP
Sbjct  60    CGKYGPLVYLRLGNIDAITTNDPDTIREILLRQDDVFASRPKTLAAVHLAYGCGDVALAP  119

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
             +GP WKRMRRICMEHLLTTKRLESF   RAEEAR+L+ DV+  A++G+ +NLRE+LGAFS
Sbjct  120   MGPHWKRMRRICMEHLLTTKRLESFTVQRAEEARYLIRDVFERAKSGKPINLREILGAFS  179

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             MNNVTRMLLGKQFFG     GP+EA EFM+ITH+LF LLGLIYLGDY+P WRW+DPYGCE
Sbjct  180   MNNVTRMLLGKQFFGPGSLVGPKEAQEFMHITHKLFWLLGLIYLGDYLPFWRWVDPYGCE  239

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDG---EMDFVDVLLSLPGENGKEHMEDVEIKA  950
             ++MR+VEKRVD FH KI++EHR++K+E +     MDFVDVLLSLPGENGKEHMEDVEIKA
Sbjct  240   REMRDVEKRVDKFHSKIIDEHRRAKREKEDNNENMDFVDVLLSLPGENGKEHMEDVEIKA  299

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
             LIQDMIAAATDTSAVTNEWAMAEVIK+PR++ KIQ+ELD++VG++RMV E+DL++LNYLR
Sbjct  300   LIQDMIAAATDTSAVTNEWAMAEVIKQPRVMHKIQEELDKIVGTNRMVDESDLINLNYLR  359

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
             CVVRE FR HPAGPFLIPHES R TTINGY+IPAKTR+FINTHGLGRN  +W DVDDF+P
Sbjct  360   CVVREAFRMHPAGPFLIPHESVRPTTINGYYIPAKTRVFINTHGLGRNTKIWTDVDDFQP  419

Query  1311  ERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             ERH+P DG GRVEISHG DFKILPFSAGKRKCPGAPLGVT+VLMALARLFH FDWS    
Sbjct  420   ERHWPVDGSGRVEISHGPDFKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWS----  475

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
               PE IDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  476   -SPEHIDTEEVYGMTMPKAKPLWAIAKPRLAAHLY  509



>ref|XP_004493277.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=521

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/476 (80%), Positives = 429/476 (90%), Gaps = 7/476 (1%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             IVGNLLQLG+LPHRD A+ CDKYGPLVYL+LG++DAITTNDP IIREILL QDDVFASRP
Sbjct  46    IVGNLLQLGKLPHRDLASLCDKYGPLVYLKLGNIDAITTNDPDIIREILLAQDDVFASRP  105

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
             RTLAAVHLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF+KHR +EA+HLV+DVW
Sbjct  106   RTLAAVHLAYGCGDVALAPLGPHWKRMRRICMEHLLTTKRLESFSKHRQDEAQHLVKDVW  165

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
               A+  + +N+REVLGAFSMNNVTRMLLGKQ+FG+ +S+GPQEA+EFM+ITHELF LLG+
Sbjct  166   AQAQTEKPINMREVLGAFSMNNVTRMLLGKQYFGS-KSAGPQEAIEFMHITHELFWLLGV  224

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI------DGEMDFV  884
             IYLGDY+P+WRW+DPYGCEKKMREVEKRVDDFH KI+EEHRK++K        D E+DFV
Sbjct  225   IYLGDYLPMWRWVDPYGCEKKMREVEKRVDDFHSKIIEEHRKARKNKKMVGKGDEEIDFV  284

Query  885   DVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQEL  1064
             D+LLSLPGE+GKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK P +LKKIQ+EL
Sbjct  285   DILLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKHPHVLKKIQEEL  344

Query  1065  DEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRI  1244
             D VVG +RMV E+DL +LNYLRCVVRETFR HPAGPFLIPHES R TTIN Y+IPAKTR+
Sbjct  345   DAVVGPNRMVMESDLPNLNYLRCVVRETFRMHPAGPFLIPHESLRPTTINDYYIPAKTRV  404

Query  1245  FINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGV  1424
             FINTHGLGRN ++WD+V++F+PERHF A+G RVEISHGADFKILPFSAGKRKCPGAPLGV
Sbjct  405   FINTHGLGRNTNIWDNVEEFKPERHFSANGSRVEISHGADFKILPFSAGKRKCPGAPLGV  464

Query  1425  TLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             TLVLMALARLFH FDWSPP+GL   DIDT EVYGMTMPK  PL  VARPRL  H+Y
Sbjct  465   TLVLMALARLFHCFDWSPPKGLNHRDIDTREVYGMTMPKVHPLIVVARPRLATHMY  520



>gb|ACN36201.1| unknown [Zea mays]
Length=530

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/522 (75%), Positives = 446/522 (85%), Gaps = 20/522 (4%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             S  LC S IF ++    + + +    +RLPPGPP WPI GNLLQL  LPH+DFA FC KY
Sbjct  7     SILLCSS-IFVVVYWRRLNSMR----LRLPPGPPTWPIFGNLLQLSPLPHKDFAQFCTKY  61

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GPLVYLRLG++DAITT+DP +IREIL++QD+VFASRPRTLAAVHLAYGCGDVALAP+GP 
Sbjct  62    GPLVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPN  121

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             WKRMRR+CMEHLLTT+RLESFA HRA+EA HL + VW  +++G+ VNLREVLGAFSMNN 
Sbjct  122   WKRMRRVCMEHLLTTRRLESFAAHRAQEAEHLCQFVWAKSQSGKPVNLREVLGAFSMNNA  181

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
             TRMLLGKQ+FG  +S+GP EAMEFM+ITHELF LLGLIYLGDY+P WRW+DPYGCEK+MR
Sbjct  182   TRMLLGKQYFGI-QSAGPGEAMEFMHITHELFFLLGLIYLGDYLPAWRWVDPYGCEKRMR  240

Query  792   EVEKRVDDFHMKILEEHRKSKK--------EIDG-----EMDFVDVLLSLPGENGKEHME  932
             EVEK+VDDFH KI++EHR++++        E DG     EMDFVDVLLSLPGENGKEHM+
Sbjct  241   EVEKKVDDFHQKIIDEHRRAREARKSRSSVEEDGGNGKDEMDFVDVLLSLPGENGKEHMD  300

Query  933   DVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLL  1112
             D+EIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L+++Q+ELD VVG DRMV+E+DL 
Sbjct  301   DMEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLRRVQEELDAVVGRDRMVAESDLA  360

Query  1113  HLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDD  1292
             HL YLRCVVRE+FR HPAGPFLIPHES +ATTI GYH+PA+TR+FINTH LGRNP VWD 
Sbjct  361   HLPYLRCVVRESFRMHPAGPFLIPHESLKATTIMGYHVPARTRVFINTHALGRNPRVWDS  420

Query  1293  VDDFRPERHFPA-DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             V +FRPERH PA +G RVEISH  DFKILPFSAGKRKCPGAPLGV LVLMALARLFH FD
Sbjct  421   VGEFRPERHLPAEEGARVEISHLPDFKILPFSAGKRKCPGAPLGVALVLMALARLFHCFD  480

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             WSPP+GLRPED+DT EVYGMTMPKATPL AVA PRL  HLYG
Sbjct  481   WSPPDGLRPEDVDTREVYGMTMPKATPLVAVATPRLPPHLYG  522



>ref|XP_010474719.1| PREDICTED: cytochrome P450 703A2-like [Camelina sativa]
Length=510

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/484 (80%), Positives = 430/484 (89%), Gaps = 9/484 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGPPRWPI+GNLLQLG LPHRD AA CDKYGPLVYLRLG++DAITTNDP  IREILL
Sbjct  31    RLPPGPPRWPILGNLLQLGPLPHRDLAALCDKYGPLVYLRLGNIDAITTNDPDTIREILL  90

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
             +QDDVFASRP+TLAAVHLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF   RAE
Sbjct  91    RQDDVFASRPKTLAAVHLAYGCGDVALAPMGPHWKRMRRICMEHLLTTKRLESFTSQRAE  150

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             EAR+LV D++  AE G+ +NLREVLGAFSMNNVTRMLLGKQFFG      P+EA EFM+I
Sbjct  151   EARYLVRDIFERAEFGKPINLREVLGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFMHI  210

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG-  869
             TH+LF LLG+IYLGDY+P WRW+DP GCEK+MR+VEKRVD FH KI++EHR++K+E +  
Sbjct  211   THKLFWLLGVIYLGDYLPFWRWVDPSGCEKEMRDVEKRVDKFHTKIIDEHRRAKREKEDN  270

Query  870   --EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               EMDFVDVLLSLPGENGKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK+PR++
Sbjct  271   NREMDFVDVLLSLPGENGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKQPRVM  330

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD +VGS+RMV E+DL+HLNYLRCVVRETFR HPAGPFLIPHES + TTINGY+
Sbjct  331   RKIQEELDTIVGSNRMVKESDLIHLNYLRCVVRETFRMHPAGPFLIPHESVKPTTINGYY  390

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRK  1400
             IPAKTR+FINTHGLGRN  +WDDV+DFRPERH+P DG GRVEISHG  FKILPFSAGKRK
Sbjct  391   IPAKTRVFINTHGLGRNTKLWDDVEDFRPERHWPVDGSGRVEISHGPGFKILPFSAGKRK  450

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPGAPLGVT+VLMALARLFH FDWS      PE IDT EVYGMTMPKA PL+A+A+PRL 
Sbjct  451   CPGAPLGVTMVLMALARLFHCFDWS-----SPEYIDTVEVYGMTMPKAKPLWAIAKPRLA  505

Query  1581  RHLY  1592
              HLY
Sbjct  506   SHLY  509



>ref|XP_009119683.1| PREDICTED: cytochrome P450 703A2 [Brassica rapa]
Length=522

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/518 (75%), Positives = 441/518 (85%), Gaps = 12/518 (2%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             + L   F   ++ F  + L            +LPPGPPRWPI+GNLLQLG LPHRD AA 
Sbjct  1     MILVLVFSLFAIFFLNVLLWRWLKASACNVQKLPPGPPRWPILGNLLQLGPLPHRDMAAL  60

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
             C KYGPLVYLRLG++DAITTNDP  IREIL +QDDVFASRP+TLAAVHLAYGCGDVALAP
Sbjct  61    CSKYGPLVYLRLGNIDAITTNDPETIREILFRQDDVFASRPKTLAAVHLAYGCGDVALAP  120

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
             +GP WKRMRRICMEHLLTTKRLESF   RAEEA++L++DV   AE G+ +NLREVLGAFS
Sbjct  121   MGPHWKRMRRICMEHLLTTKRLESFTSQRAEEAQYLIQDVCKRAECGKPINLREVLGAFS  180

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             MNNVTRMLLGKQFFG     G +EA EFM+ITH+LF LLG+IYLGDY+P WRW+DPYGCE
Sbjct  181   MNNVTRMLLGKQFFGPGSVVGAKEAQEFMHITHKLFRLLGVIYLGDYLPFWRWVDPYGCE  240

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKE-----IDGEMDFVDVLLSLPGENGKEHMEDVEI  944
             K+MR+VEKRVD FH KI+EEHR++K+E     I+G+MDFVDVLLSLPGENGKEHM+DVEI
Sbjct  241   KEMRDVEKRVDKFHTKIIEEHRRAKREKEDKNIEGDMDFVDVLLSLPGENGKEHMDDVEI  300

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KALIQDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD VVGS+RMV+E DL+HLNY
Sbjct  301   KALIQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDNVVGSNRMVNETDLVHLNY  360

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDD  1301
             LRCVVRETFR HPAGPFLIPHES R TTINGY+IPAKTR+FINTHGLGRN SVW  D+++
Sbjct  361   LRCVVRETFRMHPAGPFLIPHESVRPTTINGYYIPAKTRVFINTHGLGRNTSVWTTDIEE  420

Query  1302  FRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             FRPERH+P DG GRVEISHG D+KILPFSAGKRKCPGAPLGVT+VLMALARLFH FDW+ 
Sbjct  421   FRPERHWPVDGSGRVEISHGPDYKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWT-  479

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
                  PEDIDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  480   ----TPEDIDTVEVYGMTMPKAKPLWALAKPRLAAHLY  513



>ref|XP_006306019.1| hypothetical protein CARUB_v10011315mg [Capsella rubella]
 gb|EOA38917.1| hypothetical protein CARUB_v10011315mg [Capsella rubella]
Length=510

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/484 (79%), Positives = 430/484 (89%), Gaps = 9/484 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGPPRWPI+GNLLQLG LPHRD A  CDKYGPLVYLRLGS+D ITTNDP  IREIL 
Sbjct  31    RLPPGPPRWPILGNLLQLGPLPHRDLATLCDKYGPLVYLRLGSIDTITTNDPDTIREILF  90

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
             +QDDVFASRP+TLAAVHLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF   RAE
Sbjct  91    RQDDVFASRPKTLAAVHLAYGCGDVALAPMGPHWKRMRRICMEHLLTTKRLESFTTQRAE  150

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             EAR+L++DV   AE+G+ +NL+EVLGAFSMNNVTRMLLGKQFFG      P+EA EFM+I
Sbjct  151   EARYLIQDVLERAESGKPINLKEVLGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFMHI  210

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE-ID-  866
             TH+LF LLG+IYLGDY+P WRW+DP GCEK+MR+VEKRVD FH KI++EHR++K E ID 
Sbjct  211   THKLFWLLGVIYLGDYLPFWRWVDPSGCEKEMRDVEKRVDKFHTKIIDEHRRAKLENIDN  270

Query  867   -GEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
              G +DFVDVLLSLPGENGKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK+PR++
Sbjct  271   KGALDFVDVLLSLPGENGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKQPRVM  330

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD +VGS+RMV E+DL+HLNYLRCVVRETFR HPAGPFLIPHES R TTINGY+
Sbjct  331   RKIQEELDTIVGSNRMVDESDLVHLNYLRCVVRETFRMHPAGPFLIPHESVRPTTINGYY  390

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRK  1400
             IPAKTR+FINTHGLGRN  +W+DV+ FRPERH+P DG GRVEISHGADFKILPFSAGKRK
Sbjct  391   IPAKTRVFINTHGLGRNTKLWEDVEVFRPERHWPVDGSGRVEISHGADFKILPFSAGKRK  450

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPGAPLGVT+VLMALARLFH FDWS      PE+IDT EVYGMTMPKA PL+A+A+PRL 
Sbjct  451   CPGAPLGVTMVLMALARLFHCFDWS-----SPENIDTVEVYGMTMPKAKPLWAIAKPRLA  505

Query  1581  RHLY  1592
              HLY
Sbjct  506   AHLY  509



>ref|XP_010665532.1| PREDICTED: cytochrome P450 703A2 [Beta vulgaris subsp. vulgaris]
Length=517

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/521 (75%), Positives = 441/521 (85%), Gaps = 12/521 (2%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKII-QLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             +D+ TLA + LC     KI+ Q L           +LPPGPPRWP+ GNLLQLG LPHRD
Sbjct  1     MDFGTLAIYLLCALFATKILYQWL---KSYLYTTYKLPPGPPRWPLFGNLLQLGPLPHRD  57

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
             FA+FC+KYGPLVY+RLG+VDAITTNDP IIREIL++QDDVFASRP TLAA HLAY  GDV
Sbjct  58    FASFCEKYGPLVYIRLGNVDAITTNDPEIIREILVRQDDVFASRPHTLAATHLAYNSGDV  117

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GPKWKRMRRICMEHLLTT+RLE F  HRA+EARHLV+DV   +   + VNLREVL
Sbjct  118   ALAPMGPKWKRMRRICMEHLLTTRRLELFVSHRADEARHLVQDVLTRSHKDKVVNLREVL  177

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQ+FGA  ++GPQEA+EFM+ITHELF LLGLIYLGDY+P WRW+DP
Sbjct  178   GAFSMNNVTRMLLGKQYFGAG-TAGPQEALEFMHITHELFWLLGLIYLGDYLPFWRWVDP  236

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEID------GEMDFVDVLLSLPGENGKEHM  929
             YGCEKKMREVEKRVDDFH KI+EEHRK KK  +      GEMDFVD+LL+LPGENG EHM
Sbjct  237   YGCEKKMREVEKRVDDFHRKIIEEHRKEKKRKEEMGVNEGEMDFVDILLALPGENGNEHM  296

Query  930   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDL  1109
             +D +IKALIQDMIAAATDTSAVTNEWAMAEVIK PR+L KIQQEL+ +VG +RMV+E+DL
Sbjct  297   DDADIKALIQDMIAAATDTSAVTNEWAMAEVIKHPRVLHKIQQELNTIVGPNRMVTESDL  356

Query  1110  LHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD  1289
              HLNYLRCVVRETFR HPAGPFLIPHES R TTINGY IP+ TR+FINTHGLGRN  VWD
Sbjct  357   PHLNYLRCVVRETFRMHPAGPFLIPHESLRHTTINGYDIPSGTRVFINTHGLGRNLKVWD  416

Query  1290  DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             +++DF PERH+P DG RVEISHG+DFKILPFSAGKR+CPGAPLGV  VLM LA LFH+FD
Sbjct  417   NIEDFYPERHWPLDGSRVEISHGSDFKILPFSAGKRRCPGAPLGVVFVLMGLATLFHAFD  476

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             W PP+G++ E+IDT EVYGMTMPKA PL A+A+PRL  HLY
Sbjct  477   WLPPDGMKAEEIDTKEVYGMTMPKAQPLMALAKPRLA-HLY  516



>dbj|BAK06020.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=530

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/492 (78%), Positives = 426/492 (87%), Gaps = 13/492 (3%)
 Frame = +3

Query  159   PPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQ  338
             PPGPPRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++Q
Sbjct  31    PPGPPRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILVRQ  90

Query  339   DDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEA  518
             D+VFASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA+EA
Sbjct  91    DEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRAQEA  150

Query  519   RHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITH  698
              HL E VW  +++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITH
Sbjct  151   EHLCEFVWAKSQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITH  209

Query  699   ELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE------  860
             ELF LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK++        
Sbjct  210   ELFFLLGLIYLGDYLPAWRWVDPYGCEKKMREVEKKVDDFHQKIIDEHRKARDARKSAAS  269

Query  861   -IDGE-----MDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
               DG+     MDFVDVLLSLPGENG EHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEV
Sbjct  270   LDDGDDSKEDMDFVDVLLSLPGENGNEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEV  329

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             IK P +L+KIQ+ELD VVG  RMV E+DL HL YLRCVVRE+FR HPAGPFLIPHES +A
Sbjct  330   IKNPCVLRKIQEELDAVVGRSRMVVESDLPHLTYLRCVVRESFRMHPAGPFLIPHESLKA  389

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
             TTI GY IPA+TRIFINTH LGRNP +WDDV +F PERH PADGGRVEISH  DFKILPF
Sbjct  390   TTIMGYDIPAQTRIFINTHALGRNPRIWDDVGEFHPERHLPADGGRVEISHLPDFKILPF  449

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
             SAGKRKCPGAPLGV LVLMALARLFH FDWSPP+GLRPEDIDT EVYGMTMPKA PL A 
Sbjct  450   SAGKRKCPGAPLGVILVLMALARLFHCFDWSPPDGLRPEDIDTDEVYGMTMPKAKPLIAA  509

Query  1563  ARPRLQRHLYGS  1598
              +PRL   +YGS
Sbjct  510   VQPRLPPQMYGS  521



>ref|XP_002445004.1| hypothetical protein SORBIDRAFT_07g002610 [Sorghum bicolor]
 gb|AAL73540.1|AF466200_19 putative cytochrome P450 family [Sorghum bicolor]
 gb|EES14499.1| hypothetical protein SORBIDRAFT_07g002610 [Sorghum bicolor]
Length=526

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/496 (76%), Positives = 430/496 (87%), Gaps = 14/496 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             ++RLPPGPP WPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREI
Sbjct  27    RLRLPPGPPTWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREI  86

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L++QD+VFASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HR
Sbjct  87    LIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHR  146

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
             A+EA HL + VW  + +G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM
Sbjct  147   AQEAEHLCQFVWAKSHSGKPVNLREVLGAFSMNNVTRMLLGKQYFGI-QSAGPGEAMEFM  205

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
             +ITHELF LLGLIYLGDY+P WRW+DPYGCEKKMR+VEK+VDDFH KI++EHR++++   
Sbjct  206   HITHELFFLLGLIYLGDYLPAWRWVDPYGCEKKMRDVEKKVDDFHQKIIDEHRRAREAKK  265

Query  867   GEMD------------FVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWA  1010
                             FVDVLLSLPGENGKEHM+D+EIKAL+QDMIAAATDTS+VTNEW 
Sbjct  266   TRRSSLDDDDGKEDMDFVDVLLSLPGENGKEHMDDMEIKALMQDMIAAATDTSSVTNEWV  325

Query  1011  MAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHE  1190
             MAEVIK PR+L+++Q+ELD V+G DRMV+E+DL HL YLRCVVRE+FR HPAGPFLIPHE
Sbjct  326   MAEVIKNPRVLRRVQEELDAVIGRDRMVAESDLTHLPYLRCVVRESFRMHPAGPFLIPHE  385

Query  1191  STRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA-DGGRVEISHGADF  1367
             S + TTI GYH+PA+TR+FINTH LGRNP VWDDVD FRPERH PA +G RVEISH  DF
Sbjct  386   SLKPTTIMGYHVPARTRVFINTHALGRNPRVWDDVDAFRPERHLPAEEGARVEISHLPDF  445

Query  1368  KILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKAT  1547
             KILPFSAGKRKCPGAPLGV LVLMALARLFH FDWSPP+GLRPED+DT EVYGMTMPKAT
Sbjct  446   KILPFSAGKRKCPGAPLGVALVLMALARLFHCFDWSPPDGLRPEDVDTQEVYGMTMPKAT  505

Query  1548  PLFAVARPRLQRHLYG  1595
             PL AVA PRL  HLYG
Sbjct  506   PLVAVATPRLPPHLYG  521



>ref|XP_004155249.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase-like 
[Cucumis sativus]
Length=522

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/529 (73%), Positives = 447/529 (84%), Gaps = 19/529 (4%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D+I  A     L+++F ++     +    N +  LPPGP RWPIVGNLLQL  LPHRD 
Sbjct  1     MDFIAFA-----LAILFTLLVRSLCRXTVHNPQ-NLPPGPRRWPIVGNLLQLTHLPHRDM  54

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A  C K+GPLVYL+LGSVDAITT+DP+ IREILLQQD+VFASRPRTLAAVHLAYGC DVA
Sbjct  55    AELCRKHGPLVYLKLGSVDAITTDDPATIREILLQQDEVFASRPRTLAAVHLAYGCSDVA  114

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICMEHLLT+KRL+SF+ HRA EA+HLV+DVW  A+NGE VNLREVLG
Sbjct  115   LAPLGPNWKRMRRICMEHLLTSKRLDSFSAHRASEAQHLVQDVWARAQNGEAVNLREVLG  174

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
              FSMNNVTRMLLGKQ+FG   S+GP EAMEFM+ITHELF LLG+IYLGDY+P WRW+DP+
Sbjct  175   GFSMNNVTRMLLGKQYFGCG-SAGPGEAMEFMHITHELFRLLGVIYLGDYLPFWRWVDPH  233

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKK---------EIDGEMDFVDVLLSLPGENGKE  923
             GCE+KMR+VEK+VDDFH KI+EEHRK ++         + DG MDFVDVLLSLPGE+GKE
Sbjct  234   GCEEKMRKVEKQVDDFHTKIIEEHRKEREKRKVSGQQHDSDGTMDFVDVLLSLPGEDGKE  293

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
             HM+DVEIKALIQDMIAAATDTSAVTNEWAM EVIK P +L K+Q+ELD VVG +R+V E+
Sbjct  294   HMDDVEIKALIQDMIAAATDTSAVTNEWAMTEVIKHPHVLAKVQEELDVVVGPNRLVLES  353

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             DL+HLNYLRCVVRETFR HPAGPFLIPHES   T I+GY IPAKTRIFINTHGLGRN ++
Sbjct  354   DLVHLNYLRCVVRETFRMHPAGPFLIPHESLHDTKIHGYDIPAKTRIFINTHGLGRNTNI  413

Query  1284  WDDVDDFRPERHFPADG---GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
             WD+VD+FRPERH+P       +VEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALA+L
Sbjct  414   WDNVDEFRPERHWPTTDEIVSKVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALAQL  473

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGSR  1601
             FH FDW+PP+G++P+DIDT+E+YGMTMPKA PL A+A+PRL  H+Y S+
Sbjct  474   FHCFDWNPPKGMKPQDIDTNEIYGMTMPKAHPLMAIAKPRLAPHVYQSK  522



>ref|XP_008437881.1| PREDICTED: cytochrome P450 703A2 isoform X1 [Cucumis melo]
Length=521

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/493 (77%), Positives = 432/493 (88%), Gaps = 12/493 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP RWPIVGNLLQL  LPHRD A  C KYGPLVYL+LGSVDAITT+DP+ IREILLQ
Sbjct  30    LPPGPRRWPIVGNLLQLTHLPHRDMAELCRKYGPLVYLKLGSVDAITTDDPATIREILLQ  89

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             QD+VFASRPRTLAAVHLAYGC DVALAP+GP WKRMRRICME+LLT+KRL+SF+ HRA E
Sbjct  90    QDEVFASRPRTLAAVHLAYGCSDVALAPLGPGWKRMRRICMENLLTSKRLDSFSAHRASE  149

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
             A+HLV+DVW  A+NGE VNLREVLG FSMNNVTRMLLGKQ+FG   S+GP EAMEFM+IT
Sbjct  150   AQHLVQDVWARAQNGENVNLREVLGGFSMNNVTRMLLGKQYFGCG-SAGPSEAMEFMHIT  208

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK------  857
             HELF LLG+IYLGDY+P WRW+DP+GCE+KMR+VEK+VDDFH KI+EEHRK ++      
Sbjct  209   HELFRLLGVIYLGDYLPFWRWVDPHGCEEKMRKVEKQVDDFHTKIIEEHRKEREKRKVSG  268

Query  858   ---EIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
                + DG MDFVDVLLSLPGE+GKEHM+DVEIKALIQDMIAAATDTSAVTNEWAM EVIK
Sbjct  269   QQHDGDGNMDFVDVLLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMTEVIK  328

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              P +L KIQ+ELD VVG +R+V E+DL+HLNYLRCVVRETFR HPAGPFLIPHES + T 
Sbjct  329   HPHVLAKIQEELDVVVGPNRLVLESDLVHLNYLRCVVRETFRMHPAGPFLIPHESLQDTK  388

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG--GRVEISHGADFKILPF  1382
             I+GY IPAKTRIFINTHGLGRN ++WD+V++FRPERH+P D    ++EISHGADFKILPF
Sbjct  389   IHGYDIPAKTRIFINTHGLGRNTNIWDNVEEFRPERHWPTDEIVNKIEISHGADFKILPF  448

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
             SAGKRKCPGAPLGVTLVLMALA+LFH FDW PP+G++P DIDT+E+YGMTMPKA PL A+
Sbjct  449   SAGKRKCPGAPLGVTLVLMALAQLFHCFDWKPPKGMKPHDIDTNEIYGMTMPKAHPLMAI  508

Query  1563  ARPRLQRHLYGSR  1601
             A+PRL  HLY S+
Sbjct  509   AKPRLASHLYRSK  521



>ref|XP_004134300.1| PREDICTED: flavonoid 3',5'-hydroxylase-like [Cucumis sativus]
Length=522

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/529 (73%), Positives = 446/529 (84%), Gaps = 19/529 (4%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D+I  A   L   L+  + + L   T  +N    LPPGP RWPIVGNLLQL  LPHRD 
Sbjct  1     MDFIAFALAILFTLLVRSLCRKL--FTTPKN----LPPGPRRWPIVGNLLQLTHLPHRDM  54

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A  C K+GPLVYL+LGSVDAITT+DP+ IREILLQQD+VFASRPRTLAAVHLAYGC DVA
Sbjct  55    AELCRKHGPLVYLKLGSVDAITTDDPATIREILLQQDEVFASRPRTLAAVHLAYGCSDVA  114

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
             LAP+GP WKRMRRICMEHLLT+KRL+SF+ HRA EA+HLV+DVW  A+NGE VNLREVLG
Sbjct  115   LAPLGPNWKRMRRICMEHLLTSKRLDSFSAHRASEAQHLVQDVWARAQNGEAVNLREVLG  174

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
              FSMNNVTRMLLGKQ+FG   S+GP EAMEFM+ITHELF LLG+IYLGDY+P WRW+DP+
Sbjct  175   GFSMNNVTRMLLGKQYFGCG-SAGPGEAMEFMHITHELFRLLGVIYLGDYLPFWRWVDPH  233

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKK---------EIDGEMDFVDVLLSLPGENGKE  923
             GCE+KMR+VEK+VDDFH KI+EEHRK ++         + DG MDFVDVLLSLPGE+GKE
Sbjct  234   GCEEKMRKVEKQVDDFHTKIIEEHRKEREKRKVSGQQHDSDGTMDFVDVLLSLPGEDGKE  293

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
             HM+DVEIKALIQDMIAAATDTSAVTNEWAM EVIK P +L K+Q+ELD VVG +R+V E+
Sbjct  294   HMDDVEIKALIQDMIAAATDTSAVTNEWAMTEVIKHPHVLAKVQEELDVVVGPNRLVLES  353

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             DL+HLNYLRCVVRETFR HPAGPFLIPHES   T I+GY IPAKTRIFINTHGLGRN ++
Sbjct  354   DLVHLNYLRCVVRETFRMHPAGPFLIPHESLHDTKIHGYDIPAKTRIFINTHGLGRNTNI  413

Query  1284  WDDVDDFRPERHFPADG---GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
             WD+VD+FRPERH+P       +VEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALA+L
Sbjct  414   WDNVDEFRPERHWPTTDEIVSKVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALAQL  473

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGSR  1601
             FH FDW+PP+G++P+DIDT+E+YGMTMPKA PL A+A+PRL  H+Y S+
Sbjct  474   FHCFDWNPPKGMKPQDIDTNEIYGMTMPKAHPLMAIAKPRLAPHVYQSK  522



>ref|XP_003571355.1| PREDICTED: cytochrome P450 703A2 [Brachypodium distachyon]
Length=530

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/519 (76%), Positives = 438/519 (84%), Gaps = 18/519 (3%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKEN-GKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
                LS+I      + V   K N  K+RLPPGPPRWPI GNLLQL  LPH+DFA FC KYG
Sbjct  3     LFLLSIILCSWIFVAVYWKKLNRTKLRLPPGPPRWPIFGNLLQLSPLPHKDFARFCTKYG  62

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PLVYLRLG++DAITT+DP +IREIL++QD+VFASRPRTLAAVHLAYGCGDVALAP+GP W
Sbjct  63    PLVYLRLGTIDAITTDDPEVIREILIRQDEVFASRPRTLAAVHLAYGCGDVALAPLGPNW  122

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             KRMRR+CMEHLLTTKRLESFA HRA+EA HL + VW  +++ + VNLREVLGAFSMNNVT
Sbjct  123   KRMRRVCMEHLLTTKRLESFAAHRAQEAEHLCQFVWAKSQSEKPVNLREVLGAFSMNNVT  182

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             RMLLGKQ+FG  +S+GP EAMEFM+ITHELF+LLGLIYLGDY+P WRW+DPYGCEKKMRE
Sbjct  183   RMLLGKQYFGL-QSAGPGEAMEFMHITHELFYLLGLIYLGDYLPAWRWVDPYGCEKKMRE  241

Query  795   VEKRVDDFHMKILEEHRKSKKE-------IDG-----EMDFVDVLLSLPGENGKEHMEDV  938
             VEK+VDDFH KI++EHRK+++         DG     EMDFVDVLLSLPGENGKEHM+DV
Sbjct  242   VEKKVDDFHQKIIDEHRKAREARKSASSLDDGDDSKEEMDFVDVLLSLPGENGKEHMDDV  301

Query  939   EIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHL  1118
             EIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L+KIQ+ELD VVG  RMVSE+DL HL
Sbjct  302   EIKALMQDMIAAATDTSSVTNEWVMAEVIKHPRVLRKIQEELDAVVGRARMVSESDLPHL  361

Query  1119  NYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVD  1298
              YLRCVVRE+FR HPAGPFLIPHES + TTI GY IPA+TRIFINTH LGRNP VWDDV 
Sbjct  362   PYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYDIPARTRIFINTHALGRNPRVWDDVG  421

Query  1299  DFRPERHFPADGG-RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWS  1475
              FRPERH PADGG RVEISH  DFKILPFSAGKRKCPGAPLGV LVLMALARLFH FDWS
Sbjct  422   QFRPERHMPADGGARVEISHLPDFKILPFSAGKRKCPGAPLGVILVLMALARLFHCFDWS  481

Query  1476  PPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             PP+G   E+IDT EVYGMTMPKA PLFA ARPRL   +Y
Sbjct  482   PPDG---EEIDTDEVYGMTMPKALPLFAAARPRLPPEMY  517



>ref|XP_010054863.1| PREDICTED: cytochrome P450 703A2 [Eucalyptus grandis]
Length=550

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/499 (78%), Positives = 434/499 (87%), Gaps = 21/499 (4%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGPPRWPIVGNLLQLG LPHRD AA C KYGPLVYLRLGSVDAITT+DPS+IR+ILLQ
Sbjct  52    LPPGPPRWPIVGNLLQLGPLPHRDLAALCRKYGPLVYLRLGSVDAITTSDPSVIRQILLQ  111

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             QD+VFASRPRTLAAVHLAY CGDVALAP+GP+WKRMRRICMEHLLTT+RLE+FA+HRA E
Sbjct  112   QDEVFASRPRTLAAVHLAYDCGDVALAPLGPRWKRMRRICMEHLLTTRRLEAFARHRACE  171

Query  516   ARHLVEDVWGMAENG--ETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMY  689
             A+HLV  V+G+  +     +++REVLG FSMNNVTRMLLGKQ+FGA  SSGPQEAMEFM+
Sbjct  172   AQHLVRHVYGLCRDRGRAGIDMREVLGGFSMNNVTRMLLGKQYFGAG-SSGPQEAMEFMH  230

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI--  863
             +TH+LF LLG+IYLGDY+P WRWIDP+GCEKKMREVEKRVDDFH KI+EEHR++      
Sbjct  231   VTHQLFRLLGVIYLGDYLPFWRWIDPHGCEKKMREVEKRVDDFHTKIIEEHRRAAAAGEA  290

Query  864   --------DGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAE  1019
                     D +MDFVDVLLSLPGE+G++ M+DVEIKALIQDMIAAATDTSAVTNEWAMAE
Sbjct  291   KAAAGLAGDSDMDFVDVLLSLPGEDGRDRMDDVEIKALIQDMIAAATDTSAVTNEWAMAE  350

Query  1020  VIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTR  1199
             VI+ PR+ ++IQ+ELD VVG DRMVSE DL HLNYLRCVVRETFR HPAGPFLIPHES R
Sbjct  351   VIRHPRVQRRIQEELDSVVGRDRMVSEPDLSHLNYLRCVVRETFRMHPAGPFLIPHESVR  410

Query  1200  ATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRPERHFPA------DG-GRVEISH  1355
             ATT+NGYHIPA TR+FINTHGLGRNP VW DDV++FRPERH+PA      DG GRVEISH
Sbjct  411   ATTLNGYHIPAGTRVFINTHGLGRNPDVWADDVEEFRPERHWPAAVGEQGDGVGRVEISH  470

Query  1356  GADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTM  1535
             G DF+ILPF AGKRKCPGAPLGVTLVL ALARLFH F+WSPP G+RPED+D +EVYGMTM
Sbjct  471   GPDFRILPFGAGKRKCPGAPLGVTLVLTALARLFHCFEWSPPGGMRPEDMDMAEVYGMTM  530

Query  1536  PKATPLFAVARPRLQRHLY  1592
             PKA PL A+ARPRL  HLY
Sbjct  531   PKARPLVALARPRLAEHLY  549



>ref|XP_010941811.1| PREDICTED: cytochrome P450 703A2 [Elaeis guineensis]
Length=522

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/523 (72%), Positives = 435/523 (83%), Gaps = 14/523 (3%)
 Frame = +3

Query  48    MIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRD  227
             ++D + +   F  L L+ ++      K      ++RLPPGP +WPI GNLL LG LPH+D
Sbjct  5     ILDVVLVFVIFFPLILLSRL-----AKKRFHRSQLRLPPGPRKWPIFGNLLHLGLLPHKD  59

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A FC  YGPLVYLRLG+VD ITT+DP +IREILL+QDDVFASRPRT+AA +LAYGCGDV
Sbjct  60    LAQFCATYGPLVYLRLGTVDVITTDDPDVIREILLRQDDVFASRPRTVAAAYLAYGCGDV  119

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GP WKRMRRICMEHLLTT+RL+SF+ HR+ EA+HLV D+W  A+ GE VNLR VL
Sbjct  120   ALAPLGPHWKRMRRICMEHLLTTRRLDSFSGHRSHEAQHLVRDIWSKAQAGEPVNLRLVL  179

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQ+FG  ES+G  EAMEFM ITHELF LLG+IYLGDY+P WRW DP
Sbjct  180   GAFSMNNVTRMLLGKQYFGP-ESAGRNEAMEFMSITHELFWLLGMIYLGDYLPFWRWFDP  238

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEID--------GEMDFVDVLLSLPGENGKE  923
             +GCE+KMREVEK+VD+FH KI++EHRK+++E D         E DFVDVLLSLPGE+GKE
Sbjct  239   FGCERKMREVEKKVDEFHQKIIDEHRKAREEKDVGGVDGHGAETDFVDVLLSLPGEDGKE  298

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
             HM+DVEIKAL+QDMIAAATDTS+VTNEWAMAEVIK P +L+K+Q+ELD +VG DR+V E+
Sbjct  299   HMDDVEIKALMQDMIAAATDTSSVTNEWAMAEVIKNPWVLQKVQEELDSIVGRDRLVCES  358

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             DL HL YLRCVVRETFR HPAGPFLIPHEST  T + GY IPAKTR+FINTH LGRN  +
Sbjct  359   DLAHLTYLRCVVRETFRMHPAGPFLIPHESTGPTKLMGYDIPAKTRVFINTHALGRNSRI  418

Query  1284  WDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             W DVD+FRPERH+P DG RVEI+HG+DFKILPFSAGKRKCPGAPLGV +VLMALARLFH 
Sbjct  419   WADVDEFRPERHWPEDGQRVEINHGSDFKILPFSAGKRKCPGAPLGVVMVLMALARLFHC  478

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             F+WSPP+GLRPEDIDT EVYGMTMPKA PL A+ARPRL   LY
Sbjct  479   FNWSPPDGLRPEDIDTEEVYGMTMPKAKPLVAMARPRLAPQLY  521



>ref|XP_010457143.1| PREDICTED: cytochrome P450 703A2-like [Camelina sativa]
Length=510

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/474 (79%), Positives = 420/474 (89%), Gaps = 9/474 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             I+GNLLQLG LPHRD A  CDKYGPLVYLRLG++DAITTNDP  IREILL+QDDVFASRP
Sbjct  41    ILGNLLQLGPLPHRDLANLCDKYGPLVYLRLGNIDAITTNDPDTIREILLRQDDVFASRP  100

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
             +TLAAVHLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF   RAEEAR+L+ DV+
Sbjct  101   KTLAAVHLAYGCGDVALAPMGPHWKRMRRICMEHLLTTKRLESFTAQRAEEARYLIRDVF  160

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
               AE G+ +NLREVLGAFSMNNVTRMLLGKQFFG      P+EA EFM+ITH+LF LLG+
Sbjct  161   ERAEFGKPINLREVLGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFMHITHKLFWLLGV  220

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE---IDGEMDFVDVL  893
             IYLGDY+P WRW+DP GCEK+MR+VEKRVD FH KI++EHR++K+E    +GE+DFV VL
Sbjct  221   IYLGDYLPFWRWVDPSGCEKEMRDVEKRVDKFHTKIIDEHRRAKRENEDNNGEIDFVHVL  280

Query  894   LSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEV  1073
             LSLPGENGKEHM+DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD +
Sbjct  281   LSLPGENGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDTI  340

Query  1074  VGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFIN  1253
             VGS+RMV E+DL+HLNYLRCVVRETFR HPAGPFLIPHES R TTINGY+IPAKTR+FIN
Sbjct  341   VGSNRMVDESDLVHLNYLRCVVRETFRMHPAGPFLIPHESVRPTTINGYYIPAKTRVFIN  400

Query  1254  THGLGRNPSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTL  1430
             THGLGRN  +WDDV+DFRPERH+P DG GRVEISHG DFKILPFSAGKRKCPGAPLGVT+
Sbjct  401   THGLGRNTKLWDDVEDFRPERHWPVDGSGRVEISHGPDFKILPFSAGKRKCPGAPLGVTM  460

Query  1431  VLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             VLMALARLFH FDWS PE      IDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  461   VLMALARLFHCFDWSSPEF-----IDTVEVYGMTMPKAKPLWAIAKPRLAPHLY  509



>ref|NP_171635.1| cytochrome P450, family 703, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 sp|Q9LNJ4.1|C70A2_ARATH RecName: Full=Cytochrome P450 703A2 [Arabidopsis thaliana]
 gb|AAF97323.1|AC023628_4 Putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAY25435.1| At1g01280 [Arabidopsis thaliana]
 gb|AEE27265.1| cytochrome P450, family 703, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=510

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/474 (78%), Positives = 420/474 (89%), Gaps = 9/474 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             I+GNLLQLG LPHRD A+ CDKYGPLVYLRLG+VDAITTNDP  IREILL+QDDVF+SRP
Sbjct  41    ILGNLLQLGPLPHRDLASLCDKYGPLVYLRLGNVDAITTNDPDTIREILLRQDDVFSSRP  100

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
             +TLAAVHLAYGCGDVALAP+GP WKRMRRICMEHLLTTKRLESF   RAEEAR+L+ DV+
Sbjct  101   KTLAAVHLAYGCGDVALAPMGPHWKRMRRICMEHLLTTKRLESFTTQRAEEARYLIRDVF  160

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
               +E G+ +NL+EVLGAFSMNNVTRMLLGKQFFG      P+EA EF++ITH+LF LLG+
Sbjct  161   KRSETGKPINLKEVLGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFLHITHKLFWLLGV  220

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE---IDGEMDFVDVL  893
             IYLGDY+P WRW+DP GCEK+MR+VEKRVD+FH KI++EHR++K E    +G+MDFVDVL
Sbjct  221   IYLGDYLPFWRWVDPSGCEKEMRDVEKRVDEFHTKIIDEHRRAKLEDEDKNGDMDFVDVL  280

Query  894   LSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEV  1073
             LSLPGENGK HMEDVEIKALIQDMIAAATDTSAVTNEWAMAE IK+PR+++KIQ+ELD V
Sbjct  281   LSLPGENGKAHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEAIKQPRVMRKIQEELDNV  340

Query  1074  VGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFIN  1253
             VGS+RMV E+DL+HLNYLRCVVRETFR HPAGPFLIPHES RATTINGY+IPAKTR+FIN
Sbjct  341   VGSNRMVDESDLVHLNYLRCVVRETFRMHPAGPFLIPHESVRATTINGYYIPAKTRVFIN  400

Query  1254  THGLGRNPSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTL  1430
             THGLGRN  +WDDV+DFRPERH+P +G GRVEISHG DFKILPFSAGKRKCPGAPLGVT+
Sbjct  401   THGLGRNTKIWDDVEDFRPERHWPVEGSGRVEISHGPDFKILPFSAGKRKCPGAPLGVTM  460

Query  1431  VLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             VLMALARLFH F+WS      P +IDT EVYGMTMPKA PL A+A+PRL  HLY
Sbjct  461   VLMALARLFHCFEWS-----SPGNIDTVEVYGMTMPKAKPLRAIAKPRLAAHLY  509



>ref|XP_002892076.1| CYP703A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68335.1| CYP703A2 [Arabidopsis lyrata subsp. lyrata]
Length=494

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/515 (74%), Positives = 426/515 (83%), Gaps = 33/515 (6%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             + L S F  L L   + + L     K     RLPPGPPRWPI+GNLLQLG LPHRD A  
Sbjct  3     LVLVSLFAVLILNVLLWRWLKASACKAQ---RLPPGPPRWPILGNLLQLGPLPHRDLAGL  59

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
             CDKYGPLVYLRLG+VDAITTNDP  IREILL+QDDVFASRP+TLAAVHLAYGCGDVALAP
Sbjct  60    CDKYGPLVYLRLGNVDAITTNDPDTIREILLRQDDVFASRPKTLAAVHLAYGCGDVALAP  119

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
             +GP WKRMRRICMEHLLTTKRLESFA  RAEEA                     +LGAFS
Sbjct  120   MGPHWKRMRRICMEHLLTTKRLESFATQRAEEA---------------------LLGAFS  158

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             MNNVTRMLLGKQFFG      P+EA EFM+ITH+LF LLG+IYLGDY+P WRW+DP GCE
Sbjct  159   MNNVTRMLLGKQFFGPGSLVPPKEAQEFMHITHKLFWLLGVIYLGDYLPFWRWVDPSGCE  218

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKE---IDGEMDFVDVLLSLPGENGKEHMEDVEIKA  950
             K+MR+VEKRVD+FH KI++EH+++K E    + ++DFVDVLLSLPGENGKEHMEDVEIKA
Sbjct  219   KEMRDVEKRVDNFHTKIIDEHKRAKHEKEDTNDDIDFVDVLLSLPGENGKEHMEDVEIKA  278

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
             L+QDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD VVGS+RMV E+DL+HLNYLR
Sbjct  279   LVQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDNVVGSNRMVDESDLVHLNYLR  338

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
             CVVRETFR HPAGPFLIPHES R TTINGY+IPAKTR+FINTHGLGRN  +WDDV+DFRP
Sbjct  339   CVVRETFRMHPAGPFLIPHESVRPTTINGYYIPAKTRVFINTHGLGRNTKIWDDVEDFRP  398

Query  1311  ERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             ERH+P DG GRVEISHG DFKILPFSAGKRKCPGAPLGVT+VLMALARLFH FDWS    
Sbjct  399   ERHWPVDGSGRVEISHGPDFKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWS----  454

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
               PE+IDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  455   -SPENIDTVEVYGMTMPKAKPLWAIAKPRLAAHLY  488



>ref|XP_009118885.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 703A2-like [Brassica 
rapa]
Length=508

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/509 (74%), Positives = 427/509 (84%), Gaps = 22/509 (4%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             S F  LSL   + + L V   K     + PPGPPRWPI+GNLLQLG LPHRD A  CDKY
Sbjct  8     SLFAILSLNVLLWRWLKVSACKTQ---KFPPGPPRWPILGNLLQLGPLPHRDMARLCDKY  64

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             G       G+VDAITTNDP  IREIL +QDDVF+SRP+TLAAVHLAYGCGDVALAP+GP 
Sbjct  65    G------XGNVDAITTNDPDTIREILFRQDDVFSSRPKTLAAVHLAYGCGDVALAPMGPH  118

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             WKRMRRICMEHLLTTKRLESF   RAEE+ +L+ DV+  AE G+ VNLREVLGAFSMNNV
Sbjct  119   WKRMRRICMEHLLTTKRLESFTAQRAEESCYLIADVYKRAECGKLVNLREVLGAFSMNNV  178

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
             TRMLLGKQFFG     GP+EA EFM+ITH+LF LLG+IYLGDY+P WRW+DPYGCEK+M+
Sbjct  179   TRMLLGKQFFGPGSVVGPKEAQEFMHITHKLFRLLGVIYLGDYLPFWRWVDPYGCEKEMK  238

Query  792   EVEKRVDDFHMKILEEHRKSKKE-------IDGEMDFVDVLLSLPGENGKEHMEDVEIKA  950
             +VEKRVD FH KI++EHR++K+E        +GEMDFVDVLLSLPGENGKEHM+DVEIKA
Sbjct  239   DVEKRVDKFHTKIMDEHRRAKREREDNTKNNNGEMDFVDVLLSLPGENGKEHMDDVEIKA  298

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
             LIQDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD +VGS RMV E+DL+HLNYLR
Sbjct  299   LIQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDSIVGSKRMVDESDLVHLNYLR  358

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
             CVVRETFR HP GPFLIPHE  R TT+NGY+IPAKTR+FINTHGLGRN  +WDD D+FRP
Sbjct  359   CVVRETFRMHPVGPFLIPHEFVRPTTVNGYYIPAKTRVFINTHGLGRNTKIWDDTDEFRP  418

Query  1311  ERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             ERH+P DG GRVEISHGAD+KILPFSAGKRKCPGAPLGVT+VLMALARLFH FDW+    
Sbjct  419   ERHWPVDGSGRVEISHGADYKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWT----  474

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPR  1574
               PE+IDT EVYGMTMPKA PL+A+A+PR
Sbjct  475   -SPENIDTLEVYGMTMPKAKPLWALAKPR  502



>ref|XP_006659094.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=525

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/486 (78%), Positives = 422/486 (87%), Gaps = 12/486 (2%)
 Frame = +3

Query  171   PRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVF  350
             PRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++QD+VF
Sbjct  35    PRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVF  94

Query  351   ASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLV  530
             ASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA EA HL 
Sbjct  95    ASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRALEAEHLC  154

Query  531   EDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFH  710
             + VW  A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF 
Sbjct  155   QFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFW  213

Query  711   LLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG-------  869
             LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK+++           
Sbjct  214   LLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQKIIDEHRKAREAKKSASLDDDN  273

Query  870   --EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               ++DFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L
Sbjct  274   KEDLDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVL  333

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
              KIQ+ELD VVG  RMV+E+DL  L YLRCVVRE+FR HPAGPFLIPHES + TTI GY 
Sbjct  334   LKIQEELDAVVGRGRMVAESDLAQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYD  393

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA--DGGRVEISHGADFKILPFSAGKR  1397
             IPA+TRIFINTH LGRN  +WDDVD+FRPERH PA  DGGRVEISH  DFKILPFSAGKR
Sbjct  394   IPAQTRIFINTHALGRNTRIWDDVDEFRPERHLPASTDGGRVEISHLPDFKILPFSAGKR  453

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             KCPGAPLGV LVLMALARLFH FDWSPP+GLRP+DIDT EVYGMTMPKA PL AVA+PRL
Sbjct  454   KCPGAPLGVILVLMALARLFHCFDWSPPDGLRPDDIDTQEVYGMTMPKAKPLVAVAKPRL  513

Query  1578  QRHLYG  1595
               H+Y 
Sbjct  514   PPHMYA  519



>ref|NP_001060927.1| Os08g0131100 [Oryza sativa Japonica Group]
 dbj|BAD09645.1| putative cytochrome P450 protein [Oryza sativa Japonica Group]
 dbj|BAD33366.1| putative cytochrome P450 protein [Oryza sativa Japonica Group]
 dbj|BAF22841.1| Os08g0131100 [Oryza sativa Japonica Group]
Length=525

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/486 (78%), Positives = 421/486 (87%), Gaps = 12/486 (2%)
 Frame = +3

Query  171   PRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVF  350
             PRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++QD+VF
Sbjct  35    PRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVF  94

Query  351   ASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLV  530
             ASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA EA HL 
Sbjct  95    ASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRALEAEHLC  154

Query  531   EDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFH  710
             + VW  A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF 
Sbjct  155   QFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFW  213

Query  711   LLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG-------  869
             LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK+++           
Sbjct  214   LLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQKIIDEHRKAREAKKSASLDDDN  273

Query  870   --EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               +MDFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L
Sbjct  274   KEDMDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVL  333

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD VVG  RMV+E+DL  L YLRCVVRE+FR HPAGPFLIPHES + TTI GY 
Sbjct  334   RKIQEELDGVVGRGRMVAESDLGQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYD  393

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP--ADGGRVEISHGADFKILPFSAGKR  1397
             IPA+TRIFINTH LGRN  +WDDVD FRPERH P  ADGGRVEISH  DFKILPFSAGKR
Sbjct  394   IPARTRIFINTHALGRNTRIWDDVDAFRPERHLPASADGGRVEISHLPDFKILPFSAGKR  453

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             KCPGAPLGV LVLMALARLFH FDWSPP+GLRP+DIDT EVYGMTMPKA PL AVA PRL
Sbjct  454   KCPGAPLGVILVLMALARLFHCFDWSPPDGLRPDDIDTQEVYGMTMPKAKPLVAVATPRL  513

Query  1578  QRHLYG  1595
                +YG
Sbjct  514   PPQMYG  519



>gb|ADZ04640.1| hypothetical protein [Oryza glaberrima]
Length=525

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/486 (78%), Positives = 420/486 (86%), Gaps = 12/486 (2%)
 Frame = +3

Query  171   PRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVF  350
             PRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++QD+VF
Sbjct  35    PRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVF  94

Query  351   ASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLV  530
             ASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA EA HL 
Sbjct  95    ASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRALEAEHLC  154

Query  531   EDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFH  710
             + VW  A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF 
Sbjct  155   QFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFW  213

Query  711   LLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG-------  869
             LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK+++           
Sbjct  214   LLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQKIIDEHRKAREAKKSASLDDDN  273

Query  870   --EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               +MDFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L
Sbjct  274   KEDMDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVL  333

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD VVG  RMV E+DL  L YLRCVVRE+FR HPAGPFLIPHES + TTI GY 
Sbjct  334   RKIQEELDGVVGRGRMVVESDLGQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYD  393

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP--ADGGRVEISHGADFKILPFSAGKR  1397
             IPA+TRIFINTH LGRN  +WDDVD FRPERH P  ADGGRVEISH  DFKILPFSAGKR
Sbjct  394   IPARTRIFINTHALGRNTRIWDDVDAFRPERHLPAAADGGRVEISHLPDFKILPFSAGKR  453

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             KCPGAPLGV LVLMALARLFH FDWSPP+GLRP+DIDT EVYGMTMPKA PL AVA PRL
Sbjct  454   KCPGAPLGVILVLMALARLFHCFDWSPPDGLRPDDIDTQEVYGMTMPKAKPLVAVATPRL  513

Query  1578  QRHLYG  1595
                +YG
Sbjct  514   PPQMYG  519



>gb|ADZ04644.1| hypothetical protein [Oryza punctata]
Length=498

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/484 (78%), Positives = 420/484 (87%), Gaps = 10/484 (2%)
 Frame = +3

Query  171   PRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVF  350
             PRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++QD+VF
Sbjct  10    PRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVF  69

Query  351   ASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLV  530
             ASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA EA HL 
Sbjct  70    ASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRALEAEHLC  129

Query  531   EDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFH  710
             + V   A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF 
Sbjct  130   QFVLAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFW  188

Query  711   LLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKS----KKEIDG---  869
             LLGLIYLGDY+P WRW+DPYGCEKKMR+VEK+VDDFH KI++EHRK+    K  +D    
Sbjct  189   LLGLIYLGDYLPAWRWLDPYGCEKKMRDVEKKVDDFHQKIIDEHRKAREAKKASLDDDNK  248

Query  870   -EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILK  1046
              +MDFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L+
Sbjct  249   EDMDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVLR  308

Query  1047  KIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHI  1226
             KIQ+ELD VVG DRMV+E+DL  L YLRCVVRE+FR HPAGPFLIPHES + TTI GY I
Sbjct  309   KIQEELDAVVGRDRMVAESDLGQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYDI  368

Query  1227  PAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKC  1403
             PA+TRIFINTH LGRN  +WDDVD FRPERH PA   GRVEISH  DFKILPFSAGKRKC
Sbjct  369   PAQTRIFINTHALGRNTRIWDDVDAFRPERHLPATADGRVEISHLPDFKILPFSAGKRKC  428

Query  1404  PGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQR  1583
             PGAPLGV LVLMALARLFH FDWSPP+GLRPEDIDT EVYGMTMPKA  L AVA+PRL  
Sbjct  429   PGAPLGVILVLMALARLFHCFDWSPPDGLRPEDIDTQEVYGMTMPKAKQLVAVAKPRLPP  488

Query  1584  HLYG  1595
              +YG
Sbjct  489   QMYG  492



>ref|XP_006836296.1| hypothetical protein AMTR_s00092p00018750 [Amborella trichopoda]
 gb|ERM99149.1| hypothetical protein AMTR_s00092p00018750 [Amborella trichopoda]
Length=516

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/527 (70%), Positives = 431/527 (82%), Gaps = 17/527 (3%)
 Frame = +3

Query  27    DLIKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQL  206
             DL  +   I  ITLAS  L L    +I+Q   VK       +RLPPGPPRWPIVGNLLQL
Sbjct  2     DLSILTMTILSITLASMILAL----RILQSSKVK-------IRLPPGPPRWPIVGNLLQL  50

Query  207   GRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHL  386
             G LPH+DFA+FC KYGPLVYLRLG+VD+ITTNDP II+EILL+QDD FASRP+TLAA+HL
Sbjct  51    GPLPHKDFASFCSKYGPLVYLRLGNVDSITTNDPEIIKEILLKQDDAFASRPKTLAAIHL  110

Query  387   AYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET  566
             AY  GDVALAP G  WK MRRICMEHLL+TKRLESF + R +EA+ +V  V+  A +G+T
Sbjct  111   AYNSGDVALAPFGKHWKHMRRICMEHLLSTKRLESFQEQRRQEAQFMVSSVYRDAMHGKT  170

Query  567   VNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVP  746
             +NLREVLGAFSMNNVTRM+LGKQ+FGA  S+GP EA +FM  THELF L+G+IYLGDY+P
Sbjct  171   INLREVLGAFSMNNVTRMILGKQYFGAG-SAGPDEAAQFMDTTHELFWLMGVIYLGDYLP  229

Query  747   LWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI-----DGEMDFVDVLLSLPGE  911
              WRW+DPY CE+KMR+VEKR+D FH++ILEEHR+  K +     D  MDFVD+LLSLPGE
Sbjct  230   FWRWLDPYRCEEKMRDVEKRMDAFHVRILEEHRRRTKVVKEGSKDETMDFVDILLSLPGE  289

Query  912   NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRM  1091
             +GKEHMED+EIKAL+QDMIAAATDTS VTNEWAMAEVI+ PRILKK+Q ELD VVG DRM
Sbjct  290   DGKEHMEDIEIKALVQDMIAAATDTSLVTNEWAMAEVIRNPRILKKLQDELDTVVGKDRM  349

Query  1092  VSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGR  1271
             V E+DL HL +LRC+VRETFR HPAGPFLIPHES R T + G+ +P KTRIFIN + LGR
Sbjct  350   VVESDLNHLQFLRCIVRETFRMHPAGPFLIPHESLRPTKLAGFDVPEKTRIFINAYALGR  409

Query  1272  NPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALAR  1451
             NP +WD+VD+F PERH   DGGR+EISHGADFKILPFSAGKRKCPGAPLG+  VL+ LAR
Sbjct  410   NPKIWDNVDEFYPERHMTVDGGRIEISHGADFKILPFSAGKRKCPGAPLGLCFVLLGLAR  469

Query  1452  LFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             LFH+F+W PP+G+  +DID +EVYG+TMPKA PL A+A+PRL  HLY
Sbjct  470   LFHAFNWYPPKGMSEKDIDVNEVYGLTMPKANPLLAMAKPRLPSHLY  516



>emb|CDX90022.1| BnaA10g00600D [Brassica napus]
Length=466

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/462 (79%), Positives = 409/462 (89%), Gaps = 12/462 (3%)
 Frame = +3

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              AA C KYGPLVYLRLG++DAITTNDP  IREIL +QDDVFASRP+TLAAVHLAYGCGDV
Sbjct  1     MAALCSKYGPLVYLRLGNIDAITTNDPETIREILFRQDDVFASRPKTLAAVHLAYGCGDV  60

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GP WKRMRRICMEHLLTTKRLESF   RAEEA++L++DV   AE G+ +NLREVL
Sbjct  61    ALAPMGPHWKRMRRICMEHLLTTKRLESFTSQRAEEAQYLIQDVCKRAECGKPINLREVL  120

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQFFG     G +EA EFM+ITH+LF LLG+IYLGDY+P WRW+DP
Sbjct  121   GAFSMNNVTRMLLGKQFFGPGSVVGAKEAQEFMHITHKLFRLLGVIYLGDYLPFWRWVDP  180

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKE-----IDGEMDFVDVLLSLPGENGKEHME  932
             YGCEK+MR+VEKRVD FH KI+EEHR++K+E     I+G+MDFVDVLLSLPGENGKEHM+
Sbjct  181   YGCEKEMRDVEKRVDKFHTKIIEEHRRAKREKEDKNIEGDMDFVDVLLSLPGENGKEHMD  240

Query  933   DVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLL  1112
             DVEIKALIQDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD VVGS+RMV+E DL+
Sbjct  241   DVEIKALIQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDNVVGSNRMVNETDLV  300

Query  1113  HLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-D  1289
             HLNYLRCVVRETFR HPAGPFLIPHES R TTINGY+IPAKTR+FINTHGLGRN SVW  
Sbjct  301   HLNYLRCVVRETFRMHPAGPFLIPHESVRPTTINGYYIPAKTRVFINTHGLGRNTSVWTT  360

Query  1290  DVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSF  1466
             D+++FRPERH+P DG GRVEISHG D+KILPFSAGKRKCPGAPLGVT+VLMALARLFH F
Sbjct  361   DIEEFRPERHWPVDGSGRVEISHGPDYKILPFSAGKRKCPGAPLGVTMVLMALARLFHCF  420

Query  1467  DWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             DW+      PEDIDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  421   DWTT-----PEDIDTVEVYGMTMPKAKPLWALAKPRLAAHLY  457



>gb|EAZ05488.1| hypothetical protein OsI_27705 [Oryza sativa Indica Group]
Length=1165

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/486 (78%), Positives = 421/486 (87%), Gaps = 12/486 (2%)
 Frame = +3

Query  171   PRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVF  350
             PRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++QD+VF
Sbjct  675   PRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVF  734

Query  351   ASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLV  530
             ASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA EA HL 
Sbjct  735   ASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRALEAEHLC  794

Query  531   EDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFH  710
             + VW  A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF 
Sbjct  795   QFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFW  853

Query  711   LLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG-------  869
             LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK+++           
Sbjct  854   LLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQKIIDEHRKAREAKKSASLDDDN  913

Query  870   --EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               +MDFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L
Sbjct  914   KEDMDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVL  973

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD VVG  RMV+E+DL  L YLRCVVRE+FR HPAGPFLIPHES + TTI GY 
Sbjct  974   RKIQEELDGVVGRGRMVAESDLGQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYD  1033

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP--ADGGRVEISHGADFKILPFSAGKR  1397
             IPA+TRIFINTH LGRN  +WDDVD FRPERH P  ADGGRVEISH  DFKILPFSAGKR
Sbjct  1034  IPARTRIFINTHALGRNTRIWDDVDAFRPERHLPAAADGGRVEISHLPDFKILPFSAGKR  1093

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             KCPGAPLGV LVLMALARLFH FDWSPP+GLRP+DIDT EVYGMTMPKA PL AVA PRL
Sbjct  1094  KCPGAPLGVILVLMALARLFHCFDWSPPDGLRPDDIDTQEVYGMTMPKAKPLVAVATPRL  1153

Query  1578  QRHLYG  1595
                +YG
Sbjct  1154  PPQMYG  1159



>gb|EAZ41414.1| hypothetical protein OsJ_25936 [Oryza sativa Japonica Group]
Length=1165

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/486 (78%), Positives = 421/486 (87%), Gaps = 12/486 (2%)
 Frame = +3

Query  171   PRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVF  350
             PRWPI GNLLQL  LPH+DFA FC KYGPLVYLRLG++DAITT+DP +IREIL++QD+VF
Sbjct  675   PRWPIFGNLLQLSPLPHKDFARFCTKYGPLVYLRLGTIDAITTDDPEVIREILIRQDEVF  734

Query  351   ASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLV  530
             ASRPRTLAAVHLAYGCGDVALAP+GP WKRMRR+CMEHLLTTKRLESFA HRA EA HL 
Sbjct  735   ASRPRTLAAVHLAYGCGDVALAPLGPNWKRMRRVCMEHLLTTKRLESFAAHRALEAEHLC  794

Query  531   EDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFH  710
             + VW  A++G+ VNLREVLGAFSMNNVTRMLLGKQ+FG  +S+GP EAMEFM+ITHELF 
Sbjct  795   QFVWAKAQSGKPVNLREVLGAFSMNNVTRMLLGKQYFGL-QSAGPGEAMEFMHITHELFW  853

Query  711   LLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG-------  869
             LLGLIYLGDY+P WRW+DPYGCEKKMREVEK+VDDFH KI++EHRK+++           
Sbjct  854   LLGLIYLGDYLPAWRWLDPYGCEKKMREVEKKVDDFHQKIIDEHRKAREAKKSASLDDDN  913

Query  870   --EMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               +MDFVDVLLSLPGENGKEHM+DVEIKAL+QDMIAAATDTS+VTNEW MAEVIK PR+L
Sbjct  914   KEDMDFVDVLLSLPGENGKEHMDDVEIKALMQDMIAAATDTSSVTNEWVMAEVIKNPRVL  973

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             +KIQ+ELD VVG  RMV+E+DL  L YLRCVVRE+FR HPAGPFLIPHES + TTI GY 
Sbjct  974   RKIQEELDGVVGRGRMVAESDLGQLTYLRCVVRESFRMHPAGPFLIPHESLKPTTIMGYD  1033

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP--ADGGRVEISHGADFKILPFSAGKR  1397
             IPA+TRIFINTH LGRN  +WDDVD FRPERH P  ADGGRVEISH  DFKILPFSAGKR
Sbjct  1034  IPARTRIFINTHALGRNTRIWDDVDAFRPERHLPASADGGRVEISHLPDFKILPFSAGKR  1093

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             KCPGAPLGV LVLMALARLFH FDWSPP+GLRP+DIDT EVYGMTMPKA PL AVA PRL
Sbjct  1094  KCPGAPLGVILVLMALARLFHCFDWSPPDGLRPDDIDTQEVYGMTMPKAKPLVAVATPRL  1153

Query  1578  QRHLYG  1595
                +YG
Sbjct  1154  PPQMYG  1159



>emb|CDY15188.1| BnaC05g00670D [Brassica napus]
Length=459

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/463 (77%), Positives = 407/463 (88%), Gaps = 13/463 (3%)
 Frame = +3

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              AA C+KYGPLVYLRLG++DAITTNDP  IREIL +QDDVFASRP+TLAAVHLAYGCGDV
Sbjct  1     MAALCNKYGPLVYLRLGNIDAITTNDPETIREILFRQDDVFASRPKTLAAVHLAYGCGDV  60

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GP WKRMRRICMEHLLTTKRLESF   RAEEA++L++DV+  AE G+ +NLREVL
Sbjct  61    ALAPMGPHWKRMRRICMEHLLTTKRLESFTAQRAEEAQYLIQDVFKRAECGKPINLREVL  120

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQFFG      P+EA EFM+ITH+LF LLG+IYLGDY+P WRW+DP
Sbjct  121   GAFSMNNVTRMLLGKQFFGPGSVVSPKEAQEFMHITHKLFRLLGVIYLGDYLPFWRWVDP  180

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEI------DGEMDFVDVLLSLPGENGKEHM  929
             YGCEK+MR+VEKRVD FH KI+EEHR++K++       D +MDFVDVLLSLPGENGK HM
Sbjct  181   YGCEKEMRDVEKRVDKFHTKIIEEHRRAKRKKEDSNNNDVDMDFVDVLLSLPGENGKAHM  240

Query  930   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDL  1109
             EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK+PR+++KIQ+ELD VVG +RMV+E+DL
Sbjct  241   EDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKQPRVMRKIQEELDNVVGINRMVNESDL  300

Query  1110  LHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-  1286
             +HLNYLRCVVRETFR HPAGPFLIPHES R TTI+GY+IPAKTR+FINTHGLGRN SVW 
Sbjct  301   VHLNYLRCVVRETFRMHPAGPFLIPHESVRPTTIDGYYIPAKTRVFINTHGLGRNTSVWT  360

Query  1287  DDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
              D+D+FRPERH+P DG GRVEISHG D+KILPFSAGKRKCPGAPLGVT+VLMALARLFH 
Sbjct  361   TDIDEFRPERHWPVDGSGRVEISHGPDYKILPFSAGKRKCPGAPLGVTMVLMALARLFHC  420

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDW+       E+IDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  421   FDWTT-----TENIDTVEVYGMTMPKAKPLWALAKPRLAAHLY  458



>gb|EPS61464.1| hypothetical protein M569_13332, partial [Genlisea aurea]
Length=514

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/523 (70%), Positives = 423/523 (81%), Gaps = 18/523 (3%)
 Frame = +3

Query  42    LKMIDYITLASFFLCLS--LIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRL  215
             + M+  + ++S  + +S    F + +     +  EN + +LPPGPP WPI GNLLQLG L
Sbjct  4     ITMLFSLIVSSLAILISSYTFFILSRTWWTSSTSENVRKKLPPGPPGWPIFGNLLQLGPL  63

Query  216   PHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYG  395
             PHRD A  C+KYGPLVYL+LG +DAITTNDP II+EIL  QD VFASRPRTLAA HLAYG
Sbjct  64    PHRDLAGLCEKYGPLVYLKLGRIDAITTNDPRIIQEILRTQDQVFASRPRTLAAEHLAYG  123

Query  396   CGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNL  575
             CGD+ALAP GPKWKR+RRIC EHLLTTKRLESFA HRAEEA  + + V      GE VNL
Sbjct  124   CGDIALAPAGPKWKRLRRICTEHLLTTKRLESFANHRAEEAGLMAKSVVDSVRKGEAVNL  183

Query  576   REVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWR  755
             R+VLGAFSMNNVTRMLLGK+F G  E     E+MEFM+ITHELF LLG+IYLGDY+P+WR
Sbjct  184   RQVLGAFSMNNVTRMLLGKRFLGTGE-----ESMEFMHITHELFRLLGMIYLGDYLPIWR  238

Query  756   WIDPYGCEKKMREVEKRVDDFHMKILEEH---RKSKKEIDGEMDFVDVLLSLPGENGKEH  926
             WIDPYGCEK+MR+VEKR+D+FH KI+E+H   R+  +  + EMDFVDVLLSL        
Sbjct  239   WIDPYGCEKRMRQVEKRIDEFHAKIIEDHRRRRRGGEGQEEEMDFVDVLLSL-------D  291

Query  927   MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
             M++VEIKA+IQDMIAAATDTSAVTNEWAMAE+IK PR+LKK+QQELD VVGSDR V E+D
Sbjct  292   MDEVEIKAVIQDMIAAATDTSAVTNEWAMAEMIKHPRVLKKVQQELDSVVGSDRTVQESD  351

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
             L HLNYLRC+VRETFR HPAGPFLIPHEST+ T I+G +IP KTR+FINTH LGRN  +W
Sbjct  352   LPHLNYLRCIVRETFRMHPAGPFLIPHESTQPTEIDGCYIPEKTRVFINTHALGRNEKIW  411

Query  1287  DDVDDFRPERHFPADGG-RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             ++VD+FRPERH   DGG R+EISHG+DFKILPFSAGKRKCPGAPLGVTLVL+ALARL HS
Sbjct  412   NEVDEFRPERHLVPDGGSRIEISHGSDFKILPFSAGKRKCPGAPLGVTLVLLALARLLHS  471

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDW+PPEG  PEDIDT+EVYGMTMP A  LFAVA PRL  HLY
Sbjct  472   FDWAPPEGSSPEDIDTTEVYGMTMPMAHALFAVAAPRLASHLY  514



>ref|XP_009414535.1| PREDICTED: cytochrome P450 703A2 [Musa acuminata subsp. malaccensis]
Length=465

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/465 (75%), Positives = 388/465 (83%), Gaps = 11/465 (2%)
 Frame = +3

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A     +GPLVYLRLG+VDA+TT+DP +IREILL+QDDVFASRPRTLAAVHLAYGC DV
Sbjct  1     MAQLSSAHGPLVYLRLGAVDAVTTDDPEVIREILLRQDDVFASRPRTLAAVHLAYGCRDV  60

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP G  WKRMRR CMEHLLTTK++ESF+ HR  EA HL  DVW  A +GE VNLR+ L
Sbjct  61    ALAPFGSHWKRMRRTCMEHLLTTKQIESFSGHRKIEACHLARDVWRKARDGEPVNLRQFL  120

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             G FSMNNVTRMLLGKQ+FG  E +GP EA EFM+ITHELF LLGLIYLGDY+PLWRW+DP
Sbjct  121   GNFSMNNVTRMLLGKQYFGP-ELAGPAEAAEFMHITHELFWLLGLIYLGDYLPLWRWLDP  179

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKS----KKEIDGE----MDFVDVLLSLPGENGKE  923
              G EKK+REVEKR+D FH KI+EEHR++    K+  DGE    MDFVDVLLSLPGE+GKE
Sbjct  180   LGREKKIREVEKRMDRFHQKIIEEHREAMARRKEAGDGENKEAMDFVDVLLSLPGEDGKE  239

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
              M+D EIKAL+QDMIAAATDTSAVTNEWAM EVIK P +L+K+Q+ELD VVG DR+V E+
Sbjct  240   RMDDTEIKALMQDMIAAATDTSAVTNEWAMTEVIKHPGVLRKVQEELDRVVGRDRLVQES  299

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             DL HL YLRCVVRETFR HPAGPFLIPHESTRAT + GY IPAKTR+FINT+ LGRN  V
Sbjct  300   DLAHLTYLRCVVRETFRLHPAGPFLIPHESTRATKLMGYDIPAKTRVFINTYALGRNRRV  359

Query  1284  WDDVDDFRPERHFP--ADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLF  1457
             WDDVD FRPERH P    GGRVEISHGADFKILPF AGKR+CPGAPLGVT+VLMALA LF
Sbjct  360   WDDVDAFRPERHLPPEGSGGRVEISHGADFKILPFGAGKRRCPGAPLGVTMVLMALATLF  419

Query  1458  HSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             H FDWSPPEG+R E+IDT EVYGMTMPKA PL A ARPRL  +LY
Sbjct  420   HCFDWSPPEGVRCEEIDTEEVYGMTMPKAKPLMAAARPRLAPNLY  464



>emb|CDY38002.1| BnaCnng08630D [Brassica napus]
Length=419

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/463 (70%), Positives = 367/463 (79%), Gaps = 53/463 (11%)
 Frame = +3

Query  228   FAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDV  407
              A  CDKYG LVYLRLG+VDAITTNDP  IREIL +QDDVF+SRP+TLAA+HLAYGCGDV
Sbjct  1     MATLCDKYGSLVYLRLGNVDAITTNDPDTIREILFRQDDVFSSRPKTLAALHLAYGCGDV  60

Query  408   ALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVL  587
             ALAP+GP WKRMRRICMEHLLTTKRLESF   RAEE R+L+ DV+  AE G+ +NLREVL
Sbjct  61    ALAPMGPHWKRMRRICMEHLLTTKRLESFTAQRAEETRYLIADVYKRAECGKLINLREVL  120

Query  588   GAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             GAFSMNNVTRMLLGKQFFG     GP+EA EFM+ITH+LF LLG+IYLGDY+P WRW+DP
Sbjct  121   GAFSMNNVTRMLLGKQFFGPGSVVGPKEAQEFMHITHKLFRLLGVIYLGDYLPFWRWVDP  180

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEI------DGEMDFVDVLLSLPGENGKEHM  929
             YGCEK+M++VEKRVD FH KI EEHR++K+E       +GEMDFV+VLLSLPG+NGKEH 
Sbjct  181   YGCEKEMKDVEKRVDKFHTKITEEHRRTKREREDNNNDNGEMDFVEVLLSLPGDNGKEH-  239

Query  930   EDVEIKALIQ-DMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEND  1106
               +EIKALIQ DMIAAATDTSAVTNEWAMAE I                           
Sbjct  240   --IEIKALIQWDMIAAATDTSAVTNEWAMAESI---------------------------  270

Query  1107  LLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW  1286
                       +RETFR HPAGPFLIPHES R TT+NGY+IPAKTR+FINTHGLGRN  +W
Sbjct  271   ----------LRETFRMHPAGPFLIPHESVRPTTVNGYYIPAKTRVFINTHGLGRNTKIW  320

Query  1287  DDVDDFRPERHFPADG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             DD+D+FRPERH+P DG GRVEIS GAD+KILPFSAGKRKCPGAPLGVT+VLMALARLFH 
Sbjct  321   DDIDEFRPERHWPVDGSGRVEISRGADYKILPFSAGKRKCPGAPLGVTMVLMALARLFHC  380

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             FDW+      PE+IDT EVYGMTMPKA PL+A+A+PRL  HLY
Sbjct  381   FDWTS-----PENIDTVEVYGMTMPKAKPLWALAKPRLAAHLY  418



>gb|KGN56419.1| hypothetical protein Csa_3G119520 [Cucumis sativus]
Length=440

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/400 (77%), Positives = 350/400 (88%), Gaps = 10/400 (3%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP RWPIVGNLLQL  LPHRD A  C K+GPLVYL+LGSVDAITT+DP+ IREILLQ
Sbjct  30    LPPGPRRWPIVGNLLQLTHLPHRDMAELCRKHGPLVYLKLGSVDAITTDDPATIREILLQ  89

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             QD+VFASRPRTLAAVHLAYGC DVALAP+GP WKRMRRICMEHLLT+KRL+SF+ HRA E
Sbjct  90    QDEVFASRPRTLAAVHLAYGCSDVALAPLGPNWKRMRRICMEHLLTSKRLDSFSAHRASE  149

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
             A+HLV+DVW  A+NGE VNLREVLG FSMNNVTRMLLGKQ+FG   S+GP EAMEFM+IT
Sbjct  150   AQHLVQDVWARAQNGEAVNLREVLGGFSMNNVTRMLLGKQYFGCG-SAGPGEAMEFMHIT  208

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK------  857
             HELF LLG+IYLGDY+P WRW+DP+GCE+KMR+VEK+VDDFH KI+EEHRK ++      
Sbjct  209   HELFRLLGVIYLGDYLPFWRWVDPHGCEEKMRKVEKQVDDFHTKIIEEHRKEREKRKVSG  268

Query  858   ---EIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
                + DG MDFVDVLLSLPGE+GKEHM+DVEIKALIQDMIAAATDTSAVTNEWAM EVIK
Sbjct  269   QQHDSDGTMDFVDVLLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMTEVIK  328

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              P +L K+Q+ELD VVG +R+V E+DL+HLNYLRCVVRETFR HPAGPFLIPHES   T 
Sbjct  329   HPHVLAKVQEELDVVVGPNRLVLESDLVHLNYLRCVVRETFRMHPAGPFLIPHESLHDTK  388

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
             I+GY IPAKTRIFINTHGLGRN ++WD+VD+FRPERH+P 
Sbjct  389   IHGYDIPAKTRIFINTHGLGRNTNIWDNVDEFRPERHWPT  428



>gb|KCW78192.1| hypothetical protein EUGRSUZ_D02382 [Eucalyptus grandis]
Length=404

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/404 (75%), Positives = 344/404 (85%), Gaps = 21/404 (5%)
 Frame = +3

Query  441   MRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENG--ETVNLREVLGAFSMNNVT  614
             MRRICMEHLLTT+RLE+FA+HRA EA+HLV  V+G+  +     +++REVLG FSMNNVT
Sbjct  1     MRRICMEHLLTTRRLEAFARHRACEAQHLVRHVYGLCRDRGRAGIDMREVLGGFSMNNVT  60

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             RMLLGKQ+FGA  SSGPQEAMEFM++TH+LF LLG+IYLGDY+P WRWIDP+GCEKKMRE
Sbjct  61    RMLLGKQYFGAG-SSGPQEAMEFMHVTHQLFRLLGVIYLGDYLPFWRWIDPHGCEKKMRE  119

Query  795   VEKRVDDFHMKILEEHRKSKKEI----------DGEMDFVDVLLSLPGENGKEHMEDVEI  944
             VEKRVDDFH KI+EEHR++              D +MDFVDVLLSLPGE+G++ M+DVEI
Sbjct  120   VEKRVDDFHTKIIEEHRRAAAAGEAKAAAGLAGDSDMDFVDVLLSLPGEDGRDRMDDVEI  179

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KALIQDMIAAATDTSAVTNEWAMAEVI+ PR+ ++IQ+ELD VVG DRMVSE DL HLNY
Sbjct  180   KALIQDMIAAATDTSAVTNEWAMAEVIRHPRVQRRIQEELDSVVGRDRMVSEPDLSHLNY  239

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDD  1301
             LRCVVRETFR HPAGPFLIPHES RATT+NGYHIPA TR+FINTHGLGRNP VW DDV++
Sbjct  240   LRCVVRETFRMHPAGPFLIPHESVRATTLNGYHIPAGTRVFINTHGLGRNPDVWADDVEE  299

Query  1302  FRPERHFPA------DG-GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH  1460
             FRPERH+PA      DG GRVEISHG DF+ILPF AGKRKCPGAPLGVTLVL ALARLFH
Sbjct  300   FRPERHWPAAVGEQGDGVGRVEISHGPDFRILPFGAGKRKCPGAPLGVTLVLTALARLFH  359

Query  1461  SFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              F+WSPP G+RPED+D +EVYGMTMPKA PL A+ARPRL  HLY
Sbjct  360   CFEWSPPGGMRPEDMDMAEVYGMTMPKARPLVALARPRLAEHLY  403



>ref|XP_008437883.1| PREDICTED: cytochrome P450 703A2 isoform X2 [Cucumis melo]
Length=383

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/334 (77%), Positives = 292/334 (87%), Gaps = 10/334 (3%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP RWPIVGNLLQL  LPHRD A  C KYGPLVYL+LGSVDAITT+DP+ IREILLQ
Sbjct  30    LPPGPRRWPIVGNLLQLTHLPHRDMAELCRKYGPLVYLKLGSVDAITTDDPATIREILLQ  89

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
             QD+VFASRPRTLAAVHLAYGC DVALAP+GP WKRMRRICME+LLT+KRL+SF+ HRA E
Sbjct  90    QDEVFASRPRTLAAVHLAYGCSDVALAPLGPGWKRMRRICMENLLTSKRLDSFSAHRASE  149

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
             A+HLV+DVW  A+NGE VNLREVLG FSMNNVTRMLLGKQ+FG   S+GP EAMEFM+IT
Sbjct  150   AQHLVQDVWARAQNGENVNLREVLGGFSMNNVTRMLLGKQYFGCG-SAGPSEAMEFMHIT  208

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK------  857
             HELF LLG+IYLGDY+P WRW+DP+GCE+KMR+VEK+VDDFH KI+EEHRK ++      
Sbjct  209   HELFRLLGVIYLGDYLPFWRWVDPHGCEEKMRKVEKQVDDFHTKIIEEHRKEREKRKVSG  268

Query  858   ---EIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
                + DG MDFVDVLLSLPGE+GKEHM+DVEIKALIQDMIAAATDTSAVTNEWAM EVIK
Sbjct  269   QQHDGDGNMDFVDVLLSLPGEDGKEHMDDVEIKALIQDMIAAATDTSAVTNEWAMTEVIK  328

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
              P +L KIQ+ELD VVG +R+V E+DL+HLNYLR
Sbjct  329   HPHVLAKIQEELDVVVGPNRLVLESDLVHLNYLR  362



>ref|XP_002967231.1| hypothetical protein SELMODRAFT_168652 [Selaginella moellendorffii]
 gb|EFJ31830.1| hypothetical protein SELMODRAFT_168652 [Selaginella moellendorffii]
Length=464

 Score =   496 bits (1278),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 327/469 (70%), Gaps = 12/469 (3%)
 Frame = +3

Query  198   LQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAA  377
             +QLG LPHR  A +C KYGPLVY RLGS   IT + P +IRE+L  QD+ FASRPRT A 
Sbjct  1     MQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFASRPRTTAG  60

Query  378   VHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAEN  557
               +AY   DV LAP    WK MRRIC+E+LLTT+R+E F K RAEEAR LVE +   A+ 
Sbjct  61    KLMAYHDQDVGLAPYDAHWKLMRRICVENLLTTRRMEGFQKSRAEEARDLVETMLKEAKA  120

Query  558   GETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGD  737
             G T+N+RE LG F+MN +TRML+GK++FG  ES+G +EA +   + HE   L+G+ ++ D
Sbjct  121   GNTINIREHLGGFTMNVITRMLIGKRYFGT-ESTGEKEATDIRELLHEAVALIGVFFIPD  179

Query  738   YVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENG  917
             +VPL +W+DP     + +++ KR+DD++  I+EEHRK ++ +DG  DFVDVLL   GEN 
Sbjct  180   HVPLLKWMDPKSYRHQFKKIGKRMDDYYSYIIEEHRKRQEVVDGPKDFVDVLL---GENS  236

Query  918   KEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVV----GSD  1085
             +  + DVEIKALIQDM+   TDT++ T EW M E+I+ P++++K+Q+E+D V+     + 
Sbjct  237   E--LNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQKEIDSVLEKKATNK  294

Query  1086  RMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGL  1265
              +V E+DL  L+YL+  V+ETFR HP G FLIPHES R T + GYH+P  + I INTHGL
Sbjct  295   HLVEESDLASLDYLKAAVKETFRMHPVGGFLIPHESIRDTNVAGYHVPKGSLILINTHGL  354

Query  1266  GRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMAL  1445
             GRN +VWD+VD+FRPER    D  +V +   ++++++PF +GKR CPGA LG +++L+ L
Sbjct  355   GRNSAVWDNVDEFRPERFLRTD-DKVHL-RDSEYRVIPFGSGKRACPGAQLGQSMLLLGL  412

Query  1446  ARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              RLFH FDW PP G+   DID  E YG+T P  TPL AVA+ RL    Y
Sbjct  413   GRLFHGFDWYPPPGMSTGDIDVMEAYGLTTPPRTPLRAVAKARLDESFY  461



>ref|XP_002967259.1| hypothetical protein SELMODRAFT_144382 [Selaginella moellendorffii]
 gb|EFJ31858.1| hypothetical protein SELMODRAFT_144382 [Selaginella moellendorffii]
Length=495

 Score =   490 bits (1262),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 254/480 (53%), Positives = 334/480 (70%), Gaps = 12/480 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GNL+QLG LPHR  A +C KYGPLVY RLGS   IT + P +IRE+L  QD+ FAS
Sbjct  17    WPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFAS  76

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RPRT A   +AY   +V LAP    WK MRRIC+EHLLTT+R+E F K RAEEAR LV+ 
Sbjct  77    RPRTTAGKLMAYHDQNVGLAPYDAHWKLMRRICVEHLLTTRRMEGFQKSRAEEARDLVQI  136

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLL  716
             ++  A+ G T+N+RE LG ++MN VTRML+GK++FG  ES G +EA +F  + H    L 
Sbjct  137   MFKEAKAGNTINMREHLGGYTMNVVTRMLIGKRYFGT-ESMGEKEATDFRELIHAAIVLH  195

Query  717   GLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE---IDGEMDFVD  887
             G+ Y+ D+VPL +WIDP G  +  +++ KR+DD++  I+EEHRK ++    +DG  DFVD
Sbjct  196   GVFYIPDHVPLLKWIDPNGYRRLFKKMGKRMDDYYSYIVEEHRKRQRNGEVVDGPKDFVD  255

Query  888   VLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             VLL L GEN + H+ DVEIKALIQDM+   TDT++ T EW M E+I+ P++++K+Q ELD
Sbjct  256   VLLGLAGENSELHLNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQAELD  315

Query  1068  EVV----GSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAK  1235
              V+     +  ++ E+DL  L+YLR  V+ETFR HP G FLIPHES R T + GYH+P  
Sbjct  316   SVLQKKATNKHLLEESDLASLDYLRAAVKETFRIHPVGGFLIPHESIRDTKVAGYHVPKG  375

Query  1236  TRIFINTHGLGRNPSVWDDVDDFRPERHF-PADGGRVEISHGADFKILPFSAGKRKCPGA  1412
             + I INTHGLGRN +VWD+VD+FRPER   P D   +  S   +++++PF +GKR CPGA
Sbjct  376   SLILINTHGLGRNAAVWDNVDEFRPERFLRPEDKVHLRDS---EYRVIPFGSGKRACPGA  432

Query  1413  PLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              LG +++L+ L RL H FDW PP G   EDID  E YG+T P  TPL AVA+ RL +  Y
Sbjct  433   QLGQSMLLLGLGRLLHGFDWFPPPGTSREDIDVMEAYGLTTPPRTPLRAVAKARLDQSFY  492



>ref|XP_002960462.1| hypothetical protein SELMODRAFT_74166 [Selaginella moellendorffii]
 gb|EFJ38001.1| hypothetical protein SELMODRAFT_74166 [Selaginella moellendorffii]
Length=495

 Score =   485 bits (1248),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 252/480 (53%), Positives = 332/480 (69%), Gaps = 12/480 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GNL+QLG LPHR  A +C KYGPLVY RLGS   IT + P +IRE+L  QD+ FAS
Sbjct  17    WPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFAS  76

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RPRT A   +AY   +V LAP    WK MRRIC+EHLLTT+R+E F K RAEEAR LV+ 
Sbjct  77    RPRTTAGKLMAYHDQNVGLAPYDAHWKLMRRICVEHLLTTRRMEGFQKSRAEEARDLVQI  136

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLL  716
             ++  A+   T+N+RE LG ++MN VTRML+GK++FG  ES G +EA +F  + H    L 
Sbjct  137   MFKEAKAENTINMREHLGGYTMNVVTRMLIGKRYFGT-ESMGEKEATDFRELIHAAIVLH  195

Query  717   GLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE---IDGEMDFVD  887
             G+ Y+ D+VPL +WIDP G  +  +++  R+DD++  I+EEHRK ++    +DG  DFVD
Sbjct  196   GVFYIPDHVPLLKWIDPNGYRRLFKKMGTRMDDYYSYIVEEHRKRQRNGEVVDGPKDFVD  255

Query  888   VLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             VLL L GEN + H+ DVEIKALIQDM+   TDT++ T EW M E+I+ P++++K+Q ELD
Sbjct  256   VLLGLAGENSELHLNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQAELD  315

Query  1068  EVV----GSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAK  1235
              V+     +  ++ E+DL  L+YLR  V+ETFR HP G FLIPHES R T + GYH+P  
Sbjct  316   SVLQKKATNKHLLEESDLASLDYLRAAVKETFRIHPVGGFLIPHESIRDTKVAGYHVPKG  375

Query  1236  TRIFINTHGLGRNPSVWDDVDDFRPERHF-PADGGRVEISHGADFKILPFSAGKRKCPGA  1412
             + I INTHGLGRN +VWD+VD+FRPER   P D   +  S   +++++PF +GKR CPGA
Sbjct  376   SLILINTHGLGRNAAVWDNVDEFRPERFLRPEDKVHLRDS---EYRVIPFGSGKRACPGA  432

Query  1413  PLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              LG +++L+ L RL H FDW PP G   EDID  E YG+T P  TPL AVA+ RL +  Y
Sbjct  433   QLGQSMLLLGLGRLLHGFDWFPPPGTSREDIDVMEAYGLTTPPRTPLRAVAKARLDQSFY  492



>ref|XP_002960493.1| lauric acid in-chain hydroxylase [Selaginella moellendorffii]
 gb|EFJ38032.1| lauric acid in-chain hydroxylase [Selaginella moellendorffii]
Length=487

 Score =   480 bits (1236),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/476 (52%), Positives = 331/476 (70%), Gaps = 12/476 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GNL+QLG LPHR  A +C KYGPLVY RLGS   IT + P +IRE+L  QD+ FAS
Sbjct  17    WPIIGNLMQLGPLPHRTMAGWCQKYGPLVYCRLGSTPTITASSPQMIRELLWTQDETFAS  76

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RPRT A   +AY   DV LAP    WK MRRIC+E+LLTT+R+E F K RAEEAR LVE 
Sbjct  77    RPRTTAGKLMAYHDQDVGLAPYDAHWKLMRRICVENLLTTRRMEGFQKSRAEEARDLVET  136

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLL  716
             +   A+ G T+N+RE LG F+MN +TRML+GK++FG  ES+G +EA +   + HE   L+
Sbjct  137   MLKEAKAGNTINMREHLGGFTMNVITRMLIGKKYFGT-ESTGEKEATDIRELLHEAVALI  195

Query  717   GLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLL  896
             G+ ++ D+VPL +W+DP G   + +++ KR+DD++  I+EEHR  ++ +DG  DFVDVLL
Sbjct  196   GVFFIPDHVPLLKWMDPKGYRHQFKKIGKRMDDYYSYIIEEHRTRQEVVDGPKDFVDVLL  255

Query  897   SLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEV-  1073
                GEN +  + DVEIKALIQDM+   TDT++ T EW M E+I+ P++++K+Q+E+D V 
Sbjct  256   ---GENSE--LNDVEIKALIQDMVVGGTDTASFTMEWFMLEMIRNPKVMRKVQEEIDSVL  310

Query  1074  ---VGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRI  1244
                V +  +V E+DL  L+YL+  V+ETFR HP G FLIPHES   T + GYH+P  + I
Sbjct  311   EKKVTNKHLVEESDLASLDYLKAAVKETFRMHPVGGFLIPHESIGDTKVAGYHVPKGSLI  370

Query  1245  FINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGV  1424
              INTHGLGRN +VWD+VD+FRPER    D  +V +   ++++++PF +GKR CPGA LG 
Sbjct  371   LINTHGLGRNTAVWDNVDEFRPERFLRTD-DKVHL-RDSEYRVIPFGSGKRACPGAQLGQ  428

Query  1425  TLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             +++L+ L RL   FDW PP G+   DID  E YG+T P  TPL AVA+ RL    Y
Sbjct  429   SMLLLGLGRLLRGFDWYPPPGMSTGDIDVMEAYGLTTPPRTPLRAVAKSRLDERFY  484



>emb|CDO99831.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   455 bits (1171),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 217/275 (79%), Positives = 241/275 (88%), Gaps = 4/275 (1%)
 Frame = +3

Query  786   MREVEKRVDDFHMKILEEHRKSKK----EIDGEMDFVDVLLSLPGENGKEHMEDVEIKAL  953
             MREVEKRVDDFH KI++EHRK  +    + + E+DFVDVLLSL GE+G+ H++D +IKAL
Sbjct  1     MREVEKRVDDFHSKIIQEHRKKLQTGGVKDEAEIDFVDVLLSLAGEDGEAHLDDKDIKAL  60

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             IQDMIAAATDTSAVTNEWAMAEVIK P +L+KIQ+ELD VVG DRMV+E+DL HLNYLRC
Sbjct  61    IQDMIAAATDTSAVTNEWAMAEVIKHPTVLEKIQEELDTVVGRDRMVTESDLAHLNYLRC  120

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             VVRETFR HPAGPFLIPHES RATTINGYHIPAKTR+FINTHGLGRN  +WDDV++FRPE
Sbjct  121   VVRETFRMHPAGPFLIPHESVRATTINGYHIPAKTRVFINTHGLGRNTKIWDDVEEFRPE  180

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             RH   DG RVEISHG+DFKILPFSAGKRKCPGAPLGVTLVLMALARLFH FDW P +GLR
Sbjct  181   RHLTGDGSRVEISHGSDFKILPFSAGKRKCPGAPLGVTLVLMALARLFHCFDWRPADGLR  240

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             P+DIDTSEVYGMTMPKA PL A+ARPRL  H Y S
Sbjct  241   PQDIDTSEVYGMTMPKANPLVAIARPRLPSHFYQS  275



>ref|XP_001752061.1| predicted protein [Physcomitrella patens]
 gb|EDQ83496.1| predicted protein [Physcomitrella patens]
Length=499

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 232/486 (48%), Positives = 316/486 (65%), Gaps = 14/486 (3%)
 Frame = +3

Query  150   MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREIL  329
             ++LPPGP   P VGNLLQLG LPH+       KYG LVYLRLGSV  I  + P + REI 
Sbjct  24    LQLPPGPKGLPFVGNLLQLGSLPHKTVTELHKKYGHLVYLRLGSVQTIVMDSPELFREIT  83

Query  330   LQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRA  509
              +QD+VF+SRP       +AY   D A+AP GP W+ +R+IC+  LLT KRLES A  R 
Sbjct  84    REQDNVFSSRPHLTFTELVAYDAHDFAMAPYGPHWRHVRKICVHELLTNKRLESTAGERK  143

Query  510   EEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMY  689
             EE R +V+ +   A +G+ V++R+V    SM  + RML+G++ F A E     +  +F +
Sbjct  144   EEWRCMVKAILEAANSGDVVDMRDVFAGVSMTVMCRMLVGRRDFSARED----KPRDFKH  199

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR--KSKKEI  863
             + HELF L+G++ L D+VP   W+D  G E+ MR++ +  D+    +++EHR   S K  
Sbjct  200   LIHELFRLMGVLNLRDFVPALGWLDLQGFERDMRKLRREFDEVFDAVIQEHRDLASGKLP  259

Query  864   DGE-MDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              G+  DF+ VLL LPGENG+ H+++  IKAL+QDM+A ATDTSAVTNEWAMAE+I+   I
Sbjct  260   GGKPNDFISVLLDLPGENGEPHLDEKTIKALLQDMLAGATDTSAVTNEWAMAEIIRNQEI  319

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
              +K+Q ELD VVG DR V E+DL ++ YL C+ +ETFR HPAGPF IP E+   T +NGY
Sbjct  320   QRKLQNELDSVVGRDRNVQESDLPNMPYLMCITKETFRLHPAGPFGIPRETMADTKLNGY  379

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             H+P  TR+ +N + LGRNP +W D  +F+PER    +  +V+     +F+I PF  G+R+
Sbjct  380   HVPKGTRVLMNFYSLGRNPEIWADPLEFKPERWERENLAQVQ---DPEFRIFPFGNGRRQ  436

Query  1401  CPGAPLGVTLVLMALARLFHSFDWS-PPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             CPG  LG ++VL  LA L+H F+WS PP+  R   ID  E +G T+P  T L AVA PRL
Sbjct  437   CPGYILGSSMVLSTLATLYHGFNWSLPPDVAR---IDMDEAFGCTLPMRTRLRAVATPRL  493

Query  1578  QRHLYG  1595
               +LY 
Sbjct  494   PPYLYA  499



>ref|XP_001756284.1| predicted protein [Physcomitrella patens]
 gb|EDQ78680.1| predicted protein [Physcomitrella patens]
Length=479

 Score =   439 bits (1128),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 227/486 (47%), Positives = 304/486 (63%), Gaps = 10/486 (2%)
 Frame = +3

Query  150   MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREIL  329
             M LPPGP   P++GNLLQ+G  PHR   A   KYG ++Y+RLG +  +  + P +I EI 
Sbjct  1     MNLPPGPKAMPLLGNLLQMGSHPHRTMTAMHKKYGHILYIRLGCIPTVVVDSPQLIAEIT  60

Query  330   LQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRA  509
              +QD+VF+SRP       +AY   D A+AP GP W+ +RRIC+  LLT KRLE   K R 
Sbjct  61    KEQDNVFSSRPHMTFTDIVAYDAHDFAMAPYGPHWRYVRRICVHELLTPKRLEITMKERI  120

Query  510   EEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMY  689
             EE+R ++  V   A+ GE V++R+V    SM  + RMLLG++ F A      ++A +F +
Sbjct  121   EESRCMIMAVAEAAQKGEIVDMRDVFAGVSMTVMCRMLLGRREFAATG----KKAKDFKH  176

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR--KSKKEI  863
             + HELF L+G + L D+VP   W+D  G E+ M ++    D+    +++EHR   S K  
Sbjct  177   LIHELFRLMGALNLRDFVPALGWLDLQGFERDMYKLRDEFDEVFDAVIQEHRDLASGKLP  236

Query  864   DGE-MDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              G+  DF+ VLL LPGENG  H++D  IKA+  DM+A ATDTSAVTNEWAMAE+I+   I
Sbjct  237   GGKPNDFISVLLDLPGENGAPHLDDKTIKAITLDMMAGATDTSAVTNEWAMAEIIRNTEI  296

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
              +K+Q+E+D VVG +R V E+D+  L YL CVV+ETFR HPAGPF IP E+   T ++GY
Sbjct  297   QRKLQEEIDSVVGLERNVQESDINKLPYLMCVVKETFRLHPAGPFAIPRETMADTKLSGY  356

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
              IP  TR+ IN   LGR+   W D   F+PER    +   +   H   F+ILPF  G+R+
Sbjct  357   RIPKGTRVLINIFSLGRSSETWKDPLKFQPERWANENLSAI---HDMGFRILPFGYGRRQ  413

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPG  LG T+VL+ LARL H F WS P G+  E+ID  E+YG T P  T L  +A PRL 
Sbjct  414   CPGYNLGTTMVLLTLARLLHGFKWSFPPGVTAENIDMEELYGCTTPLRTRLRTIATPRLA  473

Query  1581  RHLYGS  1598
              HLY  
Sbjct  474   PHLYSQ  479



>ref|XP_002978011.1| hypothetical protein SELMODRAFT_108395 [Selaginella moellendorffii]
 gb|EFJ20668.1| hypothetical protein SELMODRAFT_108395 [Selaginella moellendorffii]
Length=541

 Score =   438 bits (1127),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 232/533 (44%), Positives = 330/533 (62%), Gaps = 36/533 (7%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENG------------KMRLPPGPPRWPIVGNLLQLG  209
             +A+FFL LSLI   +   P++ G ++             ++ LPPGP  WP++GNLLQ+G
Sbjct  10    VAAFFLSLSLI-HFLFFRPIRPGAKSNVDPGVKGRDRRQRLHLPPGPKPWPVIGNLLQIG  68

Query  210   RLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLA  389
               PH+    F  ++GPLVYL+LG V  I T+ P+IIR+IL++QD +FASRP  +A  +  
Sbjct  69    PFPHKSMMEFTRRHGPLVYLKLGVVPTIVTDSPAIIRDILIKQDHIFASRPENIACQYFT  128

Query  390   YGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW-------GM  548
             Y   D+A AP G  W+ MR+IC   LL+ +++ SF   R +E   +VE V+       G 
Sbjct  129   YNGRDIAFAPYGQHWRAMRKICTLELLSPRKIASFRDGRCQELNLMVESVFQDLGREDGS  188

Query  549   AENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIY  728
             +     +NLR+   + S N +TRMLLGK+ FG   ++GP++A E   + +E F L+    
Sbjct  189   SPTTHKINLRDKFASLSCNILTRMLLGKRHFGPG-AAGPEDAAEHKQMIYEGFALVNAFN  247

Query  729   LGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE-------MDFVD  887
             + DY+P  R  D  G E+KMR + +R D+ + +I+EEHR+   +  G          FVD
Sbjct  248   VADYLPFLRAFDLQGHERKMRRIMQRTDEVYDEIIEEHRQKLAKNSGRSCQEQQGASFVD  307

Query  888   VLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             VLLS+PG NG++ +    IKA++ DM++A TDTS+V +EWAMAE+ + PR + K+++ELD
Sbjct  308   VLLSVPGANGEKQLSTTTIKAIMIDMLSAGTDTSSVISEWAMAELARHPREMAKVREELD  367

Query  1068  EVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIF  1247
               VG DR V E+D+++LNYL+ VV+E FR HP G FLIPH ST  T I GY IP  TRI 
Sbjct  368   AAVGVDRPVDESDVVNLNYLKAVVKEIFRLHPVGAFLIPHFSTEDTRIGGYDIPKNTRIL  427

Query  1248  INTHGLGRNPSVW-DDVDDFRPERHFPADG---GRVEISHGADFKILPFSAGKRKCPGAP  1415
             +NT+ LGR+ SVW DDV  FRP+R   + G    ++     ++ +++PF AG+R CPGA 
Sbjct  428   VNTYSLGRSRSVWGDDVHLFRPDRFLASPGDLSSQIVELMDSECRVVPFGAGRRSCPGAS  487

Query  1416  LGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPR  1574
             LG  +V+M LARL   FDWS P G   E+ID SE  G T+    PL  VA+PR
Sbjct  488   LGSCMVVMGLARLIQRFDWSAPPG---EEIDVSERVGFTVLD-KPLELVAKPR  536



>ref|XP_002966737.1| hypothetical protein SELMODRAFT_168443 [Selaginella moellendorffii]
 gb|EFJ32764.1| hypothetical protein SELMODRAFT_168443 [Selaginella moellendorffii]
Length=541

 Score =   436 bits (1120),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 234/534 (44%), Positives = 332/534 (62%), Gaps = 38/534 (7%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENG------------KMRLPPGPPRWPIVGNLLQLG  209
             +A+FFL LSLI   +   P++ G ++             ++ LPPGP  WP++GNLLQ+G
Sbjct  10    VAAFFLFLSLI-HFLFFRPIRPGAKSNVDPGVKGRDRRQRLHLPPGPKPWPVIGNLLQIG  68

Query  210   RLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLA  389
               PH+    F  ++GPLVYL+LG V  I T+ P+IIR+IL++QD +FASRP  +A  +  
Sbjct  69    PFPHKSMMEFTRRHGPLVYLKLGVVPTIVTDSPAIIRDILIKQDHIFASRPENIACQYFT  128

Query  390   YGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW-------GM  548
             Y   D+A AP G  W+ MR+IC   LL+ +++ SF   R +E   +VE V+       G 
Sbjct  129   YNGRDIAFAPYGQHWRAMRKICTLELLSPRKIASFRDGRCQELDLMVESVFQDLGREEGS  188

Query  549   AENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIY  728
             +     +NLR+   + S N +TRMLLGK+ FG   ++GP++A E   + +E F L+    
Sbjct  189   SPTTHKINLRDKFASLSCNILTRMLLGKRHFGPG-AAGPEDAAEHKQMIYEGFALVNAFN  247

Query  729   LGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRK--------SKKEIDGEMDFV  884
             + DY+P  R  D  G E+KMR + +R D+ + +I+EEHR+        S +E  G   FV
Sbjct  248   VADYLPFLRAFDLQGHERKMRRIMQRADEVYDEIIEEHRQKLAKNSGGSCQEQQGA-SFV  306

Query  885   DVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQEL  1064
             DVLLS+PG NG++ +    IKA++ DM++A TDTS+V +EWAMAE+ + PR + K+++EL
Sbjct  307   DVLLSVPGANGEKQLSTTTIKAIMIDMLSAGTDTSSVISEWAMAELARHPREMAKVREEL  366

Query  1065  DEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRI  1244
             D  VG DR V E+D+++LNYL+ VV+E FR HP G FLIPH ST  T I GY IP  TRI
Sbjct  367   DAAVGVDRPVDESDVVNLNYLKAVVKEIFRLHPVGAFLIPHFSTEDTRIGGYDIPKNTRI  426

Query  1245  FINTHGLGRNPSVW-DDVDDFRPERHFPADG---GRVEISHGADFKILPFSAGKRKCPGA  1412
              +NT+ LGR+ SVW DDV  FRP+R   + G    ++     ++ +++PF AG+R CPGA
Sbjct  427   LVNTYSLGRSRSVWGDDVHLFRPDRFLASPGDLSSQIVELMDSECRVVPFGAGRRSCPGA  486

Query  1413  PLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPR  1574
              LG  +V+M LARL   FDWS P G   E+ID SE  G T+    PL  VA+PR
Sbjct  487   SLGSCMVVMGLARLIQRFDWSAPPG---EEIDVSERVGFTVLD-KPLELVAKPR  536



>ref|XP_001776045.1| predicted protein [Physcomitrella patens]
 gb|EDQ59090.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   414 bits (1063),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 296/468 (63%), Gaps = 10/468 (2%)
 Frame = +3

Query  204   LGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVH  383
             +G  PHR   A    YG ++ +RLG +  +  + P +I EI  +QD+VF+SRP       
Sbjct  1     MGSHPHRTMTALHKVYGHILNIRLGCIPTVVVDSPQLIAEITKEQDNVFSSRPHMTFTEI  60

Query  384   LAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGE  563
             LAY   D A+AP GP W+ +RRIC+  LLT KRLE+  K R EE+R ++ +V   A  GE
Sbjct  61    LAYDAHDFAMAPYGPHWRHVRRICVHELLTPKRLENTRKERIEESRCMIMEVAERANKGE  120

Query  564   TVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYV  743
              V+LR+VL   SM  + RMLLG++ F A   +G Q   +F +I HELF L+G +   D+V
Sbjct  121   VVDLRDVLAGVSMTVMCRMLLGRREFAA---TGKQPK-DFKHIIHELFRLMGALNPRDFV  176

Query  744   PLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR--KSKKEIDGEM-DFVDVLLSLPGEN  914
             P   W+D  G E+ M ++    D+    I++EHR  +S K   G+  DF+ VLL LPGE+
Sbjct  177   PALGWLDLQGFERDMYKLRGEFDEVLDAIIQEHRDLESGKLPGGKKNDFISVLLDLPGED  236

Query  915   GKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMV  1094
             G  H++D  IKA+  DM+A ATDTSAVTNEWAMAE+I+ P+I +K+Q+E+D VVG +R V
Sbjct  237   GAPHLDDKTIKAVTIDMMAGATDTSAVTNEWAMAEIIRNPQIQRKLQEEIDSVVGLERNV  296

Query  1095  SENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRN  1274
              E+D+ +  YL CVV+ETFR HPAGPF IP ES   TT+NGY IP  TR+ IN + LGR+
Sbjct  297   EESDVSNFPYLMCVVKETFRLHPAGPFAIPRESMADTTLNGYLIPKGTRVLINIYSLGRS  356

Query  1275  PSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
                W D   F+PER   A+     I H + F+ILPF  G+R+CPG  LG T+VL  LARL
Sbjct  357   SETWVDPLIFQPERW--ANENLTAI-HDSGFRILPFGNGRRQCPGYNLGTTMVLFTLARL  413

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
              H F+WS P G+  + ID  E+YG T P  T L A+A PRL  HLY  
Sbjct  414   LHGFNWSFPPGVTSDSIDMEELYGCTTPLRTRLRAIATPRLAPHLYSQ  461



>gb|ABR16821.1| unknown [Picea sitchensis]
Length=516

 Score =   401 bits (1030),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 206/518 (40%), Positives = 309/518 (60%), Gaps = 17/518 (3%)
 Frame = +3

Query  54    DYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFA  233
             + +T  S    L L F  +    V   K++ + RLPPGP  WP++G+L  LG +PH    
Sbjct  10    NSVTKLSLGQALGLAFLALGFFYVV--KQSLRKRLPPGPSGWPLIGSLPLLGNVPHHSLF  67

Query  234   AFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVAL  413
                 +YGP++YL+LG+ D +    P +    L   D  F++RP    A ++AY   D+  
Sbjct  68    QLSKQYGPIMYLKLGTTDTVVVTSPKVAEACLKVNDLNFSNRPGNAGATYMAYDSNDLVW  127

Query  414   APVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGA  593
             AP GP+W+ +R++C  HL   K L+     R  E   L++ +      G+ VNL E+L  
Sbjct  128   APYGPRWRMLRKVCNIHLFAGKALDDLQPVRETEVGMLLKSILDHERQGKAVNLGELLNV  187

Query  594   FSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
              + N + +++L K+ F   ES G + A EF  +  EL  L G+  +GD+VP   W+D  G
Sbjct  188   CTANVLGQIMLSKRVF---ESQGAK-ASEFREMVVELMVLAGVFNIGDFVPSLAWMDLQG  243

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSL----PGENGKEHMEDVE  941
              +KKM+++  R DDF  +ILEEH+ + +   G+ DF+ VLL+L     GE GK  + D +
Sbjct  244   VQKKMKKLHSRFDDFFGRILEEHKVAARNGGGKKDFLSVLLALRNDADGEGGK--LTDTD  301

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSD-RMVSENDLLHL  1118
             +KAL+ D+  A TDTSA T EWAM+E+I+ P+++KK QQE++  +G D R + E+D+  L
Sbjct  302   MKALLLDLFTAGTDTSASTVEWAMSELIRHPKMMKKCQQEVESAIGQDRRRLKESDIQKL  361

Query  1119  NYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVD  1298
              YL+ VV+ETFR HP+ P L+P  +  A  + GY+IP   R+ +NT G+ R+P VW+   
Sbjct  362   PYLQAVVKETFRLHPSTPLLLPRLAGEACEVEGYYIPKNARLLVNTWGIQRDPDVWERPL  421

Query  1299  DFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             +F P+R     G  V++  G DF+++PF AG+R C G  +G+ +V + LA L HSFDWS 
Sbjct  422   EFDPDRFV---GSTVDV-RGTDFQVIPFGAGRRICAGVSMGIRMVQLMLASLLHSFDWSL  477

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             PEG +PE++D +E YG+T+ KA PL AV   RL  HLY
Sbjct  478   PEGQQPENLDMAEAYGLTLQKAVPLLAVPAARLPHHLY  515



>ref|XP_002983090.1| hypothetical protein SELMODRAFT_155508, partial [Selaginella 
moellendorffii]
 gb|EFJ15899.1| hypothetical protein SELMODRAFT_155508, partial [Selaginella 
moellendorffii]
Length=481

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 207/489 (42%), Positives = 292/489 (60%), Gaps = 28/489 (6%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPIVGNLLQ   +PH    A   +YGPLV+L+LG V A+ T+DP+I++ IL  QD VFAS
Sbjct  3     WPIVGNLLQTSPIPHERMLAMNKRYGPLVFLKLGRVPAVVTDDPAIVKAILKNQDAVFAS  62

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RP ++A+ H  YG  D+A AP G  W+ MRRIC   LL  +RLE F + R EE   +   
Sbjct  63    RPASIASQHFTYGGNDIAFAPYGAHWRAMRRICTLELLAPRRLELFKQGREEEIALMARA  122

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLL  716
             V         V LR + G+ + NN+ RMLLGK+FFG    +GP++  E   + ++ F L+
Sbjct  123   VTDSITENNIVELRHLFGSLASNNLARMLLGKRFFGPG-VTGPRDGSEHRSLIYDAFALV  181

Query  717   GLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR--KSKKEIDGEM---DF  881
                 L DY+P  RW+D  G EKK++++  R D  +  ++EEHR  ++  E DG+     F
Sbjct  182   NAFNLADYLPFLRWLDVQGYEKKIKDIMNRTDRLYDAVIEEHRSKRTSAEKDGDSTTNKF  241

Query  882   VDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             VDVLL+  G      +    IKA++ DM AA TDT+++T+EW MAE+++ P +L K++ E
Sbjct  242   VDVLLTQKG------LSHTVIKAILVDMAAAGTDTTSITSEWTMAELVRHPAVLSKVRDE  295

Query  1062  LDEVVGS-DRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKT  1238
             ++ VVG   R V E+DL HL YLR VV+E  R HP G FLIPH + + T + GY IP  T
Sbjct  296   IERVVGGRHRAVRESDLKHLTYLRAVVKEVLRLHPVGAFLIPHVTVQDTELAGYFIPKNT  355

Query  1239  RIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRV----EISHGA-------DFKILPFS  1385
             R  INT+ LGRNP+VWD+  +FRPER    +        E+   A       +++++PF 
Sbjct  356   RALINTYSLGRNPAVWDNPLEFRPERFLGDEESTTRSDREVEAAASSSLFDPEYRMVPFG  415

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             AG+R CPGA LG  +++  ++ L H F+W+ P+G    +ID S  Y   +    PL  V 
Sbjct  416   AGRRGCPGAALGTCMIMYGVSTLVHGFEWATPDG---GEIDVSPAYNSVILD-KPLKLVP  471

Query  1566  RPRLQRHLY  1592
              PRL  H+Y
Sbjct  472   TPRLAEHVY  480



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   396 bits (1017),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/528 (40%), Positives = 307/528 (58%), Gaps = 30/528 (6%)
 Frame = +3

Query  30    LIKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLG  209
             +I  L M   IT+  F++ L+L          +T   N   RLPPGP  WPIVGNL  LG
Sbjct  3     IIMTLLMDTCITVLVFYVLLNL----------RTRHPN---RLPPGPTPWPIVGNLPHLG  49

Query  210   RLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLA  389
              LPH   AAF  KYGPL++LR G VD +  + P++  + L   D  FASRP    A H+A
Sbjct  50    PLPHHTLAAFAKKYGPLIHLRFGFVDVVVASSPTVASQFLRDNDLNFASRPPNSGAKHMA  109

Query  390   YGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETV  569
             Y   D+  AP GP+W  +R+IC +HL ++K L++F   R EE   L   +    E+  TV
Sbjct  110   YNYQDLVFAPYGPRWTMLRKICKDHLFSSKALDNFRHVREEEVAILTRILASAGES--TV  167

Query  570   NLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPL  749
              L ++L   + N + RM+L  + FG    SG  +A EF  +  EL  L G   +GD++P+
Sbjct  168   KLSQLLNVCTANTLARMMLDMRLFGDGNGSGDPKADEFKDMVVELMTLAGKFNIGDFIPM  227

Query  750   WRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENG  917
               W+D  G   KM++V  R D F   IL+EH+  K   D   D +  L+SL     GE G
Sbjct  228   LDWMDLQGVTTKMKKVHDRFDSFLDNILDEHKIRKGAHD---DMLSTLISLKEDVNGEGG  284

Query  918   KEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVS  1097
             K  + D+EIKAL+ ++ +A TDTS+ + EW MAE+I+ P++LK+ Q+E+D VVG DR+V+
Sbjct  285   K--LSDIEIKALLLNLFSAGTDTSSSSIEWTMAELIRNPQLLKQAQEEMDIVVGRDRLVT  342

Query  1098  ENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNP  1277
             E+DL  L +L  +V+E+FR HP+ P  +P  ++ +  +NGYHIP  + + +N   +GR+P
Sbjct  343   ESDLTQLTFLHAIVKESFRLHPSTPLSLPRIASESCEVNGYHIPKGSTLLVNIWAIGRHP  402

Query  1278  SVWDDVDDFRPERHFPAD---GGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALA  1448
              VW D  +FRP R  P     G  V+++   DF++LPF AG+R C G  L + +V + +A
Sbjct  403   EVWADPLEFRPARFLPGGEKPGVNVKVN---DFEVLPFGAGRRICAGMSLALKMVHLLIA  459

Query  1449  RLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              L  +FDW    GL PE ++  E +G+++ KA PL    RPRL  H Y
Sbjct  460   TLIQAFDWELANGLDPERLNMEEEFGISVQKAEPLMVHPRPRLAPHTY  507



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   395 bits (1015),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 198/485 (41%), Positives = 292/485 (60%), Gaps = 13/485 (3%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  WPI+GNLL LGR+PH   AA   KYGPL++LRLGSV  I     S+  +I   
Sbjct  32    LPPGPKPWPIIGNLLHLGRVPHHSLAALAKKYGPLMHLRLGSVHVIVAASSSVATQIFKT  91

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D  F+SRP    A H+AY   D+  AP GPKW+ +R+IC  HL + K L+ F   R EE
Sbjct  92    HDVNFSSRPPNSGAKHIAYNYQDLVFAPYGPKWRMLRKICSVHLFSAKALDDFRHIRQEE  151

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
                L+  ++   +     +L ++L   + N + R++LG++ FG  + SG +++ EF  + 
Sbjct  152   VLVLINALFQAGK--APTDLAKLLNVCTTNVLGRVMLGRRVFG--DGSGDEKSEEFKQMV  207

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM  875
              E+  L G+  +GD+VP   W+D  G   KM+++  R D+F  KILEEH++S  E DG +
Sbjct  208   VEMMVLAGVFNIGDFVPSLEWLDLQGVASKMKKLHNRFDEFLNKILEEHKESNGE-DGHV  266

Query  876   --DFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               D + VL+ L     GE GK  + D  IKAL+ D+  A TDTS+ T EWA+AE+I+ P+
Sbjct  267   HTDLLSVLIGLKDDAEGEGGK--LTDTNIKALLLDLFTAGTDTSSSTVEWAIAELIRNPK  324

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             +L + Q+EL++VVG DR+VSE+DL  L + + +++ETFR HP+ P  +P  ++ +  I+G
Sbjct  325   LLAQAQEELNQVVGRDRLVSESDLGQLTFFQAIIKETFRLHPSTPLSLPRMASESCEIDG  384

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             YHIP  + + +N   + R+P VW +  +F+P+R  P          G DF+++PF AG+R
Sbjct  385   YHIPKNSTLLVNVWAIARDPDVWSEPLEFKPDRFLPGGKNAHMDVKGTDFEVIPFGAGRR  444

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              C G  +G+ +V    A L H FDW  PEG   E ++  E YG+T+ +A PL    RPRL
Sbjct  445   ICAGMSMGMRMVQYVTATLVHGFDWEMPEGQMVEKLNMEESYGLTLQRAAPLVVHPRPRL  504

Query  1578  QRHLY  1592
               H+Y
Sbjct  505   APHVY  509



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   393 bits (1010),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 207/520 (40%), Positives = 305/520 (59%), Gaps = 20/520 (4%)
 Frame = +3

Query  60    ITLASFFL--CLS-LIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +T+ +F L  C++ L+F  + L  ++T   N   RLPPGP  WPIVGNL  LGR+PH   
Sbjct  1     MTILTFLLYTCITGLVFYALHLFNLRTPHRN---RLPPGPTPWPIVGNLPHLGRVPHHSL  57

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
             A    KYGPL++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+ 
Sbjct  58    ADLATKYGPLLHLRLGFVDVVVAGSASVAAQFLKVHDANFASRPPNSGAKHMAYNYQDMV  117

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
              AP GPKW+ +R+IC  HL +TK L+ F   R EE   L   + G  E+  TV L ++L 
Sbjct  118   FAPYGPKWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGES--TVKLGQLLN  175

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY  770
               + N + R++LG++ FG     G  ++ EF  +  E+  L G   +GD++P   W+D  
Sbjct  176   VCTTNALARVMLGRRVFGDGSGGGDSKSDEFKDMVMEMMVLAGEFNIGDFIPALDWLDLQ  235

Query  771   GCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDV  938
                KKM+++  R D F   ILEEH+       G MDFV  L+S+     G+ GK  + D 
Sbjct  236   SVTKKMKKLHVRFDSFLNTILEEHKS------GNMDFVSRLISVKDDADGQGGK--LSDT  287

Query  939   EIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHL  1118
             EIKAL+ ++ AA TDTS+ T EWA+AE+I+ P++LK+ Q+E+D +VG DR+V+E DL  L
Sbjct  288   EIKALLLNLFAAGTDTSSSTVEWAIAELIRHPQLLKQAQEEMDTIVGRDRLVTEVDLSRL  347

Query  1119  NYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVD  1298
              +L+ +V+E FR HP+ P  +P  ++    ++GY+IP  + + +N   + R+P +W +  
Sbjct  348   TFLQAIVKEIFRLHPSTPLSLPRIASDTCEVDGYYIPKGSTLLVNVWAISRDPKIWSNPL  407

Query  1299  DFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             +F+P R  P          G DF+++PF AG+R C G  LG+ +V +  A L H+FDW  
Sbjct  408   EFQPTRFLPGGEKPDADVKGNDFELIPFGAGRRICAGMSLGLKMVQLLTATLVHAFDWEL  467

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
               GL P+ ++  E YG+T+ +ATPL    RPRL  H+Y S
Sbjct  468   ANGLDPDKLNMEEAYGLTLQRATPLMVHPRPRLAPHVYQS  507



>ref|XP_002965839.1| hypothetical protein SELMODRAFT_230667 [Selaginella moellendorffii]
 gb|EFJ33259.1| hypothetical protein SELMODRAFT_230667 [Selaginella moellendorffii]
Length=468

 Score =   390 bits (1002),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 205/489 (42%), Positives = 290/489 (59%), Gaps = 41/489 (8%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPIVGNLLQ   +PH    A   +YGPLV+L+LG V A+ T+DP+I++ IL  QD VFAS
Sbjct  3     WPIVGNLLQTSPIPHERMLAMNKRYGPLVFLKLGRVPAVVTDDPAIVKAILKNQDAVFAS  62

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RP ++A+ H  YG  D+A AP G  W+ MRRIC   LL  +RLE F + R EE   +   
Sbjct  63    RPASIASQHFTYGGNDIAFAPYGAHWRAMRRICTLELLAPRRLELFKQGREEEIALMARA  122

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLL  716
             VW       T ++R+       NN+ RMLLGK+FFG    +GP++  E   + ++ F L+
Sbjct  123   VW-------TTSIRK------SNNLARMLLGKRFFGPG-VTGPRDGSEHRSLIYDAFALV  168

Query  717   GLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMD-----F  881
                 L DY+P  RW+D  G EKK++++  R D  +  ++EEHR+ +   + + D     F
Sbjct  169   NAFNLADYLPFLRWLDVQGYEKKIKDIMNRTDRLYDAVIEEHRRKRTSAEKDGDSTTNKF  228

Query  882   VDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             VDVLL+  G      +    IKA++ DM AA TDT+++T+EW MAE+++ P +L K++ E
Sbjct  229   VDVLLAQKG------LSHTVIKAILVDMAAAGTDTTSITSEWTMAELVRHPAVLSKVRDE  282

Query  1062  LDEVVGS-DRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKT  1238
             ++ VVG   R V E+DL HL YLR VV+E  R HP G FLIPH + + T + GY IP  T
Sbjct  283   IERVVGGRHRAVRESDLKHLTYLRAVVKEVLRLHPVGAFLIPHVTVQDTELAGYFIPKNT  342

Query  1239  RIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRV----EISHGA-------DFKILPFS  1385
             R  INT+ LGRNP+VWD+  +FRPER    +        E+   A       +++++PF 
Sbjct  343   RALINTYSLGRNPAVWDNPLEFRPERFLGDEESTTRSDREVEAAASSSLFDPEYRMVPFG  402

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             AG+R CPGA LG  +++  ++ L H F+W+ PEG    +ID S  Y   +    PL  V 
Sbjct  403   AGRRGCPGAALGTCMIMYGVSTLVHGFEWATPEG---REIDVSPAYNSVILD-KPLKLVP  458

Query  1566  RPRLQRHLY  1592
              PRL  H+Y
Sbjct  459   TPRLAEHVY  467



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   390 bits (1002),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 206/518 (40%), Positives = 300/518 (58%), Gaps = 17/518 (3%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             +TL  +     L+F ++QLL ++T   N   RLPPGP  WPIVGNL  +G  PH+  AA 
Sbjct  4     LTLLLYTCITGLVFYVLQLLNLRTPHPN---RLPPGPTPWPIVGNLPHIGTAPHQSLAAL  60

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
               KYGPL++LRLG VD +     S+  +I    D  F++RPR     H+AY   D+  AP
Sbjct  61    ATKYGPLMHLRLGFVDVVVAGSASVAAQIFKAHDVNFSNRPRVSGGKHIAYNYQDLVFAP  120

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              GPKW+ +R+IC  HL +TK L+ F   R EEA  L   + G  E+  TV L E++    
Sbjct  121   YGPKWRMLRKICSVHLFSTKALDDFRHVRQEEAAILAGTLAGAGES--TVKLGELVNVCI  178

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
              N + R++LG++ F      G  +A EF  +  EL  + G   +GD++P   W+D  G  
Sbjct  179   TNALARVVLGRRVFVDVSGDGDLKAKEFQDMVKELMVVAGEFNIGDFIPALDWLDLQGVA  238

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEIK  947
             K+M++V    D F   ILEEH+          DF+  LLSL     G+ GK    D+EIK
Sbjct  239   KRMKKVHDWFDSFLNTILEEHKSGSSG----GDFLSTLLSLKDDADGQGGK--FSDIEIK  292

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             AL+ ++ +A TDTS  T EWAMAE+I+ P++LK+ Q+E+D VVG DR+V+E DL  L YL
Sbjct  293   ALLLNLFSAGTDTSFSTVEWAMAELIRHPQLLKQAQEEMDTVVGRDRLVTEMDLSRLIYL  352

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             + +V+ETFR HP+ P  +P  +T +  +NGY+IP  + + +N   + R+P +W D  +FR
Sbjct  353   QAIVKETFRLHPSTPLSLPRMATESCEVNGYYIPKGSTLLVNVWAIARDPKMWTDPLEFR  412

Query  1308  PERHFPADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
               R  P  G + ++   G DF+++PF  G+R C G  LG+ +V + +A L H+FDW   +
Sbjct  413   ATRFLPG-GEKPDVDVKGNDFELIPFGGGRRICAGMNLGLKMVQLLIATLVHAFDWKLAD  471

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             GL PE ++  E  G+ + +  PL    +PRL  H Y S
Sbjct  472   GLDPEKLNMEEAPGLALHRVVPLMVHPKPRLAHHAYIS  509



>ref|XP_009401319.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   390 bits (1001),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 200/518 (39%), Positives = 311/518 (60%), Gaps = 14/518 (3%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             + L  + +C ++I  +I  L    G+   K+ LPPGP  WPI+GNL  +G LPHR   A 
Sbjct  1     MELPPWVMCSTIIL-VIVFLRALAGRRR-KLNLPPGPRAWPIIGNLNLIGSLPHRSLHAL  58

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
               KYGP++YLR GS   +  +   + +  L   D  F SRP+T A  +  Y   D+  +P
Sbjct  59    SQKYGPIMYLRFGSFPVVVGSSVEMAKFFLKTHDVSFVSRPKTAAGKYTTYNYSDITWSP  118

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              GP W++ R++C+  L + KRLES+   R EE R L+ D++    +G  V L++ L   S
Sbjct  119   YGPYWRQARKMCLLELFSAKRLESYEYIRVEEVRALLRDLF--RSSGGIVLLKDHLSTVS  176

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             +N ++RM+LGK++    E +      EF  +  ELF L G++ +GD +P    +D  G  
Sbjct  177   LNVISRMVLGKKYLDRTEVAAIVSPEEFKEMLDELFLLNGVMNIGDSIPWLDGLDLQGYI  236

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGE----MDFVDVLLSLPGE-NGKEHMEDVEI  944
             ++M+++ K+ D F   +L+EH + +++ +GE     D VDVLL L  + N    +E   +
Sbjct  237   RRMKKLSKKFDRFLEHVLDEHNE-RRQREGEGFVARDMVDVLLQLADDPNLDVKLERHGV  295

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KA  QD+IA  T++SAVT EWA++E++ RP +L+K  +ELD VVG  R V E D+  L Y
Sbjct  296   KAFTQDLIAGGTESSAVTVEWAISELLMRPEVLEKATEELDRVVGRGRWVEERDVSRLPY  355

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             +  +V+ET R HP  P L+P  S   TT++GY IPA  R+ ++   +GR+PSVWD  ++F
Sbjct  356   VEAIVKETMRLHPVAPMLVPRLSREHTTVDGYDIPAGARVLVSVWAIGRDPSVWDAPEEF  415

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
             RPER     G ++++  G DF++LPF AG+R CPG  LG+ ++ ++LA L H F+W  P 
Sbjct  416   RPERFV---GSQIDVK-GHDFELLPFGAGRRMCPGYSLGLKVIQLSLANLLHGFEWRLPA  471

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             G++ E++   E++G++ P+  PL  V +P+L  HLYG+
Sbjct  472   GMKAEELSMEEIFGLSTPRKVPLEVVVKPKLSAHLYGA  509



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   389 bits (1000),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 206/513 (40%), Positives = 303/513 (59%), Gaps = 14/513 (3%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
              +LC++ +   + L+ ++T + N   RLPPGP  WPIVGNL  LG +PH   A    +YG
Sbjct  8     IYLCITGVTAYV-LVNLRTRRAN---RLPPGPTPWPIVGNLPHLGTIPHHSLADLATRYG  63

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PL++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  AP GP+W
Sbjct  64    PLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGPRW  123

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             + +R+IC  HL + K L+ F   R EE   L   + G  ++  TV L ++L   + N + 
Sbjct  124   RMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVGAGKS--TVKLGQLLHVCTTNALV  181

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             R++LG++ FG     G  +A EF  +  E+  L G   LGD++P+   +D  G  KKM++
Sbjct  182   RVMLGRRVFGDGSGGGDPKADEFKNMVIEMMVLAGEFNLGDFIPVLDLLDLQGVTKKMKK  241

Query  795   VEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEIKALIQD  962
             +  R D F   ILEEHR S     G +D +  L+SL     GE GK  + D EIKAL+ +
Sbjct  242   LHTRFDSFLNSILEEHRTSSGGASGHVDLLSTLISLKDEADGEGGK--LTDTEIKALLLN  299

Query  963   MIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVR  1142
             +  A TDTS+ T EWA+AE+I+ P++LK+ QQELD VVG  R+V+E+DL  L +L+ +V+
Sbjct  300   LFVAGTDTSSSTVEWAIAELIRNPQLLKQAQQELDTVVGQGRLVNESDLSQLTFLQAIVK  359

Query  1143  ETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHF  1322
             ETFR HP+ P  +P  ++ +  INGY+IP  + + +N   + R+P +W +  +FRP R  
Sbjct  360   ETFRLHPSTPLSLPRIASESCEINGYNIPKGSTLLVNVWAIARDPKMWTEPLEFRPSRFL  419

Query  1323  PADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPE  1499
             P DG +      G DF+++PF AG+R C G  LG+ +V +  A L  +FDW    GL P 
Sbjct  420   P-DGEKPNADVKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTATLIQAFDWELANGLEPR  478

Query  1500  DIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             +++  E YG+T+ +A PL    RPRL  H+YG+
Sbjct  479   NLNMEEAYGLTLQRAQPLMVHPRPRLAPHVYGT  511



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   388 bits (996),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 201/486 (41%), Positives = 286/486 (59%), Gaps = 8/486 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPI+GNL  LGR+PH   AA   KYGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPTPWPIIGNLPHLGRIPHHALAAMATKYGPLMHLRLGVVDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A H+AY   D+  AP GPKW+ +R+IC  HL + K L+ F   R E
Sbjct  90    VHDANFASRPPNSGAKHIAYDYQDLVFAPYGPKWRMLRKICSVHLFSNKALDDFRHVREE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G   +  TV L ++L   + N + R++LG++ FG        +A EF  +
Sbjct  150   EVAILARALAGAGRS--TVALGQLLNVCTTNALARVMLGRRVFGDGSGGVDPKADEFKDM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               EL  L G   +GD++P   W+D     KKM+++  R D F   +LE+H+     + G 
Sbjct  208   VVELMVLAGEFNIGDFIPALDWLDLQSVTKKMKKLHLRFDSFLNTVLEDHKNGGDVVSGN  267

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
             +D +  L+SL     GE GK  + D+EIKAL+ ++ AA TDTS+ T EWAMAE+I+ P++
Sbjct  268   VDLLSTLISLKDDADGEGGK--LSDIEIKALLLNLFAAGTDTSSSTVEWAMAELIRHPQL  325

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             +K+ Q+E+D VVG DR+VSE DL  L +L  +V+ETFR HP+ P  +P  ++ +  +NGY
Sbjct  326   MKQAQEEMDIVVGRDRLVSELDLSRLTFLEAIVKETFRLHPSTPLSLPRIASESCEVNGY  385

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  + + +N   + R+P +W D  +FRP R  P          G DF+I+PF AG+R 
Sbjct  386   YIPKGSTLLVNVWAIARDPKMWTDPLEFRPSRFLPGGEKPNANVKGNDFEIIPFGAGRRI  445

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V + +A L H+FDW    GL PE ++  E YG+T+ +A PL     PRL 
Sbjct  446   CAGMSLGLRMVQLLIASLVHAFDWELANGLDPEKLNMEEAYGLTLQRAAPLMVHPSPRLA  505

Query  1581  RHLYGS  1598
              HLY S
Sbjct  506   PHLYKS  511



>ref|XP_011046010.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   387 bits (993),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/519 (38%), Positives = 307/519 (59%), Gaps = 13/519 (3%)
 Frame = +3

Query  51    IDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDF  230
             +D  +L  F   L+ +F ++ L  V     N  + LPPGP  WPI+GN   LG LPH+  
Sbjct  1     MDAFSLVVF--VLAWVFALLYLPKVFKSWRN-PLNLPPGPKPWPIIGNFDLLGPLPHQSL  57

Query  231   AAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVA  410
                  KYG  + L+ GS     T+   I ++IL   D +FASRP+T A  +  Y   D+A
Sbjct  58    HQLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFASRPQTAAGKYTTYEYSDLA  117

Query  411   LAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLG  590
              AP GP W++ R+I +  L + KRLES+   R EE R     ++     G+++ L++ L 
Sbjct  118   WAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRRLY--RNCGKSIELKDYLS  175

Query  591   AFSMNNVTRMLLGKQFFGADESSGPQEAME-FMYITHELFHLLGLIYLGDYVPLWRWIDP  767
              ++++ ++R++LGK++F A ES      +E F  +  ELF L G++ +GD++P   ++D 
Sbjct  176   HYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLLNGVLNIGDWIPWLDFLDL  235

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPGENGKE-HMEDV  938
              G  K+M+E++ R D FH  +++EH   +K        D VD+LL L  +   E  +   
Sbjct  236   QGYVKRMKELKVRFDRFHDHVIDEHNAKRKATKNWQPKDMVDLLLQLADDPELEVKLTRD  295

Query  939   EIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHL  1118
              IK L QD+IA  TDT+A   +W+M+E++K+P++ K++  ELD V+G DR V E D+  L
Sbjct  296   NIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDELDRVIGRDRWVEEKDIPQL  355

Query  1119  NYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVD  1298
              Y+  +++E  R HP+   L PH + + + + GY IP  TRIFINT  +GR+P +W+D +
Sbjct  356   PYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRIFINTWSMGRDPDLWEDPE  415

Query  1299  DFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             DFRPER F   G  ++I  G +F++LPF +G+R CPG PLG  ++L++LA + H F W  
Sbjct  416   DFRPERFF---GKGIDIK-GHNFELLPFGSGRRMCPGYPLGTKMILVSLANMLHGFTWEL  471

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             P G++PED+   EV+G+   +  P  AVA+PRL  HLY 
Sbjct  472   PPGMKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_010917481.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=511

 Score =   386 bits (992),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 198/509 (39%), Positives = 306/509 (60%), Gaps = 17/509 (3%)
 Frame = +3

Query  90    SLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYL  269
             +++  I+ LL    G+   K+ LPPGP  WPI+GNL  +  LPHR   A   KYGPL++L
Sbjct  12    AILASILFLLRSLFGRRRRKLNLPPGPKPWPIIGNLNLISSLPHRSLHALSQKYGPLMHL  71

Query  270   RLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRR  449
               GS   I      + + +L   D  F  RP+T A  +  Y   D+  +  GP W++ R+
Sbjct  72    YFGSFPVIVAASVDVAKLVLKTHDVTFCGRPKTAAGKYTTYNYSDITWSQYGPYWRQARK  131

Query  450   ICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLG  629
             +C+  L + KRL+S+   R EE ++L+ D++  A  G +VNL++ L   S+N ++RM+LG
Sbjct  132   MCIMELFSAKRLDSYEYIRVEEVKNLLRDLFNSA--GRSVNLKDHLSNVSLNVISRMVLG  189

Query  630   KQFFGADESS--GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEK  803
             K++    E +   P+E   F  +  ELF L G++ +GD +P   ++D  G  K+M++V K
Sbjct  190   KKYLVKSEGAIVSPEE---FKAMLDELFLLNGVMNIGDSIPWLGFLDLQGYIKRMKKVGK  246

Query  804   RVDDFHMKILEEHRKSKKEIDGE----MDFVDVLLSLPGENGKE-HMEDVEIKALIQDMI  968
             + D F   +L+EH + ++  +GE    MD VDVLL L  +   E  +E   +KA  QD+I
Sbjct  247   KFDRFLEHVLDEHNERRRR-EGENFVAMDMVDVLLQLADDPSLEVKLERHGVKAFTQDLI  305

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
             A  T++SAVT EWA++E++KRP I KK  +ELD V+G +R V E ++ +L Y+  +V+ET
Sbjct  306   AGGTESSAVTVEWAISELLKRPEIFKKATEELDRVIGRERWVEEKEVHNLPYIEAIVKET  365

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
              R HP  P L+P  S     I GY I A TR+ +N   +GR+P++WD  ++FRPER    
Sbjct  366   MRMHPVAPLLVPRMSREDCNIAGYDILAGTRVLVNVWTIGRDPTIWDSPEEFRPERFI--  423

Query  1329  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDID  1508
              G  +++  G DF++LPF +G+R CPG  LG+ ++ ++LA L H F W  P+G++ ED+ 
Sbjct  424   -GSNIDVK-GQDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGMKVEDLS  481

Query  1509  TSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
               E++G++ PK  PL  V +P+L  HLYG
Sbjct  482   MEEIFGLSTPKKVPLEVVVQPKLPAHLYG  510



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   385 bits (989),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/510 (39%), Positives = 296/510 (58%), Gaps = 12/510 (2%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
             + C+SL+  II L+ +   +     RLPPGP  WP+VGNL  LG +PH   AA   KYGP
Sbjct  9     YFCISLLV-IIALVNMFITRHTN--RLPPGPAPWPVVGNLPHLGAIPHHTLAALATKYGP  65

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             LVYLRLG V  +  + PS+  + L   D  FASRP    A H+AY   D+  AP GP+W 
Sbjct  66    LVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPNSGAKHIAYNYQDMVFAPYGPQWT  125

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNVT  614
               R+IC +HL ++K L+ F   R EE   L     G+A  G + VNL + L   + N + 
Sbjct  126   MFRKICKDHLFSSKALDDFRHVRQEEVAILAR---GLAGAGRSKVNLGQQLNMCTANTLA  182

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             RM+L K+ FG +      +A EF  +  EL  L G   +GDY+P+  W+D  G  KKM++
Sbjct  183   RMMLDKRVFGNESGGDDPKANEFKEMATELMFLAGQFNIGDYIPVLDWLDLQGIVKKMKK  242

Query  795   VEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHME--DVEIKALIQDMI  968
             +  R D F   IL+EH   K    G +D +  L+SL  +   +  +  D+EIKAL+ ++ 
Sbjct  243   LHTRFDKFLDVILDEH---KVIASGHIDMLSTLISLKDDTSVDGRKPSDIEIKALLLELF  299

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
              A TDTS+ T EWA+AE+I++P +LK+ Q+E+D VVG +R+V+E DL  L +L+ +V+E 
Sbjct  300   VAGTDTSSNTVEWAIAELIRQPHLLKRAQEEMDSVVGQNRLVTEMDLSQLTFLQAIVKEA  359

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
             FR HP+ P  +P  ++ +  ++GY+IP  + + +N   +GR+P VW D  +FRP R  P 
Sbjct  360   FRLHPSTPLSLPRIASESCEVDGYYIPKGSTLLVNIWAIGRHPEVWTDPLEFRPTRFLPG  419

Query  1329  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDID  1508
                   +    DF++LPF AG+R C G  L +  V + +  L  +FDW    G++PE ++
Sbjct  420   GEKPGIVVKVNDFEVLPFGAGRRICAGMSLALRTVQLLMGTLVQAFDWELANGIKPEKLN  479

Query  1509  TSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
               E +G+++ +A PL    RPRL  H+Y S
Sbjct  480   MDEAFGLSVQRAEPLVVHPRPRLPPHVYKS  509



>ref|NP_001147572.1| flavonoid 3-monooxygenase [Zea mays]
 gb|ACG27961.1| flavonoid 3-monooxygenase [Zea mays]
 tpg|DAA40166.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=519

 Score =   384 bits (987),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 309/518 (60%), Gaps = 16/518 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKM-RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             ASF   L ++   + LL   TG+ + +M  LPPGP  WPI+GNL  +G LPHR       
Sbjct  7     ASF---LGIVLATVMLLKALTGRRSRRMYNLPPGPKPWPIIGNLDLVGALPHRSIHELSR  63

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
             KYGPL+ LR GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P G
Sbjct  64    KYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPYG  123

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
               W++ R++C+  L + KRLES+   RA+E R L+ D+   + +G  V L++ L   S+N
Sbjct  124   AYWRQARKMCLTELFSAKRLESYEYIRADEVRALLRDLHAASSSGRAVMLKDYLSTVSLN  183

Query  606   NVTRMLLGKQFFGADESSGPQEAM----EFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
              +TRM+LGK++   +E++    ++    EF ++  ELF L G++ +GD +P   W+D  G
Sbjct  184   VITRMVLGKKYLDKEEAAAAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQG  243

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSK-KEIDG--EMDFVDVLLSLPGENGKEHMEDVE-  941
               K+M+++ K  D F   ++EEH + + +E  G    D VDVLL +  +   E   D E 
Sbjct  244   YIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELDRES  303

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             +KA  QD+IA  T++SAVT EWA++E++K+P ++ K  +ELD V+G  R V+E D+  L 
Sbjct  304   VKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLP  363

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             Y+  +V+ET R HP  P L+P  +   TT+ GY IPA TR+ ++   +GR+P++WD  ++
Sbjct  364   YVDAIVKETMRLHPVAPLLVPRLAREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEE  423

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER     G ++++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS P
Sbjct  424   FMPERFL---GSKLDV-KGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLP  479

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +G+  E+    E++G++ P+  PL AV  P+L  HLY 
Sbjct  480   DGVTKEEFSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_001751225.1| predicted protein [Physcomitrella patens]
 gb|EDQ83542.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   383 bits (984),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/491 (40%), Positives = 291/491 (59%), Gaps = 10/491 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             +++LPP PP +PI+G+L  LG+LPH+       KYG +  LRLGSV AI  + P + +E 
Sbjct  13    RLKLPPSPPAYPIIGHLHLLGKLPHQSMTNLAKKYGEIYSLRLGSVPAIVISTPEMAKEF  72

Query  327   LLQQDDVFASRP-RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKH  503
             LL  D +++SR     +  + +Y    +A AP  P W+ +R+ICM  L T +RLE+    
Sbjct  73    LLTNDKIWSSRSVHMTSGYYFSYDYAGIAFAPSTPVWRSLRKICMSELFTQRRLEASKGL  132

Query  504   RAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAM  677
             R EE ++++  +   A  G  ++L+  + A + N V RM+L K+F G  +S+     EA 
Sbjct  133   REEEMQYMIRSILDDAHQGRLIDLKLKINALTANIVARMVLNKRFTGCIDSTVETEAEAH  192

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH--RKS  851
             +F  +  E F LLG+  +GDY+P    +D  G EK+M+ + KR+D F   ILE H  +++
Sbjct  193   QFKEMMEEHFLLLGVFMIGDYIPWLSPLDLGGTEKRMKSLRKRLDAFLDDILEVHEVKRA  252

Query  852   KKEIDGE-MDFVDVLLS---LPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAE  1019
             K  I  E  D +DVLL+       N  + ++   +K+ I ++ A  TDTS VT EWAM+E
Sbjct  253   KGPIPEEDQDVIDVLLNEMYQQDSNESKQLDTNNVKSTILNLFAGGTDTSTVTIEWAMSE  312

Query  1020  VIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTR  1199
             +++ P I+ K++ ELD  +G DR V E DL  L YL+ V +ETFR HP GP LIPH ST 
Sbjct  313   MLRNPTIMGKLKAELDARIGKDRRVRETDLSDLPYLQAVTKETFRLHPVGPLLIPHVSTH  372

Query  1200  ATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILP  1379
                + GYHIP  TR+++N + +GRNP VWD   +F PER        V++  G  F +LP
Sbjct  373   DCEVGGYHIPTGTRLYVNVYAIGRNPKVWDRPLEFDPERFMTGLNAGVDVK-GKHFHLLP  431

Query  1380  FSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFA  1559
             F  G+R CP  PLG+ +V   LA L H+ D S P+ + P+D+D +E YG+T+P+A  L+ 
Sbjct  432   FGTGRRGCPALPLGLLIVQWTLATLVHALDLSLPQSMEPKDVDMTEAYGLTVPRAQSLYL  491

Query  1560  VARPRLQRHLY  1592
              A+ R   HLY
Sbjct  492   NAKLRAADHLY  502



>gb|EAZ09259.1| hypothetical protein OsI_31532 [Oryza sativa Indica Group]
Length=514

 Score =   384 bits (985),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/515 (38%), Positives = 299/515 (58%), Gaps = 15/515 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
             ASF   ++++   +  L    G+      LPPGP  WP++GNL  +G LPHR       K
Sbjct  9     ASF---VAVVLATVLFLKTVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKK  65

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGPL+YLR GS   +  +   + +  L   D VF  RP+T A  H  Y   D+  +P G 
Sbjct  66    YGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGA  125

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
              W++ R++C+  L + KRLES+   R EE R L+ D+ G A  G  V L++ L   S+N 
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAA--GGVVVLKDYLSTVSLNV  183

Query  609   VTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKM  788
             +TRM+LGK++   D         EF ++  ELF L G++ +GD +P   W+D  G  K+M
Sbjct  184   ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRM  243

Query  789   REVEKRVDDFHMKILEEHRKSKKEIDGEM----DFVDVLLSLPGE-NGKEHMEDVEIKAL  953
             +++ K  D F   +++EH + ++  +GE     D VDVLL      N +  ++   +KA 
Sbjct  244   KKLGKMFDRFLEHVVDEHNERRRR-EGESFVAKDMVDVLLQFADNPNLEVKLKREGVKAF  302

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
              QD+IA  T++SAVT EWA++E++K+P +  K  +ELD VVG  R V+E D+  L Y+  
Sbjct  303   TQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLTYVDA  362

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +V+ET R HP  P L+P  S   T+++GY IPA TR+ ++   +GR+P +WD  ++F PE
Sbjct  363   IVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEEFMPE  422

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R     G ++++  G DF++LPF +G+R CPG  LG+ ++ ++LA L H F W  P+G+ 
Sbjct  423   RFI---GNKIDVK-GQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVT  478

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
              E +   E++G++ P+  PL AV  P+L  HLY +
Sbjct  479   REQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLYAA  513



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   383 bits (984),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 207/526 (39%), Positives = 305/526 (58%), Gaps = 22/526 (4%)
 Frame = +3

Query  33    IKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGR  212
             + +L ++ Y ++ S  L L        LL ++T   N   RLPPGP  WPIVGNL  LG 
Sbjct  1     MSILTLLLYTSITSPVLYL--------LLNLRTRHPN---RLPPGPTPWPIVGNLPHLGT  49

Query  213   LPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAY  392
             +PH   A    KYGPL++LRLG VD +     S+  + L   D +FASRP    A H+AY
Sbjct  50    IPHHSLARLAVKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAY  109

Query  393   GCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVN  572
                D+  AP GP+W+ +R+IC  HL + K L+ F   R EE   L   + G  E+  TV 
Sbjct  110   NYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGES--TVK  167

Query  573   LREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLW  752
             L ++L   + N + R++LG++ FG    +G  +A EF  +  +L  L G   +GD++P  
Sbjct  168   LGQLLNVCTTNALARVMLGRRVFG---DTGDLKADEFKDMVVQLMVLAGEFNIGDFIPAL  224

Query  753   RWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGK  920
              W+D  G  KKM+++  + D F   ILEEH+       G  D +  L++L     GE GK
Sbjct  225   DWLDMQGITKKMKKLHAQFDSFLNAILEEHKSRHGRTSGHGDLLSTLIALKDDADGEGGK  284

Query  921   EHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSE  1100
               + D+EIKAL+ ++  A TDTS+ T EWA+AE+I+ PR+LK+ Q+E+D VVG DR+VSE
Sbjct  285   --LSDIEIKALLLNLFVAGTDTSSSTVEWAIAELIRHPRMLKQAQEEMDNVVGRDRLVSE  342

Query  1101  NDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPS  1280
             +DL  L +L+ +V+ETFR HP+ P  +P  S+    ++GYHIP  + + +N   + R+P 
Sbjct  343   SDLSQLPFLQAIVKETFRLHPSTPLSLPRISSENCEVDGYHIPKGSTLLVNVWAIARDPK  402

Query  1281  VWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH  1460
             +W D  +FRP R  P          G DF+++PF AG+R C G  LG+ +V + +A L  
Sbjct  403   MWADPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVATLVQ  462

Query  1461  SFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             +FDW    GL+PE ++ +E YG+T+ +  PL    +PRL  H+Y S
Sbjct  463   TFDWELANGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVYES  508



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   383 bits (984),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 195/481 (41%), Positives = 280/481 (58%), Gaps = 6/481 (1%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             L PGP  WPIVGNL  LG +PH   AA   +YGPL++LRLG VD I     S+  + L  
Sbjct  29    LAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGPLMHLRLGFVDVIVAASASVASQFLKT  88

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D  F+SRP    A HLAY   D+  AP GP+W+ +R+I   HL + K L+     R EE
Sbjct  89    HDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWRMLRKISSVHLFSGKALDDLRHVRQEE  148

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
                L   + G     +TVNL ++L   ++N + R+++GK+ F     SG  +A EF  + 
Sbjct  149   VAVLAHSLAGAGS--KTVNLAQLLNICTVNALGRVMVGKKLFADGSGSGDAKADEFKEMV  206

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM  875
              E+  L G+  +GD++P   W+D  G   KM+++ K  D F   I+E+H+KS       +
Sbjct  207   VEMMVLAGVFNIGDFIPALEWLDLQGVAAKMKKLHKSFDAFLTAIVEDHKKSSG--GKHV  264

Query  876   DFVDVLLSLPGENGKE--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKK  1049
             D +  LLSL  +   E   + D EIKAL+ +M  A TDTS+ T EWA+AE+++ P+IL +
Sbjct  265   DMLTTLLSLKEDADGEGAQLTDTEIKALLLNMFTAGTDTSSSTVEWAIAELLRHPKILAQ  324

Query  1050  IQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIP  1229
             +QQELD+V G DR+V+E DL +L YL+ V++ETFR HP+ P  +P  ++    ING+HIP
Sbjct  325   VQQELDQVAGRDRLVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASENCEINGFHIP  384

Query  1230  AKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPG  1409
                 + +N   + R+P  W D  +FRPER  P          G DF+++PF AG+R C G
Sbjct  385   KGATLLVNVWAISRDPEQWKDPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAG  444

Query  1410  APLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHL  1589
               LG+ +V +  A L H+FDW+  +GL PE ++  E YG+T+ +A PL    R RL  H 
Sbjct  445   MSLGLRMVHLMAATLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHA  504

Query  1590  Y  1592
             Y
Sbjct  505   Y  505



>ref|XP_010273844.1| PREDICTED: cytochrome P450 71A1-like [Nelumbo nucifera]
Length=509

 Score =   382 bits (982),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 193/489 (39%), Positives = 295/489 (60%), Gaps = 14/489 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             +  LPPGP  WPI+GNL  +G LPHR       KYGP++ LR GS   +  +   + ++ 
Sbjct  30    RANLPPGPKPWPIIGNLNLIGPLPHRSIHELSKKYGPIMQLRFGSRPIVVGSSVEMAKQF  89

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  FASRP+  A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R
Sbjct  90    LKIHDITFASRPKMAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSVKRLESYEYIR  149

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
              EE R +++ ++  A +G+ + L++ L   S+N ++RM+LGK++    E+S      EF 
Sbjct  150   VEELRAVLKGLY--ASSGKPIVLKDHLSTLSLNVISRMVLGKKYTDESETSIVTPG-EFK  206

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
              +  ELF L G++ +GDY+P   ++D  G  K+M+ + K+ D F   +++EH   ++ ++
Sbjct  207   KMLDELFLLNGVVNIGDYIPWIDFLDLQGYVKRMKILSKKFDKFLEHVIDEHNARRQGVE  266

Query  867   GEM--DFVDVLLSL---PGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKR  1031
             G +  D VDVLL L   P    K H E V  K   QD+IA  T++SAVT EWA++E++KR
Sbjct  267   GYVAKDMVDVLLQLADDPTLEVKLHREGV--KGFTQDLIAGGTESSAVTVEWAISELLKR  324

Query  1032  PRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTI  1211
             P + KK  +ELD V+G +R V E D+  L Y++ +V+ET R HP  P L+P  S     I
Sbjct  325   PEMFKKATEELDRVIGRERWVEEKDIPQLPYIQAIVKETMRMHPVAPMLVPRFSREDCEI  384

Query  1212  NGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAG  1391
              GY IPA T +F+NT  +GR+P++WD  D+FRP+R      GR     G DF++LPF +G
Sbjct  385   AGYDIPAGTEVFVNTWTIGRDPTLWDAPDEFRPDRFI----GRDIDVKGQDFELLPFGSG  440

Query  1392  KRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARP  1571
             +R CPG  LG+ ++  +LA L   F W+ P+ ++PE+++  E++G++ PK  PL AV  P
Sbjct  441   RRMCPGYSLGLKVIQASLANLLQGFTWNLPDKMKPENLNMEEIFGLSTPKKIPLVAVVEP  500

Query  1572  RLQRHLYGS  1598
             RL  H+YG 
Sbjct  501   RLPTHVYGQ  509



>ref|NP_001063285.1| Os09g0441400 [Oryza sativa Japonica Group]
 dbj|BAD36161.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAD38066.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF25199.1| Os09g0441400 [Oryza sativa Japonica Group]
Length=514

 Score =   382 bits (982),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 194/515 (38%), Positives = 298/515 (58%), Gaps = 15/515 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
             ASF   + ++   +  L    G+      LPPGP  WP++GNL  +G LPHR       K
Sbjct  9     ASF---VGVVLATVLFLKAVLGRSRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHNLSKK  65

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGPL+YLR GS   +  +   + +  L   D VF  RP+T A  H  Y   D+  +P G 
Sbjct  66    YGPLMYLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKHTTYNYSDITWSPYGA  125

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
              W++ R++C+  L + KRLES+   R EE R L+ D+ G A  G  V L++ L   S+N 
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRGEEVRALLRDLHGAA--GGVVVLKDYLSTVSLNV  183

Query  609   VTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKM  788
             +TRM+LGK++   D         EF ++  ELF L G++ +GD +P   W+D  G  K+M
Sbjct  184   ITRMVLGKKYLDKDAGGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYIKRM  243

Query  789   REVEKRVDDFHMKILEEHRKSKKEIDGEM----DFVDVLLSLPGE-NGKEHMEDVEIKAL  953
             +++ K  D F   +++EH + ++  +GE     D VDVLL      N +  ++   +KA 
Sbjct  244   KKLGKMFDRFLEHVVDEHNERRRR-EGESFVAKDMVDVLLQFADNPNLEVKLKREGVKAF  302

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
              QD+IA  T++SAVT EWA++E++K+P +  K  +ELD VVG  R V+E D+  L Y+  
Sbjct  303   TQDLIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDVPSLTYVDA  362

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +V+ET R HP  P L+P  S   T+++GY IPA TR+ ++   +GR+P +WD  ++F PE
Sbjct  363   IVKETMRLHPVAPMLVPRLSREDTSVDGYDIPAGTRVLVSVWTIGRDPKLWDAPEEFMPE  422

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R     G ++++  G DF++LPF +G+R CPG  LG+ ++ ++LA L H F W  P+G+ 
Sbjct  423   RFI---GNKIDVK-GQDFELLPFGSGRRMCPGYSLGLKVIQLSLANLLHGFAWRLPDGVT  478

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
              E +   E++G++ P+  PL AV  P+L  HLY +
Sbjct  479   REQLSMEEIFGLSTPRKFPLEAVVEPKLPAHLYAA  513



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   382 bits (981),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 202/524 (39%), Positives = 301/524 (57%), Gaps = 14/524 (3%)
 Frame = +3

Query  42    LKMIDYITLASFFLCLSL-IFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLP  218
             ++MI+   L  +    SL I+ I++LL     +EN +  LPPGP  WPI+GNL  LG  P
Sbjct  1     MEMINDSPLVVYTAIFSLLIYAILKLL----RRENRRPSLPPGPKPWPIIGNLPHLGTKP  56

Query  219   HRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGC  398
             H+  AA    YGPL++L+LG VD +     S+  + L + D  F++RP    A H+AY  
Sbjct  57    HQTLAAMAKTYGPLMHLKLGFVDVVVAASASVAEQFLKKHDANFSNRPPNSGAKHIAYNY  116

Query  399   GDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLR  578
              D+  AP GP+W+ +R+IC  HL + K L+ F   R EE   L   +    EN   +NL 
Sbjct  117   QDLVFAPYGPRWRLLRKICSVHLFSAKALDDFQHVRQEEVGILTRSIASAGEN--PINLG  174

Query  579   EVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRW  758
             ++LG  + N + R++LG++ FG        +A EF  +  E+  L G   LGD++P   W
Sbjct  175   QLLGVCTTNALARVMLGRRVFGDGSGGVDPQADEFKSMVVEIMVLAGAFNLGDFIPALDW  234

Query  759   IDPYGCEKKMREVEKRVDDFHMKILEEHRKS-KKEIDGEMDFVDVLLSLP-----GENGK  920
              D  G   KM++V  R D F   ILEEH+ +  +     +D + +L+SL      GE+G 
Sbjct  235   FDLQGITAKMKKVHARFDAFLDAILEEHKSNGSRGAKQHVDLLSMLISLQDNNIDGESGA  294

Query  921   EHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSE  1100
             + + D EIKAL+ ++  A TDTS+ T EWA+AE+I+ P +L + QQELD VVG  R+V+E
Sbjct  295   K-LTDTEIKALLLNLFTAGTDTSSSTVEWAIAELIRNPEVLVQAQQELDRVVGPSRLVTE  353

Query  1101  NDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPS  1280
             +DL  L +L+ V++ETFR HP+ P  +P  ++    INGY IP  + + +N   + R+PS
Sbjct  354   SDLPQLAFLQAVIKETFRLHPSTPLSLPRMASEGCEINGYSIPKGSTLLVNVWSIARDPS  413

Query  1281  VWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH  1460
             +W D  +FRP R  P          G DF+++PF AG+R C G  LG+ +V +  A L H
Sbjct  414   IWADPLEFRPSRFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVH  473

Query  1461  SFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             SF+W    G+ P+ +D  E YG+T+ +A+PL    +PRL   +Y
Sbjct  474   SFNWDLLNGMSPDKLDMEEAYGLTLQRASPLIVHPKPRLASSMY  517



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   382 bits (980),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 206/526 (39%), Positives = 304/526 (58%), Gaps = 22/526 (4%)
 Frame = +3

Query  33    IKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGR  212
             + +L ++ Y ++ S  L L        LL ++T   N   RLPPGP  WPIVGNL  LG 
Sbjct  1     MAILTLLLYTSITSPVLYL--------LLNLRTRHPN---RLPPGPTPWPIVGNLPHLGT  49

Query  213   LPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAY  392
             +PH   A    KYGPL++LRLG VD +     S+  + L   D +FASRP    A H+AY
Sbjct  50    IPHHSLARLAVKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAY  109

Query  393   GCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVN  572
                D+  AP GP+W+ +R+IC  HL + K L+ F   R EE   L   + G  E+  TV 
Sbjct  110   NYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGES--TVK  167

Query  573   LREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLW  752
             L ++L   + N + R++LG++ FG    +G  +A EF  +  +L  L G   +GD++P  
Sbjct  168   LGQLLNVCTTNALARVMLGRRVFG---DTGDLKADEFKDMVVQLMVLAGEFNIGDFIPAL  224

Query  753   RWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGK  920
              W+D  G  KKM+++  + D F   ILEEH+       G  D +  L++L     GE GK
Sbjct  225   DWLDMQGIAKKMKKLHAQFDSFLNAILEEHKSGNGRTSGHGDLLSTLIALKDDADGEGGK  284

Query  921   EHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSE  1100
               + D+EIKAL+ ++  A TDTS+ T EWA+AE+I+ PR+LK+ Q+E+D VVG DR+VSE
Sbjct  285   --LSDIEIKALLLNLFVAGTDTSSSTVEWAIAELIRHPRMLKQAQEEMDNVVGRDRLVSE  342

Query  1101  NDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPS  1280
             +DL  L +L+ +V+ETFR HP+ P  +P  S+    ++GYHIP  + + +N   + R+P 
Sbjct  343   SDLSQLPFLQAIVKETFRLHPSTPLSLPRISSENCEVDGYHIPKGSTLLVNVWAIARDPK  402

Query  1281  VWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH  1460
             +W D  +FRP R  P          G DF+++PF AG+R C G  LG+ +V + +A    
Sbjct  403   MWADPLEFRPARFLPGGEKPNVDVKGNDFEVIPFGAGRRICVGISLGLRMVQLLVATSVQ  462

Query  1461  SFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             +FDW    GL+PE ++ +E YG+T+ +  PL    +PRL  H+Y S
Sbjct  463   TFDWELANGLKPEKLNMNEAYGLTLQREEPLVVHPKPRLAPHVYES  508



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   381 bits (979),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 207/528 (39%), Positives = 303/528 (57%), Gaps = 24/528 (5%)
 Frame = +3

Query  21    LSDLIKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLL  200
             +S LI +L    +IT   F+L L+L             +     RLPPGP  WPIVGNL 
Sbjct  1     MSILISLL--YTFITALVFYLLLNL-------------RPRHSKRLPPGPSPWPIVGNLP  45

Query  201   QLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAV  380
              LG +PH   AA   KYGPL++LRLG VD +     S+  + L   D  FASRP    A 
Sbjct  46    HLGTIPHHSLAALAKKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAK  105

Query  381   HLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENG  560
             H+AY   D+  AP GP+W+ +R+IC  HL +TK L+ F   R EE   L   + G  E+ 
Sbjct  106   HIAYNYHDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHIRQEEVAILTRVLVGAGES-  164

Query  561   ETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDY  740
              TV L ++L   + N + R++LG++ FG    +G  +A EF  +  EL  L G   +GD+
Sbjct  165   -TVKLGQLLNVCTTNALARVMLGRRVFGDGSGTGDPKADEFKDMVVELMVLAGEFNIGDF  223

Query  741   VPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGK  920
             +P   W+D  G  KKM+++  R D F   ILEEH+          D +  L++L  +  +
Sbjct  224   IPALDWLDLQGVTKKMKKLHTRFDSFLNTILEEHKTGNNG-----DLLSTLIALKDDADE  278

Query  921   E--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMV  1094
             E   + D+EIKAL+ ++ AA TDTS+ T EWA+AE+I++P++LK+ Q+E+D +VG DR+V
Sbjct  279   EGGKLSDIEIKALLLNLFAAGTDTSSSTVEWAIAELIRQPQLLKQAQEEIDTIVGRDRLV  338

Query  1095  SENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRN  1274
             +E DL  L +L+ +V+ETFR HP+ P  +P  S+    ++GYHIP  + + +N  G+ R+
Sbjct  339   TELDLSQLTFLQAIVKETFRLHPSTPLSLPRVSSDDCEVSGYHIPKGSTLLVNVWGIARD  398

Query  1275  PSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
             P VW D  +FRP R  P          G DF+++PF AG+R C G  LG+ +V + +A L
Sbjct  399   PEVWTDPLEFRPTRFLPGGEKPNVDVRGNDFEVIPFGAGRRICVGISLGLRMVQLLVATL  458

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
               +FDW   +GL PE ++  E YG+T+ +A PL    + RL  H+  S
Sbjct  459   VQTFDWELAKGLEPEKLNMDETYGLTLQRAEPLMVHPKSRLAHHVCKS  506



>ref|XP_008792870.1| PREDICTED: cytochrome P450 71A1-like [Phoenix dactylifera]
Length=511

 Score =   380 bits (975),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 196/517 (38%), Positives = 305/517 (59%), Gaps = 27/517 (5%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             LAS  L L  +F          G+    + LPPGP  WPI+GNL  +  LPHR   A   
Sbjct  14    LASILLFLKSLF----------GRRRRSLNLPPGPKPWPIIGNLNLISSLPHRSLHALSQ  63

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
             KYGPL++L  GS   I      + + +L   D  F  RP+  A  +  Y   D+  +  G
Sbjct  64    KYGPLIHLYFGSFPVIVAASVDMAKLVLKSHDVSFCGRPKIAAGKYTTYNYSDITWSQYG  123

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
             P W++ R++C+  L + +RL+S+   R EE ++L+ D++    +G  V+L++ L   S+N
Sbjct  124   PYWRQARKMCIMELFSARRLDSYEYIRVEEVKNLLRDLF--KSSGSPVSLKDHLSNVSLN  181

Query  606   NVTRMLLGKQFFGADESS--GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
              ++RM+LGK++    E +   P+E   F  +  ELF L G++ +GD +P   ++D  G  
Sbjct  182   VISRMVLGKKYLDRSEGAIVSPEE---FKAMLDELFLLNGVMNIGDSIPWLDFLDLQGYI  238

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGE----MDFVDVLLSLPGE-NGKEHMEDVEI  944
             K+M+++ ++ D F   +L+EH + ++  +GE    +D VDVLL L  + N +  +E   +
Sbjct  239   KRMKKISRKFDRFLEHVLDEHNERRRR-EGENFVAVDMVDVLLELADDPNLEVKLERRGV  297

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KA  QD+IA  T++SAVT EWA++E++KRP I KK  +ELD V+G DR V E ++ +L Y
Sbjct  298   KAFTQDLIAGGTESSAVTVEWAISELLKRPEIFKKATEELDRVIGRDRWVEEKEVHNLPY  357

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             +  +V+ET R HP  P L+P  S     I GY IPA TR+ +N   +GR+P+VWD  ++F
Sbjct  358   IEAIVKETMRMHPVAPMLVPRLSREDCNIAGYDIPAGTRVLVNVWTIGRDPTVWDSPEEF  417

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
             RPER     G ++++  G DF++LPF +G+R CPG  LG+ ++ ++LA L H F W  P+
Sbjct  418   RPERFI---GSKIDVK-GHDFELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPD  473

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             G + ED+   E++G++ P+  PL AV  P+L  HLYG
Sbjct  474   GTKLEDLSMEEIFGLSTPRKVPLEAVVEPKLPAHLYG  510



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   379 bits (974),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 197/486 (41%), Positives = 286/486 (59%), Gaps = 11/486 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG +PH   A    KYGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPTPWPIVGNLPHLGTIPHHSLARLAAKYGPLMHLRLGFVDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D +FASRP    A H+AY   D+  AP GP+W+ +R+IC  HL + K L+ F   R E
Sbjct  90    TNDAIFASRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G  E+  TV L ++L   + N + R++LG++ F     +G  +A EF  +
Sbjct  150   EVAILTRALIGAGES--TVKLGQLLNVCTTNALARVMLGRRVF---SDTGDLKADEFKDM  204

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               +L  L G   +GD++P   W+D  G  KKM+++  + D F   ILEEH+       G 
Sbjct  205   VVQLMVLAGEFNIGDFIPALDWLDIQGITKKMKKLHAQFDSFLNAILEEHKSGNGRTSGH  264

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              D +  L++L     GE GK  + D+EIKAL+ ++  A TDTS+ T EWA+AE+I+ PR+
Sbjct  265   GDLLSTLIALKDDADGEGGK--LSDIEIKALLLNLFVAGTDTSSSTVEWAIAELIRHPRM  322

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             LK+ Q+E+D VVG DR+VSE+DL  L +L+ +V+ETFR HP+ P  +P  S+    ++GY
Sbjct  323   LKQAQEEMDNVVGRDRLVSESDLGQLPFLQAIVKETFRLHPSTPLSLPRISSENCEVDGY  382

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             HIP  + + +N   + R+P +W D  +FRP R  P          G DF+++PF AG+R 
Sbjct  383   HIPKGSTLLVNVWAIARDPKMWADPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRI  442

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V + +A L  +FDW    GL PE ++ +E YG+T+ +  PL    +PRL 
Sbjct  443   CVGISLGLRMVQLLVATLVQTFDWELANGLEPEKLNMNEAYGLTLQREEPLMVHPKPRLA  502

Query  1581  RHLYGS  1598
              H+Y S
Sbjct  503   PHVYES  508



>ref|XP_002462455.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
 gb|EER98976.1| hypothetical protein SORBIDRAFT_02g025850 [Sorghum bicolor]
Length=517

 Score =   379 bits (974),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 195/518 (38%), Positives = 306/518 (59%), Gaps = 14/518 (3%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKM-RLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             T ASF   L ++   + LL    G+ + ++  LPPGP  WPI+GNL  +G LPHR     
Sbjct  5     TWASF---LGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLNLMGALPHRSIHEL  61

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
               KYGPL+ L+ GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P
Sbjct  62    SRKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSP  121

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              G  W++ R++C+  L + KRLES+   RA E R L+ D+   + +G  V L++ L   S
Sbjct  122   YGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDYLSTVS  181

Query  600   MNNVTRMLLGKQFFGADESSGPQEAM--EFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
             +N +TRM+LGK++   +E++        EF ++  ELF L G++ +GD +P   W+D  G
Sbjct  182   LNVITRMVLGKKYLDKEEAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQG  241

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSK-KEIDG--EMDFVDVLLSLPGENGKE-HMEDVE  941
               K+M+++ K  D F   ++EEH + + +E  G    D VDVLL +  +   E  +    
Sbjct  242   YIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELNRES  301

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             +KA  QD+IA  T++SAVT EWA++E++K+P ++ K  +ELD V+G  R V+E D+  L 
Sbjct  302   VKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLP  361

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             Y+  VV+ET R HP  P L+P  S   TT+ GY IPA TR+ ++   +GR+P++WD  ++
Sbjct  362   YVDAVVKETMRLHPVAPLLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEE  421

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER     G ++++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS P
Sbjct  422   FMPERFL---GSKLDV-KGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLP  477

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +G+  E++   E++G++ P+  PL AV  P+L  HLY 
Sbjct  478   DGVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  515



>ref|NP_001062713.1| Os09g0264400 [Oryza sativa Japonica Group]
 dbj|BAD38500.1| putative elicitor-inducible cytochrome P450 [Oryza sativa Japonica 
Group]
 dbj|BAF24627.1| Os09g0264400 [Oryza sativa Japonica Group]
 gb|EAZ43968.1| hypothetical protein OsJ_28589 [Oryza sativa Japonica Group]
 dbj|BAG94869.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   379 bits (974),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 192/489 (39%), Positives = 291/489 (60%), Gaps = 13/489 (3%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             +LPPGP  WPI+GNL  +  LPHR       ++GP+V L  GS   +  +   + +  L 
Sbjct  34    KLPPGPKPWPIIGNLNLISSLPHRSIHEISKRHGPIVQLWFGSCPVVVGSSVEMAKLFLQ  93

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D VFA RPRT A  + AY C D+  +P G  W++ R++C   L + +RLES    R E
Sbjct  94    TNDAVFADRPRTAAGKYTAYDCTDITWSPYGAYWRQARKMCAAELFSARRLESLEHIRHE  153

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM----E  680
             E R L+ ++ G    G  V LR+ L   ++  ++RM+LGK++    + +G   AM    E
Sbjct  154   EVRALLRELHGSGAAGNAVQLRDHLSMAALGVISRMVLGKKYV-EKQPAGGGAAMTTPEE  212

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK-  857
             F ++  ELF + G++ +GD++P   W+D  G  ++M+ V + +  F  ++L+EH + ++ 
Sbjct  213   FKWMLEELFLMNGVLNIGDFIPWLDWLDLQGYIRRMKNVNRLIHRFLDRVLDEHDERRRL  272

Query  858   EIDGEM--DFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
             + DG +  D VD+LL L  + N    +    IK + QD++    DTS VT EWAM+EV+K
Sbjct  273   QGDGFVARDMVDILLQLADDPNLDVQLTRNGIKGITQDLVTGGADTSTVTVEWAMSEVLK  332

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              P IL K  +ELD +VG  R+V+E D+ HL Y+  +++ET R HP  P L+P  S    +
Sbjct  333   NPAILAKATEELDTIVGVGRLVTEGDIPHLPYIHAIMKETMRMHPVVPLLVPRMSREDAS  392

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSA  1388
             + GY +PA TR+ +NT  +GR+PSVWD  + FRPER F   G  V+   G DF++LPFS+
Sbjct  393   VAGYDVPAGTRVLVNTWTIGRDPSVWDSPEQFRPER-FVGSGIDVK---GRDFELLPFSS  448

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             G+R CPG  LG+ ++ + LA L H+F W  P+G+   ++   E++G+TMP+  PL AV +
Sbjct  449   GRRMCPGYNLGLKVIQLTLANLLHAFSWCLPDGVTAGELSMEEIFGLTMPRKIPLLAVVK  508

Query  1569  PRLQRHLYG  1595
             PRL  HLY 
Sbjct  509   PRLPDHLYA  517



>ref|NP_001063284.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAD36157.1| putative cytochrome P450 monooxygenase CYP92A1 [Oryza sativa 
Japonica Group]
 dbj|BAF25198.1| Os09g0441100 [Oryza sativa Japonica Group]
 dbj|BAG98103.1| unnamed protein product [Oryza sativa Japonica Group]
Length=525

 Score =   379 bits (973),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 191/495 (39%), Positives = 290/495 (59%), Gaps = 22/495 (4%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPI+GNL  +G LPHR       +YGPL+ LR GS   +  +   + R  L 
Sbjct  35    RLPPGPNPWPIIGNLNLIGALPHRSIHELSKRYGPLMQLRFGSFPVVVGSSAEMARFFLK  94

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D VF  RPRT A  H  Y   D+  +P G  W++ R++C+  L + +RLESF   R E
Sbjct  95    SHDIVFTDRPRTAAGKHTTYNYTDILWSPYGAYWRQARKMCVTELFSARRLESFEHIRGE  154

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADE-----------SS  659
             E R L+ D+ G A     V LR+ L   ++  ++RM+LGK++ G +            +S
Sbjct  155   EVRALLRDLHGAAA---PVLLRDYLSTATLGVISRMVLGKKYVGVEGASAGNGGGGEGTS  211

Query  660   GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEE  839
                   EF  +  ELF L G++ +GD++P   W+D  G  ++M+ V K++D F   +L+E
Sbjct  212   PAATPEEFKMMMDELFLLSGVLNIGDFIPWLDWLDLQGYIRRMKRVGKKLDRFMEHVLDE  271

Query  840   HRKSKKEIDGEM---DFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEW  1007
             H K +++        D VDVLL L  + N +  +    +KAL QD+IA  TDTSA+T EW
Sbjct  272   HDKVRRQQGDRFAARDLVDVLLQLADDPNLEVQLRRDNVKALTQDLIAGGTDTSAITVEW  331

Query  1008  AMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPH  1187
             A++E++++P IL K  +ELD VVG  R+V+E D+  L Y+  +V+ET R HP  P L PH
Sbjct  332   AISELLRKPEILAKATEELDRVVGRGRLVTETDMTSLPYVEAIVKETMRVHPVAPLLAPH  391

Query  1188  ESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADF  1367
              +    ++ GY IPA TR+ +N   + R+P++WD  ++F PER     G ++++  G DF
Sbjct  392   VAREDASVGGYDIPAGTRVLVNVWTIARDPALWDSPEEFMPERFI---GSKIDVK-GQDF  447

Query  1368  KILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKAT  1547
             ++LPF +G+R CPG  LG+ ++ ++LA L H F+W  P+G+   ++   EV+G++ P+  
Sbjct  448   QLLPFGSGRRLCPGHSLGLKVIQLSLASLLHGFEWRLPDGVSAGELSMEEVFGLSTPRKV  507

Query  1548  PLFAVARPRLQRHLY  1592
             PL  V +P+L  HLY
Sbjct  508   PLEVVVKPKLPAHLY  522



>ref|XP_008652774.1| PREDICTED: cytochrome P450 71A1-like [Zea mays]
 tpg|DAA61659.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=517

 Score =   378 bits (971),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 306/518 (59%), Gaps = 14/518 (3%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKM-RLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             T ASF   L ++   + LL    G+ + ++  LPPGP  WPI+GNL  +G LPHR     
Sbjct  5     TWASF---LGVVLATVMLLKAILGRRSRRVYNLPPGPKPWPIIGNLDLVGALPHRSIHEL  61

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
               KYGPL+ LR GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P
Sbjct  62    SRKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSP  121

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              G  W++ R++C+  L + KRLES+   RA E R L+ D+   + +G  V L++ L   S
Sbjct  122   YGAYWRQARKMCLTELFSAKRLESYEYIRAAEVRVLLRDLHSASGSGRAVMLKDYLSTVS  181

Query  600   MNNVTRMLLGKQFFGADESSGPQEAM--EFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
             +N +TRM+LGK++   +E++        EF ++  ELF L G++ +GD +P   W+D  G
Sbjct  182   LNVITRMVLGKKYLDREEAAAGAVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQG  241

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSK-KEIDG--EMDFVDVLLSLPGENGKEHMEDVE-  941
               K+M+++ K  D F   ++EEH + +  E  G    D VDVLL +  +   E   D E 
Sbjct  242   YIKRMKKLSKMFDRFLEHVVEEHHQRRLSEGKGFVAKDMVDVLLQIADDPTLEVELDRES  301

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             +KA  QD+IA  T++SAVT EWA++E++K+P ++ K  +ELD V+G  R V+E D+  L 
Sbjct  302   VKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDIPSLP  361

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             Y+  +V+ET R HP  P L+P  S   T + GY IPA TR+ ++   +GR+P++WD  ++
Sbjct  362   YVDAIVKETMRLHPVAPMLVPRLSREDTAVAGYDIPAGTRVLVSVWSIGRDPALWDAPEE  421

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER     G R+++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS P
Sbjct  422   FMPERFL---GSRLDVK-GQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLP  477

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +G+  E++   E++G++ P+  PL AV +P+L  HLY 
Sbjct  478   DGVTMEELSMEEIFGLSTPRKFPLEAVVQPKLPAHLYA  515



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   378 bits (970),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 200/514 (39%), Positives = 293/514 (57%), Gaps = 13/514 (3%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             + + FL + L   +  LL + + + N   RLPPGP  WPI+GNL  +G  PH+  AA   
Sbjct  1     MTTLFLTVVLATVLFCLLFLFSRRRNP--RLPPGPNPWPIIGNLPHMGPKPHQTLAAMVT  58

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
              YGP+++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  AP G
Sbjct  59    TYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYG  118

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENG-ETVNLREVLGAFSM  602
              +W+ +R+I   HL + K LE F   R EE   +  +   +A+ G + VNL +++    +
Sbjct  119   QRWRMLRKISSVHLFSAKALEDFKHVRQEEVATMTRE---LAQVGTKAVNLGQLVNMCVV  175

Query  603   NNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
             N ++R ++G++ FGAD      +A EF  +  E+  L G++ +GD+VP   W+D  G   
Sbjct  176   NALSREMIGRRLFGADAD---HKAEEFRSMVTEMMALAGVLNIGDFVPSLDWLDLQGVAG  232

Query  783   KMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIKAL  953
             KM+ + KR D F   ILEEH  + ++     D +  L+SL G   +     + D EIKAL
Sbjct  233   KMKRLHKRFDAFLSSILEEHEMNGQD-QKHTDMLSTLISLKGTAFDGDGGSLTDTEIKAL  291

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             + +M AA TDTSA T +WA+AE+I+ P I+ K QQELD VVG DR+VSE+D+  L YL+ 
Sbjct  292   LLNMFAAGTDTSASTVDWAIAELIRHPDIMTKAQQELDSVVGRDRLVSESDISQLPYLQA  351

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             V++E FR HP  P  +PH +  +  INGYHIP  + +  N   + R+P  W D   F+PE
Sbjct  352   VIKENFRLHPPTPLSLPHIAAESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFKPE  411

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R  P          G+DF+++PF AG+R C G  LG+  + M  A L H F+W    G+ 
Sbjct  412   RFLPGGEKAGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQMLTATLVHGFEWELAGGVT  471

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             PE ++  E YG+T+ +A PL    +PRL  ++YG
Sbjct  472   PEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYG  505



>gb|AGT17103.1| flavonoid 3-monooxygenase [Saccharum hybrid cultivar R570]
Length=519

 Score =   378 bits (971),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 194/520 (37%), Positives = 299/520 (58%), Gaps = 16/520 (3%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             T ASF   L ++   + LL    G+      LPPGP  WPI+GNL  +G LPHR      
Sbjct  5     TWASF---LGVVLATVMLLKAILGRRRRVYNLPPGPKPWPIIGNLNLMGALPHRSIHELS  61

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGPL+ LR GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P 
Sbjct  62    RKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPY  121

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             G  W++ R++C+  L + KRLES+   RA E R L+ D+   + +G  V L++ L   S+
Sbjct  122   GAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHSASGSGRAVMLKDHLSTVSL  181

Query  603   NNVTRMLLGKQFFGADESSGPQEAM-----EFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
             N +TRM+LGK++   DE +           EF ++  ELF L G++ +GD +P   W+D 
Sbjct  182   NVITRMVLGKKYLDKDEVASAGSVTMTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDL  241

Query  768   YGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM---DFVDVLLSLPGENGKE-HMED  935
              G  K+M+++ K  D F   ++EEH + +     +    D VDVLL +  +   E  +  
Sbjct  242   QGYIKRMKKLSKMFDRFLEHVVEEHNQRRLREGKDFVAKDMVDVLLQIADDPTLEVELNR  301

Query  936   VEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLH  1115
               +KA  QD+IA  T++SAVT EWA++E++K+P ++ K  +ELD V+G  R V+E D+  
Sbjct  302   ESVKAFTQDLIAGGTESSAVTVEWAISELLKKPEVIVKATEELDRVIGRGRWVTEKDIPS  361

Query  1116  LNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDV  1295
             L Y+  +V+ET R HP  P L+P  S   TT+ GY IPA TR+ ++   +GR+P++WD  
Sbjct  362   LPYVDAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAP  421

Query  1296  DDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWS  1475
             ++F PER   +   R+++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS
Sbjct  422   EEFMPERFLSS---RLDV-KGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWS  477

Query  1476  PPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              P G+  E++   E++G++ P+  PL AV  P+L  HLY 
Sbjct  478   LPYGVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   378 bits (971),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 201/510 (39%), Positives = 293/510 (57%), Gaps = 14/510 (3%)
 Frame = +3

Query  93    LIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLR  272
             L++ ++ L  +   +     RLPPGP  WPI+GNL  LG  PH+  A     YGPL++LR
Sbjct  19    LLYCLLNLRTLLFNRHPNHRRLPPGPKPWPIIGNLPHLGTKPHQSIAELARTYGPLMHLR  78

Query  273   LGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRI  452
             LG VD +     S+  + L   D  F+SRP+   A ++AY   D+  AP GP+W+ +R+I
Sbjct  79    LGFVDVVVAASASVASQFLKTHDANFSSRPQNSGAKYIAYNYQDLVFAPYGPRWRMLRKI  138

Query  453   CMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGK  632
                HL + K L+ F   R EE   L   +  + E   +V+L  +L   + N + R++LGK
Sbjct  139   SQVHLFSNKALDDFRHVRQEEVAVLTRAI--VNEGDASVDLPRLLNVCTTNALARVMLGK  196

Query  633   QFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVD  812
             + FG    SG  ++ EF  +  E+  L G+  +GD+VP   W+D  G   KM+++  R D
Sbjct  197   RVFGEGSGSGNAKSDEFKDMVVEMMVLAGVFNIGDFVPSLEWLDLQGVAAKMKKLHARFD  256

Query  813   DFHMKILEEHR-KSKKEIDGE-----MDFVDVLLSLP----GENGKEHMEDVEIKALIQD  962
              F   ILEEH+ K  K   GE      +F+  L+SL     GE GK  + D EIKAL+ +
Sbjct  257   KFLGDILEEHKIKIGKNSPGEESGKPTNFLSTLISLKDNVDGEGGK--LSDTEIKALLLN  314

Query  963   MIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVR  1142
             M +A TDTS+ T EWA+AE+I+ P+IL + QQELD VVG DR+V+E DL  L YL+ +V+
Sbjct  315   MFSAGTDTSSSTVEWAIAELIRHPKILSQAQQELDSVVGRDRLVTELDLPQLTYLQAIVK  374

Query  1143  ETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHF  1322
             ETFR HP+ P  +P  ++ +  INGYHIP    + +N   + R+ +VWD+  +FRP R  
Sbjct  375   ETFRLHPSTPLSLPRVASESCEINGYHIPKGATLLVNVWAISRDSNVWDEPLEFRPNRFL  434

Query  1323  PADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPED  1502
             P          G DF+++PF AG+R C G  LG+ +V +  A L H+FDW  P G   E 
Sbjct  435   PNGEKPNADVRGNDFEVIPFGAGRRICAGMTLGIRMVQLLTATLIHAFDWELPAGQIAEK  494

Query  1503  IDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             ++  E YG+T+ + TPL    R RL +++Y
Sbjct  495   LNMEEAYGLTLQRHTPLMVHPRTRLSQNVY  524



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   378 bits (970),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 191/479 (40%), Positives = 282/479 (59%), Gaps = 8/479 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WP+VGNL  LG +PH   AA   KYGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPTPWPVVGNLPHLGTVPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A H+AY   D+  AP GP+W+ +R+IC  HL + K L+ +   R E
Sbjct  90    THDANFASRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDYRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G  +    V L ++L   + N + R++LG++ FG     G  +A EF  +
Sbjct  150   EVAILTRALVGAGK--APVKLGQLLNVCTTNALARVMLGRRVFGDGSGGGDPKADEFKDM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               E+  L G   +GD++P   W+D  G  KKM+++  R D F   ILEEH+  K      
Sbjct  208   VVEMMVLAGEFNIGDFIPALDWLDLQGITKKMKKLHARFDSFLNTILEEHKPGKGGASSH  267

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              D +  L+SL     GE GK  + D+EIKAL+ ++  A TDTS+   EWAMAE+I+ P+I
Sbjct  268   KDLLSTLISLKDDADGEGGK--LSDIEIKALLLNLFVAGTDTSSSKVEWAMAELIRNPKI  325

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             L++ Q+E+D VVG DR+V+E+DL  L +L+ +V+ETFR HP+ P  +P  S+ +  ++GY
Sbjct  326   LRQAQEEMDNVVGRDRLVTESDLGQLTFLQAIVKETFRLHPSTPLSLPRISSESCEVDGY  385

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  + + +N   + R+P +W D  +FRP R  P          G DF+++PF AG+R 
Sbjct  386   YIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRI  445

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             C G  LG+ +V + +A L  +FDW    G++PE ++ +E YG+T+ +A PL    +PRL
Sbjct  446   CVGISLGLRMVQLLVATLVQTFDWELANGVQPEKLNMNEAYGLTLQRAEPLIVHPKPRL  504



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   378 bits (970),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 300/512 (59%), Gaps = 10/512 (2%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
              + C++ +  I  LL ++T   N   RLPPGP  WPIVGNL  LG +PH   AA  +KYG
Sbjct  8     LYSCITGLV-IYVLLNLRTRHSN---RLPPGPTPWPIVGNLPHLGVVPHHSLAAMAEKYG  63

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV-GPK  431
             PL++LRLG VD +     ++  + L   D  FASRP    A H+AY   D+  AP  GP+
Sbjct  64    PLMHLRLGFVDVVVAASAAVAAQFLKVHDANFASRPPNSGAKHIAYNYQDLVFAPYYGPR  123

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             W+ +R+IC  HL ++K L+ F   R EE   L   + G  ++   V L ++L   + N +
Sbjct  124   WRMLRKICSVHLFSSKALDDFRHVRQEEVAILTRALIGAGDS--PVKLGQLLNVCTTNAL  181

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
              R++LGK+ FG     G  +A EF  +  E+  L G   +GD++P+   +D  G  KKM+
Sbjct  182   ARVMLGKRVFGDRSGGGDPKADEFKDMVVEVMELAGEFNIGDFIPVLDSLDLQGIAKKMK  241

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGE-MDFVDVLLSLPGENGKE--HMEDVEIKALIQD  962
             E+  R D F  KILEEH+        +  D +  L+SL  +  +E   + D+EIKAL+ +
Sbjct  242   ELHVRFDSFLGKILEEHKTGNGGASSQHTDLLTTLISLKDDTDEEGGKLSDIEIKALLLN  301

Query  963   MIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVR  1142
             +  A TDTS+ T EWA+AE+I+ P++LK+ Q+E+D VVG D +V+E DL  L +L+ +V+
Sbjct  302   LFTAGTDTSSSTVEWAIAELIRHPQLLKQAQEEIDNVVGRDHLVTELDLTQLPFLQAIVK  361

Query  1143  ETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHF  1322
             ETFR HP+ P  +P  ++ +  +NGYHIP  + + +N   + R+P +W +  +FRP R  
Sbjct  362   ETFRLHPSTPLSLPRIASESCEVNGYHIPKGSTLLVNVWAIARDPKMWSEPLEFRPARFL  421

Query  1323  PADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPED  1502
             P          G DF+++PF AG+R C G  LG+ +V + +A L  +FDW    GL+PE 
Sbjct  422   PGGEKPDADVKGNDFEVIPFGAGRRSCAGMSLGLRMVQLLVATLVQTFDWELANGLKPEK  481

Query  1503  IDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             ++  E YG+T+ +A PL    +PRL  H+YGS
Sbjct  482   LNMEEAYGLTLQRAAPLLVHPKPRLAPHVYGS  513



>ref|XP_002460274.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
 gb|EER96795.1| hypothetical protein SORBIDRAFT_02g025840 [Sorghum bicolor]
Length=518

 Score =   378 bits (970),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 196/516 (38%), Positives = 304/516 (59%), Gaps = 15/516 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGK--MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             ASF   L ++   + LL    G+   +    LPPGP  WPI+GNL  +G LPHR      
Sbjct  7     ASF---LGVVLATVMLLKAIIGRRRSRRVYNLPPGPKPWPIIGNLNLVGALPHRSIHELS  63

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGPL+ LR GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P 
Sbjct  64    RKYGPLMQLRFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPY  123

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             G  W++ R++C+  L + KRLES+   RA E R L+ D+   + +G  V L++ L   S+
Sbjct  124   GAYWRQARKMCLTELFSVKRLESYEYIRAAEVRALLRDLNSASGSGRAVMLKDYLSTVSL  183

Query  603   NNVTRMLLGKQFFGADESSGPQEAM--EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
             N +TRM+LGK++   +E++        EF ++  ELF L G++ +GD +P   W+D  G 
Sbjct  184   NVITRMVLGKKYLDREEAAAGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQGY  243

Query  777   EKKMREVEKRVDDFHMKILEEHRKSK-KEIDG--EMDFVDVLLSLPGENGKEHMEDVE-I  944
              K+M+++ K  D F   ++EEH + + +E  G    D VDVLL +  +   E   D E +
Sbjct  244   IKRMKKLGKMFDRFLEHVVEEHNQRRLREGKGFVAKDMVDVLLQIADDPTLEVELDRESV  303

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KA  QD+IA  T++SAVT EWA++E++K+P ++ K  +ELD V+G  R V+E D+  L Y
Sbjct  304   KAFTQDLIAGGTESSAVTVEWAISELLKKPEVIAKATEELDRVIGRGRWVTEKDMPSLPY  363

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             +  VV+ET R HP  P L+P  +   TT+ GY IPA TR+ ++   +GR+P++WD  ++F
Sbjct  364   VDAVVKETMRLHPVAPLLVPRLAREDTTVAGYDIPAGTRVLVSVWSIGRDPALWDAPEEF  423

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
              PER     G ++++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS P+
Sbjct  424   MPERFL---GSKLDV-KGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLPD  479

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             G+  E++   E++G++ P+  PL AV  P+L  HLY
Sbjct  480   GVTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAHLY  515



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   377 bits (967),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 198/499 (40%), Positives = 290/499 (58%), Gaps = 15/499 (3%)
 Frame = +3

Query  114   LLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAI  293
             LL ++T   N   RLPPGP  WPIVGNL  LG +PH   AA  +KYGPL++LR G VD +
Sbjct  20    LLNLRTRHSN---RLPPGPTPWPIVGNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVV  76

Query  294   TTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLT  473
                  S+  + L   D  FASRP    A H+AY   D+  AP GP+W+ +R+IC  HL +
Sbjct  77    VAASASVASQFLKTHDAKFASRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFS  136

Query  474   TKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADE  653
              K L+ F   R EE   L   + G   +  TV L ++L   + N + R++LG++ FG   
Sbjct  137   GKALDDFRHVRQEEVAILTRVLAGAGNS--TVKLGQLLNVCTTNALARVMLGRRVFG---  191

Query  654   SSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKIL  833
               G  +A EF  +  EL  L G   +GD++P   W+D  G  KKM+++  R D F   IL
Sbjct  192   -DGDPKADEFKDMVVELMVLAGEFNIGDFIPALAWLDLQGVTKKMKKLHARFDSFLNTIL  250

Query  834   EEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTN  1001
             EEH+          D +  L+SL     GE GK  + D+EIKAL+ ++  A TDTS+ T 
Sbjct  251   EEHKSGNGGASSHGDLLSTLISLKDDADGEGGK--LSDIEIKALLLNLFVAGTDTSSSTV  308

Query  1002  EWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLI  1181
             EWA++E+I+ P +LK+ Q+E+D VVG DR+V+E+DL  L  L+ +V+ETFR HP+ P  +
Sbjct  309   EWAISELIRDPELLKQAQKEMDNVVGRDRLVTESDLGQLTLLQAIVKETFRLHPSTPLSL  368

Query  1182  PHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGA  1361
             P  ++ +  ++GY+IP  + + +N   + R+P +W D  +FRP R  P          G 
Sbjct  369   PRIASDSCEVDGYYIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDVKGN  428

Query  1362  DFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPK  1541
             DF+++PF AG+R C G  LG+ +V + +A L  +FDW    GL+ E ++ +E YG+T+ +
Sbjct  429   DFEVIPFGAGRRICVGISLGLRMVQLLVATLVQTFDWELASGLQAEKLNMTEAYGLTLQR  488

Query  1542  ATPLFAVARPRLQRHLYGS  1598
             A PL    +PRL  H+Y S
Sbjct  489   AEPLMVHPKPRLAPHVYES  507



>ref|XP_011040453.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=507

 Score =   376 bits (965),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/520 (37%), Positives = 306/520 (59%), Gaps = 19/520 (4%)
 Frame = +3

Query  33    IKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGR  212
             + +L+ +   +  + F+  + +  +++ L +K   E  K+ LPP P + PI+GNL QLG 
Sbjct  1     MALLQWLKECSKPTLFVVTTFLVLVLKFL-MKEKLEKRKLNLPPSPAKLPIIGNLHQLGN  59

Query  213   LPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAY  392
             +PH        KYGP+++L+LG +  +  +   + +E+L   D V ASRP+  +A HL Y
Sbjct  60    MPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKTHDLVLASRPQLFSAKHLFY  119

Query  393   GCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETV-  569
             GC D+A AP G  W+ +R+IC+  LL+ KR+  ++  R EE   L+  +   AE+   + 
Sbjct  120   GCTDIAFAPYGAYWRNIRKICILELLSAKRVHWYSFVREEEVARLIRRI---AESYPGIT  176

Query  570   NLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPL  749
             NL  ++  ++ + + R+ LG+ F G     G  +   F  +  +   LLG   LGDY P 
Sbjct  177   NLSSMIALYANDVLCRIALGRDFSGG----GEYDRHGFQKMLDDYQALLGGFSLGDYFPS  232

Query  750   WRWIDPY-GCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKE-  923
               ++    G + K++   +R D F  +++ EHR SK + + + D VD+LL +  +   E 
Sbjct  233   MEFVHSLTGMKSKLQYTFRRFDQFFDEVIAEHRSSKGKQEQKKDLVDILLDIQKDGSSEI  292

Query  924   --HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVS  1097
                M++  IKA+I DM AA TDT+ +T +WAM E+I  P +++K Q E+  VVG  R+V 
Sbjct  293   PLTMDN--IKAVILDMFAAGTDTTFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRVVQ  350

Query  1098  ENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNP  1277
             E+DL  LNY++ V++E FR HPA P L+P ES     I+GY+IPAKTRI++N  G+GR+P
Sbjct  351   ESDLPRLNYMKAVIKEIFRLHPAAPVLVPRESLEDVIIDGYNIPAKTRIYVNVWGMGRDP  410

Query  1278  SVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLF  1457
              +W++ + F PER     G  ++   G DF+++PF AG+R CP    GV  V +ALA+L 
Sbjct  411   ELWENPETFEPERFM---GSGIDFK-GQDFELIPFGAGRRSCPAITFGVATVEIALAQLL  466

Query  1458  HSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             HSFDW  P GL  +DID +E +G++M +  PL  +A+P  
Sbjct  467   HSFDWKLPPGLEAKDIDNTEAFGISMHRTVPLHVIAKPHF  506



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   376 bits (965),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 200/487 (41%), Positives = 283/487 (58%), Gaps = 9/487 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG++PH   AA  DKYGPL++LR G VD +     S+  + L 
Sbjct  31    RLPPGPTPWPIVGNLPHLGKMPHHALAAMADKYGPLMHLRFGVVDVVVAASASVAAQFLK  90

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A HLAY   D+  AP G KW+ +R+IC  HL + K L+ F   R E
Sbjct  91    VHDANFASRPPNSGAKHLAYDYQDLVFAPYGLKWRMLRKICSVHLFSNKALDDFRHVREE  150

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G    G TV L ++L   + N + R++LG++ FG     G ++A EF  +
Sbjct  151   EVAVLTRALAGAG--GSTVALGQLLNVCTTNALARVMLGRRVFGDGSGGGDRKADEFKEM  208

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI-DG  869
               E+  L G   +GD++P   W+D  G  KKM+ +  R D F  +ILE+H+     I  G
Sbjct  209   VVEMMVLAGEFNIGDFIPALDWLDLQGVTKKMKNLHLRFDSFLNEILEDHKNGGDIITSG  268

Query  870   EMDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
              +D +  L+SL     GE GK  + D+EIKA++ ++  A TDTS+ T EWAMAE+I+ P+
Sbjct  269   NVDLLTTLISLKDDADGEGGK--LSDIEIKAILLNLFTAGTDTSSSTVEWAMAELIRYPQ  326

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             +++K Q+E++ VVG DR+VSE DL  L +L  VV+ETFR HP+ P  +P  +  +  ++G
Sbjct  327   LMQKAQEEIESVVGRDRLVSELDLPRLTFLEAVVKETFRLHPSTPLSLPRMALESCEVDG  386

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y+IP  + + +N   + R+P +WDD  +FRP R  P          G DF+I+PF AG+R
Sbjct  387   YYIPKGSTLLVNVWAIARDPKMWDDPLEFRPRRFLPRGEKPNANVKGNDFEIIPFGAGRR  446

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              C G  LG+ +V +  A L H+FDW    GL  E ++  E YG+T+ +  PL     PRL
Sbjct  447   ICAGMSLGLRMVQLLTATLVHAFDWKLANGLDSEKLNMKEAYGLTLQRDVPLMVHPSPRL  506

Query  1578  QRHLYGS  1598
                LY S
Sbjct  507   APELYKS  513



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   376 bits (965),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 209/518 (40%), Positives = 304/518 (59%), Gaps = 17/518 (3%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQ-LLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAA  236
             +T+ +  L  S+I  ++  LL + T   N   RLPPGP  WPIVGNL  LG +PH   AA
Sbjct  1     MTILTLVLYTSIIALVLYVLLNLFTRHPN---RLPPGPTPWPIVGNLPHLGSIPHHGLAA  57

Query  237   FCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALA  416
                KYGPL++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  A
Sbjct  58    LATKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFA  117

Query  417   PVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAF  596
             P GP+W+ +R+IC  HL ++K L+ F   R EE   L  D+ G  ++   V L ++L   
Sbjct  118   PYGPRWRLLRKICSVHLFSSKALDDFRHVRQEEVAILTRDLVGAKKS--PVKLGQLLNVC  175

Query  597   SMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
             + N + R++LG++ FG+    G  +A EF  +  E+  L G   LGD++P   W+D  G 
Sbjct  176   TTNALARVMLGRRVFGS--GGGDLKAGEFKDMVVEMMVLAGEFNLGDFIPGLDWLDLQGI  233

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM-DFVDVLLSLP----GENGKEHMEDVE  941
              KKM+ V KR D F  KIL+EH+       G   D +  L+S+     GE GK  + D+E
Sbjct  234   AKKMKNVHKRFDSFLNKILDEHKVGHDGASGHHGDLLSTLISVKDDADGEGGK--LSDIE  291

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             IKAL+ ++  A TDTS+ T EWA+AE+I+ P++LK+ Q+E+D VVG DR+V+E DL  L 
Sbjct  292   IKALLLNLFVAGTDTSSSTVEWAIAELIRNPQLLKRAQEEMDNVVGRDRLVTELDLSRLT  351

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             +L+ +V+ETFR HP+ P  +P  ++ +  INGYHIP  + + +N   + R+P  W D  +
Sbjct  352   FLQAIVKETFRLHPSTPLSLPRIASESCEINGYHIPKGSTLLVNVWAIARDPKKWADPLE  411

Query  1302  FRPERHFPADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSP  1478
             FRP R  P  G + ++   G DF+++PF AG+R C G  LG+ +V + +A L  +FDW  
Sbjct  412   FRPARFLPG-GEKPDVDVRGNDFEVIPFGAGRRICVGLSLGMRMVQLLIATLVQTFDWEL  470

Query  1479  PEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
               GL PE ++  E YG+T+ +A PL      RL  H+Y
Sbjct  471   ANGLMPEKLNMEEAYGLTLQRAAPLMVHPMSRLAPHVY  508



>ref|XP_006369135.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
 gb|ERP65704.1| hypothetical protein POPTR_0001s16800g [Populus trichocarpa]
Length=511

 Score =   375 bits (963),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/489 (38%), Positives = 295/489 (60%), Gaps = 14/489 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K++LPPGP  WPI+GNL  +G LPHR   A   KYGP++ ++ GS   +  +   + + I
Sbjct  28    KLKLPPGPKPWPIIGNLNLIGELPHRSLHALSQKYGPIMQVQFGSFPVVVGSSVEMAKTI  87

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +F+ RP+T A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R
Sbjct  88    LKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIR  147

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM---  677
              EE + L++ +     +G  +NL++ L   S+N ++RM+LGK++     S   +E +   
Sbjct  148   VEELKALLKTL--HKSSGRPINLKDHLTDVSLNVISRMVLGKKY-TVKSSENEKEIVTPE  204

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH---RK  848
             EF  +  ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   RK
Sbjct  205   EFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKRMKVLSKKFDKFMEHVLDEHESRRK  264

Query  849   SKKEIDGEMDFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
             ++ E     D VDVLL L  + N +  +E   +KA  QD+IA  T++SAVT EWA++E++
Sbjct  265   TEDENWEPKDMVDVLLQLASDPNLEVKLERHGVKAFSQDLIAGGTESSAVTVEWAISEIL  324

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             ++P + +K  +ELD V+G +R V E D+++L Y+  + +E  R HP  P L+P E+    
Sbjct  325   RKPEVFEKASEELDRVIGRERWVEEKDMVNLPYIYAIAKEVMRLHPVAPMLVPREAREDI  384

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              +NGY I   +R+ +N   +GR+P VWD  D+F PER     G  +++  G D+++LPF 
Sbjct  385   NVNGYDIKKGSRVLVNVWTIGRDPKVWDKPDEFCPERFI---GNSIDV-RGHDYELLPFG  440

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             AG+R CPG PLG+ ++   L+ L H F W  P+G+R E++   E++G++ PK  PL AVA
Sbjct  441   AGRRMCPGYPLGLKVIQATLSNLLHGFKWRLPDGVRKEELSMEEIFGLSTPKKYPLVAVA  500

Query  1566  RPRLQRHLY  1592
              PRL  H+Y
Sbjct  501   EPRLPAHVY  509



>ref|XP_006428066.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
 gb|ESR41306.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
Length=498

 Score =   375 bits (962),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 206/504 (41%), Positives = 289/504 (57%), Gaps = 12/504 (2%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             S  L L+ IF  +Q    KT K+N K+ LPPGP  +PI G L  LG+ P R        Y
Sbjct  5     STLLALAAIFFFLQAFSSKTNKKNRKL-LPPGPKGFPIFGCLHLLGKFPPRALHKLAKIY  63

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GP+++LRLG +  I  + P    + L   D +FASRP   A  +++Y   + A+AP G  
Sbjct  64    GPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQATKYMSYQQKNFAMAPYGSY  123

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             W+++R+IC ++LL+  ++  F   R E+   L+E     A     V++   L A S N  
Sbjct  124   WRKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEAAHARCVVDISAKLSALSTNMT  183

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
              RM+LGK+    +  SG      F  +  E F L+G   LGDY+P    +D  G  K+ +
Sbjct  184   CRMVLGKKRSDNEFDSG-----GFETVIREGFELVGKPNLGDYIPQIAGLDLQGLTKRSK  238

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVE-IKALIQDMI  968
              V K  D F  KI++EH +SK E   E DFVDV+LS  G    E   D E IKA++ DM+
Sbjct  239   AVAKVFDAFMEKIIDEHIQSKDENRTE-DFVDVMLSFEGSEDTEKKIDREHIKAVVMDML  297

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
             A A DTS    EWA++E+IK P ++KK+Q+EL+ +VG  RMV E+DL +L YL  VVRET
Sbjct  298   AGAIDTSPTVVEWALSELIKHPTVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVRET  357

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
              R HP  P + PHES    T+NG+HIP K+R+ +N   +GR+P  W D + F PER    
Sbjct  358   LRLHPVTPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPEAWTDPETFFPERFV--  415

Query  1329  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDID  1508
              G  V++  G DF++LPF +G+R CPG  L +T+V    A+L H FDW  PEG+ P ++D
Sbjct  416   -GSSVDVL-GHDFQLLPFGSGRRGCPGIQLALTVVKQVTAQLVHCFDWELPEGMLPTELD  473

Query  1509  TSEVYGMTMPKATPLFAVARPRLQ  1580
              +E +G+  P+A  L AV   RL 
Sbjct  474   MTEEFGLVTPRAKHLLAVPSYRLS  497



>ref|XP_002318091.2| hypothetical protein POPTR_0012s09180g [Populus trichocarpa]
 gb|EEE96311.2| hypothetical protein POPTR_0012s09180g [Populus trichocarpa]
Length=507

 Score =   375 bits (962),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/505 (38%), Positives = 296/505 (59%), Gaps = 18/505 (4%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
              L +++   ++    +K   +  K+ LPP P + PI+GNL QLG +PH        KYGP
Sbjct  15    LLVVTIFLVVVLKFLMKEKLKKRKLNLPPSPAKLPIIGNLHQLGNMPHISLRGLAKKYGP  74

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             +++L+LG +  +  +   + +E+L   D V +SRP+  +A HL YGC D+  AP G  W+
Sbjct  75    IIFLQLGEIPTVVISSAGLAKEVLKTHDLVLSSRPQLFSAKHLFYGCTDIVFAPYGAYWR  134

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETV-NLREVLGAFSMNNVT  614
              +R+IC+  LL+ KR+  ++  R EE   L+  +   AE+   + NL  ++  ++ + + 
Sbjct  135   NIRKICILELLSAKRVHWYSFVREEEVARLIRRI---AESYPGITNLSSMIALYANDVLC  191

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY-GCEKKMR  791
             R+ LGK F G     G  +   F  +  +   LLG   LGDY P   ++    G + K++
Sbjct  192   RIALGKDFSGG----GEYDRHGFQKMLDDYQALLGGFSLGDYFPSMEFVHSLTGMKSKLQ  247

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKE---HMEDVEIKALIQD  962
                +R D F  +++ EHR SK + + E D VDVLL +  +   E    M++  IKA+I D
Sbjct  248   YTFRRFDQFFDEVIAEHRSSKGKQEEEKDLVDVLLDIQKDGSSEIPLTMDN--IKAVILD  305

Query  963   MIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVR  1142
             M AA TDT+ +T +WAM E+I  P +++K Q E+  VVG  R+V E+DL  LNY++ V++
Sbjct  306   MFAAGTDTNFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRVVQESDLRRLNYMKAVIK  365

Query  1143  ETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHF  1322
             E FR HPA P L+P ES     I+GY+IPAKTRI++N  G+GR+P +W++ + F PER  
Sbjct  366   EIFRLHPAAPVLVPRESLEDVVIDGYNIPAKTRIYVNVWGMGRDPELWENPETFEPERFM  425

Query  1323  PADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPED  1502
                G  ++   G DF+++PF AG+R CP    GV  V +ALA+L HSFDW  P GL  +D
Sbjct  426   ---GSGIDFK-GQDFELIPFGAGRRSCPAITFGVATVEIALAQLLHSFDWKLPPGLEAKD  481

Query  1503  IDTSEVYGMTMPKATPLFAVARPRL  1577
             ID +E +G++M +  PL  +A+P  
Sbjct  482   IDNTEAFGISMHRTVPLHVIAKPHF  506



>ref|XP_007012628.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY30247.1| Cytochrome P450 superfamily protein isoform 1 [Theobroma cacao]
Length=512

 Score =   375 bits (962),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 193/514 (38%), Positives = 302/514 (59%), Gaps = 17/514 (3%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
             F + ++ +  +  L  + T + N +++LPPGP  WPI+GNL  +  LPH+       KYG
Sbjct  6     FVVAITWLASLAFLSRIFTSRRN-QLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQKYG  64

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PL+ L+ GS   +  +   + ++ L   D  FASRP+T A  H  Y   ++  AP GP W
Sbjct  65    PLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYGPYW  124

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             ++ R+I +  L ++KRLESF   R EE R  V  ++G +  G+ V L+E L   +++ ++
Sbjct  125   RQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFS--GKPVVLKEHLSRATLSVIS  182

Query  615   RMLLGKQFFGADESSGPQEAM---EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKK  785
             R++LGK++F   +       +   EF  I  ELF L G++ +GD++P   ++D  G  K+
Sbjct  183   RIVLGKKYFSESDDQLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQGYLKR  242

Query  786   MREVEKRVDDFHMKILEEHRKSKKEIDG--EMDFVDVLLSL---PGENGKEHMEDVEIKA  950
             M+ ++K++D FH  +  EH+  KKE+      D VD+LL L   P  + K   + V  + 
Sbjct  243   MKALKKKLDRFHEHVFNEHKSKKKELKDFVPQDMVDLLLQLADDPDIDVKLSYDGV--RG  300

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
               QD++A  TDTSA T EWA++E+IK+P+++KK  +ELD V+G +R V E D+  L Y+ 
Sbjct  301   FTQDLVAGGTDTSATTVEWAISELIKQPQLIKKATEELDRVIGRERWVEEKDIPQLPYID  360

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
              +++ET R HP    L PH +     + GY I   T +FINT  +GR+PS+W++ +DFRP
Sbjct  361   AIMKETMRKHPVAVMLAPHLALEDCLVAGYDIRKGTTVFINTWSMGRDPSLWEEPEDFRP  420

Query  1311  ERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGL  1490
             ER     G ++++  G  F++LPF +G+R CPG  LG+ ++  +LA L H F+W  P+  
Sbjct  421   ERFL---GKKIDVK-GQHFELLPFGSGRRMCPGYSLGLKMIRSSLANLLHGFNWKLPDNT  476

Query  1491  RPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             + ED+   EVYG+  P+  PL AV  PRL  HLY
Sbjct  477   KAEDLSMEEVYGLATPRKFPLVAVLEPRLPLHLY  510



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   375 bits (962),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 284/486 (58%), Gaps = 12/486 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG +PH   AA  +KYGPL++LR G VD +     S+  + L 
Sbjct  30    RLPPGPTPWPIVGNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVVVAASASVASQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A H+AY   D+  AP GP+W+ +R+IC  HL + K L+ F   R E
Sbjct  90    THDAKFASRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G   +  TV L ++L   + N + R++L ++ FG     G  +A EF  +
Sbjct  150   EVAILTRVLAGAGNS--TVKLGQLLNVCTTNALARVMLSRRVFG----DGDPKADEFKDM  203

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               EL  L G   +GD++P   W+D  G  KKM+++  R D F   ILEEH+         
Sbjct  204   VVELMVLAGEFNIGDFIPALAWLDLQGVTKKMKKLHARFDSFLNTILEEHKSGNGGASSH  263

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              D +  L+SL     GE GK  + D+EIKAL+ ++  A TDTS+ T EWA++E+I+ P +
Sbjct  264   GDLLSTLISLKDDADGEGGK--LSDIEIKALLLNLFVAGTDTSSSTVEWAISELIRDPEL  321

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             LK+ Q+E+D VVG DR+V+E+DL  L  L+ +V+ETFR HP+ P  +P  ++ +  ++GY
Sbjct  322   LKQAQKEMDNVVGRDRLVTESDLGQLTLLQAIVKETFRLHPSTPLSLPRIASDSCEVDGY  381

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  + + +N   + R+P +W D  +FRP R  P        + G DF+++PF AG+R 
Sbjct  382   YIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDAKGNDFEVIPFGAGRRI  441

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V + +A L  +FDW    GL+ E ++ +E YG+T+ +A PL    +PRL 
Sbjct  442   CVGISLGLRMVQLLVATLVQTFDWELASGLQAEKLNMTEAYGLTLQRAEPLMVHPKPRLA  501

Query  1581  RHLYGS  1598
              H+Y S
Sbjct  502   PHVYES  507



>ref|XP_004956938.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   375 bits (962),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 192/518 (37%), Positives = 300/518 (58%), Gaps = 16/518 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGK--MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             ASF   L ++   + LL    G+   +    LPPGP  WPI+GNL  +G LPHR      
Sbjct  7     ASF---LGVVLATVMLLKAIVGRHRRRRAYNLPPGPKPWPIIGNLDLVGALPHRSIHELS  63

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGPL+ L+ GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P 
Sbjct  64    RKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPY  123

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             G  W++ R++C+  L + KRLES+   RA E R L+ D+  ++ +G  V L++ L   S+
Sbjct  124   GAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGCAVMLKDYLSTVSL  183

Query  603   NNVTRMLLGKQFFGADESSGPQEAM---EFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
             N +TRM+LGK++   + ++G        EF ++  ELF L G++ +GD +P   W+D  G
Sbjct  184   NVITRMVLGKKYLDKEVAAGGSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQG  243

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM---DFVDVLLSLPGENGKE-HMEDVE  941
               K+M+++ K  D F   ++EEH + +          D VDVLL +  +   E  +    
Sbjct  244   YIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLEVELNRES  303

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             +KA  QD+IA  T++SAVT EWA++E++K+P +  K  +ELD V+G  R V+E D+  L 
Sbjct  304   VKAFTQDLIAGGTESSAVTVEWAISELLKKPEVFAKATEELDRVIGRGRWVTEKDIPQLP  363

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             Y+  +V+ET R HP  P L+P  S   TT+ GY IPA TR+ ++   +GR+P++WD  ++
Sbjct  364   YVDAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPTLWDAPEE  423

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER     G ++++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS P
Sbjct  424   FMPERFL---GSKLDVK-GQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFSWSLP  479

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +GL  E++   E++G++ P+  PL AV  P+L  HLY 
Sbjct  480   DGLTKEELSMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_004956937.1| PREDICTED: cytochrome P450 71A1-like [Setaria italica]
Length=519

 Score =   374 bits (961),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 192/518 (37%), Positives = 300/518 (58%), Gaps = 16/518 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKM--RLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             ASF   L ++   + LL    G+   +    LPPGP  WPI+GNL  +G LPHR      
Sbjct  7     ASF---LGVVLATVMLLKAIVGRRRRRRAYNLPPGPKPWPIIGNLDLMGALPHRSIHELS  63

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGPL+ L+ GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +P 
Sbjct  64    RKYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKYTTYNYRDITWSPY  123

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             G  W++ R++C+  L + KRLES+   RA E R L+ D+  ++ +G  V L++ L   S+
Sbjct  124   GAYWRQARKMCLTELFSAKRLESYEYIRAAEVRALLRDLHAVSGSGRAVMLKDYLSTVSL  183

Query  603   NNVTRMLLGKQFFGADESSGPQEAM---EFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
             N +TRM+LGK++   + ++G        EF ++  ELF L G++ +GD +P   W+D  G
Sbjct  184   NVITRMVLGKKYLDKEVAAGGSSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQG  243

Query  774   CEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM---DFVDVLLSLPGENGKE-HMEDVE  941
               K+M+++ K  D F   ++EEH + +          D VDVLL +  +   E  +    
Sbjct  244   YIKRMKKLGKMFDRFLEHVVEEHNQRRLREGKSFVAKDMVDVLLQIADDPTLEVELNRES  303

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             +KA  QD+IA  T++SAVT EWA++E++K+P +  K  +ELD V+G  R V+E D+  L 
Sbjct  304   VKAFTQDLIAGGTESSAVTVEWAISELLKKPEVFAKATEELDRVIGRGRWVTEKDIPQLP  363

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             Y+  +V+ET R HP  P L+P  S   TT+ GY IPA TR+ ++   +GR+P++WD  + 
Sbjct  364   YVDAIVKETMRLHPVAPMLVPRLSREDTTVAGYDIPAGTRVLVSVWSIGRDPTLWDTPEQ  423

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER     G ++++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F WS P
Sbjct  424   FMPERFL---GSKLDV-KGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWSLP  479

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +GL  E+++  E++G++ P+  PL AV  P+L  HLY 
Sbjct  480   DGLTKEELNMEEIFGLSTPRKFPLEAVVEPKLPAHLYA  517



>ref|XP_007204134.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
 gb|EMJ05333.1| hypothetical protein PRUPE_ppa023335mg [Prunus persica]
Length=508

 Score =   374 bits (960),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 186/484 (38%), Positives = 289/484 (60%), Gaps = 11/484 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  WPI+GNL  +GRLP++ F      YGP++ L+ GS   +  + P + ++ L  
Sbjct  31    LPPGPKPWPIIGNLNLIGRLPNQSFHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQFLKT  90

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D +FASRP+T    +L YG  +V  AP GP W++ R+I +  L ++K+LESF   R EE
Sbjct  91    HDHIFASRPQTAVGKYLTYGYLNVTWAPYGPYWRQARKIFLTELFSSKKLESFQYIRVEE  150

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADES-SGPQEAMEFMYI  692
              R  +  ++ ++  G+ V L+E L   +++ ++R++ GK++FG  +S S      EF   
Sbjct  151   NRAFISRLYALS--GKAVVLKEHLSRLTLSIMSRIVFGKEYFGMSKSESSIMSFKEFQDT  208

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
             + ELF L G+  +GD++P   ++D  G  K+M+ + K+VD F+  +L+EH+  K+ ++  
Sbjct  209   SDELFLLSGVFNIGDWIPWLNFLDLQGYVKRMKALTKKVDHFYEFVLDEHKARKEGVEKF  268

Query  873   M--DFVDVLLSLPGENGKEHMEDV--EIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
             +  D VD+LL L  +     ++     +KAL QD+I   +DTSA T EW M+E+IK+P +
Sbjct  269   VAEDMVDLLLRLADDPNDLEVKLTYDSVKALTQDLITGGSDTSANTLEWTMSELIKQPNL  328

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             +KK  +ELD V+G +R V E DL +L Y+  +++ET R HP    L P  +     + GY
Sbjct  329   IKKATEELDRVIGKERWVEEKDLENLPYIDAIMKETMRKHPVVAMLPPRLALEDCNVAGY  388

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
              I   T +F+NT  +GR+P++WD  DDFRPER      G+     G  F+ LPF +G+R 
Sbjct  389   DICKGTIVFVNTWSMGRDPTLWDAPDDFRPERFL----GKAIDVKGQSFEFLPFGSGRRM  444

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPG  LG+ ++   LA + H F+W  PE ++ ED+D  EVYG+  P+  P+ A+  PRL 
Sbjct  445   CPGYSLGLKVIRSCLANMLHGFNWKLPENMKTEDLDMEEVYGLITPRKFPILAIVEPRLP  504

Query  1581  RHLY  1592
              HLY
Sbjct  505   IHLY  508



>ref|XP_011040452.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=507

 Score =   374 bits (960),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 192/503 (38%), Positives = 294/503 (58%), Gaps = 14/503 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
             A F + + L+  +  L+  K  K   K+ LPP P + PI+GNL QLG +PH        K
Sbjct  14    ALFVVTIFLVIVLKFLMKEKLKKR--KLNLPPSPAKLPIIGNLHQLGNMPHISLRGLAKK  71

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGP+++L+LG +  +  +   + +E+L   D V ASRP+  +A HL YGC D+  AP G 
Sbjct  72    YGPIIFLQLGEIPTVVISSAGLAKEVLKTHDLVLASRPQLFSAKHLFYGCTDIGFAPYGA  131

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
              W+ +R+IC+  LL+ KR+  ++  R EE   L+  + G        NL  ++  ++ + 
Sbjct  132   YWRNIRKICILELLSAKRVRWYSFVREEEVARLIRRIAGSCPG--ITNLSSMIALYANDV  189

Query  609   VTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY-GCEKK  785
             + R+ LG+ F G     G  +   F  +  +   LLG   LGDY P   ++    G + K
Sbjct  190   LCRIALGRDFSGG----GEYDRHGFQKMLDDFQALLGGFSLGDYFPSIEFVHSLTGMKSK  245

Query  786   MREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVE-IKALIQD  962
             ++   +R D F  +++ EHR SK + + + D VD+LL +  +   E    ++ IKA+I D
Sbjct  246   LQYTFRRFDQFFDEVIAEHRSSKGKQEQKKDLVDILLDIQKDGSSEIPLTMDNIKAVILD  305

Query  963   MIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVR  1142
             M AA TDT+ +T +WAM E+I  P +++K Q E+  VVG  R+V E+DL  LNY++ V++
Sbjct  306   MFAAGTDTTFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRVVQESDLPRLNYMKAVIK  365

Query  1143  ETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHF  1322
             E FR HPA P L+P ES     I+GY+IPAKTRI++N  G+GR+P +W++ + F PER  
Sbjct  366   EIFRLHPAAPVLVPRESLEDVIIDGYNIPAKTRIYVNVWGMGRDPELWENPETFEPERFM  425

Query  1323  PADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPED  1502
                G  ++   G DF+++PF AG+R CP    GV  V +ALA+L HSFDW  P GL  +D
Sbjct  426   ---GSGIDFK-GQDFELIPFGAGRRSCPAITFGVATVEIALAQLLHSFDWKLPPGLAAKD  481

Query  1503  IDTSEVYGMTMPKATPLFAVARP  1571
             ID +E +G++M +  PL  +A+P
Sbjct  482   IDNTEAFGISMHRTVPLHVIAKP  504



>ref|XP_004288989.1| PREDICTED: flavonoid 3'-monooxygenase-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   374 bits (960),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/529 (37%), Positives = 304/529 (57%), Gaps = 22/529 (4%)
 Frame = +3

Query  18    SLSDLIKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNL  197
             SLS  I  L ++ + TL   FL  +L  K  +L           ++ PPGP  WPI+GNL
Sbjct  3     SLSWAISTLAVVIFATLT--FLSKTLFPKSHKL----------NLKFPPGPKPWPIIGNL  50

Query  198   LQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAA  377
               +G LPH+        YGP++ L+ GS   +  + P + ++I    D VFASRP+T A 
Sbjct  51    NLIGPLPHQSLHKLSQTYGPIMQLKFGSYPVVIASSPEMAKQISKTHDHVFASRPQTAAG  110

Query  378   VHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAEN  557
              +  Y   ++  AP GP W++ R+  +  L  +KRL+SF   R EE R  +  +  ++  
Sbjct  111   KYTTYNYLNITWAPHGPYWRQGRKFYLSELFNSKRLDSFEYIRVEENRAFLSRLCALS--  168

Query  558   GETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM-EFMYITHELFHLLGLIYLG  734
             G+ V L+E L   +++ ++R++LGK++F   ES      + EF  +  ELF L G++ +G
Sbjct  169   GKPVTLKEHLSRLTLSIISRIVLGKKYFSVSESETSIVTLNEFQEMLDELFLLNGVLNIG  228

Query  735   DYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPG  908
             D++P     D  G  K+M+ ++K+ D FH  +  EHR +K+ +   +  D VDVLL L  
Sbjct  229   DWIPWLELFDLQGYVKRMKALKKKFDRFHDHVFGEHRANKEGVKEYVPKDLVDVLLKLAD  288

Query  909   E-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSD  1085
             + N +  +    +K   QD+IA  TDTSA T EWAM+E++K+P +++K  +ELD V+G +
Sbjct  289   DPNIEVKLNYDSVKGFTQDLIAGGTDTSATTVEWAMSELMKQPHLIEKATEELDRVIGRE  348

Query  1086  RMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGL  1265
             R V E D+  L Y+  +++ET R HP    L PH +     + GY I   TR+FINT  +
Sbjct  349   RWVEEKDIAQLPYIDAIMKETMRKHPVAVMLAPHLALEDCNVEGYDIRKGTRVFINTWSI  408

Query  1266  GRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMAL  1445
             GRN SVW+  ++F+PER     G  +++  G ++++LPF +G+R CPG  LG+ L+  ++
Sbjct  409   GRNSSVWEAPEEFKPERFL---GNTIDVK-GHNYELLPFGSGRRMCPGYSLGLKLIRSSI  464

Query  1446  ARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             A + H F+W  PE ++PED+   EVYG+  P+  PL AV  PRL  HLY
Sbjct  465   ANMLHGFNWKLPENMKPEDLSMDEVYGLATPRKFPLVAVVEPRLPNHLY  513



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   374 bits (960),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/487 (40%), Positives = 281/487 (58%), Gaps = 8/487 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG+ PHR  AA   KYGPL++LRLG +D +     S+  + L 
Sbjct  30    RLPPGPTPWPIVGNLPHLGQSPHRSLAALATKYGPLIHLRLGFIDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A H+AY   D+   P GP+W+ +R++C+ HL + K L  F   R E
Sbjct  90    AHDANFASRPPNSGAKHIAYNYNDMVFEPYGPRWRMLRKLCLVHLFSNKALNDFRHIRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G  ++   V L ++L     N ++R++LGK+ FG        +A EF  +
Sbjct  150   EVAILTRALGGAGQS--IVQLDKLLNLCISNALSRVMLGKRVFGDGSGGEDPKADEFKDM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR--KSKKEID  866
               E+  L G   +GD++P   W+D  G  KKM+ +  R+D F   ILEEH+   +   + 
Sbjct  208   AAEVQVLAGEFNIGDFIPALDWLDLQGVTKKMKNLHTRLDSFLNTILEEHKTGSNNSRVS  267

Query  867   GEMDFVDVLLSLPGE---NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
             G   F+ +L+SL  +   NG + + D+EIKAL+ ++  A TDTS  T EWA+AE+I+ P+
Sbjct  268   GHNHFLSMLISLKDDADGNGPK-LSDIEIKALLLNLFVAGTDTSFNTVEWAIAELIRHPK  326

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             ILK+ QQE+D VVG DR+V+E D+  L +L+ +V+ETFR HPA P  +P  ++    ING
Sbjct  327   ILKQAQQEIDTVVGQDRLVTELDISQLTFLQAIVKETFRLHPATPLSLPRIASENCEING  386

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y+IP  + +  +   + R+P +W D   F+P R  P          G DF ++PF AG+R
Sbjct  387   YNIPKGSTLLTHVWAIARDPKIWTDPLKFQPTRFLPGGEKPNADVKGNDFDLIPFGAGRR  446

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              C G  LGV +V + +A L  +FDW     L PE+++  E YG+ + +A PL    RPRL
Sbjct  447   ICAGMSLGVRMVQLLIATLVQAFDWELANCLEPENLNMEEAYGLALRRAEPLMVHPRPRL  506

Query  1578  QRHLYGS  1598
               H+Y S
Sbjct  507   SPHVYTS  513



>ref|XP_002990094.1| hypothetical protein SELMODRAFT_43356, partial [Selaginella moellendorffii]
 gb|EFJ08811.1| hypothetical protein SELMODRAFT_43356, partial [Selaginella moellendorffii]
Length=473

 Score =   372 bits (956),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 198/483 (41%), Positives = 287/483 (59%), Gaps = 15/483 (3%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  WPI+GNLL +G +PH         YGPLVYLRLG++  + ++DP+II+E L  
Sbjct  1     LPPGPRGWPIIGNLLDVGTVPHEGMMKLTRAYGPLVYLRLGAIPHVVSDDPAIIKEFLKI  60

Query  336   QDDVFASRP-RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
             QD +FASRP   + A  L YG  D+  AP G  W+ MR+IC   L + K ++SF + R  
Sbjct  61    QDHIFASRPGNVILAELLTYGGKDIGFAPYGAHWRNMRKICTLELFSAKSVDSFQRLRRM  120

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E  H +  +   A +   V+LR+     + N +TRMLLGK++FG  +  GP+   E   +
Sbjct  121   EMIHTLGLILDAAVDRRAVDLRDAFNGLTSNMMTRMLLGKRYFGPGDP-GPEVGAELKAM  179

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH--RKSKKEID  866
                   ++    + DY+P  R++D  G E++M+++ + +D     +L E   R  KK   
Sbjct  180   IAGGILMMNGFNISDYLPFLRFLDLQGQERRMKQIMRHIDGLATALLLELAPRIGKKP--  237

Query  867   GEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILK  1046
                +FVD+L++L GENG+ H+ +  +KA++ DM+AA TDT  V+ EWAMAE+++ P +L 
Sbjct  238   --ENFVDILVNLRGENGEPHLPEDVMKAVMVDMMAAGTDTPGVSCEWAMAELLRDPALLA  295

Query  1047  KIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHI  1226
             ++++E+D VV  DR+V E+DL H   LR V++E+FR HP G  LIPH +     + GY I
Sbjct  296   RVREEVDRVVSVDRLVDESDLAHFRLLRAVLKESFRLHPVGAILIPHLAMEDAVVAGYGI  355

Query  1227  PAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHG-ADFKILPFSAGKRKC  1403
             P  TR+ IN   L RN  VW+   +F PERH    G    +  G  + +++PF +G+R C
Sbjct  356   PKDTRVLINVFALNRNAQVWERPHEFDPERHLRGLGEGAVVEFGDPECRLIPFGSGRRMC  415

Query  1404  PGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQR  1583
             P A LG+T+VL+ALA L H+FDW  P  L      + E     M KA PL A+ARPRL  
Sbjct  416   PAASLGLTMVLLALANLVHAFDWEVPANL------SMERAPGKMVKAQPLTALARPRLPH  469

Query  1584  HLY  1592
             HLY
Sbjct  470   HLY  472



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/476 (40%), Positives = 282/476 (59%), Gaps = 12/476 (3%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             IVGNL  LG +PH   A+   KYGPL++LRLGSV+ I     S+  +I    D  F+SRP
Sbjct  41    IVGNLPHLGPVPHHSLASLASKYGPLMHLRLGSVNVIVAASSSVAVQIFKTHDANFSSRP  100

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
                 A H+AY   D+  AP GPKW+ +R+IC  HL + K L+ F   R EE   L + + 
Sbjct  101   PNSGAKHIAYNYQDLVFAPYGPKWRMLRKICSVHLFSAKALDDFRHIRQEEVMVLTKVLL  160

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
             G  +    V+L ++L   + N + R++LG++ FG  + +G +++ EF  +  E+  L G+
Sbjct  161   GAGK--APVDLAKLLNVCTTNALGRVMLGRRVFG--DGNGDEKSDEFKNMVVEMMVLAGI  216

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG--EMDFVDVLL  896
               +GD+VP   W+D      +M+++ KR D F  KILEEHR+S+    G    D + VLL
Sbjct  217   FNIGDFVPSLEWLDLQRVASRMKKLHKRFDAFLSKILEEHRESENSNSGVKHTDLLSVLL  276

Query  897   SLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQEL  1064
              L     GE GK  + D  IKAL+ D+  A TDTS+ T EWA++E+++ P++L + Q+EL
Sbjct  277   GLKDDVDGEGGK--LTDTNIKALLLDLFTAGTDTSSSTVEWAISELVRNPKLLAQAQEEL  334

Query  1065  DEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRI  1244
             D VVG DR+VSE+DL  L + + +++ETFR HP+ P  +P  +T +  ING++IP  + +
Sbjct  335   DRVVGRDRLVSESDLSQLTFFQAIIKETFRLHPSTPLSLPRMATESCEINGFYIPKDSTL  394

Query  1245  FINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGV  1424
              +N   + R+PSVW +  +F+PER  P          G DF+++PF AG+R C G  +G+
Sbjct  395   LVNVWAIARDPSVWPEPLEFKPERFVPGGRNAHMDVKGNDFEVIPFGAGRRICAGMSMGI  454

Query  1425  TLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              +V    A L H F+W  PEG  PE ++  E YG+T+ +A PL    +PRL  H Y
Sbjct  455   RMVTFVAATLVHGFNWELPEGQMPEKLNMDEAYGLTLQRAVPLVVHPQPRLAPHAY  510



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 286/486 (59%), Gaps = 8/486 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG  PH+  A    KYGPL+YLRLG VD +     S+  + L 
Sbjct  30    RLPPGPSPWPIVGNLPHLGASPHQSLATLAAKYGPLMYLRLGFVDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP +    ++AY   D+  AP GP+W+ +R+IC  H+ + K ++ F   R E
Sbjct  90    VHDLNFASRPLSSGGKYIAYNYQDMVFAPYGPRWRMLRKICSVHMFSAKAMDGFRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   +  ++     V L ++L   + N + R++LG++ F    + G  +A EF  +
Sbjct  150   EVAILTRTL--VSAGKSPVKLGQILNVCTTNALARVVLGRRVFADGSAGGDPKADEFKDM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               EL  L G  ++GD++P   W+D  G + KM+++  R D F   ILEEH+  K      
Sbjct  208   VVELMVLAGEFHIGDFIPALDWLDLQGIKNKMKKLHARFDSFLHGILEEHKSGKFGAPSH  267

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              D +  L+SL     GE GK  + DVEIKAL+ ++  A TDTS+ T EWA+AE+I+ P++
Sbjct  268   GDLLSTLISLKDDADGEGGK--LSDVEIKALLLNLFVAGTDTSSSTVEWAIAELIRHPKL  325

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             LK+ Q+E+D VVG DR+V+E DL  LN+L+ +V+ETFR HP+ P  +P  ++ +  ++GY
Sbjct  326   LKQAQKEMDNVVGRDRLVTELDLNELNFLQAIVKETFRLHPSTPLSLPRIASESCEVDGY  385

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  + + +N   + R+P+VW D  +FRP R  P          G +F+++PF AG+R 
Sbjct  386   YIPKGSTLLVNVWAIARDPNVWADPLEFRPMRFLPGGEKPNVDVQGNNFEVIPFGAGRRI  445

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V + +A L  +FDW    GL PE ++  E +G+T+ KA PL     PRL 
Sbjct  446   CVGISLGLRMVQLLVATLVQTFDWELANGLNPEKLNMDEAFGLTLQKAEPLMVHPMPRLA  505

Query  1581  RHLYGS  1598
              H+YGS
Sbjct  506   PHVYGS  511



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 194/510 (38%), Positives = 302/510 (59%), Gaps = 13/510 (3%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVK--TGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             +A F+    L+  +  +L  K    KEN K +LPPGP  +P+ G+L  LG+ PH D    
Sbjct  1     MAWFWAIAVLLITVFYVLQGKLWKSKENTK-KLPPGPKGFPLFGSLHLLGKFPHHDLQKL  59

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
               +YGP++++RLG +  +  + P      L   D VFA+RP   AA H+++   +++ AP
Sbjct  60    AKQYGPIMHMRLGLIPTVIVSSPEAAELFLKTHDLVFATRPPHEAAKHISWEQRNLSFAP  119

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              G  W+ +R++C   LL++ ++ +F++ R EE    ++ +   A +   V+L   +   +
Sbjct  120   YGSYWRDIRKMCTLELLSSHKISTFSEMRKEEIGLSIKSIREAALDHVAVDLSARITCLN  179

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
              +   RM+ GK++  +DE     +   F  +  E  HL     LGDY+P    +D  G  
Sbjct  180   ADMTCRMVFGKKY--SDEEF---DERGFKAVVQEGMHLAATPNLGDYIPFIAPLDLQGFT  234

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALI  956
             K+M++V +  D+F  KI++EH +SK +     DFVDV+LS  G    E+ +E   IKA+I
Sbjct  235   KRMKKVRRVFDEFFEKIIDEHIQSKDDAGKTKDFVDVMLSFMGSKESEYRIERTNIKAII  294

Query  957   QDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCV  1136
              DM+A + DTS+   EWA++E+IK PR+LKK+Q+EL+ VVG DR V E+DL  L YL  V
Sbjct  295   LDMVAGSMDTSSTATEWAISELIKNPRVLKKVQKELETVVGMDRTVEESDLERLEYLDMV  354

Query  1137  VRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPER  1316
             V+ET R HP  P LIPH +     +NG+HIP K+R+ IN + +GR+P+ W D + F PER
Sbjct  355   VKETLRLHPVAPLLIPHAAMEDCIVNGFHIPNKSRVMINVYAIGRDPNSWTDPEKFFPER  414

Query  1317  HFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRP  1496
                  G  V++  G DF+++PF +G+R CPG  LG+T+V + +A+L H FDW  P G+ P
Sbjct  415   FV---GSSVDL-RGRDFQLIPFGSGRRGCPGMQLGLTVVRLLVAQLVHCFDWELPNGMLP  470

Query  1497  EDIDTSEVYGMTMPKATPLFAVARPRLQRH  1586
              ++D  E +G+T P+A  L A+   RLQ++
Sbjct  471   AELDMEEEFGLTTPRANHLMAIPTCRLQKY  500



>ref|XP_002321645.1| hypothetical protein POPTR_0015s09760g [Populus trichocarpa]
 gb|EEF05772.1| hypothetical protein POPTR_0015s09760g [Populus trichocarpa]
Length=507

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/504 (38%), Positives = 301/504 (60%), Gaps = 15/504 (3%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGK-ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
             L    IF ++ L  +  GK +N K+ LPP P + PI+GNL QLG +PH        KYGP
Sbjct  15    LLFVTIFLLVALKFLVKGKLKNSKLNLPPSPAKLPIIGNLHQLGNMPHISLRWLAKKYGP  74

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             +++L+LG +  +  +   + +E+L   D V +SRP+  +A HL YGC D+A AP G  W+
Sbjct  75    IIFLQLGEIPTVVISSVRLAKEVLKTHDLVLSSRPQLFSAKHLFYGCTDIAFAPYGAYWR  134

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGE-TVNLREVLGAFSMNNVT  614
              +R+IC+  LL+ KR++ ++  R EE   L+  +   AE+   T NL +++G ++ + + 
Sbjct  135   NIRKICILELLSAKRVQWYSFVREEEVARLIHRI---AESYPGTTNLSKMIGLYANDVLC  191

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY-GCEKKMR  791
             R+ LG+ F G     G  +   F  +  +   LLG   LGDY P   ++    G + K++
Sbjct  192   RVALGRDFSGG----GEYDRHGFQKMLDDYQALLGGFSLGDYFPSMEFVHSLTGMKSKLQ  247

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVE-IKALIQDMI  968
                +R D F  K++ EH+ S+ + + + D VDVLL +  +   E    ++ IKA+I DM 
Sbjct  248   HTVRRFDQFFDKVITEHQNSEGKQEEKKDLVDVLLDIQKDGSSEMPLTMDNIKAVILDMF  307

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
             AA TDT+ +T +W M E+I  P++++K Q E+  VVG   +V E+DL  L+Y++ V++E 
Sbjct  308   AAGTDTTFITLDWTMTELIMNPQVMEKAQAEVRSVVGDRIVVQESDLPRLHYMKAVIKEI  367

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
             FR HPA P L+P ES     I+GY+IPAKTRI++N  G+GR+P +W++ + F PER    
Sbjct  368   FRLHPAVPVLVPRESLEDVIIDGYNIPAKTRIYVNVWGMGRDPELWENPETFEPERFM--  425

Query  1329  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDID  1508
              G  ++   G DF+++PF AG+R CP    G+  V +ALA+L HSFDW  P G++ +DID
Sbjct  426   -GSSIDFK-GQDFELIPFGAGRRSCPAITFGIATVEIALAQLLHSFDWELPPGIKAQDID  483

Query  1509  TSEVYGMTMPKATPLFAVARPRLQ  1580
              +E +G++M +  PL  +A+P   
Sbjct  484   NTEAFGISMHRTVPLHVIAKPHFN  507



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   373 bits (958),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 201/508 (40%), Positives = 291/508 (57%), Gaps = 12/508 (2%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             +A  ++ LS       LL     K   K +LPPGP  +PI+GNL  LG+ PH D      
Sbjct  1     MAWIWITLSFTLIAHLLLRALPWKRKSKKKLPPGPIGYPILGNLPLLGQNPHHDLHKLAQ  60

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
             KYGPL+YLRLG V  I  + P +  + L   D VFASRP   A+ H++Y    +A AP G
Sbjct  61    KYGPLMYLRLGFVHTIVVSSPELAEQFLKTHDLVFASRPPHEASKHISYEQRSLAFAPYG  120

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
             P W+ +R++C   LL+  ++ SF   R EE   LV  +   A +   ++L   + + S +
Sbjct  121   PYWRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAIDLTSKIFSLSAD  180

Query  606   NVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKK  785
                RM+ GK++   +      +   F  +  E   L     +GDYVP     D  G  K+
Sbjct  181   MSCRMVFGKKYMDKE-----FDERGFKAVIQEGMVLGATPNIGDYVPYLARFDLQGLTKR  235

Query  786   MREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGEN-GKEHMEDVEIKALIQD  962
             M+ V K  D F  KI++EH KS KE     DFVDV+L   G N G+ H++   IKA+I D
Sbjct  236   MKAVSKVFDAFFEKIIDEHMKSMKEEGESKDFVDVMLGFMGLNEGEYHIDRPHIKAIILD  295

Query  963   MIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVR  1142
             M++ + DTSA   +WAM E+++ P  +K++Q EL++ VG +R V E+DL  L+YL  V++
Sbjct  296   MLSGSMDTSATAIDWAMTELVRHPSAMKRVQDELEKAVGMNRAVEESDLEGLHYLDMVIK  355

Query  1143  ETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD--DVDDFRPER  1316
             ET R HP  P L+PHE+T   T+NG+HIP K+R+ +N   +GR+P VW   D ++F PER
Sbjct  356   ETMRLHPVAPLLLPHEATEDCTVNGFHIPLKSRVIVNVWSIGRDPKVWTTHDPEEFIPER  415

Query  1317  HFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRP  1496
                  G  +++  G DF++LPF AG+R CPG  LG+T+V   LA+L H FDW  P G+ P
Sbjct  416   FL---GSSMDVK-GRDFQLLPFGAGRRGCPGMQLGLTIVRFVLAQLVHCFDWDLPAGISP  471

Query  1497  EDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
              ++D +E +G+T P+A  L  + R RL 
Sbjct  472   SELDMTEEFGLTAPRAKHLVVMPRYRLS  499



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/511 (38%), Positives = 296/511 (58%), Gaps = 27/511 (5%)
 Frame = +3

Query  90    SLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYL  269
             +LIF    L+  ++ K     RLPPGP   PI+GNLL +G  PHRD      KYGP+++L
Sbjct  12    ALIFFFQSLVWKRSAKNK---RLPPGPRGLPILGNLLMIGDKPHRDLQQLAQKYGPIMHL  68

Query  270   RLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRR  449
             R GS+  I  + P    + L   D VFASRP    + ++ Y   +++ +P G  W+ MR+
Sbjct  69    RFGSMPVIVVSSPEAAEQFLKTYDLVFASRPPHEGSKYICYNQQNISFSPYGSYWRNMRK  128

Query  450   ICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLG  629
             +C   LL+  ++ SF   R EE    ++ +   A     V+L   + + S N   RM+LG
Sbjct  129   MCTLELLSNLKINSFRSMRKEELHLFIDCIQEAASARVAVDLTATVSSLSTNISCRMVLG  188

Query  630   KQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRV  809
             K++   D      EA     I  E   +     + DY+PL++ +D  G +K+M+ V K  
Sbjct  189   KKYNNDDFDEKGFEA-----IIREGMQIGAAFNIADYIPLFKALDLQGLKKRMKAVAKVF  243

Query  810   DDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALI----------  956
             DDF  K+++EH +SK E +   DFVDV+L   G    E+ +E   IKA+I          
Sbjct  244   DDFFEKVIDEHVQSKDE-NRTKDFVDVMLGFMGSEESEYRVERDTIKAIILALSNYICFS  302

Query  957   ---QDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
                QDM+ AA DTSA   EW ++E+IK PR++KK+Q+EL+ VVG +R+V E+DL  L YL
Sbjct  303   RLLQDMLVAAMDTSATAIEWTLSELIKHPRVIKKVQKELENVVGMERLVEESDLEKLEYL  362

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
               VV+E+FR HP  P L+PH S    T+NG+HIP  +R+FIN   +GR+P++W D + F 
Sbjct  363   DMVVKESFRIHPVAPLLVPHASVEDCTVNGFHIPKNSRVFINAWAIGRDPNIWTDAEKFI  422

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PER   +D   +++  G DF+++PF +G+R CPG PLG+ +V + +A+L H FDW  P+G
Sbjct  423   PERFVGSD---IDL-RGRDFQLIPFGSGRRGCPGMPLGLIMVRLVVAQLVHCFDWELPDG  478

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             +   ++D +E +G+  P+A  L A+   RL+
Sbjct  479   MLATELDMTEEFGLVSPRAKHLLAMPTWRLK  509



>gb|KDP40690.1| hypothetical protein JCGZ_24689 [Jatropha curcas]
Length=511

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/486 (38%), Positives = 293/486 (60%), Gaps = 16/486 (3%)
 Frame = +3

Query  159   PPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQ  338
             PPGP  WPI+GNL  +G LPHR   +  +KYGP++ L+ GS   +  +   + + IL   
Sbjct  34    PPGPKSWPIIGNLNLIGSLPHRSLHSLSEKYGPIMQLKFGSFPVVVGSSVEMAKTILKTH  93

Query  339   DDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEA  518
             D  FA RP+T A  +  +   D+  +P GP W++ R++C+  L + KRLES+   R EE 
Sbjct  94    DVNFAGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKMCVMELFSAKRLESYEYIRVEEL  153

Query  519   RHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSG----PQEAMEFM  686
             R L++ ++    +G  +N+++ L   S+N ++RM+LGK++   +E+      P+E  E +
Sbjct  154   RSLLKTLF--LSSGNAINVKDHLSDLSLNVISRMVLGKKYTVKNENENEIVTPEEFKEML  211

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
                 ELF L G++ +GD +P   ++D  G  K+M+ + K+ + F   +L+EH   +K ++
Sbjct  212   ---DELFLLNGVLDIGDSIPWLAFLDLQGNIKRMKVLSKKFNRFLEHVLDEHESRRKGVE  268

Query  867   GEM--DFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               +  D VD+LL L  + N +  +E   +K   QDMIA  T++SAVT EWA++E++++P 
Sbjct  269   NYVAKDMVDILLQLAEDPNLEVKLERNGVKGFTQDMIAGGTESSAVTVEWALSELLRKPE  328

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             I KK  +ELD V+G +R V E D+++L ++  + +ET R HP  P L+P +    T I G
Sbjct  329   IFKKATEELDRVIGRERWVEEKDIVNLPFIEAIAKETMRLHPVAPMLVPRQCREDTQIAG  388

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y I   TR+ +N   +GR+P++WD+ ++F PER      G+     G DF++LPF AG+R
Sbjct  389   YDIQKGTRVLVNVWTIGRDPTIWDNPNEFCPERFI----GKAIDVKGHDFELLPFGAGRR  444

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG PLG+ ++  +LA L   F+W  P  L+ ED++  E++G++ PK  PL AVA PRL
Sbjct  445   MCPGYPLGIKVIQASLANLLQGFNWKLPGNLKKEDLNMEEIFGLSTPKKFPLVAVAEPRL  504

Query  1578  QRHLYG  1595
               H+YG
Sbjct  505   PFHVYG  510



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   373 bits (957),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 203/515 (39%), Positives = 291/515 (57%), Gaps = 32/515 (6%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
             FLC SL   II          + + +LPPGP   PI+GNL  LG LPHR       KYGP
Sbjct  15    FLC-SLFHTIIT-------ASSSRPKLPPGPRALPIIGNLHMLGNLPHRSLQHLAKKYGP  66

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             ++ +RLG++ AI  + P+     L   D +FASRP+  A+ +++YG   +A    GP W+
Sbjct  67    IMSMRLGNIPAIVVSSPTAAELFLKTHDTIFASRPKVQASEYMSYGTKGMAFTEYGPYWR  126

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTR  617
              +R++C   LL   ++E  A  R EE    ++ +   A  GE V+L E +G    +   R
Sbjct  127   HIRKLCTLQLLCPSKIEGSAPLRREEVGLFIQSLKKAAAAGEVVDLSEKVGGLVEDITYR  186

Query  618   MLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREV  797
             M+LG         S   +  +      E   L G   +GDYVP    +D  G  K+M+ +
Sbjct  187   MVLG---------SKNDDMFDLKGTIQEALFLSGAFNIGDYVPFLSPLDLQGLAKRMKRI  237

Query  798   EKRVDDFHMKILEEHRKSKK--EIDGEM--DFVDVLLSL------PGENGKEHMEDVEIK  947
              K +D    KI+ EH +  K  ++ G    DFVDVLLSL      P +     ME   +K
Sbjct  238   SKTIDQLFEKIIGEHEQVSKSGQVQGHSHKDFVDVLLSLIHQPLNPNDEKVYMMERTNVK  297

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             A++ DMI+ A DTSA T  W +AE+++ PR++K +Q+EL  V+G DRMV E+DL  L YL
Sbjct  298   AILLDMISGAFDTSATTIVWTLAELLRHPRVMKHLQEELQSVIGMDRMVEESDLPKLCYL  357

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDF  1304
               VV+E+ R HP  P LIPHES    T+ G+ IP K+RIFINT  +GR+P VW ++V++F
Sbjct  358   SMVVKESLRLHPVAPLLIPHESMEDITVEGFDIPKKSRIFINTWAIGRDPKVWSENVEEF  417

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
               ER      G +++  G DF++LPF +G+R CP   LG+T V +ALA L H F+W  P 
Sbjct  418   YTERFI---DGNIDL-RGHDFQLLPFGSGRRGCPAMQLGLTTVCLALANLVHCFNWELPS  473

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHL  1589
             GL+P+D+D +E +G+++ KA  LFA+   RL   L
Sbjct  474   GLKPKDLDMTEKFGLSLSKAKHLFAMPTYRLCNQL  508



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   373 bits (957),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 280/484 (58%), Gaps = 8/484 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG +PH   AA   +YGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPTPWPIVGNLPHLGTIPHHSLAALATRYGPLMHLRLGFVDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A H+AY   D+  AP GP+W+ +R+IC  HL + K L+ F   R E
Sbjct  90    AHDANFASRPPNSGAKHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKSLDDFRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   +    ++  TV L ++L   + N + R++LG++ FG     G  +A EF  +
Sbjct  150   EVAILTRALVDAGKS--TVILGQLLNVCTTNALARVMLGRRVFGDGSGGGDPKADEFKDM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               EL  L G   +GD++P    +D  G  KKM+++  R D F   ILEEH+         
Sbjct  208   VVELMVLAGEFNIGDFIPALDILDLQGVTKKMKKLHTRFDSFLNTILEEHKTGGSGASAH  267

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
             +D +  L+SL     GE GK  + D EIKAL+ ++ AA TDTS+ T EWA+AE+I+ P +
Sbjct  268   VDLLSTLISLKDDADGEGGK--LSDTEIKALLLNLFAAGTDTSSSTVEWAIAELIRHPHL  325

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             +K+ QQE+D VVG DR+V+E DL  L +L+ +V+ETFR HP+ P  +P  ++ +  INGY
Sbjct  326   MKQAQQEMDTVVGQDRLVTELDLSQLTFLQAIVKETFRLHPSTPLSLPRIASESCEINGY  385

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  + + +N   + R+P +W +   F+P R  P          G DF+++PF AG+R 
Sbjct  386   NIPKGSTLLVNVWAIARDPKMWTNPLQFQPARFMPGGEKPNADVKGNDFEVIPFGAGRRI  445

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V +  A L  +FDW    GL P D++  E YG+T+ +A PL    RPRL 
Sbjct  446   CAGMSLGLRMVQLLTATLVQAFDWELANGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLA  505

Query  1581  RHLY  1592
              ++Y
Sbjct  506   PYVY  509



>ref|XP_006493867.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Citrus sinensis]
 ref|XP_006493868.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Citrus sinensis]
Length=498

 Score =   372 bits (956),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/504 (41%), Positives = 288/504 (57%), Gaps = 12/504 (2%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             S  L L+ IF  +Q    KT K+N K+ LPPGP  +PI G L  LG+ P R        Y
Sbjct  5     STLLALAAIFFFLQAFSSKTNKKNRKL-LPPGPKGFPIFGCLHLLGKFPPRALHKLAKIY  63

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GP+++LRLG +  I  + P    + L   D +FASRP   A  +++Y   + A+AP G  
Sbjct  64    GPIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQATKYMSYQQKNFAMAPYGSY  123

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             W+++R+IC ++LL+  ++  F   R E+   L+E     A     V++   L A S N  
Sbjct  124   WRKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEAAHARCVVDISAKLSALSTNMT  183

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
              RM+LGK+    +  SG      F  +  E F L+G   LGDY+P    +D  G  K+ +
Sbjct  184   CRMVLGKKRSDNEFDSG-----GFETVIREGFELVGKPNLGDYIPQIAGLDLQGLTKRSK  238

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVE-IKALIQDMI  968
              V K  D F  KI++EH +SK E   E DFVDV+LS  G    E   D E IKA++ DM+
Sbjct  239   AVAKVFDAFMEKIIDEHIQSKDENRTE-DFVDVMLSFEGSEDTEKKIDREHIKAVVMDML  297

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
             A A DTS    EWA++E+IK P ++KK+Q+EL+ +VG  RMV E+DL  L YL  VVRET
Sbjct  298   AGAIDTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVRET  357

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
              R HP  P + PHES    T+NG+HIP K+R+ +N   +GR+P  W D + F PER    
Sbjct  358   LRLHPVTPLMAPHESMEDCTVNGFHIPKKSRVIVNAWAIGRDPEAWTDPETFFPERFV--  415

Query  1329  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDID  1508
              G  V++  G DF++LPF +G+R CPG  L +T+V    A+L H FDW  PEG+ P ++D
Sbjct  416   -GSSVDVL-GHDFQLLPFGSGRRGCPGIQLALTVVKQVTAQLVHCFDWELPEGMLPTELD  473

Query  1509  TSEVYGMTMPKATPLFAVARPRLQ  1580
              +E +G+  P+A  L AV   RL 
Sbjct  474   MTEEFGLVTPRAKHLLAVPSYRLS  497



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   372 bits (956),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/488 (40%), Positives = 296/488 (61%), Gaps = 19/488 (4%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNL-LQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSI  314
             +N K RLPPGP  +PI G+L L  G  P++D      KYG ++Y+RLG +  I  + P  
Sbjct  22    KNKKKRLPPGPRGFPIFGSLHLLSGEFPNKDLHRLAQKYGDVMYMRLGLMPTIVVSSPQA  81

Query  315   IREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESF  494
              +  L   D VFASRP    A H+++G  +++ A  GP W+ MR++C   LL+  ++ SF
Sbjct  82    AKLFLKTHDLVFASRPPHEGAKHISFGQRNLSFAEYGPYWRDMRKMCTLELLSNHKINSF  141

Query  495   AKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNVTRMLLGKQFFGAD-ESSGPQ  668
                R EE    VE +   A  G   V+L +++ + S++   RM+LGK++   D ++ G  
Sbjct  142   KSMRREEVALCVESIRDAAYKGHVAVDLSDIVSSLSVDMSCRMVLGKKYRDEDFDTRG--  199

Query  669   EAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRK  848
                 F  +  E   L G   L DY+P    +D  G  K+M+ V K  D F  KI+EEH +
Sbjct  200   ----FRSVIKEGLQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAFDTFFEKIIEEHLQ  255

Query  849   SKKEIDGE--MDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAE  1019
             S    DGE   DFVDV++   G    E+ +E   IKA+I DM+ A+ DTS+ T +WA++E
Sbjct  256   SN---DGERTKDFVDVMVGFMGSEESEYQIERPHIKAIIMDMLVASMDTSSTTVDWALSE  312

Query  1020  VIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTR  1199
             +++ P+ +K++Q+EL++VVG +RMV E+DL  L+YL  VV+ET R HP  P L+PH +T 
Sbjct  313   LMRHPKAMKQVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLRLHPVAPLLVPHAATE  372

Query  1200  ATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILP  1379
               T+NGYHIP K+R+ IN   +GR+PS W D ++F PER    +G  V++  G  F+++P
Sbjct  373   DCTVNGYHIPKKSRVIINAWAIGRDPSAWTDAEEFIPERF---EGSDVDV-RGNHFQLIP  428

Query  1380  FSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFA  1559
             F +G+R+CPG  LG+T+V + LA+L H FDW  P  + PE++D SEV+G+T+ +A  L A
Sbjct  429   FGSGRRRCPGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSEVFGITVARAKRLIA  488

Query  1560  VARPRLQR  1583
             +   RL +
Sbjct  489   IPSYRLHK  496



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 199/506 (39%), Positives = 293/506 (58%), Gaps = 14/506 (3%)
 Frame = +3

Query  78    FLCLSLIFKIIQ--LLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             ++ ++L F +I   LL     K   K +LPPGP  +PI+GNL  LG+ P+ D      KY
Sbjct  3     WIWITLTFALIAHLLLRASLWKTKSKKKLPPGPRGYPILGNLPLLGQNPNHDLHKLAQKY  62

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GPL+YLRLG V  I  + P +  + L   D VFASRP   A+ H++Y    +A AP GP 
Sbjct  63    GPLMYLRLGFVHTIVVSSPEVAEQFLKTHDLVFASRPPHEASKHISYEQRSLAFAPYGPY  122

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNV  611
             W+ +R++C   LL+  ++ SF   R EE   LV  +   A +   ++L   + + S +  
Sbjct  123   WRNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAIDLSSKISSLSADMS  182

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
              RM+ GK++   +      +   F  +  E   L     +GDYVP     D  G  K+M+
Sbjct  183   CRMVFGKKYMDKE-----FDERGFKAVIQEFMVLGATPNIGDYVPYLARFDLQGLTKRMK  237

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGEN-GKEHMEDVEIKALIQDMI  968
              V K  D F  KI++EH KSKKE     DFVDV+L   G N G+ H++   IKA+I DM+
Sbjct  238   AVSKVFDAFFEKIIDEHMKSKKEEGESKDFVDVMLGFMGLNEGEYHIDRPHIKAIILDML  297

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
               + DTSA   +WAM E+++ P  +KK+Q EL++ VG +R V E+DL  L+YL  V++ET
Sbjct  298   LGSMDTSATAIDWAMTELVRHPSAMKKVQDELEKAVGMNRAVEESDLEGLHYLDMVIKET  357

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWD--DVDDFRPERHF  1322
              R HP  P L+PHE+T   T+NG+H+P K+R+ +N   +GR+P VW   + ++F PER  
Sbjct  358   MRLHPVAPLLLPHEATEDCTVNGFHMPLKSRVIVNVWSIGRDPKVWTTHNPEEFIPERFL  417

Query  1323  PADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPED  1502
                G  +++  G DF++LPF AG+R CPG  LG+T+V   LA+L H FDW  P G+ P +
Sbjct  418   ---GLSMDVK-GRDFQLLPFGAGRRGCPGMQLGLTVVRFVLAQLVHCFDWDLPAGISPSE  473

Query  1503  IDTSEVYGMTMPKATPLFAVARPRLQ  1580
             +D +E +G+T P+A  L  + + RL 
Sbjct  474   LDMTEEFGLTTPRAKHLVVMPQYRLS  499



>ref|XP_009413866.1| PREDICTED: cytochrome P450 71A1-like [Musa acuminata subsp. malaccensis]
Length=516

 Score =   372 bits (956),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 204/525 (39%), Positives = 308/525 (59%), Gaps = 23/525 (4%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             I  ++ +L L L+F ++  L    G+   K+ LPPGP  WP++GNL  +G LP+R  AA 
Sbjct  3     IPSSAIYLALVLVFTLLTGL--YRGRRRHKLNLPPGPRPWPVIGNLNLIGPLPYRSLAAL  60

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
               K+GPL++LR GS   +  +   + +  L   D  F SRP+T+A  +  Y   +++ +P
Sbjct  61    SQKHGPLMHLRFGSFPVVVGSSVDMAKFFLKTHDLSFVSRPKTVAGKYTFYNHSNISWSP  120

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              GP W++ RRI +  LLT KRL+S+   R EE R L+ D++   E    V L + +   +
Sbjct  121   YGPYWRQARRILIMELLTPKRLDSYQYIRVEEVRGLLRDLFRSTET--PVLLNDYIFTVN  178

Query  600   MNNVTRMLLGKQFF-------GADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRW  758
             +N ++R++LG+++        GA  +  PQE  EF  +  EL  L G+I +GD +P   +
Sbjct  179   LNIISRIVLGRKYTQEQSVSSGAPAAIVPQE--EFKEMIEELMLLNGVINVGDLIPWLNF  236

Query  759   IDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM----DFVDVLLSLPGENGKE-  923
             +D  G  K+M+ V KR D F   +L+EH + ++  +G+     D VDVLL L  ++  E 
Sbjct  237   LDLQGYVKRMKMVGKRFDRFLEHVLDEHNERRRR-EGKAFVPRDLVDVLLELADDHSLEV  295

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
              +E   +KA I DM A  TDTS VT EWA++E++KRP    K  +ELD V+G  R V E 
Sbjct  296   KLERHCLKAFILDMFAGGTDTSTVTIEWAVSEILKRPETFDKATEELDRVIGRGRWVEEE  355

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             D+  L Y+  +V+ET R HP GP L+P  S   TT++GY IPA T + +N   +GR+P+V
Sbjct  356   DVHRLPYIEAIVKETMRIHPVGPLLVPRLSREHTTVDGYDIPAGTGVLVNVWAIGRDPAV  415

Query  1284  WDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHS  1463
             WD  ++FRPER     G  +++  G  F++LPF AG+R CPG  LG+ +V ++LA L H 
Sbjct  416   WDAPEEFRPERFV---GSPIDVK-GHHFELLPFGAGRRMCPGNSLGLKMVRLSLANLLHG  471

Query  1464  FDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             F W  P G+  E++   E++G+T P+   L AV  P+L  HLYG+
Sbjct  472   FKWRLPPGMTAEELKMDEIFGLTTPRKVRLQAVVEPKLPAHLYGA  516



>gb|AET01782.2| cytochrome P450 family protein [Medicago truncatula]
Length=514

 Score =   372 bits (955),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/488 (38%), Positives = 292/488 (60%), Gaps = 14/488 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K  LPPGP  WPI+GNL  +G LPH+       KYGP+++L  GS   I  + P I +  
Sbjct  35    KYNLPPGPKSWPIIGNLNLIGSLPHQSLHGLTKKYGPIMHLWFGSKPVIVGSSPEIAKVF  94

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D V A RP+  A  +  Y   ++  +  GP W++ R++C+  L + KRLES+   R
Sbjct  95    LKTNDAVLAGRPKFSAGKYTTYNYSNITWSQYGPYWQQARKMCLLELFSVKRLESYEYMR  154

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAME  680
              +E    + +++      +T+ L++ L   S+N ++RM+LGK++    E++   P+E   
Sbjct  155   KQELHAFLHELFN--SKNKTILLKDHLSTLSLNVISRMVLGKKYLEKSENAIISPEE---  209

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  ELF L G++ +GD++P   ++D  G  K+M+ + K+ D F   +LEEH + +K 
Sbjct  210   FKKMLDELFLLNGVLNVGDFIPWIHFLDLQGYVKRMKTLGKKFDWFMEHVLEEHIERRKC  269

Query  861   IDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKR  1031
             ++  +  D VDVLL L      E  +E   +KA  QD+IA  TDTS VT EWA++E++K+
Sbjct  270   VNDYVAKDMVDVLLKLAENPSLEVKLERHGVKAFTQDLIAGGTDTSTVTVEWAISELVKK  329

Query  1032  PRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTI  1211
             P I+K+  +ELD+V+G DR V E D+++L Y+  + +ET R HPA P L+P E++    +
Sbjct  330   PEIIKRATEELDKVIGRDRWVEEKDIVNLPYVFAIAKETMRLHPAAPLLVPREASEDCNV  389

Query  1212  NGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAG  1391
             +GY IP  T I +NT  +GR+P+VWD+  +F PER     G  +++  G D+++LPF  G
Sbjct  390   DGYDIPKGTLILVNTWTIGRDPNVWDNPYEFIPERFI---GNNIDVK-GHDYELLPFGTG  445

Query  1392  KRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARP  1571
             +R CPG PLG+ ++  +LA L H F+W  P  ++ ED++  E++G+T P+  PL  V  P
Sbjct  446   RRMCPGYPLGLKVIQSSLANLLHGFNWRLPNDMKKEDLNMEEIFGLTTPRKIPLEVVVEP  505

Query  1572  RLQRHLYG  1595
             RL  HLY 
Sbjct  506   RLPHHLYS  513



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   372 bits (955),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 279/484 (58%), Gaps = 8/484 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG +PH   AA   +YGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPTPWPIVGNLPHLGTIPHHSLAALATRYGPLMHLRLGFVDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP +    H+AY   D+  AP GP+W+ +R+IC  HL   K L+ F   R E
Sbjct  90    AHDANFASRPLSSGGKHMAYNYQDLVFAPYGPRWRMLRKICSVHLFPAKSLDDFRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   +    ++  TV L ++L   + N + R++LG++ FG     G  +A EF  +
Sbjct  150   EVAILTRALVDAGKS--TVILGQLLNVCTTNALARVMLGRRVFGDGSGGGDPKADEFKDM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               EL  L G   +GD++P    +D  G  KKM+++  R D F   ILEEH+         
Sbjct  208   VVELTVLAGEFNIGDFIPALDILDLQGVTKKMKKLHTRFDSFLNTILEEHKTGGSGASAH  267

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
             +D +  L+SL     GE GK  + D EIKAL+ ++ AA TDTS+ T EWA+AE+I+ P +
Sbjct  268   VDLLSTLISLKDDADGEGGK--LSDTEIKALLLNLFAAGTDTSSSTVEWAIAELIRHPHL  325

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             +K+ QQE+D VVG DR+V+E DL  L +L+ +V+ETFR HP+ P  +P  ++ +  INGY
Sbjct  326   MKQAQQEMDTVVGQDRLVTELDLSQLTFLQAIVKETFRLHPSTPLSLPRIASESCEINGY  385

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  + + +N   + R+P +W +   F+P R  P          G DF+++PF AG+R 
Sbjct  386   NIPKGSTLLVNVWAIARDPKMWTNPLQFQPARFMPGGEKPNADVKGNDFEVIPFGAGRRI  445

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V +  A L  +FDW    GL P D++  E YG+T+ +A PL    RPRL 
Sbjct  446   CAGMSLGLRMVQLLTATLVQAFDWELANGLEPADLNMEEAYGLTLQRAAPLVVHPRPRLA  505

Query  1581  RHLY  1592
              H+Y
Sbjct  506   PHVY  509



>ref|XP_008347028.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008356594.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   372 bits (954),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 192/497 (39%), Positives = 285/497 (57%), Gaps = 11/497 (2%)
 Frame = +3

Query  96    IFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRL  275
             +  ++ +L   T   N K RLPPGP  +P+ GNL  LG  PHRD      K+G ++YLRL
Sbjct  10    LLALVYVLQAWTKSNNKKKRLPPGPRGFPLFGNLHMLGEFPHRDLHRLAQKHGDIMYLRL  69

Query  276   GSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRIC  455
             G    I  + P      L   D  FASRP   AA H+++G  +++    G  W+ MR++C
Sbjct  70    GLAPVIIASSPQAAELFLKTHDLNFASRPPLEAAKHISWGQRNLSFGEYGSYWRTMRKMC  129

Query  456   MEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQ  635
                LL+  ++ SF   R EE   L+  +   A +  TVNL   + + S +    M+ GK+
Sbjct  130   TLELLSAHKINSFKSTRKEELALLINFIQEAARDRVTVNLSAKVSSLSADISCLMVFGKK  189

Query  636   FFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDD  815
             +          +   F  +  E  HL      GDY+P    +D  G  K+M+ V K  DD
Sbjct  190   Y-----KDKELDEKGFKAVVQEGMHLAATPNFGDYIPFLAPLDLQGLTKRMKVVHKVFDD  244

Query  816   FHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSA  992
             F  KI++EH +S  E +   DFVDV+L   G    E+ +E   IKA++ DM++ + DT+A
Sbjct  245   FFEKIIDEHLQSTSE-ERPKDFVDVMLGFMGSVESEYRIERSNIKAIMLDMLSGSMDTTA  303

Query  993   VTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGP  1172
              + EW ++E++K P+++KK+Q+E++ VVG +RMV E+DL  L YL  VV+ET R HP  P
Sbjct  304   TSTEWTLSELLKHPQVMKKVQKEIENVVGMERMVEESDLEKLEYLDKVVKETMRLHPVAP  363

Query  1173  FLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEIS  1352
              L+PH +     +NG+HIP K+RI IN   +GRNPSVW D D F PER    DG  ++  
Sbjct  364   LLLPHAAIEDCNVNGFHIPGKSRIMINIWAIGRNPSVWTDADKFIPERF---DGSNIDF-  419

Query  1353  HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMT  1532
              G DF+ +PF +G+R CPG  LG+T+VL+ +A+L H FDW  P  + P ++D +E +G+T
Sbjct  420   RGRDFQFIPFGSGRRGCPGMQLGITMVLLLVAQLVHCFDWELPNNMLPTELDMTEEFGLT  479

Query  1533  MPKATPLFAVARPRLQR  1583
             +P+A  L A+   RL++
Sbjct  480   VPRANHLLALPTYRLRQ  496



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   372 bits (954),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 198/509 (39%), Positives = 288/509 (57%), Gaps = 22/509 (4%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
              L L  +  +  LL +          LPPGP   PI+GNL  LG LPHR       KYGP
Sbjct  8     ILILVFLTFLWSLLRLINASSRQSRTLPPGPMALPIIGNLHMLGDLPHRSLQNLAKKYGP  67

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             ++ +RLGS+  I  + P   +  L   D +FASRP+  A+ ++AYG   +A +  GP W+
Sbjct  68    IMSMRLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFSEYGPYWR  127

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTR  617
              +R++C   LL   ++ESFA  R EE   LV+ +   AE GE V+  E +G        R
Sbjct  128   HIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITYR  187

Query  618   MLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREV  797
             M+LG++           +  +   I  E   L G   + DYVP    +D  G  K+M+ V
Sbjct  188   MVLGRK---------NDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDVQGLTKRMKRV  238

Query  798   EKRVDDFHMKILEEHRKSKKEIDGE--MDFVDVLLSL------PGENGKEHMEDVEIKAL  953
              K VD    KI+++H +  +   G    DFVDVLLS       P +     +E    KA+
Sbjct  239   SKTVDQLLEKIIQDHEQGSRSEQGNHHKDFVDVLLSSIHQPLKPNDEEVYMLERTNAKAI  298

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             + DMIA A DTSA    W +AE+++ P+++K++Q+EL  V+G DRMV E+DL  L+YL  
Sbjct  299   LLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSM  358

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRP  1310
             VV+E+ R HP  P L+PH+S    T++GYHIP K+RIFIN   +GR+PSVW D+V++F P
Sbjct  359   VVKESLRLHPVAPLLVPHQSMEDITVDGYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYP  418

Query  1311  ERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGL  1490
             ER   ++   V++  G DF+++PF +G+R CP   LG+T V  AL  L H F+W  P G+
Sbjct  419   ERFMNSN---VDL-RGHDFQLIPFGSGRRGCPAMQLGLTTVRFALGNLLHCFNWELPSGM  474

Query  1491  RPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              P+D+D +E +G+++ KA  L A+   RL
Sbjct  475   LPKDLDMTEKFGLSLSKAKHLLAMPTCRL  503



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   372 bits (954),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 193/485 (40%), Positives = 284/485 (59%), Gaps = 24/485 (5%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP   PI+GNL  LG LPHR       KYGP++ +RLGS   I  + P      L  
Sbjct  35    LPPGPRALPIIGNLHMLGNLPHRSLQNLAKKYGPIMSMRLGSKTTIVVSSPKAAELFLKT  94

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D +FASRP+  ++ H++YG   +A +  GP W+ +R++C   LL+  R+E+FA  R EE
Sbjct  95    HDTIFASRPQVQSSKHMSYGTKAMAFSEYGPYWRHVRKLCTLQLLSPSRIEAFAPLRKEE  154

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
                LV+ +   AE GE V+L E +    +    RM+LG++           E  +   I 
Sbjct  155   VGLLVQSLKVAAEAGEVVDLSEKVSDLVVGITYRMVLGRK---------NNEMFDLKGII  205

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH----RKSKKEI  863
              E+  L G   + DYVP    +D  G  K+M+ + K VD    KI+++H    R  + + 
Sbjct  206   EEVMFLSGAFNISDYVPFLIPLDLQGLTKRMKRISKTVDQLFEKIIQDHEQVSRSEQVQG  265

Query  864   DGEMDFVDVLLSL------PGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
             +   DFVDVLLSL      P +      E    KA++ DMI+ + DTSA    W +AE++
Sbjct  266   NHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKAILLDMISGSFDTSATAIVWTLAELL  325

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             + P ++K++Q+EL  VVG DRMV E+DL  L+YL  VV+ET R HP GP LIPH+S    
Sbjct  326   RHPEVMKRLQKELQSVVGVDRMVEESDLPKLDYLSMVVKETLRLHPVGPLLIPHQSMEDV  385

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
              ++GYHIP K+R+FIN   +GR+P+VW D+V++F PER   ++   V++  G DF+++PF
Sbjct  386   IVDGYHIPKKSRVFINIWTIGRDPNVWSDNVEEFYPERFMNSN---VDL-QGHDFQLIPF  441

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              +G+R+CP   LG+T V +AL  L H F+W  P G+ P+D+D +E +G+++ KA  L A+
Sbjct  442   GSGRRRCPAMQLGLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAM  501

Query  1563  ARPRL  1577
                RL
Sbjct  502   PTHRL  506



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   372 bits (954),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 203/516 (39%), Positives = 293/516 (57%), Gaps = 13/516 (3%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             TL   F+   L F +  +L  K G  N    LPPGP  WPIVGNL  LG  PH   AA  
Sbjct  3     TLTLIFISSLLAFLLYSILK-KAG--NPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
               YGPL++LRLG V  +     S+  + L   D  F+SRP    A H+AY   D+  AP 
Sbjct  60    KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFS  599
             GP+W+ +R+IC  HL + K L+ F   R EE   L   +  +A  G+T VNL ++L   +
Sbjct  120   GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARAL--LASAGKTPVNLGQLLNVCT  177

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
              N + R++LG++ FG     G  +A EF  +  EL  L G+  LGD++P+   +D  G  
Sbjct  178   TNALGRVMLGRRVFGDGSGGGDPKADEFKSMVVELMVLAGVFNLGDFIPILDRLDLQGVA  237

Query  780   KKMREVEKRVDDFHMKILEEHR-KSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEI  944
              KM+++  R D F   ILEEH+      ++  +D +  L+SL     GE G   + D EI
Sbjct  238   GKMKKLHARFDAFLNTILEEHKINGSSGMEKHVDLLSTLISLKDNVDGEGGT--LTDTEI  295

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KAL+ D+  A TDTS+ T EWA+AE+I+ P++L + QQELD V+GS+R+V++ DL  L +
Sbjct  296   KALLLDLFTAGTDTSSSTVEWAIAELIRNPKLLAQAQQELDAVIGSNRLVTDADLPKLTF  355

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             ++ +V+E FR HP+ P  +P  +T    INGY IP  + + +N   + R+P +W D  +F
Sbjct  356   IQAIVKEAFRLHPSTPLSLPRMATENCEINGYFIPKGSTLLVNVWAIARDPDIWADPLEF  415

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
             RPER  P          G DF+++PF AG+R C G  LGV +V +  A L H+FDW  P 
Sbjct  416   RPERFLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGVRMVQLLTATLIHAFDWDLPN  475

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             G   E ++  E YG+T+ +A+PL    +PRL  ++Y
Sbjct  476   GQGAEKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   371 bits (953),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 194/483 (40%), Positives = 283/483 (59%), Gaps = 5/483 (1%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             + RLPPGP  WP+VGNL  LG  PHR+ AA    YGPL++LRLGSV+ +     S+  + 
Sbjct  26    RSRLPPGPKPWPLVGNLPHLGPAPHRNIAALARTYGPLMHLRLGSVNVVVAASASVAAQF  85

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  F+SRP    A H+AY   D+  AP GP+W+ +R+I   HL + K L+     R
Sbjct  86    LKTHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDGRYVR  145

Query  507   AEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEF  683
              EE   L      +A  G+  VNL ++L   + N + R++LG++ F    + G  +A EF
Sbjct  146   QEEVALLTRT---LASAGDAAVNLAQLLNICAANALGRVMLGRRVFSDGSACGDPKADEF  202

Query  684   MYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI  863
               +  E+  L G+  +GD+VP   W+D  G  +KM+ + +R D+F  KILEEHRK+    
Sbjct  203   KSMVVEVMVLSGVFNIGDFVPSLEWLDLQGVARKMKNLHRRFDEFLTKILEEHRKNGGGD  262

Query  864   DGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               + D + +L+S    +G E + D EIKAL+ +M  A TDTS+ T EWA+AE+++ P+IL
Sbjct  263   RKQTDLLSMLISSKESDG-EKLTDTEIKALLLNMFTAGTDTSSSTVEWAVAELLRNPKIL  321

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
               +++ELD VVG DR+V+E DL  L YL+ V++ETFR HP+ P  +P  ++    INGY 
Sbjct  322   AHLKRELDSVVGRDRLVTELDLPQLTYLQAVIKETFRLHPSTPLSLPRIASEGCEINGYE  381

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKC  1403
             IP  + + +N   + R+P VW    +FRPER  P          G DF+++PF AG+R C
Sbjct  382   IPKGSTLLVNVWAIARDPDVWAQPLEFRPERFLPGGEKASVDVRGNDFELIPFGAGRRIC  441

Query  1404  PGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQR  1583
              G  LG+ +V +  A L H+FDW   EG+ P  ++  E YG+T+ +A PL    +PRL  
Sbjct  442   AGMSLGLRMVQLMTATLVHAFDWDLEEGVDPLKLNMDEAYGLTLQRAAPLIVHPKPRLST  501

Query  1584  HLY  1592
               Y
Sbjct  502   QAY  504



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   371 bits (953),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 196/516 (38%), Positives = 284/516 (55%), Gaps = 22/516 (4%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             + LA+   CL  +F                 RLPPGP  WPI+GNL  +G  PHR   A 
Sbjct  8     VVLATVLFCLLFLFS-----------RRRNPRLPPGPNPWPIIGNLPHMGPKPHRALTAM  56

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
                YGP+++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  AP
Sbjct  57    VTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAP  116

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENG-ETVNLREVLGAF  596
              G +W+ +R+I   HL + K LE F   R EE   L  +   +A+ G + VNL +++   
Sbjct  117   YGQRWRMLRKISSVHLFSAKALEDFKHVRQEEVATLTRE---LAQVGTKAVNLGQLVNMC  173

Query  597   SMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
              +N + R ++G++ FGAD      +A EF  +  E+  L G+  +GD+VP   W+D  G 
Sbjct  174   VVNALGREMIGRRLFGADAD---HKAEEFRSMVTEMMSLAGVFNIGDFVPSLDWLDLQGV  230

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIK  947
               KM+ + KR D F   IL+EH  + ++       +  L+SL G   +     + D EIK
Sbjct  231   AGKMKRLHKRFDAFLSSILKEHEMNGQD-QKHTSMLSTLISLKGTDFDGDGGSLTDTEIK  289

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             AL+ +M  A TDTSA T +WA+AE+I+ P I+ K QQELD VVG DR+VSE+D+  L YL
Sbjct  290   ALLLNMFTAGTDTSASTVDWAIAELIRHPDIMTKAQQELDSVVGRDRLVSESDISQLPYL  349

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             + +++E FR HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   F+
Sbjct  350   QAIIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFK  409

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PER  P          G+DF+++PF AG+R C G  LG+  + M  A L H F+W    G
Sbjct  410   PERFLPGGEKAGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQMLTATLVHGFEWELAGG  469

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             + PE ++  E YG+T+ +A PL    +PRL  ++YG
Sbjct  470   VTPEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYG  505



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   371 bits (953),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 193/512 (38%), Positives = 296/512 (58%), Gaps = 7/512 (1%)
 Frame = +3

Query  75    FFLCLSLIFKIIQ--LLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
              F+ +SL+F ++   L  +++      +RLPPGP   PI+GNL  +G +PH   AA    
Sbjct  3     LFILVSLLFGVLIYFLFNIRSFFNRKSLRLPPGPKPRPIIGNLPHMGPMPHHSLAALART  62

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGP+++LRLG VD I     S+  + L   D  F+SRP    A ++AY   D+   P G 
Sbjct  63    YGPIMHLRLGFVDVIVAASASVAAQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFRPYGA  122

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
             KW+ +R+I   HL + K L+ +   R  E   L   +       E VNL ++L   ++N 
Sbjct  123   KWRLLRKITSVHLFSGKALDDYRLVRQGEVAVLTRALASAGLKSELVNLAQLLNVCTVNA  182

Query  609   VTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKM  788
             ++R++LG++ FG        +A EF  +  E+  L G+  +GD++P   W+D  G   KM
Sbjct  183   LSRVMLGRRVFGDGTGGKDPKADEFKSMVVEVMVLAGVFNIGDFIPSLEWLDLQGVAAKM  242

Query  789   REVEKRVDDFHMKILEEHRKSKKEIDG-EMDFVDVLLSL--PGENGKEHMEDVEIKALIQ  959
             +++ KR D F  +I+EEH+ +  +  G + D +  L+SL    ++G+E + + EIKAL+ 
Sbjct  243   KKLHKRFDKFLGEIVEEHKMNIHDAKGKQTDLLSTLISLMENPDDGEEKLTETEIKALLL  302

Query  960   DMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVV  1139
             +M  A TDTS+ T EWA+AE+I+ P IL +++ ELD VVG DR+V+E DL  L Y + V+
Sbjct  303   NMFTAGTDTSSSTTEWAIAELIRHPEILTRVKNELDSVVGRDRLVTELDLPKLTYFQAVI  362

Query  1140  RETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERH  1319
             +ETFR HP+ P  +P  + ++  INGYHIP  + + +N   + R+P  W +   FRPER 
Sbjct  363   KETFRLHPSTPLSLPRVAAKSCEINGYHIPEGSTLLVNVWAIARDPDEWAEPLVFRPERF  422

Query  1320  FP-ADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRP  1496
              P  +   V++  G D++I+PF AG+R C G  LG+ +V +  A L H+FDW  P GL P
Sbjct  423   LPGGEKANVDV-RGNDYEIIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDWDFPSGLTP  481

Query  1497  EDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             E ++  E YG+T+ +A PL    RPRL    Y
Sbjct  482   EKLNMEEAYGLTLQRADPLIVHPRPRLTPKAY  513



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 194/512 (38%), Positives = 286/512 (56%), Gaps = 9/512 (2%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPL  260
             L L+++   +    +         RLPPGP  WPIVGNL  +G  PH+  AA    YGP+
Sbjct  4     LFLTIVLATVLFCLLFLFSLRRNHRLPPGPNPWPIVGNLPHMGTKPHQTLAAMVTTYGPI  63

Query  261   VYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKR  440
             ++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  AP G +W+ 
Sbjct  64    LHLRLGFVDVVVAASKSVAEQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  441   MRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRM  620
             +R+I   HL + K LE F   R EE   L  ++  +    + VNL +++    +N++ R 
Sbjct  124   LRKISSVHLFSAKALEDFKHIRQEEVGTLSGELARVGT--KAVNLGQLVNMCVINSLGRE  181

Query  621   LLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVE  800
             ++G++ FG D      +A EF  +  E+  L G+  +GD+VP   W+D  G   KM+ + 
Sbjct  182   MIGRRLFGPDAD---HKAEEFRSMVTEMMALAGVFNIGDFVPSLDWLDLQGVAGKMKRLH  238

Query  801   KRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIKALIQDMIA  971
             KR D F   ILEEH  + ++     D +  L+SL G   +     + D EIKAL+ +M A
Sbjct  239   KRFDAFLSSILEEHEMNGQD-QKHTDMLSTLISLKGTDFDGDGGSLTDTEIKALLLNMFA  297

Query  972   AATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETF  1151
             A TDTSA T +WA+AE+I+ P I+ K Q+ELD VVG DR+V+E+D+  L YL+ V++E F
Sbjct  298   AGTDTSASTVDWAIAELIRHPDIMTKAQEELDSVVGRDRLVNESDISQLPYLQAVIKENF  357

Query  1152  RTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPAD  1331
             R HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   F+PER  P  
Sbjct  358   RLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGG  417

Query  1332  GGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDT  1511
                     G+DF+++PF AG+R C G  LG+  + +  A L H F+W    G+ PE ++ 
Sbjct  418   EKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQILTATLVHGFEWELAGGVTPEKLNM  477

Query  1512  SEVYGMTMPKATPLFAVARPRLQRHLYGSR*G  1607
              E YG+T+ +A PL    +PRL  ++YG R G
Sbjct  478   EEKYGLTLQRAVPLVVHPKPRLAPNVYGLRSG  509



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 205/516 (40%), Positives = 299/516 (58%), Gaps = 14/516 (3%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             +T  +F L    +   + LL V  G  +   RLPPGP  WPIVGNL  LG  PH+  A+ 
Sbjct  1     MTPVTFLLTNFAVASFVYLL-VNNGHPH---RLPPGPRPWPIVGNLPHLGPKPHQSLASL  56

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
                YGPL++LRLGSVD +     S+  + L   D  F +RP    A ++AY   D+  AP
Sbjct  57    ARSYGPLMHLRLGSVDVVVAASASVAAQFLKTNDANFVNRPPNSGAKYIAYNYQDLVFAP  116

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              GP+W+ +R++   HL + K L+ F   R EE   LV  +   + +   VNL ++L   +
Sbjct  117   YGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLVHAL--TSASNSLVNLGQLLNVCT  174

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
              N + R++LGK+ FG        +A EF  +  E+  L G+  LGD+VP     D  G  
Sbjct  175   TNALARVMLGKRVFGDGSGGVDPKADEFKDMVVEVMVLAGVFNLGDFVPALERFDLQGVA  234

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEIK  947
              KM+ +  R D F   ILEEH+ +   +  + DF+  L+SL     GE GK  + D+EIK
Sbjct  235   TKMKNLHARFDSFLGNILEEHKMNSDGVKQQNDFLSKLISLKDDVDGEGGK--LTDIEIK  292

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             AL+ +M  A TDTS+ T EW +AE+I+ P+IL + QQE+D VVG DR+V+E DL +L +L
Sbjct  293   ALLLNMFTAGTDTSSSTVEWGIAELIRHPKILAQAQQEIDSVVGRDRLVTELDLPNLPFL  352

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             + VV+ETFR HP+ P  +P  ++++  INGY+IP  + + +N   + R+P+VW +  +FR
Sbjct  353   QAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIARDPNVWAEPLEFR  412

Query  1308  PERHFPADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
             P+R  P  G +  I   G DF+++PF AG+R C G  LG+ +V +  A L H+FDW  PE
Sbjct  413   PDRFLPG-GEKPNIDIKGNDFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDWGLPE  471

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             G  PE +   E YG+T+ +A PL    +PRL  H+Y
Sbjct  472   GQIPEKLQMEEAYGLTLQRAVPLVLYPQPRLSSHVY  507



>ref|XP_011005615.1| PREDICTED: cytochrome P450 71A1-like [Populus euphratica]
Length=507

 Score =   370 bits (951),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 192/504 (38%), Positives = 297/504 (59%), Gaps = 15/504 (3%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGK-ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
             L    IF ++ L  +  GK +N K+ LPP P + PI+GNL QLG +PH        KYGP
Sbjct  15    LLFVTIFLLVALKFLMKGKLKNRKLNLPPSPAKLPIIGNLHQLGNMPHISLRGLAKKYGP  74

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             +++L+LG +  +  +   + +E+L   D V ASRP+  +A HL YGC D+A AP G  W+
Sbjct  75    IIFLQLGEIPTVVISSAGLAKEVLKTHDLVLASRPQLFSAKHLFYGCTDIAFAPYGAYWR  134

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGE-TVNLREVLGAFSMNNVT  614
              +R+IC+  LL+ KR++ ++  R EE   L+  +   AE+   T NL +++G ++ + + 
Sbjct  135   NIRKICVLELLSAKRVQWYSFVREEEVARLIHRI---AESYPGTTNLSKMIGLYANDVLC  191

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPY-GCEKKMR  791
             R+ LG+ F G     G  +   F  +  +   LLG   LGDY P   ++    G + K++
Sbjct  192   RVALGRDFSGG----GEYDRHGFQKMLDDYQALLGGFSLGDYFPSIEFVHSLTGMKSKLQ  247

Query  792   EVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMI  968
                +R D F  K++ EH+ S+ +   + D VDVLL +  +   E  +    IKA+I DM 
Sbjct  248   YTVRRFDQFFDKVITEHQNSEGKQMEKKDLVDVLLDIQKDGSSEMPLAMDNIKAVILDMF  307

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
             AA TDT+ +T +W M E+I  P+ ++K Q E+  VVG   +V E+DL  L+Y++ V++E 
Sbjct  308   AAGTDTNFITLDWTMTELIMNPKFMEKAQAEVRSVVGDRIVVQESDLPRLHYMKAVIKEI  367

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPA  1328
             FR HPA P L+P ES     I+GY+IPAKTRI++N  G+GR+P +W++ + F PER    
Sbjct  368   FRLHPAVPVLVPRESLEDVIIDGYNIPAKTRIYVNAWGMGRDPELWENPETFEPERFM--  425

Query  1329  DGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDID  1508
              G  ++   G DF+++PF AG+R CP    G+  V +ALA+L HSFDW  P G++ +DID
Sbjct  426   -GSSIDFK-GQDFELIPFGAGRRSCPAITFGIATVEIALAQLLHSFDWELPPGIKAQDID  483

Query  1509  TSEVYGMTMPKATPLFAVARPRLQ  1580
              +E +G++M +  PL   A+P   
Sbjct  484   NTEAFGISMHRTVPLHVTAKPHFN  507



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 208/527 (39%), Positives = 301/527 (57%), Gaps = 18/527 (3%)
 Frame = +3

Query  36    KVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRL  215
              +  ++  I LA    CL    +  + +P +        RLPPGP  WPI+GNL QLG  
Sbjct  3     SIFTILGSILLAVLLFCLFNQLRSRRSVPGR--------RLPPGPRPWPIIGNLPQLGPA  54

Query  216   PHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYG  395
             PH+  AA   K+GPL++LR G VD +     S+  + L   D  F SRP + AA H+ Y 
Sbjct  55    PHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAKHVGYN  114

Query  396   CGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VN  572
               D+ LAP GP+W+ MR+I   HLL+ K LE F   R EEA  L+    G+A  G T +N
Sbjct  115   YHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIR---GLANAGPTAIN  171

Query  573   LREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLW  752
             L ++L   + N + R +LG + FG         A EF  +  E   + G+  +GD+VP  
Sbjct  172   LAQLLHLCTTNTLGRAMLGYRVFGDGSGKSDPRADEFKSMVVEALAVAGVFNIGDFVPAL  231

Query  753   RWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGE-NGKE--  923
              W+D  G   +M++V KR D F  +I+EEH K+        D +  LLS+  + +G E  
Sbjct  232   EWLDLQGVVARMKKVHKRFDAFLTRIIEEH-KANAGNGKHTDMLTTLLSVKEDADGHEGG  290

Query  924   HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSEN  1103
              + + EIKAL+ ++  A TDTS+ T EWA+AE+I+ P+IL ++Q+ELD VVG DR+VSE 
Sbjct  291   KLTETEIKALLLNIFIAGTDTSSSTVEWAIAELIRHPKILAQVQEELDRVVGRDRLVSEL  350

Query  1104  DLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSV  1283
             DL  L YL+ +V+ETFR HP+ P  +P  +     INGYHIP  T + +N   + R+P+ 
Sbjct  351   DLPQLTYLKALVKETFRLHPSTPLSLPRIAAENCDINGYHIPKGTTLLVNVWAIARDPAE  410

Query  1284  WDDVDDFRPERHFPADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFH  1460
             W D   FRPER  P  G + E+   G DF+++PF +G+R C G  LG+  V +  A L H
Sbjct  411   WTDPLLFRPERFLPG-GEKAEVDVRGNDFEVIPFGSGRRMCVGMRLGLRTVQLLTASLVH  469

Query  1461  SFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGSR  1601
             +F++    GL PE ++  E YG+T+ +A+PL     PRL  H+Y ++
Sbjct  470   AFNFGLANGLVPEKLNMDEAYGLTLQRASPLMVHPWPRLSEHVYEAK  516



>ref|XP_007209911.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
 gb|EMJ11110.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
Length=513

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 194/490 (40%), Positives = 280/490 (57%), Gaps = 24/490 (5%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             +LPPGP   PI+GNL  LG LPHR       KYGP++ +RLG+  AI  + P+     L 
Sbjct  36    KLPPGPRALPIIGNLHMLGNLPHRSLQHLAKKYGPIMSMRLGNTPAIVVSSPTAAELFLK  95

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D +FASRP+  A+ +++YG   +A    GP W+ +R++C   LL   ++E FA  R E
Sbjct  96    THDTIFASRPKVQASEYMSYGTKGMAFTEYGPYWRHIRKLCTLQLLCPSKIEGFAPLRRE  155

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E    ++ +   A  GE V+L E +G    +   RM+LG         S   +  +    
Sbjct  156   EVGLFIQSLKKAAAAGEMVDLSEKVGGLVEDITYRMVLG---------SKNDDMFDLKGT  206

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK----E  860
               E   L G   +GDY+P    +D  G  K+M+ + K +D    KI+ EH +  K    +
Sbjct  207   IEEALFLSGAFNIGDYMPFLSPLDLQGLAKRMKRISKTIDQLFEKIIGEHEQVSKSGQVQ  266

Query  861   IDGEMDFVDVLLSL------PGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
                  DFVDVLLSL      P +     ME   +KA++ DMI+ A DTSA    W +AE+
Sbjct  267   DHSHKDFVDVLLSLIHQPLNPNDEQVYMMERTNVKAILLDMISGAFDTSATAIVWTLAEL  326

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             ++ PR++K +Q E+  V+G+DRMV E+DL  L YL  VV+E+ R HP  PFLIPHES   
Sbjct  327   LRHPRVMKHLQGEIQSVIGTDRMVEESDLPKLGYLSMVVKESLRLHPVAPFLIPHESMED  386

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRPERHFPADGGRVEISHGADFKILP  1379
              T+ G+ +P K+RIFINT  +GR+P VW ++V++F PER      G +++  G DF++LP
Sbjct  387   ITVEGFDVPKKSRIFINTWAIGRDPKVWSENVEEFYPERFI---DGNIDL-RGHDFQLLP  442

Query  1380  FSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFA  1559
             F +G+R CP   LG+  V +ALA L H F+W  P GL+PED+D +E +G+++ KA  LFA
Sbjct  443   FGSGRRGCPAMQLGLITVRLALANLVHCFNWELPSGLKPEDLDMTEKFGLSLSKAKHLFA  502

Query  1560  VARPRLQRHL  1589
             +   RL   L
Sbjct  503   MPTYRLCNQL  512



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   370 bits (950),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/481 (40%), Positives = 284/481 (59%), Gaps = 12/481 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K +LPPGP  +PI+GNL  LG+ PH D      KYGPL+YLRLG V  I  + P +  + 
Sbjct  27    KKKLPPGPRGFPILGNLPLLGKNPHHDLHKLAKKYGPLMYLRLGFVPTILVSSPEVAEQF  86

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +FASRP   AA H++Y    +A AP GP W+ +R++C   LL+  ++ SF   R
Sbjct  87    LKTHDLIFASRPPHEAAKHISYEQRSLAFAPYGPYWRNIRKMCTLELLSNAKIYSFRSMR  146

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
              +E   LV  +   + +   ++L   + + S +    M+ GK++   +      +   F 
Sbjct  147   RDEVSLLVNFLKDASHDHMAIDLSAKISSLSADMSCLMVFGKKYMDRE-----FDERGFK  201

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
              +  E+  L     +GDYVP     D  G  K+M+ V +  D F  KI++EH ++KKE  
Sbjct  202   AVVQEVMVLTATPNIGDYVPFLASFDLQGLTKRMKAVSRVFDAFFEKIIDEHLETKKEEG  261

Query  867   GEMDFVDVLLSLPGEN-GKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
                DFVDV+L + G N G+ H++   IKA+I DM+A + DTSA   EWAMAE+IK PR +
Sbjct  262   QTKDFVDVMLGIMGLNEGEYHIDRPHIKAIILDMLAGSMDTSATAIEWAMAELIKHPRAM  321

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
             KK+++EL++  G +R+V E+DL  L+YL  V++ET R HP  P L+PHE+T   T+NG+H
Sbjct  322   KKLREELEKAAGLNRVVEESDLEGLDYLHMVIKETMRLHPVAPLLLPHEATEDCTVNGFH  381

Query  1224  IPAKTRIFINTHGLGRNPSVWD--DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             IP K+R+ +N   +GR+P VW   D ++F PER     G  V++  G DF++LPF  G+R
Sbjct  382   IPYKSRVIVNVWSIGRDPKVWTTHDPEEFVPERFL---GSSVDVK-GRDFQLLPFGTGRR  437

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG  LG+T+V   +A+L H FDW  P G+ P ++D +E +G+  P+A  L    R RL
Sbjct  438   GCPGMQLGLTVVRFVVAQLVHCFDWELPSGMSPSELDMTEKFGLATPRAKHLVVTPRYRL  497

Query  1578  Q  1580
              
Sbjct  498   S  498



>ref|XP_006381618.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
 gb|ERP59415.1| hypothetical protein POPTR_0006s14370g [Populus trichocarpa]
Length=510

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 186/477 (39%), Positives = 286/477 (60%), Gaps = 10/477 (2%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GN   LG LPH+       KYG  + L+ GS     T+   I ++IL   D +FAS
Sbjct  40    WPIIGNFDLLGPLPHQSLHQLSLKYGKTMQLQFGSYPVFVTSSLDIAKQILKTYDHMFAS  99

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RP+T A  +  Y   D+A AP GP W++ R+I +  L + KRLES+   R EE R     
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRIEEMREFTRR  159

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAME-FMYITHELFHL  713
             ++     G+T+ L++ L  ++++ ++R++LGK++F A ES      +E F  +  ELF L
Sbjct  160   LY--RNCGKTIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLL  217

Query  714   LGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM--DFVD  887
              G++ +GD++P   ++D  G  K+M+E++ R D FH  +++EH   +K        D VD
Sbjct  218   NGVLNIGDWIPWLDFLDMQGYVKRMKELKVRFDRFHDHVIDEHNAKRKATKNWQPKDMVD  277

Query  888   VLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQEL  1064
             +LL L  +   E  +    IK L QD+IA  TDT+A   +W+M+E++K+P++ K++  EL
Sbjct  278   LLLQLADDPELEVKLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDEL  337

Query  1065  DEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRI  1244
             D VVG DR V E D+  L Y+  +++E  R HP+   L PH + + + + GY IP  TRI
Sbjct  338   DRVVGRDRWVEEKDIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTRI  397

Query  1245  FINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGV  1424
             FINT  +GR+P +W+D +DFRPER     G  ++I  G +F++LPF +G+R CPG PLG 
Sbjct  398   FINTWSMGRDPDLWEDPEDFRPERFI---GKGIDIK-GHNFELLPFGSGRRMCPGYPLGT  453

Query  1425  TLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              ++L++LA + H F W  P G++P+D+   EV+G+   +  P  AVA+PRL  HLY 
Sbjct  454   KMILVSLANMLHGFTWELPPGMKPQDVKRDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_002303241.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
 gb|EEE78220.1| hypothetical protein POPTR_0003s06460g [Populus trichocarpa]
Length=512

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/488 (38%), Positives = 289/488 (59%), Gaps = 13/488 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+  PPGP  WPI+GNL  +G LPHR   A   KYGPL+ ++ GS   +  +   + + I
Sbjct  30    KLNPPPGPKSWPIIGNLNLIGELPHRSLHALSQKYGPLMQVKFGSFPVVVGSSVEMAKTI  89

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +F+ RP+T A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R
Sbjct  90    LKTHDVIFSGRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIR  149

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM---  677
              EE R L++ +     +G  +NL++ L   S+N ++RM+LGK++     S   +E +   
Sbjct  150   VEELRALLKTL--NKSSGRPINLKDHLADVSLNVISRMVLGKKY-TVKSSENEKEIVTPE  206

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK  857
             EF  +  ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   +K
Sbjct  207   EFKEMLDELFLLNGVLDIGDSIPWIAFLDLQGYIKRMKTLSKKFDKFMEHVLDEHEARRK  266

Query  858   EIDG--EMDFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
             E       D VDVLL L  + N +  +E   +KA  QD+IA  T++SAVT EW ++E+++
Sbjct  267   EDKNWEPKDMVDVLLQLASDPNLEIKLERHGVKAFSQDLIAGGTESSAVTVEWGISEILR  326

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
             +P + +K  +ELD V+G +R V E D+++L Y+  + +E  R HP  P L+P  +     
Sbjct  327   KPEVFEKATEELDRVIGRERWVEEKDMVNLPYIYAIAKEVMRLHPVAPMLVPRAAREDIN  386

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSA  1388
             INGY I   +R+ +N   +GR+P VWD  D+F PER     G  +++  G D+++LPF A
Sbjct  387   INGYDIKKGSRVLVNVWTIGRDPKVWDKPDEFFPERFI---GNSIDV-RGHDYELLPFGA  442

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             G+R CPG PLG+ ++   L+ L H F W  P+G + +D++  E++G++ PK  PL AVA 
Sbjct  443   GRRMCPGYPLGLKVIQATLSNLLHGFKWRLPDGQKKDDLNMDEIFGLSTPKKYPLVAVAE  502

Query  1569  PRLQRHLY  1592
             PRL  H+Y
Sbjct  503   PRLPAHVY  510



>ref|XP_003578185.1| PREDICTED: cytochrome P450 71A1-like [Brachypodium distachyon]
Length=521

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/518 (37%), Positives = 301/518 (58%), Gaps = 15/518 (3%)
 Frame = +3

Query  69    ASFF-LCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             ASF  + L+ +  +  +L  + G       LPPGP  WPI+GNL  +G LPHR   A   
Sbjct  7     ASFLGVVLATVVFLKAVLRRRGGSPKRTYNLPPGPKPWPIIGNLNLIGTLPHRSIHALSK  66

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
             +YGPL+ L+ GS   +  +   + +  L   D VF  RP+T A  H  Y   D+  +P G
Sbjct  67    QYGPLMQLQFGSFPVVVGSSVDMAKFFLKTHDVVFTDRPKTAAGKHTTYDYSDITWSPYG  126

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
               W++ R+IC+  L + KRLES+   R EE   L+ D+ G   +G  V L++ L   S+N
Sbjct  127   AYWRQARKICLTELFSAKRLESYEYIRGEEVLALLRDLHG--ASGRVVVLKDFLSTVSLN  184

Query  606   NVTRMLLGKQFFGADESSGPQEAM----EFMYITHELFHLLGLIYLGDYVPLWRWIDPYG  773
              +TRM++GK++   +        +    EF ++  ELF L G++ +GD +P   W+D  G
Sbjct  185   VITRMVMGKKYLEKEVKDEAGAVITTPDEFKWMLDELFLLNGVLNIGDSIPWLDWMDLQG  244

Query  774   CEKKMREVEKRVDDFHMKILEEH-RKSKKEIDG--EMDFVDVLLSLPGENGKEHMEDVE-  941
               K+M+++ K  D F   +++EH  + ++E +G    D VDVLL +  +   E   + E 
Sbjct  245   YIKRMKKLSKMFDRFLEHVVDEHSERCRREGEGFVAKDMVDVLLQVASDPDLEVKLNREG  304

Query  942   IKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLN  1121
             +KA  QDMIA  T++SAVT EWA++E++K+P +  K  +ELD VVG  R V+E D+  L 
Sbjct  305   VKAFTQDMIAGGTESSAVTVEWALSELLKKPEVFAKATEELDRVVGRGRWVTEKDMASLP  364

Query  1122  YLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDD  1301
             Y+  +V+ET R HP  P L+P  S   T+I G+ IPA TR+ ++   +GR+P++WD  ++
Sbjct  365   YVEAIVKETMRLHPVAPLLVPRLSREDTSIGGHDIPAGTRVLVSVWSIGRDPALWDKPEE  424

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER     G R+++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F W  P
Sbjct  425   FAPERFL---GSRIDV-KGQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFAWRLP  480

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +G+  E++   E++G++ P+ +PL AV  P+L   LY 
Sbjct  481   DGVTKEELSMEEIFGLSTPRKSPLEAVVEPKLPAQLYA  518



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   370 bits (951),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 190/486 (39%), Positives = 287/486 (59%), Gaps = 14/486 (3%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WP+VGNL  LG +PH   AA   KYGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPTPWPVVGNLPHLGTIPHHSLAAMAKKYGPLMHLRLGFVDVVVAASASVAAQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FA RP    A H+AY   D+  AP GP+W+ +R+IC  HL +TK L+ F   R E
Sbjct  90    THDANFADRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G  ++   V L ++L   + N + R++LG++ F     SG  +A EF  +
Sbjct  150   EVAILARALVGAGKS--PVKLGQLLNVCTTNALARVMLGRRVF----DSGDAQADEFKDM  203

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE--ID  866
               EL  L G   +GD++P+  W+D  G  KKM+++  + D F   ILEEH+    +    
Sbjct  204   VVELMVLAGEFNIGDFIPVLDWLDLQGVTKKMKKLHAKFDSFLNTILEEHKTGAGDGVAS  263

Query  867   GEMDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRP  1034
             G++D +  L+SL     GE GK  + D+EIKAL+ ++  A TDTS+ T EWA+AE+I+ P
Sbjct  264   GKVDLLSTLISLKDDADGEGGK--LSDIEIKALLLNLFTAGTDTSSSTIEWAIAELIRNP  321

Query  1035  RILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTIN  1214
             ++L + ++E+D +VG DR+V+E+DL  L +L+ +++ETFR HP+ P  +P  +  +  + 
Sbjct  322   QLLNQARKEMDTIVGQDRLVTESDLGQLTFLQAIIKETFRLHPSTPLSLPRMALESCEVG  381

Query  1215  GYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGK  1394
             GY+IP  + + +N   + R+P +W D  +F+P R  P          G DF+++PF AG+
Sbjct  382   GYYIPKGSTLLVNVWAISRDPKIWADPLEFQPTRFLPGGEKPNTDIKGNDFEVIPFGAGR  441

Query  1395  RKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPR  1574
             R C G  LG+ +V +  A L H+FDW   +GL P+ ++  E YG+T+ +A PL    RPR
Sbjct  442   RICVGMSLGLRMVQLLTATLIHAFDWELADGLNPKKLNMEEAYGLTLQRAAPLVVHPRPR  501

Query  1575  LQRHLY  1592
             L  H+Y
Sbjct  502   LAPHVY  507



>gb|ADC34701.1| flavonoid 3' hydroxylase [Actinidia chinensis]
Length=511

 Score =   370 bits (950),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/490 (38%), Positives = 294/490 (60%), Gaps = 17/490 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPHR       +YGP+++LR GS   +  +  +  +  
Sbjct  31    KLNLPPGPKPWPIIGNLNLIGSLPHRSLHDLSQQYGPIMHLRFGSFPVVVGSSVAAAKTF  90

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  FASRP+T A  H  Y   D+  +P G  W++ R++C+  L +TKRLES+   R
Sbjct  91    LKTMDVTFASRPKTAAGKHTTYNYSDITWSPYGAYWRQARKMCLTELFSTKRLESYEYIR  150

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAME  680
              EE R L+++++  A  G  + +++ L   S+N ++RM+LG+++  A ESS   P++   
Sbjct  151   IEEMRSLIKEIYQSA--GTPIMIKDNLSTVSLNVISRMVLGRRYLDASESSVVTPED---  205

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  ELF L G+  +GD +P   ++D  G  K+M+ V K+ D F   +L+EH + ++E
Sbjct  206   FKKMLDELFLLNGVFNIGDSIPWIDFLDLQGNVKRMKVVAKKFDKFLEHVLDEHNEKRRE  265

Query  861   IDG----EMDFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
              +G      D VDVLL L  + N    +E   +KA  QD++A  T++SAVT EWA++E++
Sbjct  266   -EGVGFVAKDMVDVLLQLADDPNLDIKLERHGVKAFTQDLLAGGTESSAVTVEWAISELL  324

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             K+P+I K   +ELD V+G  R V E D+ +L Y+  +V+ET R HP  P L+P  +    
Sbjct  325   KKPKIFKMATEELDRVIGKSRWVEEKDIPNLPYIEAIVKETMRMHPVAPMLVPRLTREDC  384

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              ++GY I   TR+ +N   +GR+P +WD+ ++F PER     G  +++  G DF++LPF 
Sbjct  385   QVDGYDIQEGTRVLVNVWTIGRDPELWDEPNEFCPERFI---GKSIDVK-GQDFELLPFG  440

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R CPG  LG+ ++  +LA L H F W+ P  ++ +D++  E++G++ P+  PL  VA
Sbjct  441   SGRRMCPGYSLGLKVIQASLANLLHGFTWNLPANMKVDDLNMDEIFGLSTPRKVPLATVA  500

Query  1566  RPRLQRHLYG  1595
              PRL  HLY 
Sbjct  501   EPRLPPHLYA  510



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 194/501 (39%), Positives = 286/501 (57%), Gaps = 10/501 (2%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
             ++ LSLI     +  +    +N   RLPPGP   PI+GNL  LG LPH+D      KYGP
Sbjct  5     WIALSLIALAYVVRALLNISKNKHKRLPPGPRGIPILGNLHMLGELPHQDLLRLAKKYGP  64

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             ++Y+R   V  I  + P    + L   D VFA RP    +  ++Y    ++    GP W+
Sbjct  65    IMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPHEGSRIVSYDRKGISFTDYGPYWR  124

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTR  617
              MR++C   LL+  R+ SF   R EE   L++ +   A     V+L   + + S +   R
Sbjct  125   NMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEAALARTAVDLSAKISSLSADMSCR  184

Query  618   MLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREV  797
             M+ GK++   D      +   F  +  E   L G   +GDY+P    +D  G  ++M+ +
Sbjct  185   MIFGKKYMDKD-----IDERGFKAVIQEGMQLAGAPNIGDYIPFVAPLDLQGLARRMKAI  239

Query  798   EKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAA  974
              K  D F  KI+++H    KE     D +DV+L   G    E  +E   IKAL+ DM+A 
Sbjct  240   SKVFDAFFEKIIDDHIHEPKEEGQPKDLIDVMLGYMGSKENEFQIERSNIKALVLDMLAG  299

Query  975   ATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFR  1154
             + DTSA   EWA+AE++K PRI+KK+Q+EL++VVG +R V E+DL  L YL  VV+ET R
Sbjct  300   SMDTSATAIEWALAELLKNPRIMKKVQEELEKVVGMERKVEESDLESLEYLDMVVKETLR  359

Query  1155  THPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG  1334
              HP  P LIPHES    T+NG+HIP K+R+ +NT+ +GR+P+VW D + F PER     G
Sbjct  360   LHPVAPLLIPHESLEDCTVNGFHIPQKSRVMVNTYAIGRDPNVWTDAEKFLPERFI---G  416

Query  1335  GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTS  1514
               +++  G DF+++PF +G+R CPG  LG+T+V + LA+L H FDW  P G+ P ++D +
Sbjct  417   SSIDL-RGRDFQLIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMT  475

Query  1515  EVYGMTMPKATPLFAVARPRL  1577
             E +G+T+P+A  + AV   RL
Sbjct  476   EEFGLTVPRAKHILAVPTYRL  496



>ref|XP_008227118.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 195/486 (40%), Positives = 291/486 (60%), Gaps = 16/486 (3%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSII  317
             +N K RLPPGP  +PI G+L  LG  PH+D      KYG ++Y+RLG +  I  + P   
Sbjct  22    KNKKKRLPPGPTGFPIFGSLHLLGEFPHKDLHRLARKYGHIMYMRLGLMHTIVISSPEAA  81

Query  318   REILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFA  497
                L   D VFASRP   ++ H+++G  ++  +  G  W+  R++C   LL+  ++ SF 
Sbjct  82    ELFLKTHDLVFASRPPHESSKHISFGQKNLIFSEYGVYWRDTRKMCTIELLSNHKINSFK  141

Query  498   KHRAEEARHLVEDVWGMAEN-GETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEA  674
               R EE    VE +   A N G  V+L + + + S++   RM+LGK++   DE    +  
Sbjct  142   SMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSCRMVLGKKY--KDEEFDERG-  198

Query  675   MEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSK  854
               F  +  E   L     LGDY+P    +D  G  K+M+ V K  D+   KI+EEH K  
Sbjct  199   --FKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAFDNLFEKIIEEHLKPN  256

Query  855   KEIDGE--MDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
                DGE   DFVDV++   G    E+ +E   IKA++ DM+ A+ DTS+ T EWA++E++
Sbjct  257   ---DGERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASMDTSSTTIEWALSELM  313

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             + P+ +KK+Q+EL+ VVG D+MV E+DL  L+YL  VV+ETFR HP  P L+PH ST   
Sbjct  314   RHPKAMKKVQKELENVVGLDKMVEESDLGKLDYLNMVVKETFRLHPVAPLLVPHASTEDC  373

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
             T+NGYHIP K+R+ IN    GR+P+ W D + F PER    +G  V+++ G  F+++PF 
Sbjct  374   TVNGYHIPKKSRVLINVWATGRDPNAWTDAEKFIPERF---EGSSVDVT-GNHFQLIPFG  429

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R+CPG  LG+T+V + LA+L H FDW  P  + PE++D +E +G+T+P+A  L A+ 
Sbjct  430   SGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIP  489

Query  1566  RPRLQR  1583
               RL++
Sbjct  490   SYRLRK  495



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 197/509 (39%), Positives = 289/509 (57%), Gaps = 22/509 (4%)
 Frame = +3

Query  78    FLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGP  257
              L L L+  +  LL +         +LPPGP   P++GNL  LG LPHR       KYGP
Sbjct  8     ILILVLLTFLWSLLRLINASSRQGRKLPPGPSALPVIGNLHMLGDLPHRSLQNLAKKYGP  67

Query  258   LVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWK  437
             ++ + LGS+  I  + P   +  L   D +FASRP+  A+ ++AYG   +A    GP W+
Sbjct  68    IMSMHLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFTEYGPYWR  127

Query  438   RMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTR  617
              +R++C   LL   ++ESFA  R EE   LV+ +   AE GE V+  E +G        R
Sbjct  128   HIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITYR  187

Query  618   MLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREV  797
             M+LG++           +  +   I  E   L G   + DYVP    +D  G  K+M+ V
Sbjct  188   MVLGRK---------NDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRV  238

Query  798   EKRVDDFHMKILEEHRKSKKEIDGE--MDFVDVLLSL------PGENGKEHMEDVEIKAL  953
              K VD    KI+++H    +   G+   DFVDVLLS       P +     +E    KA+
Sbjct  239   SKTVDQLLEKIIQDHELVSRREQGKHHKDFVDVLLSSIHQPLNPNDEEVYMLERTNAKAI  298

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             + DMIA A DTSA    W +AE+++ P+++K++Q+EL  V+G DRMV E+DL  L+YL  
Sbjct  299   LLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSM  358

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRP  1310
             VV+E+ R HP  P L+PH+S    T++GYHIP K+RIFIN   +GR+PSVW D+V++F P
Sbjct  359   VVKESLRLHPVAPLLVPHQSMEDITVDGYHIPKKSRIFINIWTIGRDPSVWSDNVEEFYP  418

Query  1311  ERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGL  1490
             ER   ++   V++  G DF+++PF +G+R CP   LG+T V +AL  L H F+W  P G+
Sbjct  419   ERFMNSN---VDL-RGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLLHCFNWELPSGM  474

Query  1491  RPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              P+D+D +E +G+++ KA  L A+   RL
Sbjct  475   LPKDLDMTEKFGLSLSKAKHLLAMPTCRL  503



>ref|XP_006388081.1| hypothetical protein POPTR_0357s00220g [Populus trichocarpa]
 gb|ERP46995.1| hypothetical protein POPTR_0357s00220g [Populus trichocarpa]
Length=507

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 190/521 (36%), Positives = 304/521 (58%), Gaps = 19/521 (4%)
 Frame = +3

Query  33    IKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGR  212
             + +L+ +   +  + F+    +  +++ L +K   +  K+ LPP P + PI+GNL QLG 
Sbjct  1     MSLLQWLKECSKPTLFVVTIFLVVVLKFL-MKDKLKKRKLNLPPSPAKLPIIGNLHQLGN  59

Query  213   LPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAY  392
             +PH        KYGP+++L+LG +  +  +   + +E+L   D V +SRP+  +A HL Y
Sbjct  60    MPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKTHDLVLSSRPQLFSAKHLLY  119

Query  393   GCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETV-  569
             GC D+A AP G  W+ +R+IC+  LL+ KR+ S++  R EE   L+  +   AE+   + 
Sbjct  120   GCTDIAFAPYGAYWRNIRKICILELLSAKRVRSYSYVREEEVARLIRRI---AESYPGIT  176

Query  570   NLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPL  749
             NL  ++  ++ + + R+ LG+ F G     G  +   F  +  +   LLG   LGDY P 
Sbjct  177   NLSSMIALYTNDVLCRVALGRDFSGG----GEYDRHGFQKMFDDFQALLGGFSLGDYFPS  232

Query  750   WRWIDPY-GCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKE-  923
               ++    G + K++   +R D F  +++ EHR SK + + + D VDVLL +  +   E 
Sbjct  233   MEFVHSLTGMKSKLQYTFRRFDQFFDEVIAEHRSSKGKQEEKKDLVDVLLDIQKDGSSEI  292

Query  924   --HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVS  1097
                M++  IKA+I DM AA TDT+ +T +WAM E+I  P +++K Q E+  VVG  R+V 
Sbjct  293   PLTMDN--IKAVILDMFAAGTDTNFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRVVQ  350

Query  1098  ENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNP  1277
             E+DL  LNY++ V++E  R HPA P L+P ES     I+GY+IPAKTRI++N  G+GR+P
Sbjct  351   ESDLPRLNYMKAVIKEILRLHPAAPVLLPRESLEDVIIDGYNIPAKTRIYVNVWGMGRDP  410

Query  1278  SVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLF  1457
              +W++ + F PER     G  ++   G DF+++PF AG+R CP    G+  V +AL +L 
Sbjct  411   ELWENPETFEPERFM---GSGIDFK-GQDFELIPFGAGRRSCPAITFGIATVEIALVQLL  466

Query  1458  HSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             HSFDW  P GL  +DID +E +G+++ +  PL  +A+P   
Sbjct  467   HSFDWKLPPGLEAKDIDNTEAFGVSLHRTVPLHVIAKPHFN  507



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   370 bits (949),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 187/475 (39%), Positives = 280/475 (59%), Gaps = 8/475 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             I+GNL  +  +PH+  AA    YGPL++LRLG VD +     S+  + L   D  F+SRP
Sbjct  39    IIGNLPHMSPVPHQGLAAMAKVYGPLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRP  98

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
                 A ++AY   D+  AP GP+W+ +R+I   HL + K L+ F   R EE R LV    
Sbjct  99    PNAGAKYVAYNYQDLVFAPYGPRWRLLRKISSVHLFSGKALDDFRHIREEEIRVLVR---  155

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
              +A     VNL ++L   ++N + ++++GK+ FG        EA EF  +  EL  L G+
Sbjct  156   ALASAKTKVNLGQLLNVCTVNALGQVMMGKRVFGDGSGGADPEADEFKSMVVELMQLAGV  215

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM---DFVDVL  893
               +GD++P   W+D  G + KM+++  R D F   ILEEH+   ++ +G++   D +  L
Sbjct  216   FNIGDFIPALEWLDLQGVQAKMKKLHNRFDRFLSGILEEHKTKARQSNGQVKHKDLLSTL  275

Query  894   LSLPGENGKE--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             +SL   +G E   + D EIKAL+ +M  A TDTS+ T EWAMAE+I+ P I+ ++++ELD
Sbjct  276   ISLENADGAEGGKLSDTEIKALLLNMFTAGTDTSSSTVEWAMAELIRHPNIMAQVRKELD  335

Query  1068  EVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIF  1247
              VVG DR+VS+ DL +L Y + V++ETFR HP+ P  +P  ++ +  INGYHIP    + 
Sbjct  336   SVVGRDRLVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASDSCDINGYHIPKGATLL  395

Query  1248  INTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVT  1427
             +N   + R+P+ W++  +FRPER  P          G DF+++PF AG+R C G  LG+ 
Sbjct  396   VNVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLR  455

Query  1428  LVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             +V +  A L H+FDW   +GL PE +D  E YG+T+ +A PL    RPRL +H Y
Sbjct  456   MVQLLTATLAHAFDWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   370 bits (949),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 194/500 (39%), Positives = 288/500 (58%), Gaps = 17/500 (3%)
 Frame = +3

Query  114   LLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAI  293
             LL + +G   G   LPPGP  WPI+GNL QLG  PH+   A    +GPL  L+LGS + +
Sbjct  20    LLRLLSGGSRGGHPLPPGPKGWPILGNLPQLGTKPHQTMHALSKVHGPLFRLKLGSAEVV  79

Query  294   TTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLT  473
                  ++  E L   D  F++RP    A H+AY   D+  AP GP+W+ +R++C  HL +
Sbjct  80    VAASSTVAAEFLRSHDANFSNRPPNSGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFS  139

Query  474   TKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLG-KQFFGAD  650
              K LE     R +E   L  D   +A     VNL E L   + N ++R  +G + F G  
Sbjct  140   QKALEDLRYVREQEVGILAGD---LASTSRPVNLGEALNVCATNALSRATVGWRVFVGKG  196

Query  651   ESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKI  830
             E      A EF  +  E+  L G+  +GD+VP   W+D  G   KM+++ KR+D F  K+
Sbjct  197   ED---MTAEEFKDMVMEVMKLAGVFNVGDFVPGLGWLDLQGVVGKMKKLHKRMDTFLDKL  253

Query  831   LEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVT  998
             + EHR +     G  D + VL+ L     GE GK  + D EIKAL+ ++  A TDT++ T
Sbjct  254   IAEHRAAAD--GGGRDLLSVLVGLQEDGEGEGGK--LTDTEIKALLLNLFTAGTDTTSNT  309

Query  999   NEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFL  1178
              EWA+AE+I+ P +L++ Q+ELD V+G DR+V+E+DL  L +L+ +++ETFR HP+ P  
Sbjct  310   VEWALAELIRHPHLLRQAQKELDTVIGGDRLVAESDLPRLPFLQAIIKETFRLHPSTPLS  369

Query  1179  IPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP-ADGGRVEISH  1355
             +P  ++ + TING+HIP    + +N   + R+P+VW D  +F+P R  P  DG R+++  
Sbjct  370   LPRMASESCTINGFHIPKHATLLVNVWAIARDPAVWSDPVEFKPSRFMPGGDGARLDVK-  428

Query  1356  GADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTM  1535
             G+DF+++PF AG+R C G  LG+ +V    A L H FDW  P+G+  E +D  E YG+T+
Sbjct  429   GSDFEVIPFGAGRRICAGMSLGLRMVTFMTATLVHGFDWELPKGVVAEKLDMEEAYGLTL  488

Query  1536  PKATPLFAVARPRLQRHLYG  1595
              +A PL  +   RL    YG
Sbjct  489   QRAVPLTVMPVQRLTARAYG  508



>ref|XP_007024645.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY27267.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=511

 Score =   369 bits (948),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 188/486 (39%), Positives = 287/486 (59%), Gaps = 15/486 (3%)
 Frame = +3

Query  159   PPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQ  338
             PPGP  WPI+GNL  +G LPHR   A   KYGP++ LR GS   I  +   + + IL   
Sbjct  35    PPGPKPWPIIGNLNLIGSLPHRSIHALSQKYGPIMQLRFGSFPVIVGSSVEMAKAILRTH  94

Query  339   DDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEA  518
             D  FA RP+  A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R EE 
Sbjct  95    DVAFAGRPKIAAGKYTTYNYSDITWSPYGPYWRQARKMCLTELFSAKRLESYEYIRREEM  154

Query  519   RHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM---EFMY  689
               L++ +  ++  G  + L++ L + S+N ++RM+LGK++    E +G  E +   EF  
Sbjct  155   NLLLKGLCNLS--GSPICLKDHLSSLSLNVISRMVLGKKY---TEGTGENEIVTPKEFKE  209

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG  869
             +  ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   +K +  
Sbjct  210   MLDELFLLNGVLDIGDSIPWLSFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRKGVKD  269

Query  870   EM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              +  D VDVLL L  +   +  +E   +KA  QD+IA  T++SAVT EWA++E++K+P I
Sbjct  270   YVAKDMVDVLLQLADDPHLDVKLERHGVKAFSQDLIAGGTESSAVTVEWAISELLKKPEI  329

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
               K  +ELD V+G DR V END+ +L Y+  + +ET R HP  P L+P  +     + GY
Sbjct  330   FAKATEELDRVIGRDRWVEENDIANLPYVNSIAKETMRLHPVAPMLVPRLAREDCQLAGY  389

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
              IP  TR+ +N   +GR+P++WD+ D+F P+R      G+     G DF++LPF AG+R 
Sbjct  390   DIPKDTRVLVNVWTIGRDPTLWDNPDEFCPDRFI----GKAIDVKGHDFELLPFGAGRRM  445

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPG PLG+ ++  +LA L H F W  P  +  ED++  E++G++ PK  PL AVA+PRL 
Sbjct  446   CPGYPLGIKVIQASLANLLHGFTWKLPGNMAKEDLNMEEIFGLSTPKKFPLEAVAQPRLP  505

Query  1581  RHLYGS  1598
              H+Y  
Sbjct  506   LHMYSQ  511



>gb|ABK24537.1| unknown [Picea sitchensis]
Length=514

 Score =   369 bits (948),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 184/484 (38%), Positives = 295/484 (61%), Gaps = 10/484 (2%)
 Frame = +3

Query  150   MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREIL  329
             ++LPPGP  WPI+GNL  +G+LPHR        YGPL+Y+RLGS+  +  +   + RE L
Sbjct  31    VKLPPGPRAWPIIGNLNLMGKLPHRSLDRLSKTYGPLMYIRLGSIPCVVASSAEMAREFL  90

Query  330   LQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRA  509
                D  F+SRP+  +  +  Y   D+  +P G  ++  R++C+  L + KRLESF   R 
Sbjct  91    QTHDLTFSSRPQVASGKYTTYNYSDITWSPYGDYFRLARKVCLMELFSAKRLESFEYIRV  150

Query  510   EEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMY  689
             EE   ++  V+   + G  V +R+     S N ++RM LG+++F  D+ +G    +E + 
Sbjct  151   EEVARMLGSVFETCQRGLPVEIRKETYGVSNNIISRMALGRRYF--DKEAGNMMRLEELK  208

Query  690   ITHELFHLL-GLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
                E F LL G+  + D++P   W+D  G   +M+++ +R+D F  +++EEH + +K ++
Sbjct  209   EMLEEFFLLNGVFNIVDFIPWLGWLDLQGYVGRMKKLSERLDVFLEEVVEEHDRRRKGVE  268

Query  867   GEM--DFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
               +  D +DVLL    ++ + ++  +++KA   D+IA  T+TSA   EW ++E++K+P +
Sbjct  269   NYVAKDMMDVLLK-QADDPQLNLSRIKVKAFTLDIIAGGTETSATLVEWGLSELLKKPEM  327

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             L++  +ELD VVG +R V E D+  L Y++ +V+ET R HP  P L+PH ST+   I GY
Sbjct  328   LERATKELDRVVGRERWVEEKDMGGLEYVQWIVKETMRLHPVAPLLVPHLSTQRCRIAGY  387

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
              IPA TR+F+N   +GR+   W++ ++FRPER     G  V++  G D+++LPF +G+R 
Sbjct  388   DIPANTRVFVNVWSIGRDDQSWENPNEFRPERF---KGSTVDV-MGRDYELLPFGSGRRM  443

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             CPG  LG+ +V +ALA L H F W  P+G  P+D+D  E++G++  K  PL A+ARPRL 
Sbjct  444   CPGNSLGLKVVQIALANLIHGFQWKLPDGQSPKDLDMGEIFGLSTSKTCPLVAMARPRLP  503

Query  1581  RHLY  1592
              HLY
Sbjct  504   SHLY  507



>ref|XP_011015794.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   369 bits (948),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 187/478 (39%), Positives = 290/478 (61%), Gaps = 12/478 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GN   LG LPH+       KYG  + L  GS   I T+   + ++IL   D +FAS
Sbjct  40    WPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFAS  99

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RP+T A  +  Y   D+A AP GP W++ R+I +  L + KRLES+   R EE R     
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRR  159

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAME-FMYITHELFHL  713
             ++     G+++ L++ L  ++++ ++R++LGK++F A ES      +E F  +  ELF L
Sbjct  160   LY--RNCGKSIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLL  217

Query  714   LGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH---RKSKKEIDGEMDFV  884
              G++ +GD++P   ++D  G  K+M++++ R D FH  +++EH   RK+ K    + D V
Sbjct  218   NGVLNIGDWIPWLDFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPK-DMV  276

Query  885   DVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             D+LL L  +   E  +    IK L QD+IA  TDT+A   +W+M+E++K+P++ K++  E
Sbjct  277   DLLLQLADDPELEVKLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDE  336

Query  1062  LDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTR  1241
             LD VVG +R V E D+  L Y+  +++E  R HP+   L PH + + + + GY IP  TR
Sbjct  337   LDRVVGRERWVEEKDIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDSKVGGYDIPKGTR  396

Query  1242  IFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLG  1421
             IFINT  +GR+P +W+D +DFRPER F   G  ++I  G +F++LPF +G+R CPG PLG
Sbjct  397   IFINTWSMGRDPDLWEDPEDFRPERFF---GKGIDIK-GHNFELLPFGSGRRMCPGYPLG  452

Query  1422  VTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
               ++L++LA + H F W  P G++PED+   EV+G+   +  P  AVA+PRL  HLY 
Sbjct  453   TKMILVSLANMLHGFTWELPPGIKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   369 bits (946),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 189/483 (39%), Positives = 277/483 (57%), Gaps = 10/483 (2%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSII  317
             +N   RLPPGP   PI+GN+  LG LPHR   A   KYGP++Y+RLG V AI  + P   
Sbjct  21    KNKHKRLPPGPRGIPILGNMHMLGSLPHRALQALSKKYGPIMYMRLGFVPAIVVSSPQAA  80

Query  318   REILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFA  497
              + L   D VFA+RP    + H+ Y    ++ +  GP W+ MR++C   LLT++++ SF 
Sbjct  81    EQFLKTHDLVFANRPPHECSRHMLYDGKGISFSGYGPYWRSMRKLCTLELLTSRKINSFK  140

Query  498   KHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM  677
               R EE   L++     A  G  V++   +   S +   RM+ GK++   D      +  
Sbjct  141   PMRREEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSCRMVFGKKYMDKD-----LDER  195

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK  857
              F  +  E   L     +GDY+P    +D  G  ++++   K  DDF  KI++EH    K
Sbjct  196   GFKAVIQEAMQLAATPNIGDYIPCLLGLDLQGLTRRIKATGKVFDDFFEKIIDEHIHKPK  255

Query  858   EIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRP  1034
             E     D VDV+L L G    E+ ++   IKA+  DM+AA+ DTSA   EWA++E+IK P
Sbjct  256   EEGQTKDLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASMDTSATMIEWALSELIKHP  315

Query  1035  RILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTIN  1214
              ++KK+  EL++VVG +RMV E+DL  L YL  VV+ET R HP  P LIPHES    T++
Sbjct  316   PMMKKVINELEKVVGMERMVEESDLESLEYLNMVVKETLRLHPVAPLLIPHESMEDCTVD  375

Query  1215  GYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGK  1394
             G+HIP K+R+ +N   +GR+P+ W D D F PER   +D        G  F+ +PF +G+
Sbjct  376   GFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDID----FRGQHFQFIPFGSGR  431

Query  1395  RKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPR  1574
             R CPG  LG+T+V + LA+L H FDW  P+ + P ++D +E +G+T+P+A  L A+   R
Sbjct  432   RGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRAKHLVAIPTCR  491

Query  1575  LQR  1583
             L +
Sbjct  492   LHK  494



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   369 bits (947),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 194/514 (38%), Positives = 290/514 (56%), Gaps = 13/514 (3%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             + + FL + L   +  LL + + + N   RLPPGP  WPI+GNL  +G  PHR   A   
Sbjct  1     MTTLFLTVVLATVLFCLLFLFSRRRNP--RLPPGPNPWPIIGNLPHMGPKPHRTLTAMVT  58

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
              YGP+++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  AP G
Sbjct  59    TYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYG  118

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENG-ETVNLREVLGAFSM  602
              +W+ +R+I   HL + K L+ F   R EE   L  +   +A+ G + VNL +++    +
Sbjct  119   QRWRMLRKISSVHLFSAKALDDFKHVRQEEVATLTRE---LAQVGTKAVNLGQLVNMCVV  175

Query  603   NNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
             N + R ++G++ FGAD      +A EF  +  E+  L G++ +GD+VP   W+D  G   
Sbjct  176   NALGREMIGRRLFGADAD---HKAEEFRSMVTEMMALAGVLNIGDFVPSLDWLDLQGVAG  232

Query  783   KMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIKAL  953
             KM+ + KR D F   IL+EH  + ++       +  L+SL G   +     + D EIKAL
Sbjct  233   KMKRLHKRFDAFLSSILKEHEMNGQD-QKHTSMLSTLISLKGTDFDGAGGSLTDTEIKAL  291

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             + +M  A TDTSA T +WA+AE+I+ P I+ K QQELD VVG DR+V+E+D+  L YL+ 
Sbjct  292   LLNMFTAGTDTSASTVDWAIAELIRHPDIMNKAQQELDSVVGRDRLVNESDISQLPYLQA  351

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +++E FR HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   F+PE
Sbjct  352   IIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFKPE  411

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R  P          G+DF+++PF AG+R C G  LG+  + +  A L H F+W    G+ 
Sbjct  412   RFLPGGEKAGVDVRGSDFELIPFGAGRRICAGLSLGLRTIQILTATLVHGFEWELAGGVT  471

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             PE ++  E YG+T+ +A PL    +PRL  ++YG
Sbjct  472   PEKLNMEEKYGLTLQRAVPLVVHPKPRLAPNVYG  505



>ref|XP_011071968.1| PREDICTED: cytochrome P450 71A1 [Sesamum indicum]
Length=507

 Score =   369 bits (947),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 185/507 (36%), Positives = 299/507 (59%), Gaps = 12/507 (2%)
 Frame = +3

Query  84    CLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLV  263
             CLSL+  +  L  +   +   K+ LPPGP  WP++GNL  +G LPH+       KYGPL+
Sbjct  9     CLSLLVFVYVLAKILRRR---KLNLPPGPKPWPVIGNLNLIGSLPHKSLHELSQKYGPLM  65

Query  264   YLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRM  443
             +L+ GS   +  +   + + IL   D  F+SRPRT A  +  Y   D+  +P GP  K+ 
Sbjct  66    HLQFGSCPVVVGSSVEMAKVILKTMDVNFSSRPRTAAGKYTTYNYSDITWSPYGPYLKQA  125

Query  444   RRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRML  623
             R++C+  L + KRLES+   R EE   +++ ++    +G+ + L++ L   +++ ++RM+
Sbjct  126   RKMCLTELFSNKRLESYEYIRVEEINSMLKSLY--KSSGQPIFLKDYLSTVTLSVISRMV  183

Query  624   LGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEK  803
             LGK++   D  +      EF  +  EL +L G+I +GD +P   + D  G  K+M+ V K
Sbjct  184   LGKKYLDKDNENAVVSLDEFKKMLDELIYLNGVINVGDVIPWLSFFDLQGYVKRMKIVSK  243

Query  804   RVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAA  974
             ++D F   +L+EH++ +++++G +  D VDVLL    +   E  ME   +KAL QD++A 
Sbjct  244   KLDRFLEHVLDEHQERRRKVEGYVSRDMVDVLLEQAEDPTLEVKMERHNVKALTQDLLAG  303

Query  975   ATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFR  1154
              T++SAVT EWA++E++K+P I KK  +E+D V+G +R V E D+ +L Y+  +V+ET R
Sbjct  304   GTESSAVTVEWAISELLKKPEIFKKATEEIDRVIGQNRWVQEKDMPNLPYVEAIVKETMR  363

Query  1155  THPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADG  1334
              HP  P L+P        + GY I   T++F+NT  +G +PS+W++  DF PER      
Sbjct  364   LHPVAPLLMPRLVREDCKVAGYDIKKGTQVFVNTWTIGTDPSLWENPTDFCPERFIE---  420

Query  1335  GRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTS  1514
              +   + G DF+ LPF +G+R CP   LG+ ++  +LA L H F+W  P  +RPED++  
Sbjct  421   -KAIDAKGHDFQFLPFGSGRRMCPAYSLGMRVISSSLANLLHGFNWKLPNKMRPEDLNME  479

Query  1515  EVYGMTMPKATPLFAVARPRLQRHLYG  1595
             E++G++ P+  PL AVA PRL   +Y 
Sbjct  480   EIFGLSTPRKFPLAAVAEPRLPPEVYN  506



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   369 bits (947),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 193/490 (39%), Positives = 276/490 (56%), Gaps = 10/490 (2%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSII  317
                + RLPPGP  WPIVGNL  +G +PH++ AA    YGPLVYLRLG VD +     S+ 
Sbjct  27    SKSRRRLPPGPKAWPIVGNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMA  86

Query  318   REILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFA  497
              + L   D  F+SRP    A H+AY   D+  AP GP+W+  R+I   HL + K L+ + 
Sbjct  87    SQFLKTHDSNFSSRPPNAGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYR  146

Query  498   KHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM  677
               R EE   L  ++         VNL ++L   + N + R ++GK+ F         +A 
Sbjct  147   HVRQEEVGVLASNLARAVST--IVNLGQLLNICATNALGRAVIGKKVFKDGTDDVDPKAD  204

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK  857
             EF  +  EL  L G+  +GD++P    +D  G   KM+ + KR D F   IL+EH  +  
Sbjct  205   EFKSMVVELMVLAGVFNIGDFIPPLDCLDLQGVASKMKNLHKRFDAFLSAILQEHNINSA  264

Query  858   EIDGEMDFVDVLLSLP-----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
                     +  L+SL       E GK  + D EIKAL+ +M  A TDT++ T EWA+AE+
Sbjct  265   A-SATPSMLTTLISLKDSVEDSEGGK--LTDTEIKALLLNMFTAGTDTTSSTVEWAIAEL  321

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             I++P IL + Q+E+D VVG DR+V+E DL  L YL+ +V+ETFR H + P  +P  +T++
Sbjct  322   IRQPEILIRAQKEIDSVVGRDRLVTELDLSKLPYLQAIVKETFRLHSSTPLSLPRIATQS  381

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
               INGYHIP    + +N   + R+P VW D   FRPER  P          G DF+++PF
Sbjct  382   CEINGYHIPKGATLLVNVWAIARDPDVWADPLSFRPERFLPGSEKENVDVKGNDFELIPF  441

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              AG+R C G  LG+ +V +  A L H+F+W  P+G  P++++  E YG+T+ +A+PL   
Sbjct  442   GAGRRICAGMSLGLRMVQLLTATLLHAFNWDLPQGQIPQELNMDEAYGLTLQRASPLHVR  501

Query  1563  ARPRLQRHLY  1592
              RPRL  HLY
Sbjct  502   PRPRLPSHLY  511



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   369 bits (947),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 290/512 (57%), Gaps = 12/512 (2%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGKENGK--MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
             L L  I  ++  L     K+ G     LPPGP  WPIVGNL  LG  PH   AA    YG
Sbjct  4     LTLIFISSLLAFLLYSIHKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMAKTYG  63

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PL++LRLG V  +     S+  + L   D  F+SRP    A H+AY   D+  AP GP+W
Sbjct  64    PLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRW  123

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNV  611
             + +R+IC  HL + K L+ F   R EE   L   +  +A  G+T VNL ++L   + N +
Sbjct  124   RLLRKICSIHLFSAKALDDFHLVRQEEVGTLARAL--LASAGKTPVNLGQLLNVCTTNAL  181

Query  612   TRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMR  791
              R++LG++ FG     G  +A EF  +  EL  L G+  LGD++P+   +D  G   KM+
Sbjct  182   GRVMLGRRVFGDGSGGGDPKADEFKSMVVELMVLAGVFNLGDFIPILDRLDLQGVAGKMK  241

Query  792   EVEKRVDDFHMKILEEHR-KSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEIKALI  956
             ++  R D F   ILEEH+      ++  +D +  L+SL     GE G   + D EIKAL+
Sbjct  242   KLHARFDAFLNTILEEHKINGSSGMEKHVDLLSTLISLKDNVDGEGGT--LTDTEIKALL  299

Query  957   QDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCV  1136
              D+  A TDTS+ T EWA+AE+I+ P++L + QQELD V+GS+R+V++ DL  L +++ +
Sbjct  300   LDLFTAGTDTSSSTVEWAIAELIRNPKLLAQAQQELDAVIGSNRLVTDADLPKLTFIQAI  359

Query  1137  VRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPER  1316
             V+E FR HP+ P  +P  +T    INGY IP  + + +N   + R+P +W D  +FRPER
Sbjct  360   VKEAFRLHPSTPLSLPRMATENCEINGYFIPKGSTLLVNVWAIARDPDIWADPLEFRPER  419

Query  1317  HFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRP  1496
               P          G DF+++PF AG+R C G  LGV +V +  A L H+FDW  P G   
Sbjct  420   FLPGGEKPNVDVRGNDFEVIPFGAGRRICAGMSLGVRMVQLLTATLIHAFDWDLPNGQGA  479

Query  1497  EDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             E ++  E YG+T+ +A+PL    +PRL  ++Y
Sbjct  480   EKLNMEEAYGLTLQRASPLMVHPKPRLAPYIY  511



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   369 bits (946),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 194/509 (38%), Positives = 284/509 (56%), Gaps = 24/509 (5%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
               + L+ ++ +++L+ V + +      LPPGP   PI+GNL  LG LPHR       KYG
Sbjct  10    ILVFLTFLWSLLRLINVSSRQSRT---LPPGPAALPIIGNLHMLGDLPHRSLQNLAKKYG  66

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             P++ +RLGSV  I  + P   +  L   D +FASRP+  A+ ++AYG   +A    GP W
Sbjct  67    PIMSMRLGSVPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFTEYGPYW  126

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             + +R++C   LL   ++ESFA  R EE   LV+ +   AE GE V+  E +G        
Sbjct  127   RHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             RM+LG++           +  +   I  E   L G   + DYVP    +D  G  K+M+ 
Sbjct  187   RMVLGRK---------NDDMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKR  237

Query  795   VEKRVDDFHMKILEEHRKSKKEIDGE--MDFVDVLLSL------PGENGKEHMEDVEIKA  950
             V K VD    KI+++H +  +   G    DFVDVLLS       P +     +E    KA
Sbjct  238   VSKTVDQLFEKIIQDHEQVSRSEQGNHHKDFVDVLLSSIHQTLKPNDEEVYMLERTNAKA  297

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
              + DMIA A DTSA    W +AE+++ P+++K++Q+EL  V+G DRMV E+DL  L+YL 
Sbjct  298   TLLDMIAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLS  357

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
              VV+E+FR HP  P L+PH+S    T++GYH P K+RIFIN   +GR+P  WD+ ++F P
Sbjct  358   MVVKESFRLHPVAPLLVPHQSMEDITVDGYHTPKKSRIFINIWTIGRDPKSWDNAEEFYP  417

Query  1311  ERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGL  1490
             ER       R     G DF+++PF +G+R CP   LG+T V +AL  L H  +W  P G+
Sbjct  418   ERFM----NRNVDLRGHDFQLIPFGSGRRGCPAMQLGLTTVRLALGNLLHCSNWELPSGM  473

Query  1491  RPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              P+D+D +E +G+++ KA  L A    RL
Sbjct  474   LPKDLDMTEKFGLSLSKAKHLLATPTCRL  502



>ref|XP_006349127.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase [Solanum 
tuberosum]
Length=508

 Score =   369 bits (946),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 181/490 (37%), Positives = 286/490 (58%), Gaps = 8/490 (2%)
 Frame = +3

Query  123   VKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTN  302
             + T +E G+ RLPPGP  WP++G L  LG +PH   A    KYGP++YL++G+   +  +
Sbjct  19    IATVRERGR-RLPPGPTGWPVIGALSLLGSMPHVALAKMAKKYGPIMYLKVGTCGMVVAS  77

Query  303   DPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKR  482
              P+  +  L   D  F++RP    A HLAY   D+  AP GP+WK +R++   H+L  K 
Sbjct  78    TPNAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNSHMLGGKA  137

Query  483   LESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSG  662
             LE++A  RA E  H+++ ++  +  GE V + ++L     N + +++L K+ F       
Sbjct  138   LENWANVRANELGHMLKSMFDASHVGECVVIADMLTFAMANMIGQVMLSKRVF----VEK  193

Query  663   PQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH  842
               E  EF  +  EL  + G   +GD++P   W+D  G EK M+ + K+ DD   K+ +EH
Sbjct  194   GVEVNEFKNMVVELMTVAGYFNIGDFIPKLAWMDLQGIEKGMKSLHKKFDDLLTKMFDEH  253

Query  843   RKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
               +  E     DF+DV+++    +  E +    IKAL+ ++  A TDTS+   EWA+AE+
Sbjct  254   EATTYERKENPDFLDVVMANKDNSEGERLSTTNIKALLLNLFTAGTDTSSSVIEWALAEM  313

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             +K P+I KK+Q+E+D+V+G +R + E+D+ +L YLR + +ETFR HP+ P  +P  ST  
Sbjct  314   MKNPQIFKKVQEEMDQVIGKNRRLIESDIPNLPYLRAICKETFRKHPSTPLNLPRVSTEP  373

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
              T++GY+IP  TR+ +N   +GR+P VW++  +F PER       ++E   G DF+++PF
Sbjct  374   CTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFNPERFLSGKNAKIE-PRGNDFELIPF  432

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              AG+R C G  +G+ +V   L  L HSFDW  P  +   DI+  E +G+ + KA PL A+
Sbjct  433   GAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPNDVI--DINMEESFGLALQKAVPLEAM  490

Query  1563  ARPRLQRHLY  1592
               PRL   +Y
Sbjct  491   VTPRLSLDVY  500



>ref|XP_002521317.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF40985.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   369 bits (946),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 184/486 (38%), Positives = 286/486 (59%), Gaps = 16/486 (3%)
 Frame = +3

Query  159   PPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQ  338
             PPGP  WPI+GNL  +G LPHR   +    YGP++ L+ GS   +  +   + + IL   
Sbjct  34    PPGPKPWPIIGNLNLIGALPHRSLHSLSQTYGPIMQLKFGSFPVVVGSSVEMAKAILKTH  93

Query  339   DDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEA  518
             D  FA RP+  A  +  Y   D+  +P G  W++ R++C+  L + KRLES+   R EE 
Sbjct  94    DVAFAGRPKIAAGKYTTYNYSDITWSPYGAYWRQARKMCVMELFSAKRLESYEYIRIEEL  153

Query  519   RHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFF----GADESSGPQEAMEFM  686
             R L++ ++    +G  +NL++ L   S+N ++RM+LGK++       DE   P+E  E +
Sbjct  154   RLLLKSMF--LSSGNPINLKDHLTDLSLNVISRMVLGKKYTVKSENVDEIVTPEEFKEML  211

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
                 ELF L G++ +GD +    ++D  G  K+M+ V K+ D F   +L+EH   +K +D
Sbjct  212   ---DELFLLNGVLDIGDSISWLAFLDLQGYIKRMKTVSKKFDRFLEHVLDEHDARRKRVD  268

Query  867   GEM--DFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               +  D VDVLL L  + N +  +E   +K   QD+IA  T++SAVT EWA++E++++P 
Sbjct  269   NHVAKDMVDVLLQLADDPNLEIKLERNGVKGFTQDLIAGGTESSAVTVEWAISELLRKPE  328

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             I  K  +ELD V+G +R V E D+++L ++  +++ET R HP  P L+P +    T + G
Sbjct  329   IFGKATEELDRVIGRERWVEEKDIVNLPFIYAIIKETMRLHPVAPMLVPRQCREDTKVAG  388

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y IP  TR+ +N   +GR+PS+WD+ D+F PER      G+     G DF++LPF AG+R
Sbjct  389   YDIPEGTRVLVNVWTIGRDPSIWDNPDEFCPERFI----GKTIDVKGCDFELLPFGAGRR  444

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG PLG+ ++  +LA L H F W  P  ++ ED++  E++G++ PK  PL  VA PRL
Sbjct  445   MCPGYPLGIKVIQASLANLLHGFKWKLPGDMKIEDLNMEEIFGLSTPKKFPLVVVAEPRL  504

Query  1578  QRHLYG  1595
               H+Y 
Sbjct  505   PSHVYS  510



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   369 bits (946),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 185/475 (39%), Positives = 282/475 (59%), Gaps = 8/475 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             I+GNL  +  +PH+  AA    YGPL++LRLG VD +     S+  + L   D  F+SRP
Sbjct  39    IIGNLPHMSPVPHQGLAAMAKVYGPLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRP  98

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
                 A ++AY   D+  AP GP+W+ +R++   HL + K L+ F + R EE R LV    
Sbjct  99    PNAGAKYVAYNYQDLVFAPYGPRWRLLRKMSSLHLFSGKALDDFRQIREEEIRVLVR---  155

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
              +A     VNL ++L   ++N + ++++GK+ FG        EA EF  +  EL  L G+
Sbjct  156   ALASAKTKVNLGQLLNVCTVNALGQVMMGKRVFGDGSGGSDPEADEFKSMVVELMQLAGV  215

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM---DFVDVL  893
               +GD++P   W+D  G + KM+++  + D F   ILEEH+   ++ +G++   DF+  L
Sbjct  216   FNIGDFIPALEWLDLQGVQAKMKKLHNKFDRFLSAILEEHKTKARQSNGQVKHKDFLSTL  275

Query  894   LSLPGENGKE--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             +SL   +G E   + D EIKAL+ +M  A TDTS+ T EWAMAE+I+ P I+ ++++ELD
Sbjct  276   ISLENVDGAEGGKLSDTEIKALLLNMFTAGTDTSSSTVEWAMAELIRHPNIMAQVRKELD  335

Query  1068  EVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIF  1247
              VVG DR+VS+ DL +L Y + V++ETFR HP+ P  +P  ++ +  INGYHIP    + 
Sbjct  336   SVVGRDRLVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASDSCDINGYHIPKGATLL  395

Query  1248  INTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVT  1427
             +N   + R+P+ W++  +FRPER  P          G DF+++PF AG+R C G  LG+ 
Sbjct  396   VNVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLR  455

Query  1428  LVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             +V +  A L H+F+W   +GL PE +D  E YG+T+ +A PL    RPRL +H Y
Sbjct  456   MVQLLTATLAHAFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>dbj|BAJ09746.1| flavonoid 3',5'-hydroxylase [Solanum tuberosum]
Length=510

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/490 (37%), Positives = 286/490 (58%), Gaps = 8/490 (2%)
 Frame = +3

Query  123   VKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTN  302
             + T +E G+ RLPPGP  WP++G L  LG +PH   A    KYGP++YL++G+   +  +
Sbjct  27    IATVRERGR-RLPPGPTGWPVIGALSLLGSMPHVALAKMAKKYGPIMYLKVGTCGMVVAS  85

Query  303   DPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKR  482
              P+  +  L   D  F++RP    A HLAY   D+  AP GP+WK +R++   H+L  K 
Sbjct  86    TPNAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNSHMLGGKA  145

Query  483   LESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSG  662
             LE++A  RA E  H+++ ++  +  GE V + ++L     N + +++L K+ F       
Sbjct  146   LENWANVRANELGHMLKSMFDASHVGECVVIADMLTFAMANMIGQVMLSKRVF----VEK  201

Query  663   PQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH  842
               E  EF  +  EL  + G   +GD++P   W+D  G EK M+ + K+ DD   K+ +EH
Sbjct  202   GVEVNEFKNMVVELMTVAGYFNIGDFIPKLAWMDLQGIEKGMKSLHKKFDDLLTKMFDEH  261

Query  843   RKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
               +  E     DF+DV+++    +  E +    IKAL+ ++  A TDTS+   EWA+AE+
Sbjct  262   EATTYERKENPDFLDVVMANKDNSEGERLSTTNIKALLLNLFTAGTDTSSSVIEWALAEM  321

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             +K P+I KK+Q+E+D+V+G +R + E+D+ +L YLR + +ETFR HP+ P  +P  ST  
Sbjct  322   MKNPQIFKKVQEEMDQVIGKNRRLIESDIPNLPYLRAICKETFRKHPSTPLNLPRVSTEP  381

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
              T++GY+IP  TR+ +N   +GR+P VW++  +F PER       ++E   G DF+++PF
Sbjct  382   CTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFNPERFLSGKNAKIE-PRGNDFELIPF  440

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              AG+R C G  +G+ +V   L  L HSFDW  P  +   DI+  E +G+ + KA PL A+
Sbjct  441   GAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPNDVI--DINMEESFGLALQKAVPLEAM  498

Query  1563  ARPRLQRHLY  1592
               PRL   +Y
Sbjct  499   VTPRLSLDVY  508



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 201/501 (40%), Positives = 288/501 (57%), Gaps = 12/501 (2%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPL  260
             L L  IF  +Q    KT  +  K +LPPGP  +PI G L  LG+ PHR      ++YGP+
Sbjct  8     LALVTIFFFLQAFSWKTSTKTNK-KLPPGPKGFPIFGCLHLLGQFPHRALHKLAERYGPI  66

Query  261   VYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKR  440
             ++LRLG    I  + P      L   D +FASRP   AA H++Y    +AL+P G  W+ 
Sbjct  67    MHLRLGLTPTIVVSSPQAAELFLKTHDLIFASRPPLKAAKHISYEQKGLALSPYGSYWRT  126

Query  441   MRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRM  620
             +R+IC   LL++ ++ SF   R EE   L+  +   A     V+L   + A S +   RM
Sbjct  127   IRKICTLELLSSFKINSFQAMRKEELDLLIASIKEAACARCVVDLSTKVSAMSADMTCRM  186

Query  621   LLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVE  800
             + GK++     S    +   F  +  E   L     LGDY+P    +D  G  K+M+ V 
Sbjct  187   VFGKKY-----SDDEFDERGFKTVIQEGMELAAKPNLGDYIPQIAGLDLQGLTKRMKSVA  241

Query  801   KRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAA  977
             K  D F  KI++EH +SK E +   DFVDV+LS  G    EH +E   IKA+I DM++AA
Sbjct  242   KVFDGFLEKIIDEHVQSKDE-NRTKDFVDVMLSFEGSEETEHKIEREHIKAIILDMLSAA  300

Query  978   TDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRT  1157
              DTSA   EWA++E+IK P+++KK+Q+EL+++VG  RMV E+DL +L YL  VV+ET R 
Sbjct  301   MDTSATAVEWALSELIKHPKVMKKLQKELEKIVGLCRMVEESDLENLEYLDMVVKETLRL  360

Query  1158  HPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGG  1337
             HP  P LIPHEST   T+NG++IP  +R+ +N   +GR+   W D + F PER     G 
Sbjct  361   HPVAPLLIPHESTEDCTVNGFYIPKNSRVIVNVWAIGRDTESWSDPEIFFPERFV---GS  417

Query  1338  RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSE  1517
              +++  G DF++LPF +G+R CPG  LG+T+V   +A+L H FDW  P G+ P ++D +E
Sbjct  418   SIDL-RGHDFQLLPFGSGRRGCPGMQLGLTIVKQVIAQLVHCFDWELPGGMLPTELDLTE  476

Query  1518  VYGMTMPKATPLFAVARPRLQ  1580
              + +  PKA  L A+   RL 
Sbjct  477   EFSLVTPKAKHLLAIPSYRLN  497



>ref|XP_006665048.1| PREDICTED: cytochrome P450 71A1-like [Oryza brachyantha]
Length=517

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 185/518 (36%), Positives = 304/518 (59%), Gaps = 18/518 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
             ASF   + ++   + LL    G+      LPPGP  WP++GNL  +G LPHR       +
Sbjct  9     ASF---VGVVLATVLLLKAVFGRGRRVYNLPPGPKPWPVIGNLNLVGTLPHRSIHELSKR  65

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGP++ LR GS   +  +   + +  L   D VF  RP+T A  +  Y   D+  +  G 
Sbjct  66    YGPIMSLRFGSFPVVVGSSVEMAKFFLKTHDVVFTDRPKTAAGKYTTYNYSDITWSSYGA  125

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
              W++ R++C+  L + KRLES+   RAEE   L+ D+ G A  G  V L++ L   S+N 
Sbjct  126   YWRQARKMCLTELFSAKRLESYEYIRAEEVSALLRDLHGAA--GGVVMLKDYLSTVSLNV  183

Query  609   VTRMLLGKQFFGADESSGPQEAM---EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             +TRM+LGK++   + ++         EF ++  ELF L G++ +GD +P   W+D  G  
Sbjct  184   ITRMVLGKKYLDKETTAQNGSVTTPEEFKWMLDELFLLNGVLNIGDSIPWLDWLDLQGYI  243

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGEM----DFVDVLLSLPGE-NGKEHMEDVEI  944
             K+M+++ K  D F   +++EH + ++ ++G+     D VDVLL    + N +  ++   +
Sbjct  244   KRMKKLSKMFDRFLEHVVDEHNE-RRRLEGQSFVAKDMVDVLLQFADDPNLEVKLKREGV  302

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KA  QD+IA  T++SAVT EWA++E++K+P +  +  +ELD V+G DR V+E D+ +L Y
Sbjct  303   KAFTQDLIAGGTESSAVTVEWALSELLKKPEVFTRATEELDRVIGRDRWVTEKDIPNLPY  362

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             +  +V+ET R HP  P L+P  S   T+I+GY IPA TR+ ++   +GR+P +WD  ++F
Sbjct  363   IDAIVKETMRMHPVAPMLVPRLSREDTSIDGYDIPAGTRVLVSVWSIGRDPKLWDAPEEF  422

Query  1305  RPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPE  1484
              PER     G ++++  G D+++LPF +G+R CPG  LG+ ++ ++LA L H F W  P+
Sbjct  423   MPERFI---GNKLDVK-GQDYELLPFGSGRRMCPGYSLGLKVIQVSLANLLHGFKWRLPD  478

Query  1485  GLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             G+  +++   E++G++ P+  PL A+  P+L  HLY +
Sbjct  479   GMTRKNLSMEEIFGLSTPRKFPLEAIVEPKLSAHLYAT  516



>ref|XP_006436412.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
 gb|ESR49652.1| hypothetical protein CICLE_v10031266mg [Citrus clementina]
Length=512

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/514 (37%), Positives = 302/514 (59%), Gaps = 16/514 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
             ++ F  + L+F ++  +     + N  + LPPGP  WPI+GNL  +G LPHR   +   K
Sbjct  9     SAMFYSILLVFPLLLFICGSRCRRN--LNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQK  66

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGP++ LR GS   +  +   + +  L   D  FASRPRT A  +  Y   D+  A  GP
Sbjct  67    YGPIMQLRFGSFPVVVGSSVEMAKLFLKTHDANFASRPRTAAGKYTTYNYSDMVWATYGP  126

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
              W++ R+I +  + + KRLESF   R +E +  +  ++    + + V+L++ L   S+N 
Sbjct  127   YWRQARKIFLIEIFSPKRLESFEFIRVQEIKKFLFGLY--KSSAKPVHLKDHLSKLSLNV  184

Query  609   VTRMLLGKQFFGADESS--GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
             ++RM+LGK +    E     PQE  E +    ELF+L G++ +GD +P   ++D  G  K
Sbjct  185   ISRMVLGKNYTEETEQDFVTPQEYTEML---QELFYLNGVLEIGDSIPWLGFLDLQGHIK  241

Query  783   KMREVEKRVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPGENGKE-HMEDVEIKAL  953
             +M+ + K++D F+  +L EH   +K   G +  D VDVLL L  +   E  +E  ++KAL
Sbjct  242   RMKALMKKLDRFYELVLHEHNAKRKSSTGFVASDMVDVLLQLADDPTLEFKLERDQVKAL  301

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             IQD++A  T++S VT EWA++E++K+P I  K  +ELD V+G +R+V E D++ L Y+  
Sbjct  302   IQDLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYIDA  361

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +V+ET R HP  P L+P  +     + GY IP  TR+ +N   +GR+P++W++ ++FRPE
Sbjct  362   IVKETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRPE  421

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R F   G  +++  G DF++LPF AG+R CPG  LG+ ++  +L+ L   F+W  P  ++
Sbjct  422   RFF---GKEIDVK-GHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMK  477

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              ED+D  E +G++ PK  PL  V +PRL  H+Y 
Sbjct  478   KEDLDMEESFGLSTPKKIPLLVVPQPRLPIHVYS  511



>ref|XP_002318090.2| hypothetical protein POPTR_0012s09160g [Populus trichocarpa]
 gb|EEE96310.2| hypothetical protein POPTR_0012s09160g [Populus trichocarpa]
Length=507

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 193/523 (37%), Positives = 301/523 (58%), Gaps = 22/523 (4%)
 Frame = +3

Query  27    DLIKVLKMIDYITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQL  206
              L++ LK     TL    + L ++ K +    +K   +  K+ LPP P + PI+GNL QL
Sbjct  2     SLLQWLKECSKPTLFVVTIFLVVVLKFL----MKDKLKKRKLNLPPSPAKLPIIGNLHQL  57

Query  207   GRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHL  386
             G +PH        KYGP+++L+LG +  +  +   + +E+L   D V +SRP+  +A HL
Sbjct  58    GNMPHISLRGLAKKYGPIIFLQLGEIPTVVISSAGLAKEVLKTHDLVLSSRPQLFSAKHL  117

Query  387   AYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET  566
              YGC D+A AP G  W+ +R+IC+  LL+ KR+ S++  R EE   L+  +   AE+   
Sbjct  118   LYGCTDIAFAPYGAYWRNIRKICILELLSAKRVRSYSYVREEEVARLIRRI---AESYPG  174

Query  567   V-NLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYV  743
             + NL  ++  ++ + + R+ LG+ F G     G  +   F  +      LLG   LGDY 
Sbjct  175   ITNLSSMIALYANDVLCRVALGRDFSGG----GEYDRHGFQKMLDNFQALLGGFSLGDYF  230

Query  744   PLWRWIDPY-GCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGK  920
             P   ++    G + K++   +R D F  +++ EHR SK + + + D VDVLL +  +   
Sbjct  231   PSMEFVHSLTGMKSKLQYTFRRFDQFFDEVIAEHRNSKGKQEEKKDLVDVLLDIQKDGSS  290

Query  921   E---HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRM  1091
             E    M++  IKA+I DM A  TDT+ +T +WAM E+I  P +++K Q E+  VVG  R+
Sbjct  291   EIPLTMDN--IKAVILDMFAGGTDTTFITLDWAMTELIMNPHVMEKAQAEVRSVVGDRRV  348

Query  1092  VSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGR  1271
             V E+DL  LNY++ V++E  R HPA P L+P ES     I+GY+IPAKTRI++N  G+GR
Sbjct  349   VQESDLPRLNYMKAVIKEILRLHPAAPVLLPRESLEDVIIDGYNIPAKTRIYVNVWGMGR  408

Query  1272  NPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALAR  1451
             +P +W++ + F PER     G  ++   G DF+++PF AG+R CP    G+  V +AL +
Sbjct  409   DPELWENPETFEPERFM---GSGIDFK-GQDFELIPFGAGRRSCPAITFGIATVEIALVQ  464

Query  1452  LFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             L HSFDW  P GL  +DID +E +G+++ +  PL  +A+P   
Sbjct  465   LLHSFDWKLPPGLEAKDIDNTEAFGVSLHRTVPLHVIAKPHFN  507



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 198/528 (38%), Positives = 295/528 (56%), Gaps = 25/528 (5%)
 Frame = +3

Query  33    IKVLKMIDYITLAS--FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQL  206
             + +L ++ Y ++++  F+L L+L             +     RLPPGP  WPIVGNL  L
Sbjct  1     MTILTLLLYTSISALAFYLLLNL-------------RTRHPKRLPPGPTPWPIVGNLPHL  47

Query  207   GRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHL  386
             G +PH   AA   KYGPL++LRLG VD +     S+  + L   D  FASRP    A H+
Sbjct  48    GTVPHHSLAALATKYGPLMHLRLGFVDVVVAASASVASQFLKSHDANFASRPPNSGAKHI  107

Query  387   AYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET  566
             AY   D+  AP GP+W+ +R+IC  HL + K L+ F   R EE   L   +    E   T
Sbjct  108   AYNYHDLVFAPYGPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRVLISAGET--T  165

Query  567   VNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVP  746
             V L ++L   + N + R+LLG++ FG        +A EF  +  E+  L G   +GD++P
Sbjct  166   VKLGQLLNVCTTNALARVLLGRRVFGDGSRDSDPKADEFKDMVVEMMVLAGEFNIGDFIP  225

Query  747   LWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKE-  923
                W+D  G  KKM+++  R D F   ILEEH    K      D +  L+ L  +   + 
Sbjct  226   ALDWLDLQGVTKKMKKLHTRFDSFFNLILEEH----KSYGNSGDLLSTLIGLKDDADADG  281

Query  924   ---HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMV  1094
                 + D+EIKAL+ ++  A TDTS+ T EWA+AE+I+ PR+LK+ Q+E+D VVG DR+V
Sbjct  282   EGVKLTDIEIKALLLNLFTAGTDTSSSTVEWAIAELIRHPRLLKQAQEEIDTVVGRDRLV  341

Query  1095  SENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRN  1274
             +E DL  L +++ +V+ETFR HP+ P  +P  S+ A  ++GY+IP  + + +N   + R+
Sbjct  342   TELDLNQLTFIQAIVKETFRLHPSTPLSLPRISSEACEVDGYYIPKGSTLLVNVWAIARD  401

Query  1275  PSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARL  1454
             P +W D  +FRP R  P          G DF+++PF AG+R C G  LG+ +V + +A L
Sbjct  402   PEMWTDPLEFRPSRFLPGGEKPNVDVRGNDFEVIPFGAGRRICVGMTLGLRMVQLLVATL  461

Query  1455  FHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
               +FDW   +GL PE ++  E YG+T+ +A  L    +PRL   +Y S
Sbjct  462   VQTFDWELAKGLEPEKLNMDEAYGLTLQRAEQLIVHPKPRLAPGVYES  509



>ref|XP_010932407.1| PREDICTED: cytochrome P450 71A1-like [Elaeis guineensis]
Length=513

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 186/490 (38%), Positives = 294/490 (60%), Gaps = 17/490 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K  LPPGP  WP++GNL  +G LPHR   A   KYGPL++L  GS   I  +   + + I
Sbjct  33    KPNLPPGPKPWPVIGNLNLIGSLPHRSLHALSHKYGPLMHLYFGSFPVIVASSVDMAKLI  92

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  F  RP+T A  +  Y   ++  +  G  W++ R++C+  L + +RL+S+   R
Sbjct  93    LKTHDVTFCGRPKTAAGRYTTYNYSNITWSQYGAYWRQARKMCVMELFSARRLDSYEYIR  152

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAME  680
              EEA++L+ D++    +G  VNL++ L   S+N ++RM+LGK++    E +   P+E   
Sbjct  153   VEEAKNLLRDLFN--SSGRPVNLKDHLSNVSLNVISRMVLGKKYLDESEDAVVSPEE---  207

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  ELF L G++ +GD +P   ++D  G  ++M+++ K+ D F   +++EH + ++ 
Sbjct  208   FKAMLDELFLLNGVMNIGDSMPWLDFLDLQGYIRRMKKLGKKFDRFLEHVVDEHNERRRR  267

Query  861   IDGEM----DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
              +GE     D VDVLL L  +   E  +E   +KA  QDMIA  T++SA+T EWA++E++
Sbjct  268   -EGEKFVARDMVDVLLQLADDPTLEVKLERRGVKAFTQDMIAGGTESSAMTVEWAISELL  326

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             KRP I KK  +ELD V+G  R V E +L HL Y+  +++ET R HP  P L+P +     
Sbjct  327   KRPEIFKKATEELDRVIGRHRWVEEKELHHLPYIEAIIKETMRMHPVAPMLVPRQCREDC  386

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              + GY IPA TR+ +N   +GR+P++WD  ++FRPER     G  +++  G DF++LPF 
Sbjct  387   NVAGYDIPAGTRVLVNVWTIGRDPTIWDAPEEFRPERFI---GSTIDVK-GQDFELLPFG  442

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R CPG  LG+ ++ ++LA L H F W  P+G++ ED+   E++G++ P+  PL  V 
Sbjct  443   SGRRMCPGYSLGLKVIQVSLANLLHGFAWRLPDGMKVEDLSMEEIFGLSTPRKVPLEVVV  502

Query  1566  RPRLQRHLYG  1595
              P+L  HLY 
Sbjct  503   EPKLPVHLYA  512



>ref|XP_002273390.1| PREDICTED: cytochrome P450 71A1-like [Vitis vinifera]
Length=511

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/485 (38%), Positives = 283/485 (58%), Gaps = 9/485 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPHR       KYGP++ LR GS   +  +  ++ +  
Sbjct  31    KLNLPPGPKPWPIIGNLNLIGALPHRSIHELSQKYGPIMQLRFGSFPVVVGSSVAMAKLF  90

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  FASRP+T A  +  Y   D+  +P GP W++ R++C+  L + +RLES+   R
Sbjct  91    LKTHDVTFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSARRLESYEYIR  150

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
              EE + L+  ++   ++   V+L++ L   S+N ++RM+LGK++   +         EF 
Sbjct  151   VEETKSLLSSLY--KQSNSPVDLKDHLSTVSLNVISRMVLGKKYLDENVEGSIVTPEEFK  208

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
              +  ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   +K ++
Sbjct  209   KMLDELFLLSGVLNIGDSIPWIDFLDLQGYVKRMKVLSKKFDRFLEHVLDEHNARRKGVE  268

Query  867   GEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               +  D VDVLL    +   E  +E   +KA  QD+IA  T++SAVT EWA++E++++P 
Sbjct  269   NYVAKDMVDVLLQFADDPTLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELLRKPE  328

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             +  K  +ELD V+G +R V E D+ +L YL  +V+ET R HP  P L+P  S     I  
Sbjct  329   LFDKATEELDRVIGKERWVEEKDIPNLPYLDTIVKETMRMHPVAPMLVPRFSREDIKIAD  388

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y IP  TR+ +N   +GR+P +WD  ++F PER     G  +++  G DF++LPF  G+R
Sbjct  389   YDIPKDTRVLVNVWTIGRDPEIWDQPNEFIPERFI---GKNIDVK-GQDFELLPFGTGRR  444

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG  LG+ ++  +LA L H F W  P  ++P D+   E++G++ PK  PL A+A PRL
Sbjct  445   MCPGYSLGLKVIQSSLANLLHGFKWKLPGDMKPGDLSMEEIFGLSTPKKIPLVAMAEPRL  504

Query  1578  QRHLY  1592
               HLY
Sbjct  505   PAHLY  509



>ref|XP_003530005.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
 gb|KHN20713.1| Cytochrome P450 71A1 [Glycine soja]
Length=503

 Score =   368 bits (944),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/485 (39%), Positives = 289/485 (60%), Gaps = 18/485 (4%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSII  317
             ++ + +LPPGP   PI+GNL  LG+LP+R   A   KYGP++ ++LG +  I  + P   
Sbjct  28    QDDRTQLPPGPYPLPIIGNLHMLGKLPNRTLQALAKKYGPIMSIKLGQIPTIVVSSPETA  87

Query  318   REILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFA  497
                L   D VFASRP+T A+ +++YG   +     GP W+ +R++C   LL+  ++E  A
Sbjct  88    ELFLKTHDTVFASRPKTQASKYMSYGTRGIVFTEYGPYWRNVRKVCTTELLSASKVEMLA  147

Query  498   KHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM  677
               R +E   LV+ +   A + + VN+ + +G    N V +M+LG+            +  
Sbjct  148   PLRRQELGILVKSLEKAAASHDVVNVSDKVGELISNIVCKMILGR---------SRDDRF  198

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR---K  848
             +   +TH+  HLLGL  + DYVP     D  G +++ ++  K  D    +I+++H     
Sbjct  199   DLKGLTHDYLHLLGLFNVADYVPWAGVFDLQGLKRQFKQTSKAFDQVFEEIIKDHEHPSD  258

Query  849   SKKEIDGEMDFVDVLLSLPGENGKEHMED-VEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
             + KE     DFVD+LLSL  +  + H+ D + IKA++ DMIA A DTSA+  EWAM+E++
Sbjct  259   NNKENVHSKDFVDILLSLMHQPSEHHVIDRINIKAILLDMIAGAYDTSAIGVEWAMSELL  318

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             + PR++KK+Q EL+ VVG+DR V E+DL  L YL  VV+ET R +P GP L+P ES    
Sbjct  319   RHPRVMKKLQDELNIVVGTDRPVEESDLAKLPYLNMVVKETLRLYPVGPLLVPRESLEDI  378

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
             TINGY+I  K+RI IN   +GR+P VW D+V+ F PER   ++        G +F+++PF
Sbjct  379   TINGYYIKKKSRILINAWAIGRDPKVWSDNVEMFYPERFLNSNIDM----RGQNFQLIPF  434

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              +G+R CPG  LG+T   + LA+L H F+W  P G+ P+DID +E +G+++P++  L AV
Sbjct  435   GSGRRGCPGIQLGITTFSLVLAQLVHCFNWELPFGMSPDDIDMTENFGLSLPRSKHLLAV  494

Query  1563  ARPRL  1577
                RL
Sbjct  495   PTHRL  499



>ref|XP_010027782.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54386.1| hypothetical protein EUGRSUZ_I00339 [Eucalyptus grandis]
Length=498

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 194/478 (41%), Positives = 283/478 (59%), Gaps = 14/478 (3%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  +PI+GNL  LG+ PH D      KYGPL++LRLG V  I  + P +  + L  
Sbjct  31    LPPGPRGYPILGNLPLLGQNPHHDLHKLAQKYGPLMHLRLGFVHTIVVSSPEVAEQFLKT  90

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D VFA RP   A+ H++Y    +A +  GP W+ +R++C   LL+  ++ SF   R EE
Sbjct  91    HDIVFAGRPPHEASKHISYEQRSLAFSSYGPYWRNIRKMCTLELLSNAKINSFKSMRREE  150

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
                LV  +   A +   ++L   + + S +   RM+ GK++         +E  EFM + 
Sbjct  151   VGLLVNFLKDAAHDHTAIDLSAKISSLSADMSCRMIFGKKYMD-------KEFDEFMAVM  203

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM  875
              E   L     +GDYVP     D  G  K+M+ V K  D F  KI++EH K+KKE     
Sbjct  204   QEGVVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVFDAFFEKIIDEHMKAKKEEGESK  263

Query  876   DFVDVLLSLPGEN-GKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKI  1052
             DFVDV+L + G N G+ H++   IKA+I DM++A+ DTSA T +WA+ E+ + P ++KK+
Sbjct  264   DFVDVMLGIMGLNEGEYHIDRSHIKAIILDMLSASMDTSATTIDWAITELTRHPSVMKKL  323

Query  1053  QQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPA  1232
             Q EL++ VG +R V E+DL  L+YL  V++E  R HPA PFL+P E+T   T+NG+HIP+
Sbjct  324   QDELEKAVGMNRAVEESDLEGLHYLNMVIKEIMRLHPASPFLLPREATEDCTVNGFHIPS  383

Query  1233  KTRIFINTHGLGRNPSVWD--DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCP  1406
             K+ + +N   +GR+P VW   + ++F PER     G  V++  G DF++LPF AG+R CP
Sbjct  384   KSTVIVNVWSIGRDPKVWTTHNPEEFIPERFL---GLSVDVM-GHDFQLLPFGAGRRGCP  439

Query  1407  GAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             G  LG+T+V   LA+L H FDW  P G+ P ++D +E +G+T P+A  L    R RL 
Sbjct  440   GIQLGLTVVRFVLAQLVHCFDWDLPGGISPSELDMTEEFGLTAPRANHLVVTPRYRLS  497



>ref|XP_008393300.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=523

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/517 (38%), Positives = 296/517 (57%), Gaps = 26/517 (5%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             ++   L L+ ++ +I +L     +   + +LP GP   PI+GN   LG  PH        
Sbjct  19    ISILLLFLTFLWYLIHILTTAFQRPKHRKQLP-GPWALPIIGNFHMLGNHPHHSLQHLAK  77

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
             KYGP++ +RLG V  I  + P      L   D VF SRP+  AA +++YG   +A    G
Sbjct  78    KYGPIMSIRLGLVPTIVVSSPKAAELFLKTHDTVFCSRPKLQAAEYISYGIRGIAFTEYG  137

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
             P W+ +R++C   LL   ++E FA  R EE   LV+ +   AE GE VNL E +G    +
Sbjct  138   PYWRHIRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVNLSEKVGELVED  197

Query  606   NVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKK  785
                RM+LG         S   +  +   I  ++  +L L  +GDYVP  R +D  G  K+
Sbjct  198   ITYRMVLG---------SKSDDMFDIKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKR  248

Query  786   MREVEKRVDDFHMKILEEHRKSKK--EIDGE---MDFVDVLLSL------PGENGKEHME  932
              + + K VD    KI+ EH +  K  ++ G     DFVDV+LSL      P +     +E
Sbjct  249   NKRISKIVDQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVVLSLIHQPLNPNDEQGYRIE  308

Query  933   DVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLL  1112
               ++KA++ DMI  + DTSA    W +AE+++ PR+LK +Q+EL  V+G+DRMV E+DL 
Sbjct  309   RTDVKAILLDMITGSFDTSATAIVWNLAELLRHPRVLKHLQEELQRVIGTDRMVEESDLR  368

Query  1113  HLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-D  1289
              L+YL  V++E+FR HP  PFL+P ES +  T++GY+IP K++I INT  +GR+P+VW D
Sbjct  369   MLSYLNAVIKESFRLHPIAPFLVPRESMQDVTVDGYYIPKKSKILINTWAIGRDPNVWSD  428

Query  1290  DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             +V +F PER   ++   V++  G DF++LPF +G+R CPG  LG+T V +ALA + H F+
Sbjct  429   NVGEFYPERFINSN---VDL-RGHDFQLLPFGSGRRGCPGMQLGLTTVRLALANIVHCFN  484

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             W  P GL P+D+D +E +G    KA PL A+   RL+
Sbjct  485   WDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRLE  521



>ref|XP_010033730.1| PREDICTED: cytochrome P450 71A1-like [Eucalyptus grandis]
 gb|KCW53529.1| hypothetical protein EUGRSUZ_J02808 [Eucalyptus grandis]
Length=509

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 187/483 (39%), Positives = 279/483 (58%), Gaps = 10/483 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  WPI+GNL  +G LPHR        YGPL+ ++ GS   +  +   + R  L  
Sbjct  33    LPPGPKPWPIIGNLNLIGSLPHRSLHELTKTYGPLMQVQFGSFPVVVGSSVEMARAFLKT  92

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D  F+ RP+T A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R EE
Sbjct  93    HDVTFSGRPKTAAGKYTTYNYSDITWSPYGPYWRQARKLCIMELFSAKRLESYEYIRTEE  152

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
                L+  ++     G  + L++ L   S+N ++RM+LGK++    E+S  +   EF  + 
Sbjct  153   LMSLLGSLY--VSRGAQLTLKDHLTDLSLNVISRMVLGKKYTEETENSIVKPD-EFKKML  209

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM  875
              ELF L G + +GD +P   ++D  G  K+M+ + K+ D F   +L+EH + ++ +   +
Sbjct  210   DELFLLNGALNIGDSIPWLDFLDLQGYIKRMKALSKKFDRFLEHVLDEHDERRRGVPNYV  269

Query  876   --DFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILK  1046
               D VDVLL    + N    +E   +K   QD+IA  T++SAVT EWA++E++KRP I K
Sbjct  270   AKDMVDVLLQFADDPNLDVKLERKGVKGFTQDLIAGGTESSAVTVEWAISELLKRPEIFK  329

Query  1047  KIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHI  1226
             K  +ELD V+G DR VSE D+ +L Y+  + +ET R HP  P L+P  +     INGY I
Sbjct  330   KATEELDRVIGRDRWVSEKDIANLPYIDAIAKETMRLHPVAPMLVPRMAREDCNINGYDI  389

Query  1227  PAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCP  1406
             P  TRI +    +GR+P +WD  ++FRPER    D        G  F++LPF +G+R CP
Sbjct  390   PKGTRILVLVWTIGRDPKIWDAPEEFRPERFLEHDFD----VKGQSFELLPFGSGRRMCP  445

Query  1407  GAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRH  1586
             G  LG+ ++  +LA L H F+W  PEG+  ED+D  E++G++ PK  PL AVA PRL  H
Sbjct  446   GYSLGLKVIQASLANLLHGFNWKLPEGMSNEDLDMEEIFGLSTPKKIPLVAVAEPRLPEH  505

Query  1587  LYG  1595
             +Y 
Sbjct  506   MYS  508



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 288/494 (58%), Gaps = 25/494 (5%)
 Frame = +3

Query  126   KTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTND  305
             +T   NG  +LPPGP   PI GNL  LG LPHR+ +    KYGP++ +RLG V  I  + 
Sbjct  24    RTASVNGP-KLPPGPWALPIFGNLHMLGNLPHRNLSRLARKYGPIMSMRLGYVPTIVVSS  82

Query  306   PSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRL  485
             P      L   D VFASRP+  A+ +L YG   +A    GP W+  R++C   LLT  ++
Sbjct  83    PEAAELFLKTHDAVFASRPKIQASEYLCYGRKGMAFTEYGPYWRNARKLCTLELLTKVKI  142

Query  486   ESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLG--KQFFGADESS  659
             +SFA  R EE   LV+ +  MA   E VN+ + +G    +   RML G  K +  AD  +
Sbjct  143   DSFAAMRKEELGVLVQSLKQMAAAREVVNISKKVGELIEDMTHRMLFGRCKDYQRADLKA  202

Query  660   GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEE  839
               QE +           L+G   + DYVP    +D  G +++M+ +   VD    K+++E
Sbjct  203   LVQETLI----------LVGAFNIADYVPFLGALDLQGLKRRMKAISGAVDHILEKVIDE  252

Query  840   HRKSKKEIDGE-MDFVDVLLSLPGENGKEH------MEDVEIKALIQDMIAAATDTSAVT  998
             H++   E  G   DFVDV+LSL  E    H      +E   IK ++ D+I  A DTSA T
Sbjct  253   HKQDASENQGNHKDFVDVMLSLMNEMKNFHQEPSYLIEQENIKGIVWDIIIGAIDTSATT  312

Query  999   NEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFL  1178
              EW ++E+ + PR+++++Q+EL+ V+G +RMV E DL +L YL  V++E  R HPAGP L
Sbjct  313   IEWLLSELFRHPRVMRQLQEELENVIGMERMVEEVDLANLVYLDMVLKEGLRLHPAGPLL  372

Query  1179  IPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDDFRPERHFPADGGRVEISH  1355
             +PHES    T+NGY+IP K+RI IN   +GR+P++W ++V+DF PER     G  ++   
Sbjct  373   LPHESIEDITLNGYYIPKKSRIIINAWAIGRDPNIWSNNVEDFFPERFI---GSNIDF-Q  428

Query  1356  GADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTM  1535
             G DF+ +PF +G+RKCPG  LG+  V + LA+L H FDW  P G+ P ++D SE +G+ +
Sbjct  429   GKDFQFIPFGSGRRKCPGMQLGLINVRLVLAQLVHCFDWKLPNGMLPSELDMSEEFGLAL  488

Query  1536  PKATPLFAVARPRL  1577
             P+AT L A+   RL
Sbjct  489   PRATHLHALPTYRL  502



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 195/515 (38%), Positives = 282/515 (55%), Gaps = 19/515 (4%)
 Frame = +3

Query  60    ITLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAF  239
             I LA+F   L L+F + +             RLPPGP  WPI+GNL  +G  PH+  AA 
Sbjct  8     ILLATFIFLLVLLFSLRR-----------NHRLPPGPNPWPIIGNLPHMGHKPHQTLAAM  56

Query  240   CDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAP  419
                YGP++YLRLG  D +     S+  + L   D  FASRP    A H+AY   D+  AP
Sbjct  57    VTTYGPILYLRLGFADVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAP  116

Query  420   VGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFS  599
              G +W+ +R+I   HL + K LE F   R EE   L+ ++       + VNL +++    
Sbjct  117   YGQRWRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMREL--SRAGTKPVNLGQLVNMCV  174

Query  600   MNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCE  779
             +N + R ++G++ FGA       +A EF  +  E+  L G+  +GD+VP    +D  G  
Sbjct  175   INALGREMIGRRLFGAGAD---HKAEEFRSMVTEMMSLAGVFNIGDFVPALDCLDLQGVA  231

Query  780   KKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIKA  950
              KM+ + KR D F   ILEEH     +     D +  L+SL G   +     + D+EIKA
Sbjct  232   GKMKRLHKRFDAFLSSILEEHEMMNGQDQKHTDMLSTLISLKGTDFDGDGGSLTDIEIKA  291

Query  951   LIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLR  1130
             L+ +M +A TDTSA T +WA+AE+I+ P I+ + Q+ELD VVG +R ++E+DL  L YL+
Sbjct  292   LLLNMFSAGTDTSASTVDWAIAELIRHPDIMTRAQEELDTVVGRERPINESDLSQLPYLQ  351

Query  1131  CVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRP  1310
              VV+E FR HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   FRP
Sbjct  352   AVVKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLSFRP  411

Query  1311  ERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGL  1490
             ER  P          G+DF+++PF AG+R C G  LG+  + +  A L H FDW    G+
Sbjct  412   ERFLPGGEKFGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFDWELAGGI  471

Query  1491  RPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              PE ++  E YG+T+ +A PL    +PRL   +YG
Sbjct  472   TPEKLNMEEAYGITLQRAVPLVVHPKPRLAPGIYG  506



>ref|NP_001234840.1| putative flavonoid 3'5' hydroxylase [Solanum lycopersicum]
 gb|ACF32346.1| putative flavonoid 3'5' hydroxylase [Solanum lycopersicum]
 gb|ADC80513.1| flavonoid 3`,5`-hydroxylase [Solanum lycopersicum]
Length=511

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/491 (37%), Positives = 287/491 (58%), Gaps = 8/491 (2%)
 Frame = +3

Query  123   VKTGKENGK-MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITT  299
             + T +E G+ + LPPGP  WP++G L  LG +PH   A    KYGP++YL++G+   +  
Sbjct  26    ITTVRERGRRLPLPPGPTGWPVIGALPLLGSMPHVALAKMAKKYGPIMYLKVGTCGMVVA  85

Query  300   NDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTK  479
             + P+  +  L   D  F++RP    A HLAY   D+  AP GP+WK +R++   H+L  K
Sbjct  86    STPNAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGK  145

Query  480   RLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS  659
              LE++A  RA E  H+++ ++  +++GE V + +VL     N + +++L K+ F      
Sbjct  146   ALENWANVRANELGHMLKSMFDASQDGECVVIADVLTFAMANMIGQVMLSKRVF----VE  201

Query  660   GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEE  839
                E  EF  +  EL  + G   +GD++P   W+D  G EK M+ + K+ DD   K+ +E
Sbjct  202   KGVEVNEFKNMVVELMTVAGYFNIGDFIPKLAWMDIQGIEKGMKNLHKKFDDLLTKMFDE  261

Query  840   HRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAE  1019
             H  +  E     DF+DV+++    +  E +    IKAL+ ++  A TDTS+   EWA+AE
Sbjct  262   HEATSNERKENPDFLDVVMANRDNSEGERLSTTNIKALLLNLFTAGTDTSSSVIEWALAE  321

Query  1020  VIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTR  1199
             ++K P+I KK QQE+D+V+G +R + E+D+ +L YLR + +ETFR HP+ P  +P  S+ 
Sbjct  322   MMKNPKIFKKAQQEMDQVIGKNRRLIESDIPNLPYLRAICKETFRKHPSTPLNLPRVSSE  381

Query  1200  ATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILP  1379
               T++GY+IP  TR+ +N   +GR+P VW++  +F PER       ++E   G DF+++P
Sbjct  382   PCTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFTPERFLSGKNAKIE-PRGNDFELIP  440

Query  1380  FSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFA  1559
             F AG+R C G  +G+ +V   L  L HSFDW  P  +   DI+  E +G+ + KA PL A
Sbjct  441   FGAGRRICAGTRMGIVVVEYILGTLVHSFDWKLPNNVI--DINMEESFGLALQKAVPLEA  498

Query  1560  VARPRLQRHLY  1592
             +  PRL   +Y
Sbjct  499   MVTPRLSLDVY  509



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   367 bits (943),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/474 (41%), Positives = 280/474 (59%), Gaps = 10/474 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             IVGNL  LG +PH   AA   +YGPL++LRLG VD +     S+  + L   D  F+SRP
Sbjct  38    IVGNLPHLGPVPHHSLAALARQYGPLMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRP  97

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
                 A HLAY   D+  AP GP+W+ +R+I   HL + K L+     R EE   L   + 
Sbjct  98    PNSGAKHLAYNYHDLVFAPYGPRWRMLRKISSVHLFSGKALDDLRHVRQEEIAVLAHGLA  157

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
             G     +TVNL ++L   ++N + R+++GK+ FG    SG ++A EF  +  E+  L G+
Sbjct  158   GAGS--KTVNLAQLLNVCTVNALGRVMVGKRLFGDGSGSGDEKADEFKEMVVEMMVLAGV  215

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSL  902
               +GD++P   W+D  G   KM+++ KR D F   I+EEH+KS     G+M  +  LLSL
Sbjct  216   FNIGDFIPALEWLDLQGVAAKMKKLHKRFDAFLTAIVEEHKKSSGGKHGDM--LTTLLSL  273

Query  903   P----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDE  1070
                  GE  K  + D EIKAL+ +M  A TDTS+ T EWA+AE+++ P+IL ++QQELD+
Sbjct  274   KEDADGEGAK--LTDTEIKALLLNMFTAGTDTSSSTVEWAIAELLRHPKILAQVQQELDQ  331

Query  1071  VVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFI  1250
             VVG D++V+E D+ +L YL+ V++ETFR HP+ P  +P  ++ +  ING+HIP    + +
Sbjct  332   VVGRDQLVTELDIPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLV  391

Query  1251  NTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTL  1430
             N   + R+P  W D   FRPER  P          G DF+++PF AG+R C G  LG+ +
Sbjct  392   NVWAISRDPEQWKDPLVFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRM  451

Query  1431  VLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             V +  A L H+FDW+  +GL PE ++  E YG+T+ +A PL    R RL  H Y
Sbjct  452   VHLMAATLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>ref|XP_011079634.1| PREDICTED: cytochrome P450 71A1-like [Sesamum indicum]
Length=507

 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 184/486 (38%), Positives = 292/486 (60%), Gaps = 9/486 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WP++GNL  +G LPHR       KYGPL++L+ GS   +  +   + +  
Sbjct  27    KLNLPPGPKPWPVIGNLNLIGPLPHRSLHQLSQKYGPLLHLQFGSFPVVVGSSVEMAKVF  86

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  FASRP+T A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R
Sbjct  87    LKTMDVTFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIR  146

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
              EE   L++ ++    +G++V L++ L   S+N ++RM+LGK++   D  +      EF 
Sbjct  147   VEEMNSLLKSLF--KSSGQSVLLKDYLSTVSLNVISRMVLGKRYLDKDNENAVVSPEEFK  204

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
              +  ELF L G+I +GD +P   ++D  G  K+M+ V K+ D F   +L+EH + ++ ++
Sbjct  205   KMLDELFLLNGVINVGDLIPWISFLDLQGYVKRMKIVSKKFDRFLEHVLDEHEERRRRVE  264

Query  867   GEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
             G +  D VDVLL L  +   E  +E   +KA  QD++A  T++SAVT EWA+AE++K+P 
Sbjct  265   GYVSRDMVDVLLELAEDPTLEVKLERHGVKAFTQDLLAGGTESSAVTVEWAIAELLKKPE  324

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             I KK  +EL+ V+G ++ V E D+ +L Y+  +V+ET R HP  P L+P  S     + G
Sbjct  325   IFKKATEELNRVIGQNKWVQEKDIPNLPYIEAIVKETMRLHPVAPLLVPRFSREDCKVAG  384

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y I   T++ +N   +GR+PS+W++  +F PER      G+     G DF++LPF +G+R
Sbjct  385   YDIKKGTQVLVNVWTIGRDPSLWENPTEFCPERFI----GKAIDVKGQDFELLPFGSGRR  440

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG  LG+ ++  +LA L H F+W  P+ +RPED++  E++G++ P+  PL AV +PRL
Sbjct  441   MCPGYNLGLKVIQSSLANLLHGFNWELPDHMRPEDLNMEEIFGLSTPRKIPLVAVVKPRL  500

Query  1578  QRHLYG  1595
                +Y 
Sbjct  501   PYEVYN  506



>gb|KDO48981.1| hypothetical protein CISIN_1g010365mg [Citrus sinensis]
Length=512

 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 189/514 (37%), Positives = 302/514 (59%), Gaps = 16/514 (3%)
 Frame = +3

Query  69    ASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
             ++ F  + L+F ++  +     + N  + LPPGP  WPI+GNL  +G LPHR   +   K
Sbjct  9     SAMFYSILLVFPLLLFICGSRCRRN--LNLPPGPCPWPIIGNLNLMGSLPHRSIHSLSQK  66

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YGP++ LR GS   +  +   + +  L   D  FASRPRT A  +  Y   D+  A  GP
Sbjct  67    YGPIMQLRFGSFPVVVGSSVEMAKLFLKIHDANFASRPRTAAGKYTTYNYSDMVWATYGP  126

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNN  608
              W++ R+I +  + + KRLESF   R +E +  +  ++    + + V+L++ L   S+N 
Sbjct  127   YWRQARKIFLIEIFSPKRLESFEFIRVQEIKKFLFGLY--KSSAKPVHLKDHLSKLSLNV  184

Query  609   VTRMLLGKQFFGADESS--GPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
             ++RM+LGK +    E     PQE  E +    ELF+L G++ +GD +P   ++D  G  K
Sbjct  185   ISRMVLGKNYTEETEQDFVTPQEYTEML---QELFYLNGVLEIGDSIPWLGFLDLQGHIK  241

Query  783   KMREVEKRVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPGENGKE-HMEDVEIKAL  953
             +M+ + K++D F+  +L EH   +K   G +  D VDVLL L  +   E  +E  ++KAL
Sbjct  242   RMKALMKKLDRFYELVLHEHNAKRKSSTGFVASDMVDVLLQLADDPTLEFKLERDQVKAL  301

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             IQD++A  T++S VT EWA++E++K+P I  K  +ELD V+G +R+V E D++ L Y+  
Sbjct  302   IQDLLAGGTESSTVTLEWAISELMKKPEIFDKATKELDRVIGRNRLVEEKDIVDLPYIDA  361

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +V+ET R HP  P L+P  +     + GY IP  TR+ +N   +GR+P++W++ ++FRPE
Sbjct  362   IVKETMRLHPVAPMLVPRFARENCKVAGYDIPKNTRVLVNVWAIGRDPTIWENPNEFRPE  421

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R F   G  +++  G DF++LPF AG+R CPG  LG+ ++  +L+ L   F+W  P  ++
Sbjct  422   RFF---GKEIDVK-GHDFELLPFGAGRRMCPGYDLGLKVIQTSLSNLLQCFEWKLPGDMK  477

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              ED+D  E +G++ PK  PL  V +PRL  H+Y 
Sbjct  478   KEDLDMEESFGLSTPKKIPLLVVPQPRLPIHVYS  511



>ref|XP_008678485.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
Length=533

 Score =   368 bits (945),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 197/520 (38%), Positives = 291/520 (56%), Gaps = 17/520 (3%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLL--PVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
                CL ++  I+ L+   +K        RLPPGP  WP++GNL  +G LPHR      +K
Sbjct  18    LLTCLGMVLTIVILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALPHRSIHELSNK  77

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YG L++LR GS   +  + P +    L   D +F  RPRT A  H  Y   D+  +P G 
Sbjct  78    YGELMHLRFGSYSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNYADITWSPYGA  137

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNL-REVLGAFSMN  605
              W+  RRIC   L +  RL SF + RAEE R LV  ++  +     V L ++ L  FSMN
Sbjct  138   YWRHARRICATQLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLGKDHLSTFSMN  197

Query  606   NVTRMLLGKQFFGADESS-----GPQEAM-EFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
              +TRM+LGK+FF  +E+      GP  ++ EFM++  EL  L G++ +GD++P    +D 
Sbjct  198   VITRMVLGKRFFDGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDCLDL  257

Query  768   YGCEKKMREVEKRVDDFHMKILEEH---RKSKKEIDGEMDFVDVLLSLPGENGKE-HMED  935
              G  ++M+ V  R D F   +L+ H   R+ + E     D VDVL+ L  +   E  +  
Sbjct  258   QGYVRRMKRVAARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQLADDPTSEVQIGR  317

Query  936   VEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLH  1115
             V +KA  QD+I   T+  + T EWAM+E++++P +L    +ELD  VG  R V+E D+ H
Sbjct  318   VGVKAFTQDLIVGGTEPVSATVEWAMSELLRKPSVLAMAAEELDREVGRGRWVTEKDVAH  377

Query  1116  LNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDV  1295
             L  L+ +V+ET R HP  P L PH +    +I GY IP  T + IN   +GR+P++WD  
Sbjct  378   LPCLQAIVKETMRVHPIAPLLPPHVTREDASIGGYDIPKGTHVLINVWAIGRDPALWDAP  437

Query  1296  DDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWS  1475
             ++FRPER     G + ++  G DF++LPF +G+R CPG  LG+  + ++LA L H F W+
Sbjct  438   EEFRPERFV---GSKTDVK-GRDFELLPFGSGRRMCPGYSLGLQEIQLSLANLLHGFTWT  493

Query  1476  PPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              PEG+  ED+   E++G++  +  PL  V RPRL   LY 
Sbjct  494   LPEGMAKEDLRMDELFGLSTTRKFPLEVVVRPRLASELYA  533



>ref|NP_001274807.1| flavonoid 3',5'-hydroxylase [Solanum tuberosum]
 gb|AAV85473.1| flavonoid 3',5'-hydroxylase [Solanum tuberosum]
Length=509

 Score =   367 bits (942),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/490 (37%), Positives = 285/490 (58%), Gaps = 8/490 (2%)
 Frame = +3

Query  123   VKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTN  302
             + T +E G+ RLPPGP  WP++G L  LG +PH   A    KYGP++YL++G+   +  +
Sbjct  26    IATVRERGR-RLPPGPTGWPVIGALSLLGSMPHVALAKMAKKYGPIMYLKVGTCGMVVAS  84

Query  303   DPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKR  482
              P+  +  L   D  F++RP    A HLAY   D+  AP GP+WK +R++   H+L  K 
Sbjct  85    TPNAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAPYGPRWKLLRKLSNSHMLGGKA  144

Query  483   LESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSG  662
             LE++A  RA E  H+++ ++  +  GE V + ++L     N + +++L K+ F       
Sbjct  145   LENWANVRANELGHMLKSMFDASHVGECVVIADMLTFAMANMIGQVMLSKRVF----VEK  200

Query  663   PQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH  842
               E  EF  +  EL  + G   +GD++P   W+D  G EK M+ + K+ DD   K+  EH
Sbjct  201   GVEVNEFKNMVVELMTVAGYFNIGDFIPKLAWMDLQGIEKGMKSLHKKFDDLLTKMFNEH  260

Query  843   RKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
               +  E     DF+DV+++    +  E +    IKAL+ ++  A TDTS+   EWA+AE+
Sbjct  261   EATTYERKENPDFLDVVMANKDNSEGERLSTTNIKALLLNLFTAGTDTSSSVIEWALAEM  320

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             +K P+I KK+Q+E+D+V+G +R + E+D+ +L YLR + +ETFR HP+ P  +P  ST  
Sbjct  321   MKNPQIFKKVQEEMDQVIGKNRRLIESDIPNLPYLRAICKETFRKHPSTPLNLPRVSTEP  380

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
              T++GY+IP  TR+ +N   +GR+P VW++  +F PER       ++E   G DF+++PF
Sbjct  381   CTVDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFNPERFLSGKNAKIE-PRGNDFELIPF  439

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              AG+R C G  +G+ +V   L  L HSFDW  P  +   DI+  E +G+ + KA PL A+
Sbjct  440   WAGRRICAGTRMGIVMVEYILGTLVHSFDWKLPNDVI--DINMEESFGLALQKAVPLEAM  497

Query  1563  ARPRLQRHLY  1592
               PRL   +Y
Sbjct  498   VTPRLSLDVY  507



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   366 bits (940),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 191/502 (38%), Positives = 286/502 (57%), Gaps = 16/502 (3%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPL  260
             L L+ I  +I ++      +N   RLPPGP   PI+GN+  LG LPHR   A   KYGP+
Sbjct  9     LALTAIIFLINIV------KNKHKRLPPGPRGIPILGNMHMLGSLPHRALQALSKKYGPI  62

Query  261   VYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKR  440
             +Y+RLG V AI  + P    + L   D VFA+RP    + H+ Y    ++ +  GP W+ 
Sbjct  63    MYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLYDGKGISFSGYGPYWRS  122

Query  441   MRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRM  620
             MR++C+  LL++ ++ SF   R EE   L++     A  G  V++   +   S +   RM
Sbjct  123   MRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSCRM  182

Query  621   LLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVE  800
             + GK++   D      +   F  +  E+  L     +GDY+P    +D  G  ++++   
Sbjct  183   VFGKKYMDKD-----LDERGFKAVIKEVMQLAATPNIGDYIPCLLGLDLQGLTRRIKATA  237

Query  801   KRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAA  977
             K  DDF  KI++EH    KE     D VDV+L L G    E+ ++   IKA+  DM+AA+
Sbjct  238   KVFDDFFEKIIDEHIHKPKEEGQTKDLVDVMLDLMGSEETEYNIQRANIKAISLDMMAAS  297

Query  978   TDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRT  1157
              DTSA T EWA++E+IK P ++KK++ EL++VVG +RMV E+DL  L YL  VV+ET R 
Sbjct  298   MDTSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRL  357

Query  1158  HPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGG  1337
             HP  P LIPHES    T++G+HIP K+R+ +N   +GR+P+ W D D F PER   +D  
Sbjct  358   HPVVPLLIPHESIEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDID  417

Query  1338  RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSE  1517
                   G  F+ +PF +G+R CPG  LG+T+V + LA+L H FDW  P+ +   ++D +E
Sbjct  418   ----FRGQHFQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNE  473

Query  1518  VYGMTMPKATPLFAVARPRLQR  1583
              +G+T+P+A  L A+   R  +
Sbjct  474   EFGLTLPRAKHLVAIPTCRFHK  495



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   367 bits (941),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 198/516 (38%), Positives = 286/516 (55%), Gaps = 15/516 (3%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             + + +L + L   I  ++ V + + N   RLPPGP  WPI+GNL  +G  PH+  AA   
Sbjct  1     MTNLYLTILLPTFIFLIVLVLSRRRNN--RLPPGPNPWPIIGNLPHMGPKPHQTLAAMVT  58

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
              YGP+++LRLG  D +     S+  + L   D  FASRP    A H+AY   D+  AP G
Sbjct  59    TYGPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYG  118

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
              +W+ +R+I   HL + K LE F   R EE   L+ ++     N + VNL +++    +N
Sbjct  119   QRWRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMREL--ARANTKPVNLGQLVNMCVLN  176

Query  606   NVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKK  785
              + R ++G++ FGAD      +A EF  +  E+  L G+  +GD+VP    +D  G   K
Sbjct  177   ALGREMIGRRLFGADAD---HKAEEFRSMVTEMMALAGVFNIGDFVPALDCLDLQGVAGK  233

Query  786   MREVEKRVDDFHMKILEEHRKSKKEIDGE-MDFVDVLLSLPG-----ENGKEHMEDVEIK  947
             M+ + KR D F   ILEEH   K   D +  D +  L+SL G     E G   + D EIK
Sbjct  234   MKRLHKRFDAFLSSILEEHEAMKNGQDQKHTDMLSTLISLKGTDFDGEGGT--LTDTEIK  291

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             AL+ +M  A TDTSA T +WA+AE+I+ P I++K Q+ELD VVG  R ++E+DL  L YL
Sbjct  292   ALLLNMFTAGTDTSASTVDWAIAELIRHPEIMRKAQEELDSVVGRGRPINESDLSQLPYL  351

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             + V++E FR HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   FR
Sbjct  352   QAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFR  411

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PER  P          G DF+++PF AG+R C G  LG+  + +  A L H F+W    G
Sbjct  412   PERFLPGGEKAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEWELAGG  471

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             + PE ++  E YG+T+ +A PL    +PRL R  YG
Sbjct  472   VTPEKLNMEETYGITLQRAVPLVVHPKPRLDRSAYG  507



>ref|XP_011035092.1| PREDICTED: flavonoid 3'-monooxygenase-like [Populus euphratica]
Length=510

 Score =   366 bits (940),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 187/478 (39%), Positives = 288/478 (60%), Gaps = 12/478 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GN   LG LPH+       KYG  + L  GS   I T+   + ++IL   D +FAS
Sbjct  40    WPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLYFGSYPVIVTSSLDMAKQILKTYDHMFAS  99

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RP+T A  +  Y   D+A AP GP W++ R+I +  L + KRLES+   R EE R     
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRR  159

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAME-FMYITHELFHL  713
             ++     G+++ L++ L  ++++ ++R++LGK++F A ES      +E F  +  ELF L
Sbjct  160   LY--RNCGKSIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVTLEEFQEMLDELFLL  217

Query  714   LGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH---RKSKKEIDGEMDFV  884
              G++ +GD++P   ++D  G  K+M++++ R D FH  +++EH   RK+ K    + D V
Sbjct  218   NGVLNIGDWIPWLDFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPK-DMV  276

Query  885   DVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             D+LL L  +   E  +    IK L QD+IA  TDT+A   +W+M+E++K+P++ K++  E
Sbjct  277   DLLLQLADDPELEVKLTRDNIKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDE  336

Query  1062  LDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTR  1241
             LD VVG +R V E D+  L Y+  +++E  R HP+   L PH + +   + GY IP  TR
Sbjct  337   LDRVVGRERWVEEKDIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTR  396

Query  1242  IFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLG  1421
             IFINT  +GR+P +W+D +DFRPER     G  V+I  G +F++LPF +G+R CPG PLG
Sbjct  397   IFINTWSMGRDPDLWEDPEDFRPERFI---GKGVDIK-GHNFELLPFGSGRRMCPGYPLG  452

Query  1422  VTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
               ++L++LA + H F W  P G++PED+   EV+G+   +  P  AVA+PRL  HLY 
Sbjct  453   TKMILVSLANMLHGFTWELPPGIKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>gb|AFW61881.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=557

 Score =   368 bits (944),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 197/520 (38%), Positives = 291/520 (56%), Gaps = 17/520 (3%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLL--PVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDK  248
                CL ++  I+ L+   +K        RLPPGP  WP++GNL  +G LPHR      +K
Sbjct  42    LLTCLGMVLTIVILILRSLKCKSRRRVYRLPPGPRPWPVIGNLNLVGALPHRSIHELSNK  101

Query  249   YGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGP  428
             YG L++LR GS   +  + P +    L   D +F  RPRT A  H  Y   D+  +P G 
Sbjct  102   YGELMHLRFGSYSVVVASSPEMAELFLKAHDLLFLDRPRTAAGKHTTYNYADITWSPYGA  161

Query  429   KWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNL-REVLGAFSMN  605
              W+  RRIC   L +  RL SF + RAEE R LV  ++  +     V L ++ L  FSMN
Sbjct  162   YWRHARRICATQLFSPGRLASFERVRAEEVRRLVRGLFAASGRRRAVRLGKDHLSTFSMN  221

Query  606   NVTRMLLGKQFFGADESS-----GPQEAM-EFMYITHELFHLLGLIYLGDYVPLWRWIDP  767
              +TRM+LGK+FF  +E+      GP  ++ EFM++  EL  L G++ +GD++P    +D 
Sbjct  222   VITRMVLGKRFFDGEEAEESAAEGPVSSLPEFMWMMDELMLLNGVLNIGDWIPWLDCLDL  281

Query  768   YGCEKKMREVEKRVDDFHMKILEEH---RKSKKEIDGEMDFVDVLLSLPGENGKE-HMED  935
              G  ++M+ V  R D F   +L+ H   R+ + E     D VDVL+ L  +   E  +  
Sbjct  282   QGYVRRMKRVAARFDAFLEHVLDTHGQQRRREGESFAARDMVDVLMQLADDPTSEVQIGR  341

Query  936   VEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLH  1115
             V +KA  QD+I   T+  + T EWAM+E++++P +L    +ELD  VG  R V+E D+ H
Sbjct  342   VGVKAFTQDLIVGGTEPVSATVEWAMSELLRKPSVLAMAAEELDREVGRGRWVTEKDVAH  401

Query  1116  LNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDV  1295
             L  L+ +V+ET R HP  P L PH +    +I GY IP  T + IN   +GR+P++WD  
Sbjct  402   LPCLQAIVKETMRVHPIAPLLPPHVTREDASIGGYDIPKGTHVLINVWAIGRDPALWDAP  461

Query  1296  DDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWS  1475
             ++FRPER     G + ++  G DF++LPF +G+R CPG  LG+  + ++LA L H F W+
Sbjct  462   EEFRPERFV---GSKTDVK-GRDFELLPFGSGRRMCPGYSLGLQEIQLSLANLLHGFTWT  517

Query  1476  PPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              PEG+  ED+   E++G++  +  PL  V RPRL   LY 
Sbjct  518   LPEGMAKEDLRMDELFGLSTTRKFPLEVVVRPRLASELYA  557



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   366 bits (940),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 190/486 (39%), Positives = 284/486 (58%), Gaps = 12/486 (2%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WPIVGNL  LG  PH   AA   KYGPL++LRLG VD +     S+  + L 
Sbjct  30    RLPPGPSPWPIVGNLPHLGTTPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  FASRP    A H+AY   D+  AP GP+W+ +R+IC  HL + K L+ F   R E
Sbjct  90    THDANFASRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
             E   L   + G  ++   V L ++L   + N + R++LG++ FG  ++    +A EF  +
Sbjct  150   EVAVLTRALAGAGKS--PVKLGQLLSVCTTNALARVMLGRRVFGERDA----KADEFKDM  203

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGE  872
               E+  L G   +GD++P   W+D  G  KKM+++  + D F   ILEEH+  K      
Sbjct  204   VVEMMVLAGEFNIGDFIPALDWLDLQGITKKMKKLHAQFDSFLNTILEEHKTGKGGSSSH  263

Query  873   MDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
              D    L++L     GE GK  + D+EIKAL+ ++  A TDTS+ T EWA+AE+I+ P+I
Sbjct  264   RDLSSTLIALKDDADGEGGK--LSDIEIKALLLNLFIAGTDTSSSTVEWAIAELIRCPQI  321

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             L++  +E+D VVG +R+V+E+DL  L +L+ +V+ETFR HP+ P  +P  ++ +  I+GY
Sbjct  322   LRQAHEEMDNVVGRERLVTESDLGKLTFLQAIVKETFRLHPSTPLSLPRIASESCEIDGY  381

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
              IP  + + +N   + R+P +W D  +FRP R  P          G DF+++PF AG+R 
Sbjct  382   FIPKGSTLLVNVWAIARDPKMWTDPLEFRPTRFLPGGEKPNVDVKGNDFEVIPFGAGRRI  441

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V + +A L  +FDW    G+ PE ++ +E +G+T+ +A PL    +PRL 
Sbjct  442   CVGISLGLRMVQLLVATLVQTFDWELANGVLPEKLNMNEAFGLTLQRAEPLIVYPKPRLA  501

Query  1581  RHLYGS  1598
              H+Y S
Sbjct  502   PHVYES  507



>ref|XP_002310011.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
 gb|EEE90461.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
Length=493

 Score =   365 bits (938),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 192/500 (38%), Positives = 294/500 (59%), Gaps = 18/500 (4%)
 Frame = +3

Query  87    LSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVY  266
             ++LIF ++Q L  K        RLPPGP  +PI G+L  LG+ PHR F     KYGP+++
Sbjct  11    VALIF-LLQWLSTKNK------RLPPGPRGFPIFGSLHLLGKFPHRAFHQLAQKYGPIMH  63

Query  267   LRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMR  446
             LRLG V  I  + P      L   D VFA RP   +A +++YG   V  +  G  W+ MR
Sbjct  64    LRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHESARYISYGQKSVTFSQYGSYWRNMR  123

Query  447   RICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLL  626
             ++C   LL++ ++ SF   R EE   L++ +   A+    V+L   + + S +   RM+ 
Sbjct  124   KMCTVELLSSLKITSFKSTRMEELDLLIKYIQEAAQERVAVDLSAKVSSLSADMSCRMVF  183

Query  627   GKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKR  806
             GK++   D      +   F  +  E+ HL     LGDY+P    +D  G  K+M+ + K 
Sbjct  184   GKKYLDED-----LDERGFKSVMQEVMHLSAAPNLGDYIPQIGALDLQGLTKRMKAISKV  238

Query  807   VDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVE-IKALIQDMIAAATD  983
             +D F  KI++EH + +++   + DFVDV+LS       E++ D   +KA++ DM+A + D
Sbjct  239   LDLFVSKIIDEHAQYQEKGKNK-DFVDVMLSCMKSEENEYLVDQGCMKAIMLDMLAGSMD  297

Query  984   TSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHP  1163
             TS+   +WA +E+IK PR++KK+Q+EL+EVVG  RMV E+DL  L YL  VV+ETFR HP
Sbjct  298   TSSTVIDWAFSELIKNPRVMKKVQKELEEVVGKQRMVEESDLESLEYLDMVVKETFRLHP  357

Query  1164  AGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRV  1343
              GP LIPHE+     +NG+HIP K+ + IN   +GR+P  W D ++F PER   +D   +
Sbjct  358   VGPLLIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAENFYPERFVGSD---I  414

Query  1344  EISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVY  1523
             ++  G +F+++PF AG+R CPG  LG+T+V + LA+L H FDW  P G+ P ++D +E +
Sbjct  415   DV-RGRNFQLIPFGAGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEF  473

Query  1524  GMTMPKATPLFAVARPRLQR  1583
             G+ + ++  L A+   RL +
Sbjct  474   GLVICRSKHLVAIPTYRLNK  493



>gb|EYU21317.1| hypothetical protein MIMGU_mgv1a004638mg [Erythranthe guttata]
Length=517

 Score =   366 bits (940),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/489 (37%), Positives = 288/489 (59%), Gaps = 14/489 (3%)
 Frame = +3

Query  150   MRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREIL  329
             +RLPPGP  WP++GNL  +G LPHR       KYGPL++LR GS   +  +     +  L
Sbjct  33    LRLPPGPKPWPVIGNLNLIGELPHRSLHHLSQKYGPLMHLRFGSCPIVVGSSVDTAKIFL  92

Query  330   LQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRA  509
                D  FASRP+T A  +  Y   D+  +P GP W++ R++C+  L + KRLES+   R 
Sbjct  93    KTMDATFASRPKTAAGKYTTYNYSDITWSPYGPYWRQARKMCLMELFSAKRLESYEYIRL  152

Query  510   EEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMY  689
             EE   L+++V+  A  G+   L++ L   S+N ++RM+LGK++      +      EF  
Sbjct  153   EEMNSLIKEVYKTA--GKPFPLKDFLSTVSLNVISRMVLGKRYLDEGNENAVVSPEEFKK  210

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK----  857
             +  ELF L G++ +GD +P   ++D  G  K+M+ V ++ D F   +L+EH + ++    
Sbjct  211   MIDELFLLNGVLNVGDLIPWLGFLDLQGYVKRMKIVSRKFDRFLEHVLDEHEERRRGRKT  270

Query  858   ---EIDGEMDFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
                +  G  D VD+LL L  +   E  +E   +KA  QD++A  T++SAVT EWA++E++
Sbjct  271   AAEDCGGGGDMVDLLLELAEDPTLEVKLERHGVKAFTQDLLAGGTESSAVTVEWAISEIL  330

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             K+P+I  K  +ELD V+G +  V E D+++L Y+  +++ET R HP  P L+P  S    
Sbjct  331   KKPKIFIKATEELDRVIGQNNWVKEKDIINLPYIEAIIKETMRLHPVAPMLVPRMSREDC  390

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              ++GY I   T++ +N   +GR+P++W + ++F PER    D   +++  G DF++LPF 
Sbjct  391   KVDGYDIEKGTQVLVNVWTIGRDPAIWVNPNEFWPERFIGKD---IDVK-GQDFELLPFG  446

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R CPG  LG+ ++  +LA L H F+W  P+ ++PED+D  E++G++ P+  PL  V 
Sbjct  447   SGRRMCPGYSLGLKVIQSSLANLLHGFNWKLPDNMKPEDLDMDEIFGLSTPRKVPLVTVV  506

Query  1566  RPRLQRHLY  1592
              PRL   LY
Sbjct  507   GPRLPLELY  515



>ref|XP_009337257.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   366 bits (939),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 192/511 (38%), Positives = 299/511 (59%), Gaps = 26/511 (5%)
 Frame = +3

Query  63    TLASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFC  242
             T     + L+ ++ ++++L   + +++ K  LPPGP   PI+GNL  LG LPHR      
Sbjct  6     TTMLILVFLTFLWSLLRILINASSRQSQK--LPPGPRALPIIGNLHMLGNLPHRSLQNLA  63

Query  243   DKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPV  422
              KYGP++ +RLGS   I  + P      L   D +FASRP+  ++ H+++G   +A +  
Sbjct  64    KKYGPIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSHGTKAMAFSEY  123

Query  423   GPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSM  602
             GP W+ +R++    LL+  R+E+ A  R EEA  LV+ +   AE GE V+L E +    +
Sbjct  124   GPYWRHVRKLSTLQLLSPSRIEASAPLRREEAGLLVQSLKVAAEAGEVVDLSEKVSELVV  183

Query  603   NNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEK  782
                 RM+LG++           +  +   I  E+  L G   +GDYVP    +D  G  K
Sbjct  184   GITYRMVLGRK---------NNDMFDLKGIIEEVMFLSGAFNIGDYVPFLIPLDLQGLTK  234

Query  783   KMREVEKRVDDFHMKILEEH----RKSKKEIDGEMDFVDVLLSL------PGENGKEHME  932
             +M+ + K VD    KI+++H    R  + + +   DFVDVLLSL      P +      E
Sbjct  235   RMKRISKTVDQLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFE  294

Query  933   DVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLL  1112
                 KA++ DMI+ + DTSA+   W +AE+++ P ++K++Q+EL  VVG DRMV E+DL 
Sbjct  295   RTNAKAILLDMISGSFDTSAMAIVWTLAELLRHPEVMKRLQKELQSVVGMDRMVEESDLP  354

Query  1113  HLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-D  1289
              L+YL  VV+E+ R HP GP LIPH+S     ++GYHIP K+R+FIN   +GR+P+VW D
Sbjct  355   KLDYLSMVVKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSRVFINIWTIGRDPNVWSD  414

Query  1290  DVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFD  1469
             +V++F PER   ++   V++  G DF+++PF +G+R+CP   LG+T V +AL  L H F+
Sbjct  415   NVEEFYPERFMNSN---VDL-QGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVHCFN  470

Query  1470  WSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
             W  P G+ P+D+D +E +G+++ KA  L A+
Sbjct  471   WELPTGMLPKDLDMTEKFGLSLSKAKHLLAM  501



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   366 bits (940),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 196/486 (40%), Positives = 279/486 (57%), Gaps = 13/486 (3%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             RLPPGP  WP++GNL QLG  PH+  AA    YGPL  LR GSVD +     ++  + L 
Sbjct  34    RLPPGPRGWPVLGNLPQLGTKPHQTLAAMSKLYGPLFRLRFGSVDVVVAASSTVAAQFLR  93

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D  F++RP    A H+AY   D+  AP GP+W+ +R++C  HL + K L+     R  
Sbjct  94    TYDANFSNRPPNSGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSLKALDDLRLVRQG  153

Query  513   EARHLVEDVWGMAENGET-VNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMY  689
             E   L  ++   A NG   VNL   L   + N + R +LG++ F  +E  G  EA EF  
Sbjct  154   EVAALAANLHRHAANGHPPVNLGRALNVCATNALARAMLGRKVFTEEEGRG--EADEFKE  211

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG  869
             +  EL  L G+  +GD+VP   W+D  G   KM+ + +R D F  +++EEH+   K   G
Sbjct  212   MVVELMKLAGVFNVGDFVPWLGWLDLQGVVGKMKRLHRRYDTFFDRVIEEHQSVAKA--G  269

Query  870   EMDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               D + VL+ L     G+ GK  + + +IKAL+ ++  A TDTS+ T EWA+ E+I+ P 
Sbjct  270   APDLLSVLIRLKEDADGDGGK--LTNTDIKALLLNLFTAGTDTSSSTVEWALVELIRHPD  327

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             IL+K Q+ELD VVG +R+VSE+DL +L  L+ VV+ET R HP+ P  +P  S+    I G
Sbjct  328   ILRKAQEELDSVVGRERLVSESDLPNLPVLQAVVKETLRLHPSTPLSLPRMSSEECVIGG  387

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEIS-HGADFKILPFSAGK  1394
             Y IP      +N   +GR+PSVW D  +FRP R  P  G R  +   G DF+++PF AG+
Sbjct  388   YRIPKHATPLVNVWAIGRDPSVWTDPLEFRPARFLPG-GEREHVDVRGNDFEVIPFGAGR  446

Query  1395  RKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPR  1574
             R C G  LG+ +V +  A + H+FDW+ P G +PE +D  E YG+T+ +A PL     PR
Sbjct  447   RICAGMSLGIRMVQLMTATIVHAFDWTLPGGFKPEHLDMEEAYGLTLQRAVPLDLHPVPR  506

Query  1575  LQRHLY  1592
             L +  Y
Sbjct  507   LLKQSY  512



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   366 bits (939),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/477 (40%), Positives = 280/477 (59%), Gaps = 11/477 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             IVGNL  +G+ PH+  AA   KYGPL+Y+RLG VD +     S+  + L   D  F+SRP
Sbjct  41    IVGNLPHMGQAPHQGLAALAQKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRP  100

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
                 A H+AY   D+  AP GPKW+ +R+IC  H+ ++K L+ F   R EE   LV    
Sbjct  101   PNSGAKHIAYNYQDLVFAPYGPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVN---  157

Query  543   GMAENG-ETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLG  719
              +A+ G + V L ++L   + N ++R++LGK+  G        +A EF  +  EL  L G
Sbjct  158   AIAKAGTKPVQLGQLLNVCTTNALSRVMLGKRVLGDGTGKSDPKAEEFKDMVLELMVLTG  217

Query  720   LIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLS  899
             +  +GD+VP    +D  G   KM+++ KR+D+F   ILEEH+    + +G  D + +L+S
Sbjct  218   VFNIGDFVPALECLDLQGVASKMKKLHKRLDNFMSNILEEHKSVAHQQNGG-DLLSILIS  276

Query  900   LP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             L     GE GK    D EIKAL+ D+  A TDTS+ T EWA+AE+I+ P+IL ++QQE+D
Sbjct  277   LKDNCDGEGGK--FSDTEIKALLLDLFTAGTDTSSSTTEWAIAELIRHPKILAQVQQEMD  334

Query  1068  EVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIF  1247
              VVG DR+++E D+ +L Y + V++E FR HP+ P  +P  +  +  INGYHIP  T + 
Sbjct  335   SVVGRDRLIAEADIPNLTYFQAVIKEVFRLHPSTPLSLPRVANESCEINGYHIPKNTTLL  394

Query  1248  INTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVT  1427
             +N   + R+P VW D  +F+PER  P          G DF+++PF AG+R C G  LG+ 
Sbjct  395   VNVWAIARDPEVWADPLEFKPERFLPGGEKPNVDVKGNDFELIPFGAGRRICAGLSLGLR  454

Query  1428  LVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGS  1598
             +V +  A L H++DW+  +GL PE ++  E YG+T+ +  PL      RL   +Y S
Sbjct  455   MVQLMTATLAHTYDWALADGLMPEKLNMDEAYGLTLQRKVPLMVHPTRRLSARVYNS  511



>ref|XP_009337201.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=519

 Score =   366 bits (940),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 193/512 (38%), Positives = 298/512 (58%), Gaps = 26/512 (5%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
               + L+ ++ ++++L   + +++ K  LPPGP   PI+GNL  LG LPHR       KYG
Sbjct  23    ILVFLTFLWSLLRILINASSRQSQK--LPPGPRALPIIGNLHMLGNLPHRSLQNLAKKYG  80

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             P++ +RLGS   I  + P      L   D +FASRP+  A+ +++YG   +A +  G  W
Sbjct  81    PIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQASKYMSYGTKAMAFSEYGSYW  140

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             + +R++C   LL   R+E+FA  R EE   LV+ +   AE G+ V+L E +G   +    
Sbjct  141   RHVRKLCTLQLLCPSRIEAFAPLRREEVGLLVQSLKVAAEAGKVVDLSEKVGELVVGITY  200

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             +M+LG++           +  +   I  E   L G   + DYVP    +D  G  K+M+ 
Sbjct  201   KMVLGRR---------NNDMFDLKGIIEETMFLTGAFNISDYVPFLIPLDLQGLTKRMKR  251

Query  795   VEKRVDDFHMKILEEHRKSKK--EIDGE--MDFVDVLLSL------PGENGKEHMEDVEI  944
             + K VD    +I++EH +  +  ++ G    DFVDVLLSL      P +      E    
Sbjct  252   ISKTVDQLFERIIQEHEQVSRSEQVHGNHHKDFVDVLLSLIHQPLNPNDKEVYMFERTNA  311

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KA++ DMI+ + DTSA    W +AE+++ P+++K++Q+EL  VVG DRMV E+DL  L+Y
Sbjct  312   KAILLDMISGSFDTSATAIVWTLAELLRHPKVMKRLQKELQSVVGMDRMVEESDLPKLDY  371

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVW-DDVDD  1301
             L  VV+E+ R HP GP LIPH+S     ++GYHIP K+ IFIN   +GR+P+VW D+V++
Sbjct  372   LSMVVKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKKSIIFINIWTIGRDPNVWSDNVEE  431

Query  1302  FRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             F PER   ++   V++  G DF+++PF +G+R+CP   LG+T V +AL  L H F+W  P
Sbjct  432   FYPERFMNSN---VDL-QGHDFQLIPFGSGRRRCPAMQLGLTTVRLALGNLVHCFNWELP  487

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              G+ P+D+D +E +G++M KA  L A+   RL
Sbjct  488   TGMLPKDLDMTEKFGLSMSKAKHLLAMPTHRL  519



>gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   365 bits (938),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 284/484 (59%), Gaps = 13/484 (3%)
 Frame = +3

Query  129   TGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDP  308
             T K+N K  LPPGP  +PI GNL  LG+ PHR       KYGP+ +LRLG V  I  + P
Sbjct  26    TSKKNYK--LPPGPRGFPIFGNLHLLGKFPHRALHQLAQKYGPITHLRLGLVTTIVVSSP  83

Query  309   SIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLE  488
             +     L   D VFASRP   +A +++Y   +++ A  GP W+ +R++C   LL+  ++ 
Sbjct  84    NAAESFLKTNDIVFASRPPHESAKYISYQQKNLSFASYGPYWRNVRKMCTLELLSNHKIN  143

Query  489   SFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQ  668
             SF   R EE   L++ +   +   E V+L   + + S +   RM+ GK++   DE     
Sbjct  144   SFKFIRKEELDLLIKYIKEASFQREAVDLSAKVASLSADMSCRMVFGKKYMD-DEF----  198

Query  669   EAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRK  848
             +A  F  +  E   L     LGDY+P   W+D  G  K+M+ V K  D F  KI++EH +
Sbjct  199   DARGFKVVIQEGMKLAAAPNLGDYIPQIAWLDLQGLTKRMKAVSKVFDGFFEKIIDEHIQ  258

Query  849   SKKEIDGEMDFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
              K E   + DFVDV+L   G    E H+    IKA+I DM+A + DTSA   EWA++E++
Sbjct  259   FKDESRTK-DFVDVMLEFVGSEVSEYHIGRDHIKAIILDMLAGSMDTSAAVIEWALSELL  317

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             K PRI+KK+Q+EL+  VG ++MV E+DL +L YL  V++ETFR HP  P LIPH++T+ T
Sbjct  318   KHPRIMKKVQKELELKVGLNKMVEESDLENLEYLEMVIKETFRLHPVAPLLIPHQATQDT  377

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              ++GY IP  + I INT  +GR+PS W D + F PER     G  V+   G DF++LPF 
Sbjct  378   IVDGYLIPKNSHIVINTWAIGRDPSAWTDPERFLPERF---AGNNVDF-RGRDFQLLPFG  433

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R CPG  LGVT+V + LA+L H FDW  P  + P ++D SE + +  P+A  L A+ 
Sbjct  434   SGRRGCPGIQLGVTVVRLVLAQLVHCFDWELPNDMLPNELDMSEEFSLVTPRAKHLLALP  493

Query  1566  RPRL  1577
               RL
Sbjct  494   TYRL  497



>ref|XP_011071969.1| PREDICTED: flavonoid 3'-monooxygenase-like [Sesamum indicum]
Length=507

 Score =   365 bits (938),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 189/512 (37%), Positives = 300/512 (59%), Gaps = 16/512 (3%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
             +F CLSLI  +  L  V       K+ LPPGP  WP++GNL  +G LPHR       KYG
Sbjct  6     WFSCLSLIVFVYVLTKVL---RREKLNLPPGPRPWPVIGNLNLIGPLPHRSIHELAQKYG  62

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PL++L+ GS   +  ++  + +  L   D  FASRP T A  +  Y   D+  AP GP W
Sbjct  63    PLIHLKFGSASVVVGSNVEMAKVFLKTMDVNFASRPVTAAGKYTGYNYTDITWAPYGPYW  122

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             ++ RR+C+  L + KRLES+   R EE   L+++++     G+ + +++ L   ++N ++
Sbjct  123   RQARRMCLMELFSAKRLESYEYIRIEEMNSLLKNMFKCC--GQPILVKDYLSTVTLNVIS  180

Query  615   RMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMRE  794
             RM+LGK++   D  +      EF  +  ELF L G+I +GD +P   ++D  G  K+M+ 
Sbjct  181   RMVLGKRYLDKDIENPVVAPQEFKKMLDELFLLNGVINVGDLIPWISFLDLQGYVKRMKI  240

Query  795   VEKRVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDM  965
             V K+ D F   +L+EH++ ++ I+G +  D VDVLL L  +   E  +E   +K  I D+
Sbjct  241   VHKKFDKFLEHVLDEHQERRRSIEGYVSRDMVDVLLELAEDPTLEVKLERHGVKGHILDL  300

Query  966   IAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRE  1145
             +A  T++S VT  WA++E++K+P+  KK  +ELD V+G +R V E D+ +L Y++ +++E
Sbjct  301   LAGGTESSTVTIIWAISELLKQPKYFKKATEELDRVIGRNRWVKEQDMPNLPYIQAIMKE  360

Query  1146  TFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHF-  1322
             T R HP  P L P  +     + GY I   T++F+N   +G +PS+W++  +F P+R   
Sbjct  361   TMRLHPIAPILTPRLAREDCKVAGYDIKKGTQVFVNVWTIGLDPSIWENPTEFNPDRFIK  420

Query  1323  -PADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPE  1499
              P D        G DF++LPF AG+R CPG  LG+ ++L +LA L H F+W  P+ ++PE
Sbjct  421   KPID------VRGHDFELLPFGAGRRMCPGYSLGLKVILSSLANLIHGFNWKLPDPMKPE  474

Query  1500  DIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             D++  EV+G+++P+  PL AV  PRL   +Y 
Sbjct  475   DLNMEEVFGLSVPRKVPLVAVPEPRLPLEVYN  506



>ref|XP_004510480.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=511

 Score =   365 bits (938),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 186/488 (38%), Positives = 286/488 (59%), Gaps = 14/488 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K  LPPGP  WPI+GN   +G LPH+       KYGP++YLR GS   I  +   I +  
Sbjct  32    KYNLPPGPKPWPIIGNFNLIGPLPHQSIHGLTQKYGPMMYLRFGSKPVIVGSTVKIAQAF  91

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D   A RP   A  +  Y   D+  +  GP W++ RR+C+  L + KRLES+   R
Sbjct  92    LKTHDAALAGRPNLSAGKYTTYNYSDITWSQYGPYWRQARRMCLLELFSAKRLESYEYIR  151

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAME  680
              +E R L+  ++      +T+ L++ L   S+N ++RM+LGK++    E++   P E   
Sbjct  152   KQELRVLLHGLFN--SKNKTILLKDHLTTLSLNVISRMVLGKKYLEETENAIISPDE---  206

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  ELF L G++ +GD++P   ++D  G  K+M+ + K+ D F   +LEEH + +K 
Sbjct  207   FKKMLDELFLLNGVLNIGDFIPWIHFLDLQGYVKRMKTLGKKFDRFMEHVLEEHIERRKN  266

Query  861   IDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKR  1031
             +   +  D VDVLL L  +   E  +E   +KA  QD+IA  T++SAVT EWA++E++KR
Sbjct  267   VKDFVAKDMVDVLLQLADDPDLEVKLERHGVKAFTQDLIAGGTESSAVTVEWAISELVKR  326

Query  1032  PRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTI  1211
             P I KK   ELD+V+G DR V E D+++L Y+  + +ET R HP  P L+P ++     +
Sbjct  327   PEIFKKATDELDKVIGKDRWVEEKDIVNLPYVYAIAKETMRLHPVAPMLVPRQAREDCNV  386

Query  1212  NGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAG  1391
             +GY IP  + I +NT  +GR+ ++W++  +F PER    D   +++  G DF++LPF AG
Sbjct  387   DGYDIPKGSLILVNTWTIGRDSNIWENPYEFMPERFLDKD---IDVK-GHDFELLPFGAG  442

Query  1392  KRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARP  1571
             +R CPG PLG+ ++  +LA L H ++W  P  ++ ED++  EV+G++ PK  PL  V  P
Sbjct  443   RRMCPGYPLGIKVIQSSLANLLHGYNWKLPNNVKKEDLNMEEVFGLSTPKKIPLQVVVEP  502

Query  1572  RLQRHLYG  1595
             RL  HLY 
Sbjct  503   RLPHHLYS  510



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 196/514 (38%), Positives = 289/514 (56%), Gaps = 16/514 (3%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             + F C +L   ++     +       +RLPPGP  WPIVGNL  LG +PH   AA    Y
Sbjct  5     ALFFCTALFCVLLYHFLTRR-----SVRLPPGPKPWPIVGNLPHLGPVPHHSIAALAKTY  59

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GPL++LR+G VD +     S+  + L   D  F++RP    A H+AY   D+  AP GP+
Sbjct  60    GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNN  608
             W+ +R+IC  HL + K L+ F   R EE   L      +A  G+T VNL ++L   + N 
Sbjct  120   WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTR---ALARAGQTPVNLGQLLNVCTTNA  176

Query  609   VTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKM  788
             + R++LG++ FG        +A EF  +  EL  L G+  +GD+VP   W+D  G   KM
Sbjct  177   LGRVMLGRRVFGDGSGGEDPKADEFKEMVVELMVLAGVFNIGDFVPALEWLDLQGVAAKM  236

Query  789   REVEKRVDDFHMKILEEHR-----KSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKAL  953
             +++  R D F   I+EEH+      S++ +D     + V  +  GE GK  + DVEIKAL
Sbjct  237   KKLHARFDAFLGAIVEEHKISGSAGSERHVDLLSTLISVRDNADGEGGK--LTDVEIKAL  294

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             + ++  A TDTS+ T EWA+AE+I+ P ++ + QQELD VVG  R+V++ DL  L YL+ 
Sbjct  295   LLNLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAVVGRGRLVTDLDLPRLTYLQA  354

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +++ETFR HP+ P  +P  +  +  INGYHIP    + +N   + R+P VW+   +FRP 
Sbjct  355   IIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPS  414

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R  P          G DF+++PF AG+R C G  LG+ +V +  A L H+F+W  PEG  
Sbjct  415   RFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNWELPEGQV  474

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              E ++  E YG+T+ +A PL    RPRL   ++G
Sbjct  475   AEKLNMDEAYGLTLQRAAPLMVYPRPRLSPQVFG  508



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 195/490 (40%), Positives = 285/490 (58%), Gaps = 14/490 (3%)
 Frame = +3

Query  144   GKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIRE  323
             G + LPPGP  WPI+GNL  LG  PH+   A    +GPL  LRLGS + I     SI  E
Sbjct  28    GGLPLPPGPKGWPILGNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASE  87

Query  324   ILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKH  503
              L   D  F++RP    A H+AY   D+  AP GP+W+ +R++C  HL + K LE     
Sbjct  88    FLRTHDTNFSNRPPNSGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYV  147

Query  504   RAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLG-KQFFGADESSGPQEAME  680
             R +E   L  D+ G   +   VNL E L   + N ++R  +G + F G  E      A E
Sbjct  148   REQEVAILARDLAG---SSRPVNLGETLNVCATNALSRATIGWRVFVGKGEDV---TAEE  201

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKS--K  854
             F  +  E+  L G+  +GD+VP   W+D  G   KM+++ KR+D F  K++ EHR +   
Sbjct  202   FKDMVMEVMRLAGVFNIGDFVPGLGWLDLQGVVGKMKKLHKRMDSFLDKLIAEHRAAVAG  261

Query  855   KEIDGEMDFVDVLLSLPGENGKE--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
              E+ G+ D + V++ L  E   E   + D EIKAL+ ++  A TDT++ T EWA+AE+I+
Sbjct  262   GELAGK-DLLSVMVRLQEEGEGEGGKLTDTEIKALLLNLFTAGTDTTSSTVEWALAELIR  320

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              P++L + Q+ELD VVG DR+VSE+DL HL +L  +++ETFR HP+ P  +P  ++ + T
Sbjct  321   HPQLLHQAQKELDTVVGHDRLVSESDLPHLPFLSAIIKETFRLHPSTPLSLPRMASESCT  380

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP-ADGGRVEISHGADFKILPFS  1385
             INGYHIP    + +N   + R+P+VW    +F+P+R  P  DG  +++  G+DF+++PF 
Sbjct  381   INGYHIPKNATLLVNVWAIARDPAVWAAPVEFKPDRFMPGGDGVHLDVK-GSDFEMIPFG  439

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             AG+R C G  LG+ +V    A L H FDW  P G+  E +D  E YG+T+ +A PL  + 
Sbjct  440   AGRRICAGMSLGLRMVTFMTATLVHGFDWKLPNGVVAEKLDMEEAYGLTLQRAVPLMVLP  499

Query  1566  RPRLQRHLYG  1595
              PRL +  YG
Sbjct  500   VPRLAKQAYG  509



>dbj|BAP15886.1| cytochrome P450 71AU50 [Prunus mume]
Length=497

 Score =   365 bits (936),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/486 (40%), Positives = 289/486 (59%), Gaps = 16/486 (3%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSII  317
             +N K RLPPGP  +PI G+L  LG  P++D      KYG ++Y+RLG +  I  + P   
Sbjct  22    KNKKKRLPPGPRGFPIFGSLHLLGEFPNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAA  81

Query  318   REILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFA  497
                L   D VFASRP    + H+++G  ++  +  G  W+  R++C   LL+  ++ SF 
Sbjct  82    ELFLKTHDLVFASRPPHEGSKHISFGQKNLIFSEYGAYWRDTRKMCTIELLSNHKINSFK  141

Query  498   KHRAEEARHLVEDVWGMAEN-GETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEA  674
               R EE    VE +   A N G  V+L + + + S++   RM+LGK++   DE    +  
Sbjct  142   SMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSCRMVLGKKY--RDEEFDERG-  198

Query  675   MEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSK  854
               F  +  E   L     LGDY+     +D  G  K+M+ V K  D+   KI+EEH +  
Sbjct  199   --FKSVVREAIQLASAPNLGDYIRFIAPLDLQGFTKRMKSVNKAFDNLFEKIIEEHLQPN  256

Query  855   KEIDGE--MDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
                DGE  MDFVDV++   G    E+ +E   IKA++ DM+ A+ DTSA T EWA++E++
Sbjct  257   ---DGERTMDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASMDTSATTIEWALSELM  313

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             + P+ +KK+Q+EL+ VVG D+MV E+DL  L+YL  VV+ETFR HP  P LIPH S    
Sbjct  314   RHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLHPVAPLLIPHASIEDC  373

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
             T+NGYHIP K+R+ IN   +GR+P+ W D + F PER    +G  V++  G  F+++PF 
Sbjct  374   TVNGYHIPKKSRVLINVWAIGRDPNAWTDAEKFIPERF---EGSSVDV-RGNHFQLIPFG  429

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R+CPG  LG+T+V + LA+L H FDW  P  + PE++D +E +G+T+P+A  L A+ 
Sbjct  430   SGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIP  489

Query  1566  RPRLQR  1583
               RL++
Sbjct  490   SYRLRK  495



>ref|XP_004304846.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=499

 Score =   365 bits (936),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 188/478 (39%), Positives = 280/478 (59%), Gaps = 10/478 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  +PI+GNLL LG  PH D      K+G ++YLRLG V  I  + P      L  
Sbjct  31    LPPGPRGFPIIGNLLMLGEFPHVDLHRLSQKHGDIMYLRLGLVPTIVVSSPQAAELFLKT  90

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D  FA+RP   AA H++YG  +++ A  GP W+ +R++C   LL+  ++ S    R EE
Sbjct  91    HDHSFATRPPHEAAKHISYGQRNLSYAEYGPYWRTIRKMCTLELLSNHKINSLKPMRKEE  150

Query  516   ARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYIT  695
                 +  +     +   V+L   + + + +   R++ GK++   +      +A    +I 
Sbjct  151   LDLFMNFIQEACRDRAAVDLSAKVSSLNTDMTCRLVFGKKYMDKEFDEKGFQA----WIV  206

Query  696   HELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM  875
              E  HL G    GDY+P     D  G  K+M+ V K  DDF  KI++EH KS+ + +   
Sbjct  207   -EGMHLAGTPNFGDYLPFLAPFDLQGLTKRMKAVRKVFDDFFEKIIDEHIKSQDDQERTK  265

Query  876   DFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKI  1052
             DFVDV+L   G    E+ +E   IKA+I DM+A A DTSA   EW ++E+++ PR++KK+
Sbjct  266   DFVDVMLCFMGSKESEYKIERSNIKAIILDMVAGAMDTSATAIEWTLSELMRHPRVMKKV  325

Query  1053  QQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPA  1232
             Q+EL++VVG DRMV E+DL  L YL  VV+E  R HP  P LIPH +    T+NG+HIP 
Sbjct  326   QKELEDVVGMDRMVDESDLEKLEYLNMVVKENLRLHPVAPLLIPHAAIEDCTVNGFHIPK  385

Query  1233  KTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGA  1412
             K+R+ +N   +GR+PS W D D F PER     G  +++  G DF++LPF +G+R CPG 
Sbjct  386   KSRVMVNVWAVGRDPSAWTDPDKFIPERFV---GSNIDL-RGRDFQLLPFGSGRRGCPGM  441

Query  1413  PLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRH  1586
              LG+T+V + +A+L H FDW  P+ + P ++D +E +G+T+P+A  L A+   RL++ 
Sbjct  442   HLGLTVVHLVVAQLVHCFDWELPDNILPTELDMTEEFGLTVPRAKHLLAIPSYRLRQQ  499



>ref|XP_008227094.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   365 bits (936),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 289/486 (59%), Gaps = 16/486 (3%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSII  317
             +N K RLPPGP  +PI G+L  LG  P++D      KYG ++Y+RLG +  I  + P   
Sbjct  22    KNKKKRLPPGPRGFPIFGSLHLLGEFPNKDLHRLARKYGDIMYMRLGLMPTIVISSPEAA  81

Query  318   REILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFA  497
                L   D VFASRP    + H+++G  ++  +  G  W+  R++C   LL+  ++ SF 
Sbjct  82    ELFLKTHDLVFASRPPHEGSKHISFGQKNLIFSEYGAYWRDTRKMCTIELLSNHKINSFK  141

Query  498   KHRAEEARHLVEDVWGMAEN-GETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEA  674
               R EE    VE +   A N G  V+L + + + S++   RM+LGK++   DE    +  
Sbjct  142   SMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSCRMVLGKKY--RDEEFDERG-  198

Query  675   MEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSK  854
               F  +  EL  L     LGDY+     +D  G  K+M+ V K  D+   KI+EEH +  
Sbjct  199   --FKSVVRELIQLASAPNLGDYIRFIAPLDLQGFTKRMKSVNKAFDNLFEKIIEEHLQPN  256

Query  855   KEIDGE--MDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
                DGE  MDFVDV++   G    E+ +E    KA++ DM+ A+ DTSA T EWA++E++
Sbjct  257   ---DGERTMDFVDVMVGFMGSEESEYRIERPHTKAIMLDMLVASMDTSATTIEWALSELM  313

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             + P+ +KK+Q+EL+ VVG D+MV E+DL  L+YL  VV+ETFR HP  P L+PH S    
Sbjct  314   RHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLHPVAPLLVPHASIEDC  373

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
             T+NGYHIP K+R+ IN   +GR+P+ W D + F PER    +G  V++  G  F+++PF 
Sbjct  374   TVNGYHIPKKSRVLINVWAIGRDPNAWTDAEKFIPERF---EGSSVDV-RGNHFQLIPFG  429

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R+CPG  LG+T+V + LA+L H FDW  P  + PE++D +E +G+T+P+A  L A+ 
Sbjct  430   SGRRRCPGIQLGLTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIP  489

Query  1566  RPRLQR  1583
               RL++
Sbjct  490   SYRLRK  495



>ref|XP_002516018.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF46438.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=521

 Score =   365 bits (938),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 184/496 (37%), Positives = 288/496 (58%), Gaps = 16/496 (3%)
 Frame = +3

Query  141   NGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIR  320
             N  + LPPGP  WPI+GN   +G LPH+       K+GP++ L+ GS   +  +   + +
Sbjct  30    NRSLNLPPGPKPWPIIGNFNLIGHLPHQSLHKLSQKFGPIMQLKFGSYPVVIVSSAEMAK  89

Query  321   EILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAK  500
             +IL   D +FASRP+T A  +  Y   +V  AP G  W++ R+I +  L ++KRL+S+  
Sbjct  90    QILRTNDHIFASRPQTAAGKYTTYNYSNVTWAPYGAYWRQGRKIYLHELFSSKRLDSYHD  149

Query  501   HRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM-  677
              R EE R  V  +  ++  G+ + L++ L   +++ ++R++LGK++F  +  S       
Sbjct  150   IRVEEMRAFVSRIHTLSVTGKPILLKDHLSRATLSIISRIVLGKKYFITESESESLSESE  209

Query  678   --------EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKIL  833
                     EF  I  ELF L G++ +GD++P   ++D  G  K+M+ ++ + D FH  +L
Sbjct  210   TSVITTLGEFQKILDELFLLNGVMNIGDWIPWLAFLDLQGYVKRMKALKVKWDRFHDHVL  269

Query  834   EEHRKSKKEIDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNE  1004
              EH+  K E+   +  D VD+LL L  +   E  + +  +K  IQD+IA  TDTSA T E
Sbjct  270   GEHKAKKAEVKNFVPKDMVDLLLQLADDPELEVKLNNDSVKGFIQDLIAGGTDTSATTVE  329

Query  1005  WAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIP  1184
             WAM+E++K+P ++KK  +ELD V+G +R V E D+  L Y+  +++ET R HP    L P
Sbjct  330   WAMSELLKQPSLIKKATEELDRVIGKERWVEEKDIPQLPYIDAIMKETMRKHPVAVMLAP  389

Query  1185  HESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGAD  1364
             H +     +NG+ I   T +FINT  +GR+P +WDD ++FRPER      G+     G  
Sbjct  390   HYALEDAKVNGHDIAKGTTVFINTWSIGRDPLLWDDPEEFRPERFL----GKAIDVKGQS  445

Query  1365  FKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKA  1544
             F++LPF +G+R CPG  LG+ ++  +LA L H F+W  P+ ++PED+   EVYG+  P+ 
Sbjct  446   FELLPFGSGRRMCPGYSLGLKMIQSSLANLLHGFNWKLPDDMKPEDLSMDEVYGLATPRK  505

Query  1545  TPLFAVARPRLQRHLY  1592
              PL AV  PRL  +LY
Sbjct  506   FPLVAVTEPRLPINLY  521



>ref|XP_002989844.1| hypothetical protein SELMODRAFT_235879 [Selaginella moellendorffii]
 gb|EFJ09111.1| hypothetical protein SELMODRAFT_235879 [Selaginella moellendorffii]
Length=488

 Score =   364 bits (935),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 194/479 (41%), Positives = 283/479 (59%), Gaps = 15/479 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GNLL +G +PH         YGPLVYLRLG++  + ++DP+II+E L  QD +FAS
Sbjct  20    WPIIGNLLDVGTVPHEGMMKLTRAYGPLVYLRLGAIPHVVSDDPAIIKEFLKIQDHIFAS  79

Query  357   RP-RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVE  533
             RP   + A  L YG  D+  AP G  W+ MR+IC   L + K ++SF + R  E  H + 
Sbjct  80    RPGNVILAELLTYGGKDIGFAPYGAHWRNMRKICTLELFSAKSVDSFQRLRRMEMIHTLG  139

Query  534   DVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHL  713
              +   A +   V+LR+     + N +TRMLLGK++FG  +  GP+   E   +  E   +
Sbjct  140   LILDAAVDRRAVDLRDAFNGLTSNMMTRMLLGKRYFGPGDP-GPEVGAELKAMIAEGILM  198

Query  714   LGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH--RKSKKEIDGEMDFVD  887
             +    + DY+P  R++D  G E++M+++ + +D     +L E   R  KK       FVD
Sbjct  199   MNGFNISDYLPFLRFLDLQGQERRMKQIMRHIDGLATALLLELAPRIGKKP----ESFVD  254

Query  888   VLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELD  1067
             +L++L GENG+ H+ +  +KA++ DM+AA TDT  V+ EWAMAE+++ P +L ++++E+D
Sbjct  255   ILVNLRGENGEPHLPEDVMKAVMVDMMAAGTDTPGVSCEWAMAELLRDPALLARVREEVD  314

Query  1068  EVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIF  1247
              VV  DR+V E+DL H   LR V++E+FR HP G  LIPH +     + GY IP  TR+ 
Sbjct  315   RVVCVDRLVDESDLAHFRLLRAVLKESFRLHPVGAILIPHLAMEDAVVAGYGIPKDTRVL  374

Query  1248  INTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHG-ADFKILPFSAGKRKCPGAPLGV  1424
             IN   L RN  VW+   +F PERH    G    +  G  + +++PF +G+R CP A LG+
Sbjct  375   INVFALNRNAQVWERPHEFDPERHLRGLGEGAVVEFGDPECRLIPFGSGRRMCPAASLGL  434

Query  1425  TLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYGSR  1601
             T+VL+ALA L H+FDW  P  L      + E     M KA  L A+ARPRL RHLY  +
Sbjct  435   TMVLLALANLVHAFDWEVPANL------SMERAPGKMVKAQALTALARPRLPRHLYSQQ  487



>gb|KHG15722.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   365 bits (937),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 188/516 (36%), Positives = 298/516 (58%), Gaps = 21/516 (4%)
 Frame = +3

Query  66    LASFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCD  245
             L ++   L+LI   ++  P +      K+ LPPGP  WP++GNL  +G LPHR   +   
Sbjct  10    LIAWLATLALILLSLRFRPRR------KLNLPPGPKPWPVIGNLDLIGSLPHRSIHSLSQ  63

Query  246   KYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVG  425
             KYGPL+ L+ GS   +  +   + +  L   D +FA RP+  A  +  Y   D+  +P G
Sbjct  64    KYGPLMQLKFGSFPVVVASSVEMAKAFLKTHDVIFAGRPKIAAGEYTTYNYSDITWSPYG  123

Query  426   PKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMN  605
             P W++ R++CM  L + KRLES+   R EE + L++  +    +G  + L++ L   S+N
Sbjct  124   PYWRQARKMCMTELFSAKRLESYEYIRREEMKLLLKGFY--ESSGVPIVLKDHLSDLSLN  181

Query  606   NVTRMLLGKQFFGADESSGPQEAM---EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
              ++RM+ GK++    E +G  E +   EF  +  ELF L G++ +GD +P  R++D  G 
Sbjct  182   VISRMVFGKKY---TEGTGENEIVTPKEFKEMLDELFLLNGVLDIGDSIPWLRFLDLQGN  238

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM--DFVDVLLSLPGE-NGKEHMEDVEIK  947
              K+M+ + K+ D F   +L+EH   ++++   +  D VDVLL L  + N    +E   +K
Sbjct  239   IKRMKALSKKFDKFLEHVLDEHNARRRDVKDYIAKDMVDVLLQLADDPNLDVKLERHGVK  298

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             A  QD+IA  T++SAVT EWA++E++K+P I  K  +ELD V+G +R V E D+++L Y+
Sbjct  299   AFSQDLIAGGTESSAVTVEWAISEMLKKPEIFAKATEELDRVIGRERWVEERDIVNLPYI  358

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
               + +ET R HP  P L+P  +     ++GY I   TR  +N   +GR+P+VWD+ ++F 
Sbjct  359   DSIAKETMRLHPVAPMLVPRMTREDCQVDGYDILKGTRALVNVWTIGRDPTVWDNPNEFF  418

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PER       +     G DF++LPF AG+R CPG PLG+ ++  +LA L H F W  P  
Sbjct  419   PERFI----DKTIDVKGHDFQLLPFGAGRRMCPGYPLGIKVIQASLANLLHGFTWKLPGN  474

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             +  +D+D  E++G++ PK  PL AVA P+L  H+Y 
Sbjct  475   MTKDDLDMEEIFGLSTPKKCPLQAVAVPKLPLHMYS  510



>ref|XP_002324180.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
 gb|EEF02745.2| hypothetical protein POPTR_0018s05370g [Populus trichocarpa]
Length=510

 Score =   365 bits (936),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 185/478 (39%), Positives = 289/478 (60%), Gaps = 12/478 (3%)
 Frame = +3

Query  177   WPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFAS  356
             WPI+GN   LG LPH+       KYG  + L  GS   + T+   + ++IL   D +FAS
Sbjct  40    WPIIGNFNLLGPLPHQSLHQLSLKYGKTMQLHFGSYPVMVTSSLDMAKQILKTYDHMFAS  99

Query  357   RPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVED  536
             RP+T A  +  Y   D+A AP GP W++ R+I +  L + KRLES+   R EE R     
Sbjct  100   RPQTAAGKYTTYEYSDLAWAPYGPYWRQGRKIYLTELFSAKRLESYEYMRVEEMREFTRR  159

Query  537   VWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAME-FMYITHELFHL  713
             ++     G+++ L++ L  ++++ ++R++LGK++F A ES     ++E F  +  ELF L
Sbjct  160   LY--RNCGKSIELKDYLSHYTLSIISRIVLGKKYFSASESEKEIVSLEEFQEMLDELFLL  217

Query  714   LGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEH---RKSKKEIDGEMDFV  884
              G++ +GD++P   ++D  G  K+M++++ R D FH  +++EH   RK+ K    + D V
Sbjct  218   NGVLNIGDWIPWLDFLDLQGYVKRMKKLKVRFDKFHDHVIDEHNVRRKTTKNWQPK-DMV  276

Query  885   DVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQE  1061
             D+LL L  +   E  +    +K L QD+IA  TDT+A   +W+M+E++K+P++ K++  E
Sbjct  277   DLLLQLADDPELEVKLTRDNMKGLTQDLIAGGTDTAATMGDWSMSELLKKPQLFKRVTDE  336

Query  1062  LDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTR  1241
             LD VVG +R V E D+  L Y+  +++E  R HP+   L PH + +   + GY IP  TR
Sbjct  337   LDRVVGRERWVEEKDIPQLPYIEAIMKEAMRMHPSAVMLAPHLALQDCKVGGYDIPKGTR  396

Query  1242  IFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLG  1421
             IFINT  +GR+P +W+D +DFRPER     G  V+I  G +F++LPF +G+R CPG PLG
Sbjct  397   IFINTWSMGRDPDLWEDPEDFRPERFI---GKGVDIK-GHNFELLPFGSGRRMCPGYPLG  452

Query  1422  VTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
               ++L++LA + H F W  P G++PED+   EV+G+   +  P  AVA+PRL  HLY 
Sbjct  453   TKMILVSLANMLHGFTWELPPGIKPEDVKRDEVFGLATQRKYPTVAVAKPRLPLHLYN  510



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   365 bits (936),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 193/516 (37%), Positives = 290/516 (56%), Gaps = 13/516 (3%)
 Frame = +3

Query  66    LASFFLCL---SLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAA  236
             +A+ FL +   +++F I+++   +  + +   RLPPGP  WPI+GNL  +G  PHR  +A
Sbjct  1     MATLFLTILLATVLFLILRIFSHRRNRSHNN-RLPPGPNPWPIIGNLPHMGTKPHRTLSA  59

Query  237   FCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALA  416
                 YGP+++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  A
Sbjct  60    MVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFA  119

Query  417   PVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAF  596
             P G +W+ +R+I   HL + K LE F   R EE   L  ++  +    + VNL +++   
Sbjct  120   PYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGT--KPVNLGQLVNMC  177

Query  597   SMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
              +N + R ++G++ FGAD      +A EF  +  E+  L G+  +GD+VP   W+D  G 
Sbjct  178   VVNALGREMIGRRLFGADAD---HKADEFRSMVTEMMALAGVFNIGDFVPSLDWLDLQGV  234

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIK  947
               KM+ + KR D F   IL+EH  + ++     D +  L+SL G   +     + D EIK
Sbjct  235   AGKMKRLHKRFDAFLSSILKEHEMNGQD-QKHTDMLSTLISLKGTDLDGDGGSLTDTEIK  293

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             AL+ +M  A TDTSA T +WA+AE+I+ P I+ K Q+ELD VVG DR V+E+D+  L YL
Sbjct  294   ALLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYL  353

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             + V++E FR HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   F+
Sbjct  354   QAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFK  413

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             PER  P          G+DF+++PF AG+R C G  LG+  +    A L   FDW    G
Sbjct  414   PERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGG  473

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             + PE ++  E YG+T+ +A PL    +PRL  ++YG
Sbjct  474   VTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYG  509



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   365 bits (936),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 193/484 (40%), Positives = 275/484 (57%), Gaps = 9/484 (2%)
 Frame = +3

Query  156   LPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQ  335
             LPPGP  WP+VGNL  LG +PHR  AA    YGPL++LRLG VD +     S+  + L  
Sbjct  31    LPPGPKPWPLVGNLPHLGPMPHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKT  90

Query  336   QDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEE  515
              D  F SRP   A  HL Y    +   P G +W+ +R+I   HL ++K L+ F   R EE
Sbjct  91    HDANFLSRPPRSAGKHLGYNHQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEE  150

Query  516   ARHLVEDVWGMAENGE-TVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYI  692
                L      +A  G  +VNL ++L   + N + R++LGK+  G  +     +A EF  +
Sbjct  151   VAILT---CALAHVGSASVNLAQLLNVCTANALGRVMLGKRVLGEGKGRDNLKADEFRSM  207

Query  693   THELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKS-KKEIDG  869
               E+  L G+  + DYVP   W+D  G   KM+ + KR D F   ILEEHR +     + 
Sbjct  208   VVEMMVLGGVFNISDYVPALEWLDLQGVAAKMKRLHKRFDAFWTAILEEHRANMSNSGNK  267

Query  870   EMDFVDVLLSLPGENGKE--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRIL  1043
               D +  L+SL     +E  ++ D EIKA +Q M AA TDTS+ T EWA+AE+I++P IL
Sbjct  268   HNDLLSTLISLQDVADEEGGNLMDTEIKASVQTMFAAGTDTSSSTTEWAIAELIRQPGIL  327

Query  1044  KKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYH  1223
              ++Q+E+D VVG DR+V+E DL  L YL+ VV+ETFR HP  P  +P  +  +  INGY 
Sbjct  328   ARVQEEIDSVVGRDRLVTELDLPRLTYLQAVVKETFRLHPPTPLSLPRIAAESCEINGYR  387

Query  1224  IPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP-ADGGRVEISHGADFKILPFSAGKRK  1400
             IP    + +N   + R+P  W +   FRPER  P  +   V++  G DF+++PF AG+R 
Sbjct  388   IPKGATLLVNVWAIARDPEAWAEPLAFRPERFLPGGEKANVDVK-GNDFELIPFGAGRRI  446

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  LG+ +V    A L H+FDW   +G+ PE ++  E +G+T+ +A PL    +PRL 
Sbjct  447   CVGMSLGLRMVQFMTATLAHAFDWEVADGVSPEKLNMDEAFGLTLQRAEPLLVHPKPRLA  506

Query  1581  RHLY  1592
              H+Y
Sbjct  507   SHVY  510



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   364 bits (935),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 196/514 (38%), Positives = 289/514 (56%), Gaps = 16/514 (3%)
 Frame = +3

Query  72    SFFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKY  251
             + F C +L   ++     +       +RLPPGP  WPIVGNL  LG +PH   AA    Y
Sbjct  5     ALFFCTALFCVLLYHFLTRR-----SVRLPPGPKPWPIVGNLPHLGPVPHHSIAALAKTY  59

Query  252   GPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPK  431
             GPL++LR+G VD +     S+  + L   D  F++RP    A H+AY   D+  AP GP+
Sbjct  60    GPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPR  119

Query  432   WKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNN  608
             W+ +R+IC  HL + K L+ F   R EE   L      +A  G+T VNL ++L   + N 
Sbjct  120   WRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTR---ALARAGQTPVNLGQLLNVCTTNA  176

Query  609   VTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKM  788
             + R++LG++ FG        +A EF  +  EL  L G+  +GD+VP   W+D  G   KM
Sbjct  177   LGRVMLGRRVFGDGSGGEDPKADEFKEMVVELMVLAGVFNIGDFVPALEWLDLQGVAAKM  236

Query  789   REVEKRVDDFHMKILEEHR-----KSKKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKAL  953
             +++  R D F   I+EEH+      S++ +D     + V  +  GE GK  + DVEIKAL
Sbjct  237   KKLHARFDAFLGAIVEEHKISGSAGSERHVDLLSTLISVRDNADGEGGK--LTDVEIKAL  294

Query  954   IQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRC  1133
             + ++  A TDTS+ T EWA+AE+I+ P ++ + QQELD VVG  R+V++ DL  L YL+ 
Sbjct  295   LLNLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAVVGRGRLVTDLDLPQLTYLQA  354

Query  1134  VVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPE  1313
             +++ETFR HP+ P  +P  +  +  INGYHIP    + +N   + R+P VW+   +FRP 
Sbjct  355   IIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPS  414

Query  1314  RHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLR  1493
             R  P          G DF+++PF AG+R C G  LG+ +V +  A L H+F+W  PEG  
Sbjct  415   RFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNWELPEGQV  474

Query  1494  PEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
              E ++  E YG+T+ +A PL    RPRL   ++G
Sbjct  475   AEKLNMDEAYGLTLQRAPPLMVHPRPRLSPQVFG  508



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   364 bits (934),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 190/502 (38%), Positives = 286/502 (57%), Gaps = 16/502 (3%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPL  260
             L L+ I  +I ++      +N   RLPPGP   PI+GN+  LG LPHR   A   KYGP+
Sbjct  9     LALTAIIFLINIV------KNKHKRLPPGPRGIPILGNMHMLGSLPHRALQALSKKYGPI  62

Query  261   VYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKR  440
             +Y+RLG V AI  + P    + L   D VFA+RP    + H+ +    ++ +  GP W+ 
Sbjct  63    MYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLHDGKGISFSGYGPYWRS  122

Query  441   MRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRM  620
             MR++C+  LL++ ++ SF   R EE   L++     A  G  V++   +   S +   RM
Sbjct  123   MRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSCRM  182

Query  621   LLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVE  800
             + GK++   D      +   F  +  E+  L     +GDY+P    +D  G  ++++   
Sbjct  183   VFGKKYMDKD-----LDERGFKAVIKEVMQLAATPNIGDYIPCLLGLDLQGLTRRIKATA  237

Query  801   KRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAA  977
             K  DDF  KI++EH    KE     D VDV+L L G    E+ ++   IKA+  DM+AA+
Sbjct  238   KVFDDFFEKIIDEHIHKPKEEGQTKDLVDVMLDLMGSEETEYNIQRANIKAISLDMMAAS  297

Query  978   TDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRT  1157
              DTSA T EWA++E+IK P ++KK++ EL++VVG +RMV E+DL  L YL  VV+ET R 
Sbjct  298   MDTSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRL  357

Query  1158  HPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGG  1337
             HP  P LIPHES    T++G+HIP K+R+ +N   +GR+P+ W D D F PER   +D  
Sbjct  358   HPVVPLLIPHESIEDCTVDGFHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDID  417

Query  1338  RVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSE  1517
                   G  F+ +PF +G+R CPG  LG+T+V + LA+L H FDW  P+ +   ++D +E
Sbjct  418   ----FRGQHFQFIPFGSGRRGCPGMQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNE  473

Query  1518  VYGMTMPKATPLFAVARPRLQR  1583
              +G+T+P+A  L A+   R  +
Sbjct  474   EFGLTLPRAKHLVAIPTCRFHK  495



>ref|XP_006426680.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
 gb|ESR39920.1| hypothetical protein CICLE_v10025391mg [Citrus clementina]
Length=512

 Score =   364 bits (935),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 179/486 (37%), Positives = 291/486 (60%), Gaps = 9/486 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPHR   A  +KYGP++ L+ GS   +  +   + + +
Sbjct  32    KLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSEKYGPIMQLKFGSFPVVVGSSVEMAKVV  91

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +FA RP+T A  +  +   D+  +P GP W++ R++C+  L + KRLESF   R
Sbjct  92    LKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKMCLMELFSAKRLESFEYIR  151

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
              +E + L+  ++ ++  G+ + L++ L   S+  ++RM+LGK +    + +      EF 
Sbjct  152   VQELKLLLSRLYELS--GKPIMLKDHLSDLSLAVISRMVLGKNYTDKQQENEIVTPQEFK  209

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
              +  ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   +K ++
Sbjct  210   AMLDELFLLNGVLDIGDSIPWLGFLDLQGNIKRMKALAKKFDKFLEHVLDEHNARRKGVE  269

Query  867   GEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               +  D VDVLL L  +   E  +E   +KA  QD+IA  T++SAVT EWA++E+IK+P 
Sbjct  270   NYVAKDMVDVLLQLADDPSLEVKIERHGVKAFTQDLIAGGTESSAVTVEWAISELIKKPE  329

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             I +K  +ELD V+G +R V E D+++L ++  +V+ET R HP  PFL+P  +     + G
Sbjct  330   IFEKATEELDRVIGKERWVEEKDIVNLPFIDAIVKETMRLHPVAPFLVPRAAREDCKVAG  389

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y IP  TR+ ++   +GR+PS+W+  ++F PER     G  +++  G DF++LPF AG+R
Sbjct  390   YDIPKGTRVLVSVWAIGRDPSLWEKPNEFYPERFI---GKSIDVK-GHDFELLPFGAGRR  445

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG  LG+ ++  +LA L H F W  P  +  E+++  E++G++ P+  PL  +A PRL
Sbjct  446   MCPGYSLGLKVIQASLANLLHGFAWKLPGNMSNEELNMEEIFGLSTPRKFPLEVLAHPRL  505

Query  1578  QRHLYG  1595
               HLY 
Sbjct  506   SPHLYN  511



>ref|XP_009626729.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nicotiana tomentosiformis]
Length=507

 Score =   364 bits (934),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 185/485 (38%), Positives = 280/485 (58%), Gaps = 9/485 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K +LPPGP  WPI+GNL  +G +P         KYG L++L+ GS   +  + P + +EI
Sbjct  29    KTKLPPGPKPWPIIGNLNLIGSIPRESLHNLSQKYGDLMHLKFGSRPVLIASSPEMAKEI  88

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +FASRP   A  +L++   D++ AP G KW + R+I +  +   KRL+SF   R
Sbjct  89    LKTHDAIFASRPALAAGKYLSFNYSDMSWAPYGAKWGQGRKIYITEIFNPKRLDSFKYIR  148

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLL-GKQFFGADESSGPQEAME-  680
              EE R+L+  ++ ++  G+ + L++ L  F++  ++RM++ GK +    ES+     +E 
Sbjct  149   VEEGRNLISRLFALS--GKPIFLKDHLPQFTLCTISRMVMSGKYYCDKSESNDTIVTLEK  206

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
               ++  E F L G++ +GD++P   W+D  G  K+M+ +EK + +FH  +LE+H+   KE
Sbjct  207   LQWMLEEWFILGGVVNIGDWIPWLNWLDLQGYVKRMKALEKTMVEFHNYVLEDHKAKAKE  266

Query  861   IDGEMDFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
                  D VDVLL L  + N +  +    +  LI D++A  TDTSA T EWA  E+++ P+
Sbjct  267   NSHPTDMVDVLLQLADDPNLEVKLTTNHLMGLILDLLAGGTDTSATTVEWAFQELMRNPK  326

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             I++K  QELD+ +G +R V E DL  L Y+  +++ETFR HP    L PH S     + G
Sbjct  327   IIEKANQELDKAIGKERWVEEEDLSQLPYIEAIIKETFRLHPLTTLLAPHYSIEDCNVAG  386

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y IP  T +F+NT  LGRNP  WD  + F PER    D   ++I  G +F +LPF +G+R
Sbjct  387   YDIPKGTTVFVNTWSLGRNPKCWDRPEKFIPERFLEND---IDIK-GQNFTLLPFGSGRR  442

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
             +CPG  LG+ LV   LA L H F+W     ++PEDI   E+YG+T     P   +  P+L
Sbjct  443   RCPGYSLGIKLVQTTLANLLHGFNWKLSGDMKPEDISMEEIYGLTTHPKKPTSMIMEPKL  502

Query  1578  QRHLY  1592
               HLY
Sbjct  503   SPHLY  507



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   364 bits (935),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 279/474 (59%), Gaps = 10/474 (2%)
 Frame = +3

Query  183   IVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRP  362
             IVGNL  LG +PH   AA   +YGPL++LRLG VD +     S+  + L   D  F+SRP
Sbjct  38    IVGNLPHLGPVPHHSLAALARQYGPLMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRP  97

Query  363   RTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVW  542
                 A HLAY   D+  AP GP+W+ +R+I   HL + K L+     R EE   L   + 
Sbjct  98    PNSGAKHLAYNYHDLVFAPYGPRWRMLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLA  157

Query  543   GMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGL  722
             G     + VNL ++L   ++N + R+++GK+ FG    SG ++A EF  +  E+  L G+
Sbjct  158   GAGS--KPVNLAQLLNVCTVNALGRVMVGKRLFGDGSGSGDEKADEFKEMVVEMMVLAGV  215

Query  723   IYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSL  902
               +GD++P   W+D  G   KM+++ KR D F   I+EEH+KS     G+M  +  LLSL
Sbjct  216   FNIGDFIPALEWLDLQGVAAKMKKLHKRFDAFLTAIVEEHKKSSGGKHGDM--LTTLLSL  273

Query  903   P----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDE  1070
                  GE  K  + D EIKAL+ +M  A TDTS+ T EWA+AE+++ P+IL ++QQELD+
Sbjct  274   KEDADGEGAK--LTDTEIKALLLNMFTAGTDTSSSTVEWAIAELLRHPKILAQVQQELDQ  331

Query  1071  VVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFI  1250
             VVG D++V+E DL +L YL+ V++ETFR HP+ P  +P  ++ +  IN +HIP    + +
Sbjct  332   VVGRDQLVTELDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINSFHIPKGATLLV  391

Query  1251  NTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTL  1430
             N   + R+P  W +  +FRPER  P          G DF+++PF AG+R C G  LG+ +
Sbjct  392   NVWAISRDPEQWKEPLEFRPERFLPGGEKPHVDVRGNDFEVIPFGAGRRICAGMSLGLRM  451

Query  1431  VLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             V +  A L H+FDW+  +GL PE ++  E YG+T+ +A PL    R RL  H Y
Sbjct  452   VHLMAATLVHAFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRTRLAPHAY  505



>ref|XP_007214404.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
 gb|EMJ15603.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
Length=496

 Score =   363 bits (933),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 193/487 (40%), Positives = 291/487 (60%), Gaps = 17/487 (3%)
 Frame = +3

Query  138   ENGKMRLPPGPPRWPIVGNL-LQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSI  314
             +N K  LPPGP  +PI G+L L  G  P++D      KYG ++Y+RLG +  I  + P  
Sbjct  22    KNKKKTLPPGPRGFPIFGSLHLLSGEFPNKDLHRLAQKYGDIMYMRLGLMPTIVVSSPQA  81

Query  315   IREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESF  494
              +  L   D VFASRP    A H+++G  +++ A  GP W+ MR++C   LL+  ++ SF
Sbjct  82    AKLFLKTHDLVFASRPPHEGAKHISFGQRNLSFAEYGPYWRDMRKMCTLELLSNHKINSF  141

Query  495   AKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQE  671
                R EE    VE +   A  G   V+L +++ + S++   RM+LGK++   D      +
Sbjct  142   KSMRREEVALCVESIRDAAYKGRVAVDLSDIVSSLSVDMSCRMVLGKKYRDED-----FD  196

Query  672   AMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKS  851
             A  F  +  E   L G   L DY+P    +D  G  K+M+ V K  D F  KI+EEH +S
Sbjct  197   ARGFRSVIKEGIQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAFDVFFEKIIEEHLQS  256

Query  852   KKEIDGE--MDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
                 DGE   DFVDV++   G    E+ +E   IKA+I DM+ A+ DTS+ T +WA++E+
Sbjct  257   N---DGERTKDFVDVMVGFMGSVESEYQIERPHIKAIIMDMLVASMDTSSTTVDWALSEL  313

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             ++ P+ +K++Q+EL++VVG +RMV E+DL  L+YL  VV+ET R HP  P L+PH +T  
Sbjct  314   MRHPKAMKEVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLRLHPVAPLLVPHAATED  373

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
               +NGYHIP K+R+ IN   +GR+PS W D ++F PER    +G  V++  G  F+++PF
Sbjct  374   CIVNGYHIPKKSRVIINAWAIGRDPSAWTDAEEFIPERF---EGSDVDV-RGNHFQLIPF  429

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              +G+R+CPG  LG+T+V + LA+L H FDW  P  + PE++D SE +G+T+ +   L A+
Sbjct  430   GSGRRRCPGIQLGLTVVQLMLAQLVHCFDWELPNNMLPEELDMSESFGITVERVKRLIAI  489

Query  1563  ARPRLQR  1583
                RL +
Sbjct  490   PSYRLHK  496



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   363 bits (933),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 189/488 (39%), Positives = 282/488 (58%), Gaps = 13/488 (3%)
 Frame = +3

Query  129   TGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDP  308
             +  +N K RLPPGP  +P+ GNL  LG  PHRD      K+G ++YLRLG    +  + P
Sbjct  22    SKSKNEKKRLPPGPRGFPLFGNLHMLGEFPHRDLHRLAQKHGDIMYLRLGLAPVVVASSP  81

Query  309   SIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLE  488
                   L   D VFASRP   AA H++YG  +++    G  W+ MR++C   LL++ ++ 
Sbjct  82    QAAELFLKTHDLVFASRPPLQAAEHISYGQRNLSFGAYGSYWRTMRKMCTLELLSSHKIN  141

Query  489   SFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGAD-ESSGP  665
             SF   R EE   L + +   A +  TV+L   + + + +    M+ GK++   + +  G 
Sbjct  142   SFKPMRKEELSILTKFIQEAACDRVTVDLSGKVASLTADMSCLMVFGKKYMDKEFDERG-  200

Query  666   QEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR  845
                  F  +  E  HL      GD++P    +D  G  K+M+ V K  D F  KI++EH 
Sbjct  201   -----FKAVIQEGMHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFDAFFEKIIDEHI  255

Query  846   KSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
             +SK + +   DFVDV+L   G    E+ +E   IKA+I DM+A A DT+A   EW ++E+
Sbjct  256   QSKDQ-ERTKDFVDVMLGFMGSEESEYRIERSNIKAIILDMLAGAMDTTATAIEWTLSEL  314

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             IK PR++KK+Q+EL+ VVG +R V E+DL  L YL  VV+ET R HP  P L+PH +   
Sbjct  315   IKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHPVAPLLLPHAAIED  374

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
               ++G+HIP K+R+ IN   +GR+PS+W D + F PER    DG  ++   G DF+ +PF
Sbjct  375   CNVSGFHIPRKSRVMINIFAIGRDPSIWTDAEKFIPERF---DGSNIDF-RGRDFQFIPF  430

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              +G+R CPG  LG+T+V + +A+L H FDW  P  + P ++D +E +G+T+P+A  L AV
Sbjct  431   GSGRRGCPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAV  490

Query  1563  ARPRLQRH  1586
                RLQ+ 
Sbjct  491   PTYRLQQQ  498



>gb|KEH33357.1| flavonoid hydroxylase [Medicago truncatula]
Length=506

 Score =   364 bits (934),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 181/484 (37%), Positives = 281/484 (58%), Gaps = 9/484 (2%)
 Frame = +3

Query  141   NGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIR  320
             N    LPPGP  WPI+G L  LG +PH   A    K+GP++YL++G+ D +  +     R
Sbjct  31    NTSKNLPPGPRGWPILGVLPHLGTMPHVTLANMAKKFGPIMYLKMGTCDTVVASSSDAAR  90

Query  321   EILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAK  500
               L   D  F +RP  + A +L Y   D+  A  GPKWK +R++   H+L  K L+++A 
Sbjct  91    AFLKTLDHNFLNRPTIIGATYLGYNSQDLVFAKYGPKWKLLRKLTTLHMLGGKALQNWAN  150

Query  501   HRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAME  680
              R  E +H+V  +    + GE++ +  +L     N V++++L K+ F    +S  QE+ E
Sbjct  151   VRENEVKHMVRSIHESGKKGESIEVGGLLSCAITNMVSQVVLSKRMF----ASKGQESKE  206

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  E   + G I +GD+VP   WID  G   KM+ + KR D+F  K++E+H     E
Sbjct  207   FKEMVVEFMTISG-INIGDFVPFIGWIDLEGVVGKMKRLHKRFDEFLTKLIEDHVNCAHE  265

Query  861   IDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRI  1040
               G  DF+D++L+   +N  E +    IKAL+ ++  A TDTS+   EWA+AE++K P I
Sbjct  266   RKGNPDFLDIVLANDDDNFGERLSLSNIKALLLNLFTAGTDTSSSIIEWALAEMLKSPNI  325

Query  1041  LKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGY  1220
             L + Q+E+++VVG +RM+ E+DL  L YL+ + +ET+R HP+ P  +P  S +A  INGY
Sbjct  326   LIRAQKEMNQVVGRERMLVESDLEKLPYLQAICKETYRLHPSTPLSVPRVSNKACQINGY  385

Query  1221  HIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRK  1400
             +IP  TR  +N   +GR+P++W +  +F+PER       R++ S G DF+++PF AG+R 
Sbjct  386   YIPKNTRFNVNIWAIGRDPNIWANPLEFKPERFLSGKYARIDPS-GVDFELIPFGAGRRV  444

Query  1401  CPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             C G  + + ++   L  L HSFDW  P G+   +++  E +G+T+ KA PL A   PRL 
Sbjct  445   CVGYKMAIVVIEYILGTLVHSFDWKLPNGV---ELNMDEAFGLTLEKAVPLSATVTPRLV  501

Query  1581  RHLY  1592
              H Y
Sbjct  502   PHAY  505



>ref|XP_002310014.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90464.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   363 bits (933),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 278/478 (58%), Gaps = 13/478 (3%)
 Frame = +3

Query  153   RLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILL  332
             +LPPGP  +PI G+L  LG+ PH D      KYGP++Y+RLG V  +  + P     IL 
Sbjct  30    KLPPGPIGFPIFGSLHLLGKFPHHDLHQLAKKYGPIMYMRLGLVPTVVVSSPRAAELILK  89

Query  333   QQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAE  512
               D VFASRPR  AA H++Y   +++ AP G  W+ +R++C   LL+  ++ SF   R E
Sbjct  90    TNDLVFASRPRNEAAKHISYEQKNLSFAPYGSYWRNVRKMCTLELLSNHKINSFMSTRKE  149

Query  513   EARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGAD-ESSGPQEAMEFMY  689
             E   L++ +   +     V+L   + + S +   RM+ GK++   + +  G      F  
Sbjct  150   ELDLLIDYIKDASRERVAVDLGAKVSSLSADISCRMVFGKKYLEKEFDEKG------FKP  203

Query  690   ITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDG  869
             +THEL  L     LGDY+P    +D  G  K+M+ V K  DDF  KI++EH + K E + 
Sbjct  204   VTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKAVGKVFDDFFEKIIDEHIQFKDE-NR  262

Query  870   EMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILK  1046
               DFVDV+L   G    E+ +    IKA+I DM+  + DTSA   EW ++E+I+ PR++K
Sbjct  263   TKDFVDVMLDFLGSEETEYSIGRDNIKAIILDMLVGSMDTSATAIEWTLSELIRHPRVMK  322

Query  1047  KIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHI  1226
             K+Q+EL+E +G DRMV E+DL  L YL  V++E FR HP  P L PHES    TI+G+ I
Sbjct  323   KVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLHPVAPLLGPHESMEDCTIDGFLI  382

Query  1227  PAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCP  1406
             P KTR+ +N   +GR+ S W D + F PER     G  +++  G DF++LPF AG+R CP
Sbjct  383   PQKTRVIVNVWAIGRDQSAWTDANKFIPERF---AGSNIDV-RGRDFQLLPFGAGRRGCP  438

Query  1407  GAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQ  1580
             G  LG+T+V   +A+L H FDW  P  + PE++D +E +G+  P+A  L A    RL 
Sbjct  439   GMHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLH  496



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   363 bits (933),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 191/500 (38%), Positives = 290/500 (58%), Gaps = 18/500 (4%)
 Frame = +3

Query  87    LSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVY  266
             ++LIF ++Q L  K        RLPPGP  +PI G+L  LG+ PHR       KYGP+++
Sbjct  11    VALIF-LLQWLSTKNK------RLPPGPRGFPIFGSLHMLGKFPHRALHQLAQKYGPIMH  63

Query  267   LRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMR  446
             LRLG V  I  + P      L   D VFA RP   AA + +YG   +  A  GP W+ MR
Sbjct  64    LRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYFSYGQKGMTFAQYGPYWRNMR  123

Query  447   RICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLL  626
             ++C   LL++ ++ SF   R EE   L++ +   A     V+L   + + + +   RM+ 
Sbjct  124   KMCTIELLSSLKITSFKSTRMEELDLLIKYIQEAARERVAVDLSAKVSSLNADMSCRMVF  183

Query  627   GKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKR  806
             GK++   D      +   F  +  E+ HL    +LGDY+P    +D  G  K+M+ + K 
Sbjct  184   GKKYLDED-----LDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKV  238

Query  807   VDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPGENGKEHMEDVE-IKALIQDMIAAATD  983
             +D +  KI++EH + +++   + DFVDV+LS       EH+ D   +KA++ DM+A + D
Sbjct  239   LDVYLNKIIDEHAQYQEKGKNK-DFVDVMLSFMKSEENEHLVDQGCMKAIMLDMLAGSMD  297

Query  984   TSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHP  1163
             TSA   +WA +E+IK PR++KK+Q+EL+E VG  RMV E+DL  L YL  VV+ET R HP
Sbjct  298   TSATVIDWAFSELIKNPRVMKKLQKELEEAVGKQRMVEESDLERLEYLDMVVKETLRLHP  357

Query  1164  AGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRV  1343
             AGP +IPHE+     +NG+HIP K+ + IN   +GR+P  W D + F PER   +D   +
Sbjct  358   AGPLMIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSD---I  414

Query  1344  EISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVY  1523
             ++  G +F+++PF  G+R CPG  LG+T+V + LA+L H FDW  P G+ P ++D +E +
Sbjct  415   DV-RGRNFQLIPFGTGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEF  473

Query  1524  GMTMPKATPLFAVARPRLQR  1583
             G+ M ++  L A+   RL +
Sbjct  474   GLVMCRSKHLVAIPTYRLNK  493



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   364 bits (934),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 183/474 (39%), Positives = 280/474 (59%), Gaps = 8/474 (2%)
 Frame = +3

Query  186   VGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPR  365
             +GNL  +  +PH+  AA    YGPL++LRLG VD +     S+  + L   D  F+SRP 
Sbjct  40    IGNLPHMSPVPHQGLAAMAKVYGPLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPP  99

Query  366   TLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWG  545
                A ++AY   D+  AP GP+W+ +R++   HL + K L+ F + R EE R LV     
Sbjct  100   NAGAKYVAYNYQDLVFAPYGPRWRLLRKMSSLHLFSGKALDDFRQIREEEIRVLVR---A  156

Query  546   MAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLI  725
             +A     VNL ++L   ++N + ++++GK+ FG        EA EF  +  EL  L G+ 
Sbjct  157   LASAKTKVNLGQLLNVCTVNALGQVMMGKRVFGDGSGGSDPEADEFKSMVVELMQLAGVF  216

Query  726   YLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEIDGEM---DFVDVLL  896
              +GD++P   W+D  G + K +++  + D F   ILEEH+   ++ +G++   DF+  L+
Sbjct  217   NIGDFIPALEWLDLQGVQAKTKKLHNKFDRFLSAILEEHKTKARQSNGQVKHKDFLSTLI  276

Query  897   SLPGENGKE--HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDE  1070
             SL   +G E   + D EIKAL+ +M  A TDTS+ T EWAMAE+I+ P I+ ++++ELD 
Sbjct  277   SLENVDGAEGGKLSDTEIKALLLNMFTAGTDTSSSTVEWAMAELIRHPNIMAQVRKELDS  336

Query  1071  VVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFI  1250
             VVG DR+VS+ DL +L Y + V++ETFR HP+ P  +P  ++ +  INGYHIP    + +
Sbjct  337   VVGRDRLVSDLDLPNLTYFQAVIKETFRLHPSTPLSLPRMASDSCDINGYHIPKGATLLV  396

Query  1251  NTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTL  1430
             N   + R+P+ W++  +FRPER  P          G DF+++PF AG+R C G  LG+ +
Sbjct  397   NVWAISRDPNEWNNPLEFRPERFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRM  456

Query  1431  VLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             V +  A L H+F+W   +GL PE +D  E YG+T+ +A PL    RPRL +H Y
Sbjct  457   VQLLTATLAHAFEWELADGLMPEKLDMEEAYGLTLQRAAPLMVHPRPRLSKHAY  510



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   364 bits (934),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 200/517 (39%), Positives = 301/517 (58%), Gaps = 11/517 (2%)
 Frame = +3

Query  60    ITLASFFL-CLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAA  236
             +T  +F L  L++   +  L+ ++T   +   RLPPGP  WPIVGNL  LG  PH+  A+
Sbjct  1     MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  237   FCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALA  416
                 YGPL++LRLG VD +     S+  + L   D  FA+RP    A ++AY   D+  A
Sbjct  61    LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  417   PVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAF  596
             P GP+W+ +R++   HL + K L+ F   R EE   L   +   +     VNL ++L   
Sbjct  121   PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHAL--ASARDSLVNLGQLLNVC  178

Query  597   SMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
             + N + R++LGK+ FG        +A +F  +  E+  L G+  LGD+VP     D  G 
Sbjct  179   TTNALARVMLGKRVFGDGSGGADPKADKFKDMVVEVMVLAGVFNLGDFVPALERFDLQGI  238

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEI  944
               KM+ +  R D F   ILEEH+K++  +  + DF+  L+SL     GE GK  + D+EI
Sbjct  239   ATKMKNLHARFDSFLGNILEEHKKNRDGVKQQNDFLSKLISLKDDVDGEGGK--LTDIEI  296

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KAL+ ++  A TDTS+ T EWA+AE+I+ P+IL + QQE+D VVG DR+V E DL +L +
Sbjct  297   KALLLNLFTAGTDTSSSTVEWAIAELIRHPKILAQAQQEIDSVVGRDRLVIELDLPNLPF  356

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             L+ VV+ETFR HP+ P  +P  ++++  INGY+IP  + + +N   + R+P VW +  +F
Sbjct  357   LQAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIARDPDVWAEPLEF  416

Query  1305  RPERHFPADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             RP+R F   G +  +   G +F+++PF AG+R C G  LG+ +V +  A L H+FDW  P
Sbjct  417   RPDR-FLLGGEKPNVDIKGNNFEVIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDWGLP  475

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              G  PE ++  E YG+T+ +A PL    +PRL  H+Y
Sbjct  476   AGQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   364 bits (934),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 200/509 (39%), Positives = 291/509 (57%), Gaps = 12/509 (2%)
 Frame = +3

Query  81    LCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPL  260
             + LS++F ++    V     + + +LPPGP +WP++GNL  LG+ PH+  A    K+GPL
Sbjct  7     ILLSILFAVLVYRLVNNLIRS-RRKLPPGPRQWPVIGNLPHLGQAPHQTMATLARKHGPL  65

Query  261   VYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKR  440
             ++LRLG VD +     S+  + L   D  F+SRP    A H+AY   D+   P G +W+ 
Sbjct  66    MHLRLGQVDVVVAASASMAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPYGQRWRL  125

Query  441   MRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNVTR  617
             +R+I   HL + K LE F   R EE   L+     +A  G T VNL ++L   ++N + R
Sbjct  126   LRKITSVHLFSGKALEDFRHVRQEEVAVLIS---ALANRGSTAVNLGQLLNVCTVNALGR  182

Query  618   MLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREV  797
              +LG + FG         A EF  +  E+  L G+  LGD+VP   W+       +M+++
Sbjct  183   TMLGYRVFGDGSGKSEPRADEFKSMVVEVMVLAGVFNLGDFVPALDWLGLQRVAARMKKL  242

Query  798   EKRVDDFHMKILEEHRKS---KKEIDGEMDFVDVLLSLPGENGKEHMEDVEIKALIQDMI  968
               R D F   I+EEH+ +    K  D     + +     GE+GK  + D EIKAL+ +M 
Sbjct  243   HNRFDAFLTTIIEEHKANVGKGKHTDLLTTLLSLKDDAEGEDGK--LTDTEIKALLLNMF  300

Query  969   AAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRET  1148
              A TDT++ T EWA+AE+I+ P IL K+Q+ELD VVG D +VSE DL  L YL+ VV+ET
Sbjct  301   TAGTDTTSSTVEWAIAELIRHPEILAKVQEELDRVVGRDGLVSELDLAQLTYLQAVVKET  360

Query  1149  FRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFP-  1325
             FR HP+ P  +P  +  +  INGYHIP  T + +N   + R+P+ W D  +FRPER  P 
Sbjct  361   FRLHPSTPMSVPRMANESCEINGYHIPKGTTLLVNVWAIARDPAEWTDPLEFRPERFLPG  420

Query  1326  ADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDI  1505
              +  +V+I  G DF+++PF AG+R C G  LGV +V +  A L H F+   P GL PE +
Sbjct  421   GEKAQVDI-RGNDFEVIPFGAGRRICAGMSLGVRMVQLLTASLVHGFNLGLPNGLLPEKL  479

Query  1506  DTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             +  E YG+T+ +A PL    +PRL +HLY
Sbjct  480   NMDEAYGLTLQRAAPLMVHPQPRLDQHLY  508



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   363 bits (933),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 188/488 (39%), Positives = 280/488 (57%), Gaps = 13/488 (3%)
 Frame = +3

Query  129   TGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDP  308
             +  +N K RLPPGP  +P+ GNL  LG  PHRD      K+G ++Y+RLG    +  + P
Sbjct  22    SKSKNKKKRLPPGPRGFPLFGNLHMLGEFPHRDLHRLAQKHGDIMYMRLGLAPVVVASSP  81

Query  309   SIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLE  488
                   L   D VFASRP   AA H++YG  +++    G  W+ MR++C   LL++ +  
Sbjct  82    QAAELFLKTHDLVFASRPPLQAAEHISYGQRNLSFGAYGSYWRTMRKMCTLELLSSHKTN  141

Query  489   SFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGAD-ESSGP  665
             SF   R EE   L + +   A +  TV+L   + + + +    M+ GK++   + +  G 
Sbjct  142   SFKPMRKEELALLTKFIQEAASDRVTVDLSGKVASLTADMSCLMVFGKKYMDKEFDERG-  200

Query  666   QEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHR  845
                  F  +  E  HL      GD++P    +D  G  K+M+ V K  D F  KI++EH 
Sbjct  201   -----FKAVIQEGMHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFDAFFEKIIDEHI  255

Query  846   KSKKEIDGEMDFVDVLLSLPGENGKEH-MEDVEIKALIQDMIAAATDTSAVTNEWAMAEV  1022
             +S  + +   DFVDV+L   G    E+ +E   IKA+I DM+A A DT+A   EW ++E+
Sbjct  256   QSTDQ-ERTKDFVDVMLGFMGSEESEYRIERSNIKAIILDMLAGAMDTTATAIEWTLSEL  314

Query  1023  IKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRA  1202
             IK PR++KK+Q+EL+ VVG +R V E+DL  L YL  VV+ET R HP  P L+PH +   
Sbjct  315   IKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHPVAPLLLPHAAIED  374

Query  1203  TTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPF  1382
               +NG+HIP K+R+ IN   +GR+PS+W D + F PER    DG  ++   G DF+ +PF
Sbjct  375   CNVNGFHIPRKSRVIINIFAIGRDPSIWTDAEKFIPERF---DGSNIDF-RGRDFQFIPF  430

Query  1383  SAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAV  1562
              +G+R CPG  LG+T+V + +A+L H FDW  P  + P ++D +E +G+T+P+A  L AV
Sbjct  431   GSGRRGCPGMQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAV  490

Query  1563  ARPRLQRH  1586
                RLQ+ 
Sbjct  491   PTYRLQQQ  498



>ref|XP_009337219.1| PREDICTED: flavonoid 3'-monooxygenase-like [Pyrus x bretschneideri]
Length=514

 Score =   364 bits (934),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 183/489 (37%), Positives = 288/489 (59%), Gaps = 12/489 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K + PPGP  WPI+GNL  +G LPH+        YGP++ LR GS   +  + P + ++ 
Sbjct  31    KQKFPPGPKPWPIIGNLNLIGPLPHQSLHKLSQTYGPIMQLRFGSRPVVVASSPEMAKQF  90

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D VF+SRP T A  +L Y   +V  +P GP W++ R+I +  L ++KRLESF   R
Sbjct  91    LKTHDHVFSSRPPTAAGKYLTYDYQNVTWSPYGPYWRQGRKIFLYELFSSKRLESFEYIR  150

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM-EF  683
              +E R     ++ +A++G  + L+E L   +++ ++R +LGK +F   E  G   ++ EF
Sbjct  151   VDENRAFTSRLYAIAKSGNPIVLKEHLSRLNLSIMSRTVLGKDYFSVAEYEGSIMSLEEF  210

Query  684   MYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEI  863
               +  ELF L G+  +GD++P   ++D  G  K+M+ ++K+++ F+  +L EH+  K+ +
Sbjct  211   QDMIDELFVLSGVFNIGDWIPWLNFLDLQGYIKRMKAIQKKINRFYDFVLNEHKARKEGV  270

Query  864   DGEM--DFVDVLLSLPGENGKEHMEDV----EIKALIQDMIAAATDTSAVTNEWAMAEVI  1025
             +  +  D VD+LL L   +G   +E       IKA IQD+IA  TDTSA   EWAM+E+I
Sbjct  271   EEFVPKDMVDLLLQL--VDGSSDLEVKLNYDSIKAFIQDLIAGGTDTSATVLEWAMSELI  328

Query  1026  KRPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRAT  1205
             K+P ++KK  +ELD V+G +R V E DL  L Y+  +++ET R HPA   L PH +   +
Sbjct  329   KQPNLIKKATEELDRVIGRERWVEEKDLAQLPYIDAIMKETMRRHPAVVILPPHLAVENS  388

Query  1206  TINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFS  1385
              + GY +   T +F+NT  +GR+P +W++ ++FRP R     G  ++   G  F++LPF 
Sbjct  389   NVAGYDVCKGTVVFVNTWSMGRDPKLWEEPEEFRPGRFLGNTGIDLQ---GQSFELLPFG  445

Query  1386  AGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVA  1565
             +G+R CPG  LG+ ++   LA + H F+W  P  ++ ED+   E +G+  P+  PL AV 
Sbjct  446   SGRRMCPGYKLGLKMIRTCLANMLHGFNWKLPGNVKVEDLGMEETFGLVTPRKFPLVAVM  505

Query  1566  RPRLQRHLY  1592
              PRL  HLY
Sbjct  506   EPRLPVHLY  514



>gb|KHF98582.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   364 bits (934),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 181/489 (37%), Positives = 293/489 (60%), Gaps = 15/489 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPH+   A   KYGP++ L+ GS   +  +   + + I
Sbjct  31    KLNLPPGPKPWPIIGNLNLIGSLPHQSIHALSQKYGPIMQLKFGSFPIVVASSVEMAKAI  90

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +F+ RP+T A  +  Y   D+  +  GP W++ R++C+  L + KRLES+   R
Sbjct  91    LKTNDAIFSDRPKTAAGKYTTYNYSDITWSSYGPYWRQARKMCLTELFSAKRLESYEYIR  150

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAM---  677
              EE   L++ ++    +G  + L+E L + ++N ++RM+ GK++    E +G  E +   
Sbjct  151   KEERNLLLKRLY--ESSGTQIVLKEHLLSLNLNVISRMVFGKKY---TEGTGKNEIVTPN  205

Query  678   EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKK  857
             EF  + +ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   +K
Sbjct  206   EFNEMLNELFFLNGVLDIGDSIPWLSFLDLQGYIKRMKALSKKFDRFLEHVLDEHNARRK  265

Query  858   EIDGEM--DFVDVLLSLPGE-NGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
              +   +  D VDVLL L  E N +  +E   +KA  QD+IAA TD+SAVT EWA+ E+++
Sbjct  266   RVKDYVAKDMVDVLLQLSEEPNLEVKLERHGVKAFSQDIIAAGTDSSAVTVEWAITELLR  325

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
             +P IL K  +ELD+V+G ++ V E D+ +L Y++ + +E  R HP  P L+PH +++   
Sbjct  326   KPEILAKAMEELDKVIGREQWVGEKDIGNLPYIKSIAKEAMRLHPVAPMLVPHVASQDCE  385

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSA  1388
             I GY IP  TR  +N   +GR+P++WD  ++F P+R     G  +++  G DF++LPF +
Sbjct  386   IAGYDIPKGTRALVNIWTIGRDPNLWDKPNEFWPDRFI---GKSIDVK-GHDFELLPFGS  441

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             G+RKCPG PL + ++  +LA + H F+W  P     +D++  E++G++  K  PL  VA 
Sbjct  442   GRRKCPGYPLAIKVIQASLANILHGFNWKLPAKTTKDDLNMEELFGLSTSKKHPLVVVAE  501

Query  1569  PRLQRHLYG  1595
             PRL  H+Y 
Sbjct  502   PRLPLHMYS  510



>ref|XP_006465906.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
Length=512

 Score =   363 bits (933),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 179/486 (37%), Positives = 291/486 (60%), Gaps = 9/486 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPHR   A  +KYGP++ L+ GS   +  +   + + +
Sbjct  32    KLNLPPGPKPWPIIGNLHLIGSLPHRSVHALSEKYGPIMQLKFGSFPVVVGSSVEMAKVV  91

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D +FA RP+T A  +  +   D+  +P GP W++ R++C+  L + KRLESF   R
Sbjct  92    LKTHDVLFAGRPKTAAGKYTTFNYSDITWSPYGPYWRQARKMCLMELFSAKRLESFEYIR  151

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEFM  686
              +E + L+  ++ ++  G+ + L++ L   S+  ++RM+LGK +    + +      EF 
Sbjct  152   VQELKLLLSRLYELS--GKPIMLKDHLSDLSLAVISRMVLGKNYTDKQQENEIVTPQEFK  209

Query  687   YITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKEID  866
              +  ELF L G++ +GD +P   ++D  G  K+M+ + K+ D F   +L+EH   +K ++
Sbjct  210   AMLDELFLLNGVLDIGDSIPWLGFLDLQGNIKRMKALAKKFDKFLEHVLDEHNARRKGVE  269

Query  867   GEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKRPR  1037
               +  D VDVLL L  +   E  +E   +KA  QD+IA  T++SAVT EWA++E+IK+P 
Sbjct  270   NYVAKDMVDVLLQLADDPSLEVKIERHGVKAFTQDLIAGGTESSAVTVEWAISELIKKPE  329

Query  1038  ILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTING  1217
             I +K  +ELD V+G +R V E D+++L ++  +V+ET R HP  PFL+P  +     + G
Sbjct  330   IFEKAIEELDRVIGKERWVEEKDIVNLPFIDAIVKETMRLHPVAPFLVPRAAREDCNVAG  389

Query  1218  YHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKR  1397
             Y IP  TR+ ++   +GR+PS+W+  ++F PER     G  +++  G DF++LPF AG+R
Sbjct  390   YDIPKGTRVLVSVWAIGRHPSLWEKPNEFYPERFI---GKSIDVK-GHDFELLPFGAGRR  445

Query  1398  KCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRL  1577
              CPG  LG+ ++  +LA L H F W  P  +  E+++  E++G++ P+  PL  +A PRL
Sbjct  446   MCPGYSLGLKVIQASLANLLHGFAWKLPGNMSNEELNMEEIFGLSTPRKFPLEVLAHPRL  505

Query  1578  QRHLYG  1595
               HLY 
Sbjct  506   SPHLYN  511



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   363 bits (933),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 194/489 (40%), Positives = 283/489 (58%), Gaps = 11/489 (2%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
              +RLPPGP  WPIVGNL  LG +PH   AA    YGPL++LR+G VD +     S+  + 
Sbjct  25    SVRLPPGPKPWPIVGNLPHLGPVPHHSIAALAKTYGPLMHLRMGFVDVVVAASASVAAQF  84

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  F++RP    A H+AY   D+  AP GP+W+ +R+IC  HL + + L+ F   R
Sbjct  85    LKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGQALDDFRHIR  144

Query  507   AEEARHLVEDVWGMAENGET-VNLREVLGAFSMNNVTRMLLGKQFFGADESSGPQEAMEF  683
              EE   L+     +A  G+T V L ++L   + N + R++LG++ FG        +A EF
Sbjct  145   QEEVLALMR---ALAREGQTPVKLGQLLNVCTTNALGRVMLGRRVFGDGSGGEDPKADEF  201

Query  684   MYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE-  860
               +  EL  L G+  +GD+VP   W+D  G   KM+++  R D F   I+EEH+ S    
Sbjct  202   KEMVVELMVLAGVFNIGDFVPALEWLDLQGVASKMKKLHARFDAFLGAIVEEHKISGSAG  261

Query  861   IDGEMDFVDVLLSLP----GENGKEHMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIK  1028
              +  +D +  L+SL     GE GK  + DVEIKAL+ ++  A TDTS+ T EWA+AE+I+
Sbjct  262   SERHVDLLSTLISLKDNADGEGGK--LTDVEIKALLLNLFTAGTDTSSSTVEWAIAELIR  319

Query  1029  RPRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATT  1208
              P ++ + QQELD VVG  R+V++ DL  L YL+ +V+ETFR HP+ P  +P  +  +  
Sbjct  320   HPEMMAQAQQELDAVVGRGRLVTDLDLPKLTYLQAIVKETFRLHPSTPLSLPRMAAESCE  379

Query  1209  INGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSA  1388
             INGYHIP    + +N   + R+P VW++  +FRP R  P          G DF+++PF A
Sbjct  380   INGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGA  439

Query  1389  GKRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVAR  1568
             G+R C G  LG+ +V +  A L H+F+W  PEG   E ++  E YG+T+ +A PL    R
Sbjct  440   GRRICAGMSLGLRMVHLLTATLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPR  499

Query  1569  PRLQRHLYG  1595
             PRL   ++G
Sbjct  500   PRLSPQVFG  508



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   363 bits (933),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 196/516 (38%), Positives = 288/516 (56%), Gaps = 12/516 (2%)
 Frame = +3

Query  66    LASFFLCLSLIFKI-IQLLPVKTGKEN--GKMRLPPGPPRWPIVGNLLQLGRLPHRDFAA  236
             + + FL + L   I + LL V + + N    +RLPPGP  WPI+GNL  +G  PHR  AA
Sbjct  1     MTTLFLTILLATVIFLFLLRVFSLRRNRSHNIRLPPGPNPWPIIGNLPHMGPKPHRTLAA  60

Query  237   FCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALA  416
                 YGP+++LRLG VD +     S+  + L   D  FASRP    A H+AY   D+  A
Sbjct  61    MVSTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFA  120

Query  417   PVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAF  596
             P G +W+ +R+I   HL + K LE F   R EE   L  ++  +    + VNL +++   
Sbjct  121   PYGQRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELARVGT--KPVNLGQLVNMC  178

Query  597   SMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
              +N + R ++G++ FGAD      +A EF  +  E+  L G+  +GD+VP   W+D  G 
Sbjct  179   VVNALGREMIGRRLFGADAD---HKADEFRSMVTEMMALAGVFNIGDFVPSLDWLDLQGV  235

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLPG---ENGKEHMEDVEIK  947
               KM+ + KR D F   ILEEH  + ++     D +  L+SL G   +     + D EIK
Sbjct  236   AGKMKRLHKRFDAFLSSILEEHEMNGQD-QKHTDMLSTLISLKGTDLDGDGGSLTDTEIK  294

Query  948   ALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNYL  1127
             AL+ +M  A TDTSA T +WA+AE+I+ P I+ K ++ELD VVG DR V+E+D+  L YL
Sbjct  295   ALLLNMFTAGTDTSASTVDWAIAELIRHPDIMNKAREELDSVVGRDRPVNESDISQLPYL  354

Query  1128  RCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDFR  1307
             + V++E FR HP  P  +PH ++ +  INGYHIP  + +  N   + R+P  W D   F+
Sbjct  355   QAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLTFK  414

Query  1308  PERHFPADGGRVEISHGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPPEG  1487
             P+R  P          G+DF+++PF AG+R C G  LG+  +    A L   FDW    G
Sbjct  415   PDRFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGG  474

Query  1488  LRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLYG  1595
             + PE ++  E YG+T+ +A PL    +PRL  ++YG
Sbjct  475   ITPEKLNMEESYGLTLQRAVPLMVHPKPRLAPNVYG  510



>gb|AAK62346.1| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=509

 Score =   363 bits (933),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 184/488 (38%), Positives = 290/488 (59%), Gaps = 14/488 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPHR       KYGP++ L+ G+   +  +   + +  
Sbjct  30    KLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPIMQLQFGTFPVVVGSSVEMAKVF  89

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  F  RP+T A  +  Y   D+  +P GP W++ RR+C+  L +TKRL+S+   R
Sbjct  90    LKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLMELFSTKRLDSYEYIR  149

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAME  680
             AEE   L+ ++  ++  G+ + L++ L   S+N ++RM+LGK++    E+S   P+E   
Sbjct  150   AEELHSLLHNLNKIS--GKPIVLKDYLTTLSLNVISRMVLGKRYLDESENSIVTPEE---  204

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  ELF L G++ +GD +P   ++D  G  K+M+ V K+ D F   +++EH   +  
Sbjct  205   FKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKFVSKKFDKFLEHVIDEHNVRRNG  264

Query  861   IDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKR  1031
             ++  +  D VDVLL L  +   E  +E   +KA  QDM+A  T++SAVT EWA++E++K+
Sbjct  265   VENYIAKDMVDVLLQLADDPTLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1032  PRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTI  1211
             P I KK  +ELD V+G +R V E D+ +L Y+  +V+ET R HP  P L+P E      +
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDCKV  384

Query  1212  NGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAG  1391
              GY +   TR+ ++   +GR+P++WD+ + F+PER        +++  G DF++LPF AG
Sbjct  385   AGYDVKKGTRVLVSVWTIGRDPTLWDEPEAFKPERFHEKS---IDVK-GHDFELLPFGAG  440

Query  1392  KRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARP  1571
             +R CPG  LG+ ++  +LA L H F+WS P+ + PED+D  E++G++ PK  PL  V  P
Sbjct  441   RRMCPGYNLGLKVIQASLANLIHGFNWSLPDNMTPEDLDMDEIFGLSTPKKFPLATVIEP  500

Query  1572  RLQRHLYG  1595
             RL   LY 
Sbjct  501   RLSPKLYS  508



>ref|XP_007012629.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY30248.1| Cytochrome P450 superfamily protein isoform 2 [Theobroma cacao]
Length=539

 Score =   364 bits (935),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 193/539 (36%), Positives = 301/539 (56%), Gaps = 40/539 (7%)
 Frame = +3

Query  75    FFLCLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYG  254
             F + ++ +  +  L  + T + N +++LPPGP  WPI+GNL  +  LPH+       KYG
Sbjct  6     FVVAITWLASLAFLSRIFTSRRN-QLKLPPGPKPWPIIGNLNLIDSLPHQSLHKLSQKYG  64

Query  255   PLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKW  434
             PL+ L+ GS   +  +   + ++ L   D  FASRP+T A  H  Y   ++  AP GP W
Sbjct  65    PLMQLKFGSYPVVVASSADMAKQFLKNHDQNFASRPQTAAGKHTTYNYKNITWAPYGPYW  124

Query  435   KRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVT  614
             ++ R+I +  L ++KRLESF   R EE R  V  ++G +  G+ V L+E L   +++ ++
Sbjct  125   RQGRKIYLNELFSSKRLESFEYIRVEEMRAFVSRLYGFS--GKPVVLKEHLSRATLSVIS  182

Query  615   RMLLGKQFFGADESSGPQEAM---EFMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKK  785
             R++LGK++F   +       +   EF  I  ELF L G++ +GD++P   ++D  G  K+
Sbjct  183   RIVLGKKYFSESDDQLETSIVTLKEFQEILDELFLLNGVLNIGDWIPWLDFLDLQGYLKR  242

Query  786   MREVEKRVDDFHMKILEEHRKSKKEIDG--EMDFVDVLLSLPGE----------------  911
             M+ ++K++D FH  +  EH+  KKE+      D VD+LL L  +                
Sbjct  243   MKALKKKLDRFHEHVFNEHKSKKKELKDFVPQDMVDLLLQLADDPDIDVKLSYDGVRGFT  302

Query  912   NGKEHMEDVEIKALI------------QDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQ  1055
               KE         L+            QD++A  TDTSA T EWA++E+IK+P+++KK  
Sbjct  303   QKKEKKRAFCFAPLLLDDNFSCFVNRDQDLVAGGTDTSATTVEWAISELIKQPQLIKKAT  362

Query  1056  QELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAK  1235
             +ELD V+G +R V E D+  L Y+  +++ET R HP    L PH +     + GY I   
Sbjct  363   EELDRVIGRERWVEEKDIPQLPYIDAIMKETMRKHPVAVMLAPHLALEDCLVAGYDIRKG  422

Query  1236  TRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAGKRKCPGAP  1415
             T +FINT  +GR+PS+W++ +DFRPER     G ++++  G  F++LPF +G+R CPG  
Sbjct  423   TTVFINTWSMGRDPSLWEEPEDFRPERFL---GKKIDVK-GQHFELLPFGSGRRMCPGYS  478

Query  1416  LGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
             LG+ ++  +LA L H F+W  P+  + ED+   EVYG+  P+  PL AV  PRL  HLY
Sbjct  479   LGLKMIRSSLANLLHGFNWKLPDNTKAEDLSMEEVYGLATPRKFPLVAVLEPRLPLHLY  537



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   363 bits (933),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/517 (39%), Positives = 300/517 (58%), Gaps = 11/517 (2%)
 Frame = +3

Query  60    ITLASFFL-CLSLIFKIIQLLPVKTGKENGKMRLPPGPPRWPIVGNLLQLGRLPHRDFAA  236
             +T  +F L  L++   +  L+ ++T   +   RLPPGP  WPIVGNL  LG  PH+  A+
Sbjct  1     MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  237   FCDKYGPLVYLRLGSVDAITTNDPSIIREILLQQDDVFASRPRTLAAVHLAYGCGDVALA  416
                 YGPL++LRLG VD +     S+  + L   D  FA+RP    A ++AY   D+  A
Sbjct  61    LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  417   PVGPKWKRMRRICMEHLLTTKRLESFAKHRAEEARHLVEDVWGMAENGETVNLREVLGAF  596
             P GP+W+ +R++   HL + K L+ F   R EE   L   +   +     VNL ++L   
Sbjct  121   PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHAL--ASARDSLVNLGQLLNVC  178

Query  597   SMNNVTRMLLGKQFFGADESSGPQEAMEFMYITHELFHLLGLIYLGDYVPLWRWIDPYGC  776
             + N + R++LGK+ FG        +A EF  +  E+  L G+  LGD++P     D  G 
Sbjct  179   TTNALARVMLGKRVFGDGSGGADPKADEFKGMVVEVMVLAGVFDLGDFIPALERFDLQGV  238

Query  777   EKKMREVEKRVDDFHMKILEEHRKSKKEIDGEMDFVDVLLSLP----GENGKEHMEDVEI  944
               KM+ +  R D F   ILEEH+ ++  +  + DF+  L+SL     GE GK  + D+EI
Sbjct  239   ATKMKNLHARFDSFLGNILEEHKMNRDGVKQQNDFLSKLISLKNDVDGEGGK--LTDIEI  296

Query  945   KALIQDMIAAATDTSAVTNEWAMAEVIKRPRILKKIQQELDEVVGSDRMVSENDLLHLNY  1124
             KAL+ +M  A TDTS+ T EWA+AE+I+ P+IL + QQE+D VVG DR+V E DL +L +
Sbjct  297   KALLLNMFTAGTDTSSSTVEWAIAELIRHPKILAQAQQEIDSVVGRDRLVIELDLPNLPF  356

Query  1125  LRCVVRETFRTHPAGPFLIPHESTRATTINGYHIPAKTRIFINTHGLGRNPSVWDDVDDF  1304
             L+ VV+ETFR HP+ P  +P  ++++  INGY+IP  + + +N   + R+P VW +  +F
Sbjct  357   LQAVVKETFRLHPSTPLSLPRMASQSCEINGYYIPKGSTLLVNVWAIARDPDVWAEPLEF  416

Query  1305  RPERHFPADGGRVEIS-HGADFKILPFSAGKRKCPGAPLGVTLVLMALARLFHSFDWSPP  1481
             RP+R F   G +  +   G +F+++PF AG+R C G  LG+ +V +  A L H+FDW  P
Sbjct  417   RPDR-FLLGGEKPNVDIKGNNFEVVPFGAGRRICAGMSLGLRMVQLLTATLVHAFDWGLP  475

Query  1482  EGLRPEDIDTSEVYGMTMPKATPLFAVARPRLQRHLY  1592
              G  PE ++  E YG+T+ +A PL    +PRL  H+Y
Sbjct  476   AGQIPEKLEMEEAYGLTLQRAVPLVLHPQPRLSSHVY  512



>ref|XP_009771565.1| PREDICTED: cytochrome P450 71A1-like [Nicotiana sylvestris]
Length=509

 Score =   363 bits (933),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 183/488 (38%), Positives = 291/488 (60%), Gaps = 14/488 (3%)
 Frame = +3

Query  147   KMRLPPGPPRWPIVGNLLQLGRLPHRDFAAFCDKYGPLVYLRLGSVDAITTNDPSIIREI  326
             K+ LPPGP  WPI+GNL  +G LPHR       KYGP++ L+ GS   +  +   + +  
Sbjct  30    KLNLPPGPKPWPIIGNLNLIGNLPHRSIHELSLKYGPVMQLQFGSFPVVVGSSVEMAKIF  89

Query  327   LLQQDDVFASRPRTLAAVHLAYGCGDVALAPVGPKWKRMRRICMEHLLTTKRLESFAKHR  506
             L   D  F  RP+T A  +  Y   D+  +P GP W++ RR+C+  L +TKRL+S+   R
Sbjct  90    LKSMDINFVGRPKTAAGKYTTYNYSDITWSPYGPYWRQARRMCLTELFSTKRLDSYEYIR  149

Query  507   AEEARHLVEDVWGMAENGETVNLREVLGAFSMNNVTRMLLGKQFFGADESS--GPQEAME  680
             AEE   L+ ++  ++  G+ + L++ L   S+N ++RM+LGK++    E+S   P+E   
Sbjct  150   AEELHSLLHNLNKIS--GKPIVLKDYLTTLSLNVISRMVLGKRYLDESENSFVNPEE---  204

Query  681   FMYITHELFHLLGLIYLGDYVPLWRWIDPYGCEKKMREVEKRVDDFHMKILEEHRKSKKE  860
             F  +  ELF L G++ +GD +P   ++D  G  K+M+ V K+ D F   +++EH   +  
Sbjct  205   FKKMLDELFLLNGVLNIGDSIPWIDFMDLQGYVKRMKVVSKKFDKFLEHVIDEHNIRRNG  264

Query  861   IDGEM--DFVDVLLSLPGENGKE-HMEDVEIKALIQDMIAAATDTSAVTNEWAMAEVIKR  1031
             ++  +  D VDVLL L  +   E  +E   +KA  QDM+A  T++SAVT EWA++E++K+
Sbjct  265   VENYVAKDMVDVLLQLADDPKLEVKLERHGVKAFTQDMLAGGTESSAVTVEWAISELLKK  324

Query  1032  PRILKKIQQELDEVVGSDRMVSENDLLHLNYLRCVVRETFRTHPAGPFLIPHESTRATTI  1211
             P I KK  +ELD V+G +R V E D+ +L Y+  +V+ET R HP  P L+P E    + +
Sbjct  325   PEIFKKATEELDRVIGQNRWVQEKDIPNLPYIEAIVKETMRLHPVAPMLVPRECREDSKV  384

Query  1212  NGYHIPAKTRIFINTHGLGRNPSVWDDVDDFRPERHFPADGGRVEISHGADFKILPFSAG  1391
              GY +   TR+ ++   +GR+P++WD+ + F+PER        +++  G D+++LPF AG
Sbjct  385   AGYDVQKGTRVLVSVWTIGRDPTLWDEPEVFKPERFHEKS---IDVK-GHDYELLPFGAG  440

Query  1392  KRKCPGAPLGVTLVLMALARLFHSFDWSPPEGLRPEDIDTSEVYGMTMPKATPLFAVARP  1571
             +R CPG  LG+ ++  +LA L H F+WS P+ + PED++  E++G++ PK  PL  V  P
Sbjct  441   RRMCPGYSLGLKVIQASLANLLHGFNWSLPDNMTPEDLNMDEIFGLSTPKKFPLATVIEP  500

Query  1572  RLQRHLYG  1595
             RL   LY 
Sbjct  501   RLSPKLYS  508



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5203707872428